3H9GA

Crystal structure of e. coli mccb + mcca-n7isoasn
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
346
Chain Sequence
b'MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSNNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 106
structure length 346
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9gA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9gA02
2YZ7A 1H6DA 2V6BA 2VUTA 4RO0A 4BL5A 1UDAA 4I1IA 3OA2A 3VH3A 5CDYA 4XCVA 4LGVA 5G4LA 1WAMA 4HFJA 3SVTA 4WLNA 3WS7A 4BO4A 1FJHA 1QRRA 4TRNA 4OSOA 1Z73A 5CDUA 3NT2A 1JKJA 4J7UA 1HDRA 4IZHA 3WIEA 1F17A 3DWFA 2P91A 4L4SA 2HSDA 2Q2QA 1NPYA 5JAIA 1R37A 2AA3A 1WP4A 4OMUA 4W99A 1E3LA 2JD1A 4Y6RA 3PDUA 4E4YA 1TLTA 4TQGA 5B1YA 4XYLA 4M55A 4E0BA 4ALNA 2EXXA 3PEFA 2IRWA 1T26A 1YOVB 4PZDA 3HG7A 4YJFB 3EAGA 2OL4A 2C59A 5DULA 2W90A 4ID9A 4MIEA 3T7CA 1DPGA 2POQX 4JBHA 3C85A 1F8FA 3JQ9C 2FR8A 4MVJM 1QKIA 3TN7A 1HWYA 1QYVA 2GCGA 2NVUB 1P1IA 3ZWOA 1O5IA 9LDTA 4LISA 1N2SA 3RFTA 3H2ZA 4IDCA 1I0ZA 3GZNB 1BDMA 1E0DA 1GPJA 4MIOA 4BQRA 4TSKA 3W6UA 5CDTA 4MKZA 4BIIA 2AE2A 2P5UA 3VKVA 4BGIA 2Q99A 5U4QA 4E12A 4E2XA 5L40A 1MG0A 3BYZA 4M8SA 3RCBA 3C7AA 2C5AA 3RVDA 4XDZA 1SEPA 4II2A 1AHIA 2AQKA 1LSJA 2R6JA 2CVQA 3B1JA 4AJ2A 2EG9A 5JW6A 1BVRA 1Q0QA 3WBFA 5IZ4A 1GUZA 4BGUA 4J2HA 3U9LA 2HUNA 4WLEA 4BO8A 2ILTA 5H81A 1CIVA 1PJ3A 2EW8A 3WGHA 4EW6A 3WB9A 3FNHA 4D7AA 2YYYA 1XG5A 5JDIA 1QLHA 3IDSA 5F5LA 3U0BA 5IZCA 3GVPA 1SZJG 4Q3EA 2Y1GA 1QV6A 4TRMA 4BNMA 3WSVA 4IGEA 4QSMA 4IJVA 4CLHA 2UYYA 4E5KA 1M2WA 3U4IA 2NUAA 4L9RA 2NU6A 4ZHSA 1IHXA 4CLRA 4BNGA 1A9ZA 2ZB8A 5BT9A 3ZV3A 1I3MA 1QG6A 2VHYA 1LTHR 2PD3A 4W82A 3GPIA 4BB6A 5JC8A 1P77A 4DMLA 1X0VA 2G5CA 3GVXA 4CM3A 3X2EA 2GZ2A 2VHWA 2DQ4A 3PK0A 3PJFA 1PL8A 1ZVMA 2X4GA 4UVDA 3ZZNA 4CM8B 1I2CA 3FRJA 3GG2A 1ID1A 4XR9A 4QX6A 4YAGA 4XGNA 1NFFA 4JBIA 4DA9A 4JIGA 1GYRA 3IQDB 3KYCA 1EUDA 2DBQA 2Y1DA 2D3TA 2GO1A 5TS3A 5DCWA 3PVZA 1E7SA 4JN6B 4BNJA 2QYTA 3RQSA 3HADA 1NQAO 1O0SA 3DTTA 4XYGA 3VAZA 2A9FA 4L0QA 3TPCA 3FWZA 4FGSA 2CZCA 2VCYA 3QWBA 1MXFA 2DVMA 4NR0A 3ZNNA 3BMOB 4BNIA 4WK6A 3DBLA 4CUZA 3G1TA 3KSDO 4TVOA 5A05A 1NQOA 4E5YA 5DDIP 5TIIA 5EINA 1YL7A 2EEZA 3KYDA 3QSGA 2F1KA 4PG5A 3G17A 4ND5A 4RGBA 1ZJYA 4CQMD 2VRCD 2FSVA 4ZQEA 1AHHA 2A94A 1HETA 3BMCA 4Q3BA 1CWUA 2X5JO 4FQ8A 5I9NA 4CL8A 3M2PA 2NLOA 2OFPA 2UDPA 4TWRA 1GV0A 1YWGO 2V6MA 2OO5A 1M76A 4JP2A 5K6AA 2DUUA 1HDCA 1KBZA 1KEWA 2PZLA 1EFLA 2B37A 1YL6A 4YXFA 1C0IA 2TMDA 4YWJA 1ZO8A 4FIZA 2QRKA 2PA3A 1QV7A 3GT0A 3RU7A 4MKRA 4PZEA 4B8ZA 4GX2A 3WGOA 1U28A 2EJVA 3TNLA 1LLQA 5B4VA 5BSHA 2OZPA 4QQRA 1VKNA 4MDHA 2ZCVA 3LDHA 1B15A 3DFUA 3ZV5A 3NDIA 1KC1A 5KVVA 1Z75A 2GN4A 3H9UA 3K2BA 1N9GB 3GAFA 2FPIA 3G3EA 2Y0CA 5F5NA 2CNBA 2JHFA 1MGOA 3NYWA 3N74A 1XYGA 4P4GA 2A4KA 4D3SA 1B8PA 3OEWA 3RUIA 3VKUA 3VPGA 2ZJ1A 1AN9A 3GA0A 4KDFA 3JQAA 1MV8A 5KJ6A 4FFPA 3RUEA 3ZWYA 3DMTC 1WPQA 1O6ZA 3JD2A 1E3IA 4IINA 2FR1A 4ND4A 1A5ZA 1M66A 3LK7A 2B69A 1L7DA 3VVBA 4CM9D 1IOLA 3F1KA 1T2AA 3ASUA 3DR3A 2HK8A 3OFSA 1DRUA 3HB4X 2J3HA 4DLBA 2FSSA 1TB4A 1RM4A 1PEDA 1Y8RB 2WSBA 4BO5A 5L53A 5KTKA 2EERA 1NPDA 1MFPA 4RVFA 1ORRA 4IM7A 2OXIA 5JS6A 4ZU3A 3NTRA 5KVSA 1J5PA 1C1DB 2NTNA 4WPGA 4E31A 2BFAA 3TF5A 1ONPA 1T4DA 5G0VA 1IZ0A 3LF2A 2C07A 3CUKA 3OP4A 4GGOA 2RHCA 4NK4A 4ALJA 3DC2A 3E6AA 4NIMA 4PLTA 1E1NA 1B26A 3I9MA 1GUYA 2QW8A 3PHLA 1QR6A 1OI7A 4RPJA 4CR7A 3LZ6A 3E5RA 5HTOA 3F6YA 5K9ZA 1ADGA 5L3ZA 4F45A 3EYWA 2ZK7A 2ZTMA 3NKLA 3GGPA 4OHUA 4UULA 3B1FA 2BHLA 1PS8A 4XA8A 1GV1A 3AFMA 1XEAA 4HXYA 1A7KA 5DP1A 1WW8A 1PSDA 1VL6A 2PZKA 4ZGWA 2VWGA 3DO5A 1MXHA 1BDBA 2YHIA 4D42A 1UXGA 4XWYA 3FNGA 4Z0HO 1NR7A 2AEMA 1E1LA 1MUUA 4IS3A 4Z9XA 5LDGA 4BKQA 1I01A 4LK3A 1ADCA 3ENNA 1Z6ZA 4OQZA 3WQRA 3F3SA 3ZV6A 5JAMA 4E2ZA 3AK4A 1LC0A 2IZZA 1LSUA 2FY8A 2Z95A 1G0NA 3RI3A 1X1TA 2D59A 3WQSB 1KIFA 2ZTVA 1ZXLA 5JY6A 2HAEA 1KEVA 2CDBA 2JD0A 4O5OA 5AQ1A 3V1YA 4ROSA 1AXEA 3K73O 3VZRA 3GN1A 5COAA 1LI4A 5HRUA 3GLQA 3I9JA 4HADA 4CLDA 5CEEA 3K8ZA 2PY6A 4GSLA 4XYBA 4HWKA 1EQUA 2ZYAA 4DIBA 3IAHA 4IDEA 2C20A 3DDNA 1J6UA 5I7EA 3QIVA 2UV8A 4E5NA 4K9DA 4GSKA 3CSDA 1DRWA 5TJHA 2O2YA 4RVSA 4K6CA 3BMNA 4IBOA 3RUAA 4TKMA 4LRSB 2IYOA 4BKUA 1PGNA 1NHGA 3E9QA 4WE3A 2P9GA 4FOOA 1KS9A 4YA6A 3OJOA 4AJLA 1V9LA 3E18A 3I83A 5GMOA 3CIFA 4CLOA 3KUXA 2CY0A 3RJ9A 2YHUA 2WD7A 3F46A 3WBBA 5DBGA 4YB8A 5KJFA 4N7RA 3VC7A 4EITA 2B5VA 3I5MA 3PWZA 1H2BA 5IXSA 1ARZA 1K6IA 2NQTA 2X22A 2ZKLA 1GCOA 3EZYA 1NNUA 3GDOA 2BI8A 2NU9A 1E6UA 3KTDA 2GASA 1VRWA 2NNLD 3P2YA 3TL3A 4XZ3A 4B4WA 5TRTA 3JD1A 3WGYA 1ZEJA 2IYPA 3LC2O 3QP9A 5CPBA 4BNTA 2C2YA 4JJGA 1R4NB 3GDGA 1YJQA 4WKGA 3WQQA 2HRBA 4MVJD 1NVMB 5IXYA 3PP8A 1I32A 3PZBA 4CM5A 4RLSA 4J4BA 4UAGA 4JP3A 5DNAA 2X8LA 3OA0A 4L4RA 4Q39A 1KY4A 1ZIDA 3SLGA 3MWDB 2CF5A 1HKUA 3V2UA 3KETA 3EUWA 1E5LA 3JYNA 1HSOA 1PIWA 4GLOA 4CMBA 1TT7A 3D4PA 3RC7A 3QJ5A 2X9GA 1DJQA 2FZWA 4OXYA 1YRLA 3PXXA 3GEMA 3LT0A 4UEOA 3RKUA 1HZZA 4NJMA 1YOVA 2C7GA 1B8UA 3GNQA 5EERA 4DXHA 4ZJUA 3OETA 4J90A 5L7YA 3L6EA 3IIEA 3CPSA 4M54A 4E5MA 5KIAA 2GF2A 1XDWA 3KSUA 3PIIA 5BNIA 