3H9GA

Crystal structure of e. coli mccb + mcca-n7isoasn
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
346
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSNNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 106
structure length 346
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9gA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9gA02
4P22A 2ZB4A 4D45A 3Q2KA 5HS6A 3QV1A 3F3SA 1EFKA 1HLPA 1U9JA 2VNAA 1AHHA 2H6EA 1B15A 4E21A 2HK7A 2JFHA 4XX0A 1ONPA 3PQFA 3S2EA 2D0IA 2XPCA 4U8GA 1LDBA 3OP4A 1QRRA 2Q3EA 4D44A 4CLRA 4WASA 3PYXA 3A28A 3VKVA 1DHRA 3DB2A 4M1QA 1NQOA 3DTYA 2EJWA 1I36A 2YV3A 5TF4A 1YGYA 3AW9A 3JYOA 1B7GO 3N58A 3ZHBA 3WB9A 1XGKA 4QX6A 1W4ZA 2DU8A 4J43A 2ZYAA 4L74A 3OIDA 4Q3DA 4A10A 4BO3A 3V1UA 3GUCA 5A04A 3H7AA 4BUCA 3AFNA 1B26A 4J91A 3ZV6A 2BGMA 4BNTA 1PS8A 5T8KC 4OOEA 3AOEC 1EQUA 4EZBA 2UUPA 2IODA 3NTOA 4ALNA 5LCXA 4GVLA 4AJJA 2VHXA 4WLOA 6ADHA 1C1DA 2PGLA 3C85A 1ZSNA 3QWFA 1E3JA 5L45A 1SO8A 3GDFA 2YJZA 3PJEA 1UDAA 3SEFA 4