5JXWA 1XQ6A 4LN1A 1E6EA 1GZ4A 1NWCA 5JCJD 2G17A 3HWRA 2NSDA 3UAGA 3GGOA 3EC7A 2NVUA 4Q3DA 1DIAA 4IIVA 3A14A 1UUFA 1YQGA 2JKVA 3PQFA 4RORA 4KDEA 1N5DA 2FPGA 3WNVA 4B3JA 1X0XA 3OSUA 3L0DA 1HDYA 1EK6A 3B6ZA 4IY1A 4BO2A 5F3RA 4ZICA 5DBFA 4YJHA 3DMYA 1WZIA 1LSOA 1R12A 4IMRA 1SEVA 1TT5B 1Y81A 1F0YA 1YONA 4GQAA 4TZKA 3OQ6A 3PHJA 4CQMA 4J7CA 1U9JA 3DBHB 4J91A 1GTMA 1UP4A 3BMQB 1DHRA 3D3WB 5GZ6A 3P5SA 4LSMA 3V2GA 4I9UA 1PGJA 1ZMOA 1H6AA 1ZH8A 3JYOA 2ZB7A 1JA9A 1T1RA 3O9ZA 3DL2A 5JAQA 4WCFA 4OAQA 2ET6A 1B3RA 2VYNA 3L6DA 4PG8A 4GKBA 4QXMA 3RD5A 1NQ5A 2Q46A 1EVZA 1BXKA 1PWZA 4Q3AA 4BNFA 2D5AA 4MJLA 3A06A 3QRWA 2Y93A 2HCTA 2RCYA 1W8DA 3OEYA 1RWBA 4XIJA 1EBUA 5LC1A 1LLUA 5EMHA 4A26A 3AUTA 1U8FO 4P38A 1K2WA 4DBZA 2ZYGA 3U09A 1CERA 4NBVA 3BTSA 4NFSA 3I6QA 4XKJA 4M89A 3AOEC 4NZ9A 2BGMA 2NVWA 2PKRA 1XSEA 1BXZA 1LDBA 2Q1UA 3HN2A 1BRMA 3W4IA 4R1UA 3AI2A 3ROKA 1A71A 1R6DA 3KLPX 1E7QA 4RLHA 3D1LA 1HDZA 1LA2A 2WJPA 2HQ1A 3RC1A 3ZCXA 1NQTA 3QWFA 2EIHA 1LDNA 5JMWA 3R1IA 3P2OA 4TVBA 1QYDA 5IN4A 4D43A 4PLGA 5JC1A 1ZFNA 4H15A 4QFCA 4YTEA 1UR5A 3JD4A 5DBIA 3BMOA 5IFLA 2W2LA 1N1GA 2PZJA 3DZGA 1YB5A 1ISMA 4W7IA 5ILGA 2ZB3A 4YBZA 1FF9A 4YT2A 5KOIA 4QT0A 1GYPA 1D1SA 2IODA 3GDFA 3K30A 3GR6A 1F8GA 3DHYA 4BV9A 3LLVA 5JMPA 1FDTA 5F1KA 1B0AA 4UVGA 3GNSA 4YJDA 3DTYA 1N8KA 4PG7A 1XGKA 4J0EA 4DLLA 1NHWA 1R0SA 2AEJA 3PTZA 5CP8A 3NTQA 1Y8QA 5I9MA 1UP7A 2UUPA 1FXSA 5TQVA 2WE7A 4QTZA 1C0KA 1Y1PA 1F12A 2BGLA 3O8QA 4DC1A 2O48X 3L9WA 1GZ6A 2B4QA 4MVJE 3AI1A 1SCUA 4KUEA 4PRKA 3S2EA 1D3AA 4U8GA 4DBVO 2IXBA 2I76A 4PGFA 1EVYA 2R00C 3VPXA 4GX0A 3T4XA 4JQCA 3TOZA 2AQ8A 3JQBC 1PX0A 3C1OA 1FK8A 4Q9NA 2AXQA 4CJXA 2Y68A 4RL6A 1T1SA 1P3DA 3DAFA 4B79A 1FDUA 4CODB 1A27A 4YJGB 5ENDA 3RROA 5EJ2A 5AXDA 1EE2A 3IMFA 2I3AA 1U2DA 1UP6A 1U3UA 2V65A 2D0IA 1EFKA 2PZMA 4P4LA 3O26A 1H0KA 3EGOA 3P19A 1I24A 4Y8VA 4BNUA 2UVDA 1YQDA 2AQIA 4P4NA 4XQCA 3MEQA 1B8VA 3QVTA 4TMFA 3FR8A 2ZATA 1P1KA 3PYXA 5JCXA 1I2BA 4RVHA 5JFOA 1NWHA 4KUGA 4EI2A 4B7UA 3WIDA 5ITWA 1C1DA 3DBRB 2I66A 4GLLA 4IIUA 1OBFO 3AW9A 4MP8A 5IDXA 4PVDA 4DUPA 1KYQA 4LVCA 1NXQA 2ZTLA 3ROPA 4WECA 1QYCA 2I6TA 1IUKA 1ZMTA 1P1HA 3E82A 3KO8A 4QO7A 4ZN6A 3OQBA 2CDCA 3RUHA 3ZWVA 4TROA 3H8VA 3JD0A 4RVDA 3OJFA 1U3VA 1DIRA 1GY8A 2I5PO 4B4VA 4B4UA 1SBYA 1BW9A 3WFJA 1DC4A 3JQCA 2VTEA 5J23A 4BKRA 5C3MA 1R0KA 3CKYA 1I3NA 1KETA 1E7RA 5F21A 3B20A 4E6PA 2X23A 4FFNA 1D7OA 1V0JA 3F4LA 4LW8A 4BV8A 4J4TA 2WDZA 2VT3A 3VZQA 4PLWA 3UH1A 4EJMA 1DFGA 4NBTA 2JJYA 4ZQFA 4EUFA 1WLYA 2XOXA 3L9XA 1I5RA 3TFQA 1ZW1A 4M49A 1ZXBA 2DPHA 2Q4BA 2JFFA 3EMKA 3WWZA 1Y7TA 3PDJA 3WYEA 2B35A 1PZHA 5ER9A 3IC5A 2NV6A 2CD9A 3HDQA 4YVFA 2PLAA 4O63O 1DFHA 3AUAA 3W6ZA 4BO0A 2FPPA 3KEOA 3L4BA 4DMMA 2X9NA 4BNKA 4UVIA 4G65A 2TMGA 4L4XA 3Q2IA 1DEHA 4EDFA 4MIYA 4UUMA 3AI3A 4GL4A 2YV3A 1YBAA 4BNLA 1VL8A 3I9OA 1O94A 1GQ2A 1QORA 4M87A 3ZWCA 3UXYA 3WJ7A 1NR1A 2Y1FA 5IJZA 3RUDA 4OXKA 1ZBQA 2ZCUA 2NM0A 1E7MA 1EMDA 1E92A 2E6UX 2RHRA 3AWDA 4YT5A 5BR7A 1EK5A 1XLTA 4OH1A 1YBVA 2YUTA 1E7YA 2ZQZA 3IKVA 2OMEA 3UW3A 1I8TA 3HFGA 1E3JA 1VSUA 1ZK4A 2Q2WA 4FFMA 1PZFA 1YVEI 2WYWA 4FFLA 4BNHA 4ZRNA 1IULA 2OP0A 3QWIA 2D2IA 4Z3DA 5ITVA 5FI3A 4IDBA 3W4JA 5JYEA 1K0UA 2EGGA 2LDXA 3OECA 4N5MA 4CPDA 4R54A 1X7GA 1U4OA 3E1KA 1HXHA 4FW8A 3INGA 2GERA 4NBWA 4IXWA 3FBGA 1RM3A 4J1QA 2BRUA 2VNAA 1GR0A 3VH4A 2PFGA 3NGXA 1UAGA 5A9SB 2VN8A 4CM1A 1G0OA 1GD1O 5JDCA 4FCCA 4DREA 4XGIA 3H5AA 1V3UA 3WTBA 1M67A 3QV1A 2O23A 1A72A 1HDGO 5KKAA 2V6FA 2X5KO 1JU9A 4FR5A 4ILKA 4AG3A 5GZ3A 1UDCA 2IEDA 4FBGA 4PZCA 4BHTA 2GZ1A 4JGBA 4ITUA 1HEUA 1DO8A 4FD3A 3OIFA 4J6FA 2QYSA 2UUOA 1NFQA 2VYVD 3FNEA 1JN0A 3JQ9A 3ZW9A 3JSAA 3ICCA 4Y9DA 2IZ0A 2OOSA 3AM4A 3GAZA 3TQHA 1ZUD1 1XQ1A 3MCVA 3KSZO 4TRRA 1H9AA 4R9RA 3V8BA 3MOIA 1RYEA 2D4AA 2DTDA 3CTMA 5B37A 3UN1A 3E48A 1SAYA 4AJIA 4YYZA 2J5KA 4D3DA 4AL4A 3ZDFA 3U4CA 4XD2A 2P9CA 1XCBA 3JQGA 1E3WB 2CDAA 3QVWA 4MO2A 5I7VA 3DAPA 1VPDA 4NBRA 4PFJA 4YR9A 5C37A 1XR3A 1ISJA 4JLWA 1E5QA 5JNLA 4IPTA 4OIMA 4LCEA 4ND3A 2VQ3A 4A0SA 4INAA 4C7KA 1G6KA 3KRTA 4GWKA 1IE3A 1SC6A 1QXSA 4W7HA 2BLLA 3OIDA 4BVAA 1MA0A 3ST7A 4EJ0A 2OGUA 2W4QA 1GPDG 1IHYA 4EJ6A 3C3XA 1D4FA 4NMHA 3K9QO 4L8VA 4K6FA 1J49A 4O6VA 5FYDA 5C5IA 1PJ2A 3IOYA 3AOGA 2PH5A 2BMAA 3HQ4O 4OO3A 2O3SA 3SC4A 4OL9A 1IZ9A 4CV2A 3DXFA 1LNQA 4OYRA 2HO5A 1PJCA 3Q6IA 3VPHA 3DBHA 1JQBA 1RYDA 3PI7A 1XWFA 1KY5A 4J9UE 3D3WA 2EW2A 3KB6A 3VDQA 4AJOA 5CG2A 1X14A 1R16A 1EVIA 1HF3A 1DSSG 2O3UA 4YRBA 5I8WA 4CM4B 3JCZA 4LRTB 3LU1A 4F3YA 2QG4A 3ZHXA 1ZKMA 4IGFA 4RCVA 3UCEA 4XIYA 4CQLB 1MX3A 1TA4A 3ZU2A 1PWXA 5HWSA 3G1UA 3W8FA 5JSFA 3NUGA 4QO8A 4N5LA 3ULKA 3CXRA 4R1SA 1DB3A 4ESOA 1E7WA 3GUCA 4I8XA 4R68A 1CJCA 2GD1O 1NASA 3PQDA 3FTNA 1JKFA 3WYBA 3IUSA 2DT5A 2F00A 5CEJA 2FMUA 3E5MA 3H4VA 4U6QA 3ANNA 2Y1CA 3FPLA 4FJ2A 1ZSYA 4ZD6A 2W98A 3NX4A 5L7WA 3T4EA 1BXGA 1DC5A 2CVOA 2PTGA 3NT5A 3LSYA 1P0FA 3GN2A 4GVLA 2JD2A 3RASA 1EDZA 4UEJA 4ZA2A 2DLDA 4KQWA 4PLHA 3TFOA 5AXAA 1SO8A 1T2CA 1Z7BA 1DC6A 1CRWG 3VTZA 1LDMA 1XHLA 2GZ3A 3M6IA 3UUWA 1PJQA 3A4VA 3CE6A 4II3A 3SLKA 1OFGA 3CH6A 1WMAA 3LLSA 1DLIA 4OSPA 3IKTA 1LBEA 1SPXA 1HE3A 1ZJZA 4ZQHA 3I3OA 3JQ7B 2I99A 4WUVA 1ZK1A 4AFNA 3GHHA 3BTUA 4RQTA 1YXMA 2Y67A 1PZGA 3CZRA 1U1IA 3OBBA 4LSWA 1K6XA 1PR9A 3SXPA 3AU9A 5FWNA 1R4MB 2RH8A 4FJ1A 3ZWWA 3OMLA 5A04A 2WMDA 5LCXA 4NQZA 4I9HA 3TSCA 5L4NA 1NBOA 2RIRA 5JY1A 1C1XA 3IP1A 3ZGYA 1H93A 1C0LA 5HBRA 3UFXA 4J9VA 3NV9A 5A1TA 3ANMA 4CMEC 1SMKA 3UVEA 1WMBA 3JQ8B 1XKQA 2EP5A 1DRVA 3EVTA 4FSHA 6LDHA 3K2EA 3RSHA 1DHTA 3FNFA 4ALKA 4MVJF 3TOXA 2NWQA 5L4SA 3ZHYA 1B14A 2NACA 3W8EA 3FHLA 5I7SA 4RPHA 3S1LA 4A03A 2VUSA 5IDYA 3ZHBA 4YEDA 1F06A 2O50A 2VZ8A 2E48A 1S6YA 4LVUA 1BGVA 4E32A 4EGFA 5IF3A 1IPEA 1I33A 4NI5A 3EW7A 3EVNA 1NP3A 3I1JA 3OHSX 1I36A 4WOJA 4C4OA 1HE4A 1B16A 5CEFA 3KEQA 4R5MA 3D4NA 2VNSA 2WM3A 5EQDA 4AJJA 2VWHA 4GH5A 4UUNA 1NAHA 4YCAA 1ISFA 4XB1A 3BA1A 2HRZA 3GFGA 2J5RA 2D8AA 2AW5A 2CFCA 3GPDG 3LT1A 4J0FA 4Y67A 3EDMA 2X0RA 2J3KA 5FI5A 4CMIB 5IAAA 4DQVA 4UVEA 2A92A 4I5GA 1PJLA 2BD0A 3VDRA 2FZEA 3V5NA 3ADPA 3ZI0A 1I3LA 1NFRA 5DCYA 1Y5RA 1BG6A 4XRGA 3RWBA 4JXKA 4R1TA 2PR2A 2FR0A 4AVYA 4GWGA 3AUSA 3VH2A 1X13A 5F1OA 2Z5LA 4PG4A 4KQXA 4AJHA 4J43A 3E9MA 3RJ5A 4AJKA 3L6OO 4DRYA 4WOKA 1EQ2A 4DQUA 3ROMA 4IDGA 4N5NA 2H6EA 5THQA 4BNNA 3ZNQA 2IE0A 3PWKA 1N7GA 1EZ4A 1ISIA 9LDBA 3KOUA 2VOJA 2PK3A 1KVRA 3AY3A 1VJ0A 4J16A 3WLFA 1C0PA 4Z0PA 2DTEA 2QX7A 1V8BA 3F9IA 5T8KC 1AUPA 5DN9A 4UUPA 2Y1EA 2VYVA 2O7SA 2O2SA 3GC6A 1Q0HA 3QA9A 5T64A 1EEHA 1ENOA 1U5CA 5BNTA 1W0CA 5HS6A 4KZPA 4YPOA 1DBVO 4YJFA 4RDIA 3ONEA 1UDBA 3DHNA 4GPD1 2RAFA 3ZW8A 1JAYA 4JK3A 3U49A 2GYYA 1U7TA 3QLJA 1GUFA 3W8DA 4E2WA 1Q7BA 3KYCB 2WEKA 4WCFC 2HMTA 3F4BA 3C7CB 4J1SA 4MVJH 5EL0A 1YL5A 3RBVA 3LYLA 2VUUA 4BNVA 4DPLA 2CVZA 2PD6A 1VI2A 5THKA 3WX0A 4RVGA 5AXBA 4WLVA 1DLJA 4BO1A 1PL7A 3DZFA 1LUAA 3PJGA 4PG6A 5KCZA 3KVOA 5KVCA 2C82A 2Q45A 3GZNA 4BNWA 3DB2A 3BZUA 3GH3A 4R16A 4W9NC 3UCFA 2GN6A 4PN3A 5A9TA 1OAAA 1K89A 3ZWPA 1YBMA 1HT0A 4D44A 4EZBA 2O3RA 1NVGA 1ML3A 3DOCA 3LF1A 4R51A 4WNCA 3S2IA 4X54A 3TRIA 3F5QA 3VZPA 5JAZA 1CQJA 1PJSA 1VE9A 4U6SA 1VL0A 4BGVA 2I67A 2O4UX 4WEQA 5CHEA 1BHSA 1K3TA 3L77A 3VTFA 5CAEA 1CETA 2J3JA 2EJWA 2VRCA 4IQ8A 4MPDA 4ALMA 1QLJA 3PQEA 3HDJA 4B3IA 4TRJA 3BMCB 5TT0A 2WTBA 1LDYA 4R9SA 5TC4A 2W8ZA 1CQIA 4OGWA 2Y99A 3ON5A 2PKQP 2DBRA 1E3SA 4KWIA 3V1UA 4L73A 2QZZA 3HSKA 1T2DA 4JJIA 3SEFA 2OUIA 5JLAA 1EBFA 3BHJA 3OQ1A 3AUUA 4MVJG 4ZQBA 3T7EA 1Y6JA 4Z6KA 3H5NA 3F5SA 4EBFA 2SCUA 1P1JA 4U0JA 3GOHA 4BOYA 4KWHA 4D45A 1WXDA 4CLEA 2QHXA 1KEPA 2DTXA 1TXGA 1UH5A 4BNYA 2DM6A 1U3WA 4NU5A 5DF1A 3JQEA 4Z0TA 3PRJA 4CMJA 4E3ZA 4CM8A 3WGGA 1UZNA 3DHEA 2Q3EA 3GGGA 4HUJA 3GRPA 4HKTA 4AJ4A 5HM8A 3JQAB 5EIOA 3Q0EA 2X7HA 3JQ6A 2ZIZA 5JYDA 4RZHA 2O3JA 2PGDA 1HYHA 3NGLA 4CM9A 3EK2A 2DBZA 1H6CA 3KLMX 1U4SA 1CYDA 4CMAA 3FI9A 3WJAA 1Z74A 4ALIA 4FPXA 2QZ9A 1P33A 5DOZA 5T67A 1NAIA 1WWKA 4BO9A 1I3KA 5TGDA 3ZNPA 3AU8A 3JTMA 2DAPA 2B83A 1P45A 1CF2O 2J8ZA 5A3VA 4E21A 5F1PA 2HMWA 1UJMA 2NVBA 5A4DA 1T25A 1HDXA 3A9WA 1WDMA 1U5AA 1KEUA 3LC1O 3BTVA 1ZK0A 1V35A 2I65A 4MVJI 3RAJA 4FOSA 3PGXA 1T2FA 1NTOA 1P44A 4A5OA 2EV9A 2HLPA 2G82A 1O8CA 1Y5MA 4IDAA 4A10A 2H63A 1C14A 4Z9YA 5I7FA 5G0TA 2PH3A 4FFRA 2B5WA 2XXJA 1QYXA 4PLZA 2GNAA 3PZRA 1ULSA 4HX5A 4JBGA 3EY4A 2YHIB 3KZVA 3AOEA 1GZ3A 2YY7A 4PVCA 3GMDA 1GQYA 2E4AA 2EKLA 1V6AA 4FB5A 5CDGA 1RJWA 4N54A 4A2CA 4CQLA 3E8XA 2HJRA 2ZTUA 4AJPA 1IY8A 3M1AA 1N9GA 5JO9A 5JE8A 4OKIA 3TZQA 3NEPX 3TZ6A 1GYQA 2QRJA 5HS4A 5C7IO 4JNKA 2CSUA 2IZ1A 3GVCA 3BTOA 3RFXA 1ONOA 2V7PA 3JYQA 2AEFA 1G1AA 3HE3A 2E49A 3OJ0A 3TL2A 3DOJA 3UGKA 2QIOA 1YQXA 4CR8A 1YH3A 2Y05A 1GEEA 4XX0A 1QP8A 3ZN2A 1GFSA 4HY3A 4R3NA 1VM6A 3QWAA 1U2GA 2YQ4A 4M86A 1DDOA 4FDAA 3QVSA 4WEOA 1Y8RA 1PTJA 1HRDA 3TJRA 1LQUA 1XIVA 3D3EA 1N1EA 4BMNA 2YV1A 5EPOA 4FS3A 1ZZEA 1VJ1A 1HL3A 5A3JA 1TVEA 3NRCA 1Q7CA 2FHSA 2WE8A 2D5CA 2FOIA 1MB4A 3JQFA 5B12A 2BGKA 5BSGA 1YJ8A 3L4BC 4A27A 3I23A 1JVSA 2IDZA 2X9VA 2ZB4A 4LMPA 4EUHA 1A9YA 3EHEA 1R15A 1EUCA 2DFDA 3I9NA 3ETGA 1B3BA 3GMSA 3R3SA 1PU2A 2E37A 1H5QA 2WD7B 1Y9EA 1HZJA 4OXNA 5TLSA 3A1NA 1VKOA 4IXTA 2XF8A 3RBZA 1I10A 4OOFA 3JQBA 3DZJA 3ADOA 3M2TA 8LDHA 2H1SA 2BFMA 2JCXA 3DBVO 3H3FA 1JAXA 5FF9A 3JQ8A 1N7HA 1OZAA 3E9NA 4EEZA 5DT9A 4WLOA 2WYVA 3MTJA 2JCYA 1H94A 4Q3NA 3E03A 3U4HA 3DEYX 1LXCA 4OOEA 4TZTA 5G0SA 4MVJA 5B4UA 5KVQA 5A9RA 3O03A 5KNLA 4HP8A 2Y1OA 3L4SO 4RF5A 4CMGA 3IJRA 2G76A 3G0OA 5JDIC 4ZQGA 3U62A 3GK3A 3DZKA 5IZCC 4GGPA 3HJAA 2GN9A 4MVJP 3SJ7A 4AICA 4JX8A 3LT2A 5JDCC 5I8ZA 1HLPA 4HV4A 2B36A 2Q50A 4D46A 3WGTA 5A5EA 4NJMB 5ES3A 2J3IA 4KOAA 3GF4A 5H82A 3OF2A 1LEHA 1GU7A 2WYUA 4NH4A 4UEKA 4XQGA 4GKVA 4B4OA 4DPKA 2O7QA 3WDSA 2BI7A 5A5FA 5DZSA 1H9BA 5G0WA 5ICSA 5JCJA 4JCOA 3MOGA 1KVUA 1B7GO 3WXBA 1QMGA 2NQ8A 3R6DA 4UUOA 2Q49A 3HDHA 3HDYA 3M1LA 3TZCA 4GX1A 1I30A 4Q3CA 1DJNA 4CMIA 1GEGA 1ZCJA 3G79A 2YJZA 3BAZA 3PPIA 4OM8A 4W4TA 1PGQA 3OICA 3ZWBA 3C8MA 4YJHB 1XU7A 2Y66A 2JFGA 5EESA 2X0IA 4CV3A 4NHEA 2O3TA 4U5QA 4BS9A 3LQFA 1JDJA 3RC2A 4QUKA 4CQMB 4HNGA 2HJSA 1PR3A 4NNJA 4HFRA 2NU8A 2GGSA 4G5HA 2E82A 1LRJA 1KERA 3GUYA 4DIFA 1GADO 1OOEA 2BH9A 1ULUA 2PKQO 3MWEB 3WGIA 3S2FA 4WCFB 2P2SA 1ADFA 1MC5A 4YQZA 3B70A 1LSSA 3U3XA 3GZ4A 4BO3A 4FFOA 3AM5A 4EYEA 3GHYA 3FTPA 2R2GA 1Q1NA 1HTBA 4XQEA 1KOLA 4RPGA 1VLLA 1F14A 2HK7A 4ONEA 3NTOA 1R4NA 1MC4A 4I5FA 4NG5A 1ZEMA 3ETEA 3MJSA 4LMRA 5B4TA 4I5EA 4AJ1A 2HMSA 1MG5A 5KJCA 2YQ5A 4D0RA 1VJTA 2BKAA 2PV7A 4IS2A 3I4FA 3QHAA 3ICPA 5K6AC 3FPCA 2P5YA 1DC3A 3ITDA 1ZK2A 2C54A 3KYBA 1PGPA 4PRLA 4DTIA 3H9EO 3FCOA 3I6IA 4XJTA 1PZEA 2FN7A 3SJUA 1YO6A 3JQDA 3HN7A 2PGLA 4B7CA 1PQUA 3TZHA 3QE3A 3DZIA 3WWYA 4DL9A 5IDQA 1BSVA 3INRA 3JYLA 4S1VA 3FF4A 1IL0A 3H9JA 3D0OA 3Q11A 4DQXA 1SB8A 2GUGA 2OHXA 4IQGA 2HK9A 4MKXA 4NBUA 5EQFA 5ICMA 1AXGA 3UOGA 1PS9A 1RPNA 3ZNOA 2X86A 3CEAA 1JWAB 3WICA 3DAGA 4I5DA 3AM3A 1DIHA 1X15A 3PIDA 1O89A 2QRLA 5CDSA 1L1FA 3UCXA 1HDOA 3KHUA 1JVBA 1TT5A 2DPGA 4J4HA 3X2FA 3OIGA 4FC6A 4H3VA 5CPFA 3CMCO 2OORA 5G4KB 4CUJA 3O4RA 3ZU3A 2NU7A 3BMQA 3TWOA 3AFNA 4JROA 5IG2A 1XELA 1LQTA 3PHIA 4FN4A 4TKLA 3TZKA 4DPMA 4IZIA 4QEDA 4E30A 1Y8QB 4F6CA 5ADHA 4P8RA 5DOVA 4CMHA 2EGHA 5ER6A 4BUCA 4K28A 1XU9A 2VYND 4OJNA 2DC1A 3S55A 3ONDA 1YGYA 3RKRA 2CMDA 1K6JA 5BNFA 4C7JA 2B4TO 3LC7O 3O8QB 4YAIA 3RUFA 3FWNA 2Q1TA 2D1YA 4Y6SA 2DFVA 2GDZA 1WZEA 2X0NA 5L7TA 3F47A 2JFHA 3Q9NA 3IS3A 3OJLA 1SB9A 1E1KA 5TNXA 3LVFO 1P9LA 3WOHA 4NPCA 2J6IA 4XGKA 4DWVA 1LRLA 2W2KB 1GAEO 3VPFA 4K26A 3WFIA 4CMCA 3K31A 4J1NA 1HE2A 3MJTA 1TI7A 1ENYA 3SC6A 1YKFA 3Q2KA 5COBA 4BNXA 2X1HA 3DZBA 5HA5A 4XQ9A 5KWEA 3D5TA 2ZYDA 3MJVA 1B2LA 2DU8A 3ZV4A 4HNHA 3HHPA 4URFA 3VH1A 1PQPA 1WDKA 4MOWA 1ZK3A 4R41A 1DFIA 5AOVA 2FWMX 3H3JA 1A4UA 2Z1NA 3PJDA 1BTOA 4P22A 1DAOA 1LX6A 2W2LD 4HBGA 2OP1A 4BKOA 2GSDA 4D3FA 1E77A 2AG5A 1FDVA 1UXHA 2VHXA 3C1AA 3ORFA 1OC2A 4MP3A 2FP4A 5BSFA 2UAGA 5IDWA 4L74A 2NADA 1T4BA 1V3TA 2PGJA 4WLUA 4HFMA 1O95A 1ISHA 2A35A 5MDHA 5DP2A 2CUKA 1PJTA 4MP6A 2B0JA 5T57A 1IYZA 3V1TC 3NT4A 2WWRA 3K6JA 3SX2A 4NU6A 3GY0A 2YDYA 4BB5A 1LDEA 1YB4A 3DMTA 4F46A 4D0SA 1BW9B 2VHVA 4AJEA 3ZU5A 4M1QA 3R3JA 1EDOA 1P31A 2JHGA 2YDXA 3NDJA 4B7XA 2DBVO 2FRDA 1NVTA 1WDLA 1PQWA 2VT2A 3JD3A 4NK5A 4RPLA 1E6WA 5TSDA 3DFZA 3FR7A 4BNZA 1FMCA 2AQHA 1X1EA 1WVGA 3H2SA 3GFBA 3HFSA 3GVIA 5BSEA 2HU2A 4NJOA 4RPKA 5AVOA 1Z45A 1NX6A 2VTDA 4KP7A 3Q1LA 3NAQA 3WLEA 1TEHA 3I9KA 1S7CA 1HLDA 4R69A 5L95A 4WCDA 4J7XA 1YDWA 3W1VA 2Z1MA 4J2OA 4QFDA 4CR6A 3DQPA 4DGSA 3H7AA 4YJGA 3PFFA 4YT8A 3ZWMA 4RF3A 1SNYA 1HE5A 1P1FA 3VVCA 3W4KA 5JO0A 2JCVA 1ENZA 4B8WA 2OBYA 2X5OA 3DZHA 3G49A 3BHMA 2J5QA 3UHAA 4YAKA 1UXJA 4BGEA 4BO7A 1QYWA 3BXXA 4RQUA 3U5TA 3HUDA 1J0XO 2AE1A 4RV9A 1SOVA 4CL3A 1U7HA 3BIOA 4E2YA 2EKPA 4CMEA 1W4ZA 4PLCA 3K5PA 3DBRA 3WTCA 3OM9A 3WR5A 2HKIA 6ADHA 2NTJA 5JBIA 4RVUA 1IPFA 2X58A 4DLAA 4F6LA 3Q9UA 4QECA 3ABIA 4Y6PA 1E1MA 1ZSNA 4EEXA 2GRAA 1ADBA 2IEBA 5T6BA 3UKOA 2C5EA 4YRAA 2YFQA 2WD8A 1Q7GA 3I9LA 2HMVA 4DYDA 2PD4A 5A03A 4FGWA 4U7WA 1JTVA 1OMOA 4NDNE 3CMMA 1SOWA 3EZLA 3INTA 1OC4A 3ZH2A 5FEUA 4Z3KA 3PLRA 1NYTA 4WJZA 1T2EA 3VHRA 2PWZA 4FC7A 1LU9A 5G0UA 1KVTA 4XYMA 3WGQA 4N18A 4CLRB 3SBOA 4CV1A 1PJBA 3UICA 1RKXA 5A06A 1VC2A 1D8AA 4PLVA 4J1TA 1BMDA 1HSZA 2H9IA 1DIGA 2JAHA 4L75A 1PL6A 4D41A 4DIOA 3H5RA 2YFHA 1R0LA 5A02A 4GI2A 4ND2A 4JJFA 2BF7A 2BFPA 3FSRA 3JYPA 1MP0A 1D1TA 3GG9A 4XRRA 4XEHA 4XR4A 5G2OA 1FDSA 3K96A 3FD8A 3STHA 1UXKA 1LJ8A 1LLDA 1NPTO 2AHRA 3C7DB 3FN4A 3QVOA 4CUKA 1H6BA 2AMFA 1W6UA 3TDKA 4I08A 3JQGB 3ANLA 4AJNA 3R0IA 3GNTA 5TF4A 4BKPA 1NM5A 3ETDA 3WG9A 3WYCA 4NFHA 5ILOA 1CEQA 1M6WA 3PHHA 3KXDA 4GBJA 4GX5A 1UZLA 4GMFA 5TX7A 5U9CA 2Q2VA 1EVJA 2GR9A 4BQPA 1X7DA 3DBLB 3D5QA 1CDOA 3VOSA 4KTVE 1GQQA 4L76A 3QQPA 4G2NA 4PCVA 1RM0A 1JKIA 3DOOA 2VZ0A 4H7PA 4R01A 4OKNA 1PS0A 3KYDB 4RF2A 2GLXA 4A7PA 4PLYA 4K1LA 4KUHA 4J49A 5K0ZA 1Y9AA 2DKNA 2GN8A 3D64A 3RFVA 2ZJ0A 2I3GA 2VWQA 5H83A 5T5QA 3DONA 3O38A 2XPCA 3I52A 4YDRA 4YQYA 2GPTA 1LDGA 4D79A 5COQA 3L07A 4A73A 3QWHA 5T8KA 1T24A 3N7UA 2YW9A 3OJEA 2O3QA 3BHIA 4O59O 1YE3A 3H6KA 2Y0EA 4CM6A 1Z7EA 4MINA 3NJ4A 3V2HA 5KKCA 3WNQA 1PJ4A 4GMGA 5A9SA 5JPIA 4EUEA 2AG8A 2G0TA 1LLCA 4CV0A 1YB1A 2HDHA 3RU9A 2EWMA 1EE9A 3WGZA 3S2GA 3QW2A 5CFZA 1WNTA 1UXIA 3FBTA 2BFOA 4RDHA 1GDHA 1LRKA 3D4OA 1FDWA 1ZNQO 4DVJA 3PFWO 1GCUA 2EHDA 2O4CA 1M6HA 3ZU4A 3LT4A 2X6TA 3H65A 1UAYA 2P4QA 4KTTE 5MGBA 3GQVA 2C7VA 1DAPA 2P68A 5AXCA 5U1PA 4BO6A 4W9NA 3WMWA 2RBEA 5KJEA 1ENPA 4E13A 4J3FA 4YRDA 2YV2A 1BWSA 4XB2A 1BXGB 3ITKA 2Q4EA 3GEGA 2P9EA 3MTGA 4IMPA 4PLPA 1P74A 3ASVA 4IJKA 4RZIA 1E3WA 3PJEA 1KVSA 4IJWA 3COSA 3I4CA 4OQYA 4R3WA 1N92A 4WASA 2PNFA 4E5PA 1RM5A 4GAEA 1P0CA 5FFFA 1U8XX 3WMXA 4XJSA 5GY7A 3S8MA 2V6GA 2BELA 3ENKA 2C2XA 5KJ1A 4WNIA 1Q0LA 3RUCA 4R1NA 1O9BA 5BQFA 4YAEA 1UZMA 2XAAA 3GVHA 1ONNA 1MFZA 1JWBB 1ISGA 5GZ1A 1DIBA 1QSGA 1DXYA 1K5HA 4FJ0A 4LCJA 2NTVA 1V3VA 2Q1SA 3MJ4A 3MJCA 3OH8A 1W73A 4W6ZA 4DYVA 4NFYA 1C3VA 4H16A 2P4HX 4I9NA 5LDHA 2H5LA 4UREA 3ONFA 3PGJA 1A4IA 1ZSVA 4IQ0A 4BMVA 1KC3A 1DOHA 1PGOA 3GEDA 4YT4A 3H9QA 1L7EA 5CG1A 1HYGA 2X0JA 3KM0A 3IP3A 3ROQA 5G4KA 2I9PA 2OBNA 1M75A 1C1XB 3IL2A 3H9GA 3N58A 2VRBA 4Z9FA 1E3EA 4WGGA 2G1UA 2C0CA 2RH4A 3NDRA 3KBOA 4CMKA 2LDBA 4IJUA 4CM4A 5I9LA 1BVUA 2EKQA 4O1MA 4BMSA 4S3MA 3HNPA 1EUZA 2EF1A 5DCUA 3IJPA 1LC3A 5EN4A 3JQFC 3RIHA 1VSVA 3ZHZA 4RJTA 3PYLA 1JW9B 1P1RA 3RBXA 1GL3A 4XYEA 3CZMA 3VPSA 2ZQYA 1YDEA 1KVQA 1H2HA 4PIVA 3Q3CA 5TT1A 4YACA 1YS4A 3C1TA 4IUYA 3JV7A 3U4DA 3RC9A 2HMUA 3JQAD 3PLNA 3ZWXA 3AY6A 2B4RO 3PHGA 3C24A 3MJEA 2XXBA 2QQ5A 5L9AA 3IUPA 3QY9A 1U3TA 2W2KA 2C29D 4O0LA 3PYMA 3WSWA 3ZWAA 1X7HA 3AJRA 4XDYA 4ZRMA 2DUWA 4IDDA 1JLLA 2VHZA 4Y98A 1HYEA 1A7AA 3AY7A 3KV3O 4RF4A 3QVXA 5IN5A 3F1LA 4R4JA 2JL1A 3ZWNA 3K92A 4UVHA 5L4LA 5TJ9A 4U0KA 4CM7A 3PWSA 4IDFA 2VOEA 3B1KA 3GRKA 3BMNB 4ND1A 2VZ9A 3VZSA 5AYVA 5C7LO 2CF6A 2VWPA 4R5HA 8ADHA 3P7MA 4KMSA 4YAJA 3HB5X 1XA0A 3JQ7A 5L51A 2IXAA 4WLFA 7MDHA 2EP7A 4B3HA 3CINA 4G81A 4ZVVA 1MLDA 4GVXA 3D7LA 4CLOB 5ENVA 3UF0A 3NJ8A 4PLFA 5C7OO 5L45A 1IB6A 4ALLA 1R4MA 4HFNA 1Z82A 4DC0A 2R00A 1AE1A 4CLXA 1Q2XA 3MZ0A 1R66A 3A28A 1J4AA 2JAPA 2Q1WA 7ADHA 1I2ZA 3HZZA 4E33A 1AGNA 2Y0DA
chains in the Genus database with same CATH superfamily
4B5KA 5DHRA 2X3UA 2IS1A 3KZIC 4RAFA 4WLNA 5T3YA 4JC4A 5CIWA 3G5AA 4MQEB 1WS6A 2EBUA 4OMUA 3PDUA 5HNFA 1MZBA 1LEBA 4HQ0A 3W6OA 1KY2A 4DZZA 5D5QA 3TGNA 3H4MA 3N2LA 4MIEA 5KNDH 1SVUA 1L7QA 3VR3D 4BJ6C 3TJZA 3N0XA 4LISA 4JB2A 3LBIA 1TVKB 1RKQA 5U4QA 3EXFA 4E2XA 4B3MB 3U7FB 2AQKA 3AGQA 4UE2A 3VC2A 1TEZA 4QU0A 1ZAOA 5H81A 1JMVA 4D7AA 1C7JA 2ODAA 3RC3A 2DODA 3KZZA 1W52X 4G8DA 3EXHB 4TRMA 1P6QA 3I73A 4IGEA 3BG6A 4ZPXA 3RSNA 2TRSB 3ZPLA 1R8QA 1UDWA 5HLTA 3RJMA 1TT0A 3VJMA 4C6RA 2ZB8A 5EHGA 1R71A 2DQ4A 3PJFA 4OREX 1ID1A 5C53B 2QRVB 1NJ1A 4YCCA 2NYAA 2I4IA 3DTTA 1LTKA 4XYGA 3TPCA 2VCYA 2DF8A 2GZHA 3CB2A 4EG7A 2QQ9A 3I4LA 5EINA 2LDUA 3FK7A 3Q41A 3ZC3A 1TEXA 3L0BA 2OO5A 5K6AA 4C4AA 5AIQA 3R8XA 2E21A 1R6XA 4FIZA 1Q0ZA 3MCWA 4MKRA 2FUCA 3N6XA 1AO0A 2CXSA 5DYIA 2XB9A 3ZH9B 1HV8A 3LBNA 5KVVA 2NO6A 3IDFA 1CB0A 1UMDA 6Q21A 4V02A 7REQA 4P4GA 3EQLF 1TAGA 1L4BA 2C7RA 3V80A 3ZWYA 3PPWA 1TZMA 5JZMA 4PONA 2B69A 4H17A 3ASUA 3NHZA 2J3HA 3FYSA 3ZCPA 1Z56C 1TBXA 3OX4A 2QW8A 4ZI5A 5L3ZA 3TP0A 4D4HA 5JZVA 3HXKA 2WJWA 1XEAA 1P0MA 5IULC 3U7JA 2WSMA 4PX3A 1E3OC 1T4GA 1V4NA 4BMDA 1OCRH 5I5EA 3JRCA 3VOBA 5ALNA 5K7SA 1ZA2A 2JLQA 2Z6QA 3ZV6A 4XWWA 3KC2A 1T5SA 3B9QA 4ZT3A 1ZXLA 3BGDA 4ZYYA 4KDRA 1KEVA 2Z2JA 1QG2A 4Y1EA 5EY5B 1SQ0A 2Q5OA 3ELWA 3QXSA 1T3GA 3DDNA 2AS5F 2QMZA 3QIVA 1LV8A 2WKWA 3CSDA 2IU6A 4UZEA 1W9HA 4ZI2A 1RKTA 1WF3A 2G72A 4N4NB 2TYSB 2H8RA 2XGMA 5C1OA 2EL7A 1ZGGA 3WBBA 4I1YA 5ICEA 2WG2A 2X41A 2P7VB 4V19K 2BI8A 4JUAA 2XAUA 3OPXA 4P54A 1CUZA 4R2WA 3IAM6 3LSMA 5IXYA 2HSGA 4CDGA 4PS0A 1QUFA 2FUG2 5DNAA 1O87A 2CF5A 2V9PA 2O05A 2XECA 1C8LA 4ZTJA 4E5UA 3IIEA 3CPSA 3IIIA 2WVAA 1SMYF 1VG1A 4YMSA 4O2LA 4CU5A 2ZJ6A 4HVAA 1YQGA 3OJXA 3WNVA 4ZREA 2UVQA 3MBOA 2QMOA 4LSMA 1JNXX 2NS0A 1ZMOA 3K0BA 1RR7A 1T1RA 2CYCA 5ELLA 4WCFA 3LXXA 2FPMA 2AKAB 1MSFC 4GKBA 1RS0A 1HC8A 1EVQA 3VI3B 1ZD5A 1FVOA 2A9RA 4C76A 3HUEA 1RWBA 4KVZA 4EV0A 4YMGA 4QLOA 4M89A 2JSCA 4LHSA 4NHOA 4HLQB 1BXZA 3W4IA 1S72I 3M4JA 1NQTA 3O7MA 5EYPB 3R1IA 1EM8A 4MW2A 2B4AA 4QFCA 2WIDA 4Y17A 1W2HA 4MYSA 2IGMA 1FRZA 2UU9B 5KU7A 2A68F 4FEAA 5K5OA 3GZJA 3NHMA 4KBYA 1GQRA 2XGOA 3L9WA 4MVJE 1D3AA 4RY9A 1K7XB 1MTZA 3KVYA 4RL6A 4ENVA 1GLNA 1O9HA 2BM8A 1TZCA 1NVVQ 1GRVA 3O26A 3EGOA 2XPVA 1ITZA 2QQ0A 3DTKA 4MFDA 1P1KA 2QT9A 3PYXA 1RXIA 5IWAB 2H2GA 3JYHA 1OBFO 1W93A 4LJ6A 3KTFA 1OISA 4C0SA 3ZJ4A 1PQYA 1IUKA 2DHRA 5F33A 3FNBA 1ZM9A 4E6EA 5AI4A 1XROA 2B9SA 3OJFA 4B4UA 1H8AC 4B81A 1VKRA 1ZM4A 4IEIA 4G1VA 5T4FA 2VT3A 2P78A 4MV9A 1Q20A 5HJ5A 3L9XA 2F48A 1S2NA 3KTAA 4O4LB 5DWDA 3IE2A 5ER9A 5A2QA 4J0KA 2W6MA 2QS9A 4ZIRB 3HRMA 2WB1A 4MIYA 2R6DA 4YAOA 5B5EC 4ARUA 3HJRA 4UCXA 1NR1A 1J1IA 3WO1A 2GCPA 4M6YA 2JKYA 5JHUA 1O7LA 3G8YA 4BX2A 1I8TA 1X58A 4NZPA 1XVUA 1K2VN 4FFMA 3KOZA 4PQEA 1GN9A 1ZBDA 4R54A 4CTKA 3J80K 3H35A 5JQWA 3HWX1 4H6WA 4J0IA 2C31A 1VXRA 3M5PA 4MYRA 2IEDA 4ITUA 3IVCA 3NTLA 2OORC 3HVHA 3FNEA 2OXCA 5LA6F 4KI7A 4M0PA 4BFTA 4YP5A 3AM4A 5D3MB 4NCAA 3MCVA 2RGGA 5IABA 4TTQA 4A8JB 1FFEA 3WAJA 5BUZA 2ISYA 1DGWY 4FX5A 5FOXA 1E5QA 2M6KA 4IPTA 5JVDB 1AB5A 3UMYA 1CLEA 1SVLA 1BAPA 3PL1A 1L5SA 3P9YA 5JJKA 4EW1A 1EXWA 1F8YA 2WHPB 3OIWA 5A0VA 2A1TR 1DEKA 1HOMA 1MJHA 3MRVA 1LNQA 1S0UA 4HCJA 3IR5A 1ZN8A 1RYDA 1AZSC 2IXSA 1X14A 1R16A 5J59A 2W0SA 4TUYA 3PITA 3BCHA 3ZU2A 5HWSA 1ZUIA 3BGWA 3EUEA 3EIEA 3IT3A 1DQRA 4I8XA 16PKA 3X1XA 3SJMA 4FHZA 1IBSA 1JLMA 4I3FA 3LAWA 2FW6A 3NX4A 4ND8A 1KI2A 5GAEJ 3WL5A 1XZ8A 1DOAA 3CLSC 5K0TA 5E6RB 1AGRA 4N5IX 5TE9A 1Q0TA 5AM0A 2ZS7A 2CJFA 3MZHA 1H8EA 4FFBA 1N2IA 1RAIA 1F1ZA 4GO1A 5BQTA 2DWOA 5I6DA 3SIWA 3TEJA 1F1JA 3V8JA 1YA6A 1YW8A 1OXKB 5C5DA 2PJDA 1XKQA 3AVPA 4HMOA 1N5KA 3DT9A 1A9PA 1E2XA 2HDDA 5F12A 4XKBA 3PENA 3ZHBA 2L4AA 2V79A 5EFOA 1FIUA 4LVUA 1BGVA 3I09A 3GTGJ 2PGOA 2YVAA 3L1IA 5DYNA 3LDFA 1RADA 3K6SB 3BG7A 3NOQA 4H60A 3E6CC 1WB9A 1RHRA 1QZ3A 2VWHA 2F8TA 1U5TC 1EKXA 1JBQA 5F3DA 3TCXB 3GPDG 4P0TA 2I2WA 1OXSC 4G0QA 1VCIA 3LYAA 5B6PA 5FA8A 2P1DA 4K9RA 3FMRA 2YIDA 5KOHB 4IRUB 4R1TA 1DQNA 1TCAA 1B8OA 5G41A 5HDBB 1AA7A 3OOEA 4L15A 1NKVA 5DE3A 3OKPA 3FPKA 2P6PA 3WLFA 4OLAA 2HPMA 4D6PA 1U9NA 2Z2SB 4DT1A 4UU0A 4JI6B 1S7AA 3HCBA 4EELA 1UBSB 1RR8C 1HT2E 2VF4X 3MG9A 1KORA 1ENOA 2XT0A 1W0CA 2LG4A 2NOJB 1Y3CE 2P7HA 1U7TA 3DVAA 2P9FA 3ZW7A 3B2NA 5THKA 3E7WA 4TXNA 3UCFA 4MIKA 3LCJA 3KSBC 1YBMA 3WZLA 2O3RA 3LF1A 2HQBA 3GTOJ 3U31A 4HDQB 4IQ8A 2VJMB 4WBSA 1T4CB 1RXYA 4N7JA 4B3IA 1ZISA 2WT9A 1RZVA 1AC5A 2ADUA 5FP0A 1SVNA 3ABKH 3QQ5A 4L73A 3E35A 2FEAA 2QP4A 3EA5A 4ISBA 2E2IJ 2VP6A 5D5PA 1W85B 5HQJA 3JASB 3AF2A 2DTXA 4G4SP 1Z2OX 2FMXA 3OYGA 5EP1A 2H4FA 4XVRA 1GRNA 4KC0A 2GQ0A 2Q3EA 2STTA 3DM9B 3EVFA 2O3JA 5C8VA 3EK2A 3UK6A 4XFKA 3EAFA 4LHEA 3QX3A 5HIIA 1QHHB 2B0LA 2C9MA 3ZOKA 4BO9A 4OQQA 2QOEA 5C52B 2J8ZA 5KWSA 1E2UA 4YGYA 5BWNA 2NVBA 2QL7A 4B45A 1A4RA 5M3BA 2ACEA 1HFEL 5D8KB 3IE1A 2ZUUA 5AI0A 3V8NA 3KOMA 4M3DA 2W00A 2J4DA 5KNBD 4DYHA 3HP4A 4XVQA 5EE5B 2PWYA 4KQIA 1S1MA 4O02B 4EYOA 1GQYA 4G0MA 4DM7A 1RBMA 4FTWA 2WJYA 3HM5A 3M1AA 4D8TA 2QRJA 5HS4A 3NONA 4JNKA 3W78A 1LQ1A 3I64A 1X74A 4E14A 2EFOA 3LVRE 4HAYA 5JD6A 1V4BA 3TP3A 1PR6A 3V7RA 2RFLA 4NP6A 1K78A 4XX0A 1V5IA 1GTL1 4I2OA 4UV8A 2ZC2A 1A31A 5B55A 5HQTA 1W48A 2WA2A 1XIVA 1Y1VJ 1SVMA 2AK2A 3D3JA 2DQZA 4M99A 2YN0A 1H0SA 1BJKA 2WAMA 1YJ8A 1PUFA 4N3GA 4YH1A 3HABA 1NURA 3SLRA 3ANXA 1FFAA 2YPRA 3UWOA 3MB8A 4JJAA 4WV3A 3RBZA 4XEUA 3RZDJ 3RYHB 4TT3D 2QJWA 1PR2A 1ZKGA 2JCXA 3H3FA 2NU9B 4NEGA 1MX1A 5HIAA 4FETA 2JCYA 2EX4A 4OOEA 5AP9A 1RMTA 5JDIC 3LOCA 1TM5E 2IZOA 4BDZA 5GOZA 4W5HA 4ZYEA 5EIFA 2NXEA 3M8KA 2B36A 4DLXA 3K9WA 5ALXA 4N39A 2RAEA 4W63A 1W36D 1WVIA 3OM8A 4LZLA 2JRMA 2I4RA 1FTYA 1JFLA 1EUQA 2WQ6A 4G9EA 1VA4A 1BC5A 3RC2A 1SCDA 3LLMA 4UVCA 4LY6A 5G53C 4FKMA 2XMQA 4YUXA 1M72A 3QX7A 3KJQA 2RHMA 2VAXA 1GAWA 1R6VA 3RS0A 5JSYA 8OHMA 4EVRA 4IQFA 2QN6A 4JR2A 2DR2A 5IUKC 3H86A 4CU2A 1ETOA 1OQYA 3U39A 1YKSA 3CVVA 3IPLA 3HN7A 4MO9A 2XQFA 4C07A 3HJHA 4C4TA 4DQXA 4UXNA 4DNQA 3N0WA 3NBQA 3A37A 2M32A 2A8YA 5A6SB 2C4MA 2IE8A 4AMZA 4ZDJA 3NKFA 4B4CA 5J2UB 3CD6I 2HNBA 4GOLD 1JWAB 4RY0A 2F4VB 1KGDA 4G8CA 3UCXA 1HTTA 1SFUA 4PFSA 5DGDA 2VBYA 1OXTA 3O8OB 4AU1A 1XD2A 4OIOF 3TWOA 4MV1A 4K9NA 3OTGA 3ZXYA 3FZVA 1C9NA 4AY6A 2VYND 1HFJA 4DMRA 1EHIA 1YGYA 3KYLA 1NI4A 2H7CA 2A78A 1WB5A 1E1KA 1P9LA 3ZD9A 3DE4X 2FRVA 1Z22A 3V8LA 2QB5A 5DM2A 1SVOA 3BBPA 1ENYA 2J6BA 4JU8A 3KU1A 4LFUA 3VO8A 1GGJA 5CPRB 2QM0A 4WDRA 1C9JA 2QTLA 3DR5A 1OKRA 4ZAGA 2QPAA 2XF7A 2FOKA 1PE0A 4AY2A 4WNAA 3RGGA 1OC2A 2UAGA 4EEFG 3ISTA 5IAGA 2P69A 3W79A 3SFIA 3NT4A 4B83A 1Y8AA 5ALQA 1MEEA 5AUQA 5CH3A 3HO1A 1Q0SA 1FMCA 3DM5A 4C3HJ 2W9XA 4MUJA 4D3XA 3W3AA 1KONA 3HCWA 4IIFA 2ZB9A 4QDTA 3H7AA 3KHSA 1WTAA 2KLHA 1HE5A 2YMQA 2ZUSA 1JQ3A 2X5OA 2XTMA 5EZYB 3OFVA 1GGKA 1OWPA 4ESVA 3L7JA 1MB3A 4BFLA 2MH2A 5BORA 1BOAA 3S1QJ 4FGJA 1OBOA 5EGSA 2X58A 3Q9UA 2JKZA 3MF4A 5C8XA 4UJ5A 2E1NA 4WWHA 4LLLA 3NALA 2YFQA 4DV1B 2B61A 3MUEA 3F73A 4BXOA 4FT4A 1BMQA 5JBQA 4QGFA 3GLLA 1YBHA 3FDZA 5A3RA 2SECE 3DCNA 5FKMA 2FUKA 4G89A 4MS4A 1E1CB 4GI2A 3M7GA 1RRGA 1DAKA 2DSTA 5JMTA 4ZCPA 3FD8A 4JQZA 1BA2A 4MEJA 3JQGB 5JSQA 1MBEA 2BP7B 1NATA 1GFWA 1L8XA 4GYKA 1K9VF 3CCJI 1X9GA 1EB9A 3D5QA 4NENB 1E96A 3QENA 3VNSA 3QQAA 4R01A 4OKNA 3SOZA 2DQKA 1MD9A 3U4MA 5DH9A 4XLAA 3RFVA 5H83A 3DONA 2XPCA 4N01A 2GCOA 3BHIA 3I34X 2I55A 4P7FA 3IPXA 2AG8A 4KE6A 2P30A 1EZZA 2PUBA 2X0EA 3D4OA 4X84A 1H2AS 3EJ6A 1QV9A 4MRAA 3K15A 1XCMA 4KTTE 2HO4A 2B1QA 3GU3A 3OYHA 3B78A 4U7BA 1A36A 1V7CA 2CUTA 3OL3A 3RTGA 1KVSA 1ZK8A 4L57A 1KTIA 4MH0R 2LVSA 4PQYA 4DLSA 3ZHCA 1NLYA 2NGRA 1T3ZA 1WMSA 1IBCA 1W73A 5ERIA 2Q3DA 1UBMS 4C0LA 1Z88A 4XM1A 3U4GA 1QCCA 3TQTA 4IEJA 2I2FA 2ZE6A 3ZOZA 1X3LA 4I0WB 4PBSA 5M5XJ 3IP3A 1QTNA 3SWWA 4HHEA 4ZGGA 4ZCRA 4B17A 4KK3A 3JQRA 5BXYA 5B3AA 3D0QA 3X1KA 5HDGA 4QE3A 3CRZA 5J6XA 2RGVA 3M6XA 1C7IA 1YA8A 1W5FA 5A2GA 3NYRA 5I7WA 3S15J 4TLMB 5J40A 5CQGA 4AM3A 4O0LA 5DU2A 2VHZA 4JA0A 2VDQB 3OQJA 1K88A 4N8DA 3EPRA 3GRKA 4ND1A 1WPGA 2FGJA 3KL2A 2OHIA 4KKXB 4NQWB 1VSBA 3ND8A 1FY2A 1NQXA 2R5FA 4AS2A 4NZMA 4MW1A 3ZHUA 4V2IA 3OY9A 1H6DA 4I1IA 3NBXX 3IERA 2O54A 4LHWA 1Z73A 1N8SA 4UE6A 1A5SB 3L6RA 1HDRA 1EFAA 2HSDA 2GEJA 5FAXA 4KUMA 2CMPA 4DV6B 1RJ9A 4ALNA 2P1RA 4V2UA 2BMVA 2W90A 2SHKA 2VHEA 1FS6A 1U9YA 3GLUA 1Z0DA 4EYSA 3PFKA 2RVCA 4MVJM 3F72A 2EFCB 1O5IA 5BQ5A 3A1SA 3WB0A 4UBNA 2PT6A 3G2BA 1QFYA 2C5FA 1I1SA 4LHVA 1JEDA 3P0EA 4CKCB 1U8RA 4XIIA 3ERCA 3KKPA 2VSNA 1GUZA 3K4HA 3TRFA 2G6BA 2XE4A 4WY2A 3WQBA 4EW6A 1SG0A 5FUMA 1Z63A 4D7NA 4A69C 2IYLD 5AM5A 1Z4IA 4M0UA 3QU7A 3P9KA 3Q0UA 5E6UA 1YZVA 2IDMA 4ZYXA 1Y3BE 1D04A 3HOUJ 2X5NA 1GVHA 2FMIA 4RS8A 3TH5A 1L9KA 2FZVA 4HSTA 1X0VA 2G5CA 3GVXA 3L1VA 1G5PA 3VYWA 2PX3A 2QWWA 3PK0A 1GHTA 1ZVMA 3ZZNA 3IP8A 1A9RA 3GJTA 1M8PA 3QSYA 4AM8A 1LVAA 2XT6A 1R88A 1SZDA 2YOGA 3ORYA 3QWBA 1G9SA 1XP5A 1I7QB 4PBTA 4K8OA 3LS2A 4KRFA 1YL7A 3OU2A 1LFDB 2D7JA 2G36A 2GMWA 2P35A 2WPDA 4IZ6A 4OJKA 3HSSA 2G07A 3T1NA 2R8OA 3IELA 1MOZA 2HA2A 2EGUA 2QSUA 2AWNA 4JP2A 2HA3A 1KEWA 2IHVA 4DBRA 1VQPI 3OPVA 3QVMA 4B8ZA 3MN1A 1LLQA 2OZPA 3FM9A 1OUMA 2WV1A 4JV5B 1E0KA 2I4LA 1N9GB 5F5NA 2YRWA 3M7IA 4AZTA 2VT7A 4A6XA 3BFKA 5JZ9A 5FTJA 1D4ZA 2R8PA 4G1FA 1IOLA 1NONA 4MR9B 1W49A 5IS2A 2PUEA 1O97D 1XMAA 1WSBA 5KTKA 1M2OB 4A6EA 1MFPA 2QM8A 5BOVA 3KKLA 1MT3A 4E31A 3RTAA 2VC1A 2RHCA 1DUSA 3DC2A 3E6AA 1E9SA 1P1BA 1HH4A 2O7RA 1KZ6A 3K6RA 1S3SA 5K9ZA 5A7FA 4IIJA 3GGPA 2GA2A 3DLAA 4TTPA 3EJWA 1FW8A 2EBFX 1CKEA 2BWJA 5DP1A 4F04A 5CA1A 3WL3A 4BRUA 4D42A 1BDBA 4H1HA 3OF3A 4E51A 2AFHA 4ZVUA 3EWNA 1KJ9A 1XXLA 5AJTA 1RWWA 3ZHVA 4KVAA 4N82A 2D59A 1H4TA 4OQDA 3OAAD 3RJPA 2R5WA 4LRQA 4UCWA 1EK1A 5J5CA 4HADA 3FNIA 2APJA 3DE1X 2P2CA 2C20A 4K9DA 1XCVA 3LCVB 2OAQ1 4IBOA 4I1UA 1OCEA 2ZPAA 4AUEA 5CD9A 1I4DD 4G5FA 3AF6A 2I6GA 4HWPA 3NB0A 2QJOA 3EA4A 2YHUA 4Q1VA 4YB8A 1NBIA 1JPVA 2HX1A 1MEJA 3IDQA 5BO5A 5DHQA 3X2QH 1F2UB 4EENA 5CA0A 3A9UA 2WMNB 5LQMA 4LNHA 1VBNA 3KAQA 5EKXA 1ORTA 521PA 2BMWA 4KQ1A 4B47A 2V3CC 3AAFA 2F8MA 1HMYA 4F2PA 3CLUD 3M1YA 3REFA 1E5LA 2VQEB 4CMBA 1DJQA 5BYJA 4FHEA 3OETA 2I2XB 2QLNA 4W97A 3KSUA 3AFOA 2X0LA 4HGPA 4US1R 1LJ9A 2Q3BA 4RORA 1N5DA 2FPGA 2J67A 2LPMA 2VJNA 1AGXA 1FX7A 4TS9A 5BUSA 4E70A 3ILHA 5LU9A 3OKCA 1FSZA 3L7DA 3HM2A 4GPIB 2L0XA 1JWLA 2DMPA 1GTMA 5ENZA 2HOAA 1DHRA 1Q0PA 3OSZA 3BZWA 2DCMA 4JCCA 5HKKD 3K1PA 4MQFA 3TE6A 1LFBA 1ZRFA 3FH0A 1OFUA 4FCTA 3RRNA 4E7PA 2GK7A 1T36A 1PWZA 5ALIA 1TRHA 5GP9A 4ON9A 3WKEA 4F2GA 5C8DA 3C2HA 5H9VA 1Z38A 4P35A 3PL5A 1WSDA 3I6QA 1XSVA 3PXAA 4PQRA 1TK2A 1XSEA 5PGMA 4ZT2A 3PR2B 2E34A 5T7BA 3QKSA 4AUMA 4O2BF 4LGWA 4TTIA 3RC1A 2G28A 1Z06A 3KLBA 1QYDA 2V6IA 4H15A 3BP8A 4PTYA 3COZA 1JB9A 3CZQA 1M34B 2O7VA 2COBA 2EZHA 2C77A 3PFYA 3HNOA 2LKPA 2GN0A 1R9JA 2R751 4BWFB 4LMYA 1QKKA 3GJ7A 4M83A 1PFWA 4ND7A 4PZPA 5SZJA 3SKXA 3SQXA 1HT1E 2OXFA 1I4WA 1I7SB 3AI1A 1T8YA 5E7JA 5AESA 1XF1A 5CDHA 1EVYA 3V1KA 1XA4A 1H66A 3T4XA 4ZT5A 3TOZA 1G8YA 3L2CA 1PEKE 1GTVA 2B7LA 1XCGB 1E58A 2QW1A 2LP0A 1UODA 1KF0A 2EQRA 5EMMA 5AKYA 2WTXA 2W5UA 3G88A 3PNLA 1QOPB 4J0HA 5FKLA 2Q6OA 1GVDA 3PX2A 4BN0A 5CJJA 1T9KA 2OILA 3FR8A 2UVPB 1RXEA 4XK4A 4S1NA 5JCXA 3IUEA 1C1DA 3DUWA 2I66A 4IIUA 3L0PA 3WYGA 3WLJA 1ZMTA 4XX1A 4JVMA 1EFPA 1BW9A 2FK8A 3B20A 3UAVA 1OZFA 2H54A 4MCJA 3BCRA 3T7TA 1CF7B 3S70A 4EJMA 1DGRM 1QHNA 5FPHA 1UT5A 4TM7A 1D5WA 2BTEA 3O2PE 2ZT7A 2X1DA 1HDDC 5J43A 2JFFA 2YFKA 5HLIA 3I6ZA 1G21E 3RIYA 1Z0KA 2CD9A 3DP9A 4G4GA 5F52A 5AVRA 4O63O 3H9BA 2FPPA 1AMOA 3R5HA 4L4XA 2G06A 2GARA 2DN0A 2QU8A 4JOCA 4IDQA 1UIMA 4QBKA 1J2EA 2J33A 4F5YA 3C70A 3B12A 5EXEA 2YBDA 4FEEA 3DV9A 3ZQCA 1VSUA 5CAEB 3J80Z 4BNHA 3MUNA 1TMGE 4ESBA 2VDMB 1WEHA 3FBGA 4KIFA 4FDTA 3NGXA 4NJEB 3SR3A 2XGXA 1ZKDA 3K1NA 1XK6A 5KNCH 3WTBA 1CT9A 2O23A 2AOXA 2XC7A 3AEQA 4BHTA 1HEUA 3WZMA 1NTRA 4BJ5A 3DBIA 1BI1A 2N1BA 5HSGA 4YAUA 3O8BA 1VHWA 4EKIA 4FX0A 2C8KA 3P0JA 4OB8A 1NSYA 1II8A 1Z5UA 3DOUA 4TYPA 3OWHA 2J09A 4CQNA 4PFJA 2VS1A 5JNLA 4QYIA 4KFCA 3THXA 5FUQA 3OEEA 4GWKA 4HN2A 3SG0A 2OM2A 2CJXA 1A8HA 5KSOA 5FEMA 3G23A 2WU1A 1ZDMA 2KM1A 1W96A 4M0EA 1TO1E 4C3IJ 4EJ6A 1Z4OA 3IPCA 3U0VA 1TQMA 4ZJYA 1HKTA 4DV7B 1JF8A 4OO3A 2WTNA 7ABPA 1JDPA 1MTOA 5LBQA 1DV2A 3RSGA 3F7MA 2Q5HA 1CCWA 3GJYA 5K3BA 5J1RA 2O3UA 4CM4B 1JSLA 1DKLA 4PR3A 4PN7A 3BDAA 1J21A 4EKDA 3BC1A 4MKHA 3RVRA 1CJCA 3VYSB 3I42A 4FMDB 4FJ2A 2PAFA 4ZD6A 1GKLA 1FPQA 3HRTA 3FOZA 1YZYA 3TVTA 3DEWA 3AIIA 3KZYA 1MZVA 1LDMA 4F92B 5FLVA 3HG9A 1WIWA 4F8EA 4F21A 3L3BA 3GFIA 1ZK1A 3PJRA 1YXMA 1U1IA 3SXPA 3N3BC 4QPCA 1VQ6I 2RIRA 4J9VA 1QIFA 1PNVA 2MYTA 1FRQA 1DRVA 4F8JA 2ZOSA 3CEJA 2VA9A 3ABSB 2Z9CA 3QITA 3V00A 4EHAA 4YONB 4A03A 5IDYA 1ZM7A 2WHXA 1P5HA 2XCUA 4QEZA 1NP3A 3KQKA 1IN5A 3CPHA 1BD4A 4RS4A 3D4NA 3KQYA 1B23P 3B5JA 3LWFA 2Q1YA 1P2DA 3EDMA 3UMFA 5FI5A 4HN4B 4UARA 4V2GA 3PTAA 5L3EA 3NARA 2V6EA 4D5FA 1H5UA 2FI1A 4JXKA 4BKMA 4GWGA 2BFNA 5E2BA 1X13A 3RH0A 5CW2A 5JIBA 3T3HA 1JI3A 5CB8A 4XSVA 3V3TA 3WTZA 4HDUA 1CJKC 1ZD1A 2B2NA 1GPKA 1ZN9A 3A4MA 4GQIA 2IAIA 3RKQA 3QFFA 4I0AA 3W6PA 2VC0A 2VP9A 2BBTA 4P31A 1MGPA 3QXJA 3DHNA 2RAFA 4LVNA 2GYYA 2CYAA 4D2IA 1DOZA 5DX1A 5CKTA 4CCKA 3MTIA 2C82A 4MLDA 4D9JA 1Z4LA 1RC0A 2Z57A 4YWHA 5AJXA 2NP7A 2LYCA 1ML3A 1CS0A 1S5PA 1YJNI 1MH4A 1VE9A 1VL0A 3IQIX 3CBQA 1KKUA 1NJGA 1WPXA 1FP7A 4FWIB 2M9HA 2NO4A 4YRSA 1R18A 2FE1A 5CITA 1M9NA 5I4KA 5TC4A 3QOYA 5JPCA 1ZY2A 3JATB 3CVXA 4LOAA 1ZH0A 5IARA 4Q1EA 3EOBI 1WBJB 1J0RA 1RJDA 4X1KB 2ZU0C 4IO1A 3AV3A 4ZYTA 5EIAA 2OQIA 4AZ0A 3QU5A 1T6BY 5LA6A 4CMJA 3IKLA 3KQNA 5TMDA 5EQTA 2I91A 1MBKA 3MKZA 5ITSA 2X7HA 1NIJA 4RBOA 2OLJA 2EL9A 2JCGA 3FFAA 1N2ZA 4ALIA 4YX9A 4Q7EA 3JTGA 1R0XA 3BGOS 1K86A 1ULHA 3SZUA 1AKMA 4PINA 3A1DA 4IDOA 4HI0E 3C5EA 5AJUA 1T2FA 1NTOA 1P44A 4D56A 2WUDA 4L9AA 3AH8A 1LFPA 2HD4A 1WJBA 3CUWA 1OFUX 1C14A 2N9UA 5I7FA 3UMJA 4LXIA 2YHIB 5DN6A 4U7PB 1GTSA 1ZLJA 3LOQA 2V7EA 1Q84A 3QEMB 3BQYA 4N54A 1AKYA 4LG1A 3WP0A 4C4SA 4LJLA 1ONOA 2ZB2A 4IEEA 4LZJA 4RHCA 2R7QA 3LSJA 1YH3A 2Y05A 1VE5A 4PZUA 1TADA 4HWTA 5CLQA 4GOND 5IP7J 3ZZ1A 3PQ4A 3DP7A 5LHIA 1PTJA 2FQYA 1JA0A 1R23A 4ASUA 3F3XA 3FHZA 5BSGA 3L4BC 2GZMA 3ZOBA 3KAPA 4XI9A 4OOFA 3D8NA 5DV9A 2EV6A 2NUPA 1HORA 2BFMA 3A6ZA 5FF9A 4Y9TA 4LB6B 3E9NA 2CJWA 4WLOA 3E03A 5D3QA 3DEYX 3HB9A 3A4IA 4MRMB 2J45A 2FUEA 2ISSD 4CEIB 1PL0A 3WG7H 4X65B 3NI2A 4IV8A 5GJVC 5IVKA 2V0CA 4LRUA 5CK5A 5JWHA 2YX1A 4DB2A 3KKQA 1GU1A 4G0YA 3A4TA 4YJ2B 2Q49A 1WRBA 2DPDA 1VG9B 2YJZA 2UWMA 1EFDN 5EKUA 2LF7A 4L5BA 1P1CA 1XU7A 4Z4IA 3WLQA 2VSYA 5IPAA 4ZC1A 2XITA 2WB1N 4NNJA 4HFRA 4QOSA 2GFHA 4N41A 1DBPA 5CFMA 3KD3A 4JB8A 3ENVA 3AM5A 1GXQA 3GHYA 4JX9A 2CXRA 4EGJA 1I5OA 4I5EA 2YHSA 1FFBA 3I4FA 1VB5A 2P5YA 1ZK2A 4KPYA 3EZ6A 5JNTA 4ZC3A 1NI5A 4G01B 5BVGA 3VWBA 3CCBA 3FB4A 3SJBA 2RDMA 3EPPA 5ICMA 3F98A 4BQEA 4V38A 3D3KA 3R5SA 4K9QA 2PCJA 2QRLA 1Z5ZA 1T2UA 1T9GR 2AFIE 4WMLA 4Z7QB 3OIGA 2FBKA 2VNHA 3CQZJ 1TTHA 2COMA 1SUWA 1N2CA 2C4TA 4KGZA 2C4KA 2DC1A 5BNFA 3BM5A 1Y1TA 2ECOA 2PL5A 2YICA 2Q1TA 4OSEA 3B48A 5G3YA 4OATA 3B1VA 1XAIA 2TMYA 3UUFA 5TNXA 3QAHA 3LUPA 3K9NA 1Z4JA 2FW9A 1OAOA 4HNTA 3K31A 3SHTA 4F5EA 1BU5A 1OE0A 1UBRS 3NBKA 4AP6A 2VE8A 3RYPA 2UZIR 3ZV4A 1TYEB 1X1BA 4C0BA 5KHAA 2JIMA 5AOVA 3G3ZA 2GZWA 4JJ6A 3QVKA 3RO7A 3DLTA 1CZNA 1PBTA 3T7SA 2Z1NA 1BTOA 2V7TA 3ZGKA 2OP1A 1E77A 2D5VA 2AG5A 1UXHA 2L18A 4GR9A 1PYDA 3HDGA 3OX3A 2B0JA 1ORKA 1WD7A 3SX2A 5BQXA 4YMIA 4WIAA 1E3HA 4QYTA 2HBRA 3UMMA 1P31A 1L5VA 2R1UA 2H4JA 1E6WA 5TSDA 3ZI4A 3EGDA 4BNZA 5CVRA 2RG7A 2ZJ4A 3IPYA 4DCTA 1W5BA 3IE0A 2FKNA 1YMQA 2LD4A 1YDWA 2M87A 1M1UA 5LJLA 4RGVA 3W6VA 2IVZA 3DZHA 4XXHA 3C7TA 2ZS9A 1JXMA 5DHTA 3QZUA 2HUPA 2CLFB 2AD1A 1SUPA 1AG9A 2DQRA 1W4ZA 1FUKA 3I28A 1M2FA 1RI5A 4ZWNA 4QECA 4DEXA 2BCGY 4MX8A 4NYIQ 5SZKB 2JHCA 2V4UA 3DDWA 4OTZA 4QT4A 2NAPA 3UKOA 2DOAA 5A03A 4FGWA 1E63A 1BIFA 3BSYA 1YJCA 3EIXA 3G8CA 4ETNA 1Y1KE 3GTQJ 3P9IA 1HM5A 1YZHA 1CR4A 1WABA 4CV1A 1BBYA 1PJBA 2CD7A 3WV4A 1FBQA 4Q9JA 1A69A 1P9RA 3O4GA 2RHGB 2XRYA 3OTWA 4JUFA 1D1TA 4AIHA 1DT5A 4KO8A 4I08A 3MTAA 5F2NA 3ZVLA 3FPBA 1CEQA 3QKRA 5BT8A 3ZMUA 2BT4A 2XIJA 1GQQA 3EASA 3QQPA 1AU9A 1JKIA 1AOXA 1AF7A 2MR6A 2QA5A 3GZTB 1O7JA 3FAZA 2WFZA 4AVPA 1VTKA 3ONNA 1SIUA 3VU3A 4J3NA 2OBPA 3PDIB 1XMSA 4CM6A 3V2HA 2JAWA 3FMQA 3DFFA 4GOXA 3TGLA 4AAYA 1SVWA 3AVWA 1M33A 2AG1A 2HYGD 3AVVA 3CRVA 3FBTA 2GLTA 3HACA 5H3HA 3PFWO 3VSCA 2J4FA 3BCSA 3ZU4A 1S8AA 4MCHA 1S2DA 1X2BA 1MH3A 1MPXA 2YV2A 4Q4JB 2P6TA 3A31A 2H4ZA 3OE4A 5AW6A 3FYUB 4F7ZA 5EOVA 5DCLA 3O0TA 3S8MA 2X7XA 4A3CJ 3STXA 2PMCA 2PUDA 3GVHA 5GZ1A 2P5VA 1RQGA 4NEQA 3T1BA 3OS0A 4ZOAA 3V8VA 4I9NA 3TO5A 3SJZA 1DKQA 1U3GA 4EAQA 1C7EA 3FMSA 5LL6P 3ZP5A 2BJVA 4A0GA 1FIAA 3T3NA 2OBNA 3HOZJ 3BDDA 1E3EA 3TLBA 3BKXA 4KN5A 3NYQA 2EKQA 3H16A 1EWKA 3KT3A 2DQLA 4UMVA 5JATA 4DNOA 1JIJA 3N8NA 2OAEA 1QU2A 3HY4A 5CVDA 4LYAA 4WX9A 3A7EA 1G3IA 1SXQA 3WIVA 3ZWAA 2XJ4A 3AJRA 1IQUA 1REQA 2Q3JA 3FLBA 2OHHA 3O7WA 4RZ2A 1NQVA 4FHGA 2JL1A 5AK3A 5CK4A 2I2DA 5AYVA 3VXKA 5CTJA 2ZIXB 4BUJA 1QRDA 4K9MA 2ICWG 4B3HA 2QM3A 3ZWDA 2G0EA 3S99A 3BN3A 4C01A 4U9HS 1Z82A 2R00A 1AE1A 3P97A 1Q2XA 2JWTA 4JP1A 1I2ZA 2QDXA 5DM60 3HP7A 1AGNA 3T1OA 2YZ7A 3ZLBA 3SIRA 1SUFA 1M2NA 2KISA 4MYHA 4X20B 3JARB 3CG0A 1JFVA 4TQGA 1E9RA 2QA4I 1D2MA 5J1UA 4JBHA 3MINB 1QE3A 2HCRA 3CR7A 4TSKA 4MKZA 4XD7A 3MQ0A 4RH3A 1QO9A 1V43A 1CUSA 4HDMB 4DW8A 5DXJA 3ZZ0A 4HWRA 3WWOA 4DZJA 1Q0QA 2CFTA 2JJ7A 3DE5X 1J5YA 3FM5A 3LKBA 4JX6A 3CZ5A 4UM8B 4M73A 4BNMA 4II7A 4E5KA 1YZFA 2SCUB 5KDLA 1IHXA 1DIOB 4IUCS 1X8JA 4UVDA 4XR9A 3IQHX 2ZSHA 1RUOA 1F36A 3KYCA 4TMWA 2KJQA 1WZCA 3SNHA 1WQ2A 4BNJA 2QYTA 4M7WA 5CM8B 3HADA 1O0SA 1I9CA 1F8UA 3CUOA 4FGSA 3C2QA 1N5IA 3ZNNA 4R8VA 4N6GA 1MSEC 3WNBA 5EEHA 3OPNA 2CXHA 1K6EA 2PDAA 2BR4A 4BU0A 1CWUA 2LBFA 2X5JO 4CRWB 4OXRA 1Y0BA 4EJFA 2NLOA 2UDPA 1M76A 2A6HF 4GT1A 2RB4A 1AGYA 4YWJA 2FGKA 1NY6A 3WGOA 1PR4A 2EJVA 3TNLA 3BEOA 1ZGAA 4MDHA 3T0GA 1B15A 1BC7C 2VPXA 3AMVA 2R6FA 1XF9A 1IVYA 4J07A 4Z2AA 4I4TB 5D7BA 2ZJPF 1W7AA 5EPEA 1W0TA 5WRFA 2J0QA 3JTEA 2XQVA 3NEUA 2VK8A 4GMHA 1DAHA 3BZCA 2WJZB 1MW9X 5BSWA 3MA0A 3L40A 4AW9A 3KALA 3NTRA 1HXDA 1BKYA 2IIPA 4AO7A 2RGRA 5LNK6 1PTKA 4DA7A 1UANA 2DMUA 4KYWA 3F6YA 4F2HA 2K87A 2ZK7A 1F9NA 2X2FA 3AFMA 4PBRA 1NF2A 2YS6A 1QNFA 1ZJ4A 2QJTA 1NR7A 1JRLA 1I3AA 1ADCA 5IU6A 3WQRA 3F3SA 1G16A 1TJ5A 3WMRA 2WNIA 2CDBA 1R1VA 5LQUA 2JD0A 2JAQA 4BKXA 4EEKA 3KU4A 1W75A 3EVEA 4RYDA 2HPAA 2P62A 1F6WA 3VFDA 5LP6F 2J7PA 3I2KA 2LW7A 1MMDA 3DEUA 3CCLI 4ZEVA 3DJFA 1YASA 4FGKA 5A5DA 4DMFA 3MAJA 3I83A 5GMOA 1GG8A 4KSCA 4OHFA 3AVUA 3RVBA 3F46A 1NLZA 3SU8A 1EBBA 4FNMA 1NMXA 2VTBB 4GP6A 1SCIA 4YR7A 1USVA 4ENQA 1QE5A 5MHTA 1DCMA 1ZG1A 2ZIAA 5CPBA 4L51A 4ARAA 2JIDA 4JVNA 3OYMA 1I2DA 4JC8A 2UUBB 4WQMA 3QJ5A 3H97A 4UEOA 2OHOA 4EYGA 3K1TA 3L6EA 1U7PA 5JBNA 2FW1A 3ICWA 1Q1EA 1G98A 3DMNA 2KKOA 1UUFA 1I0LA 4Q1BA 4BO2A 4AUNA 2NMVA 4YJHA 2GX6A 2MA3A 1YI0A 3HVJA 4U7HA 3PHJA 5LWHA 4J91A 2LR0A 4KSYA 2GK4A 1M73E 4X91A 1YNOA 3VKGA 4I1VA 1HE8B 4EJ2A 2C3YA 4AT1A 3OOPA 2EP8A 3OEYA 3A0RB 1UMBA 2VXBA 3M0EA 1GJRA 2DBBA 4NBVA 3A6HA 5H02A 3IEMA 1CEXA 3AI2A 4DKXA 1IUOA 5K3OA 1LA2A 2HQ1A 2DOKA 1CUDA 2IEYA 1F60A 3WU0A 3OQIA 1JIVA 2F7SA 5FPSA 3V42A 4Y2PA 4UDNA 3D0SA 4I4IA 1OA1A 3P2IA 3R8FA 2QYOA 5AIAA 4OH7A 3DHYA 2I4NA 1JR2A 1XGKA 1IN1A 1RYMA 2CVPA 2AEJA 4EYKA 4KWCA 2K9NA 3I8SA 1Z17A 1NG9A 4WVLA 5DHFA 3JRIA 3DHWC 4RH0A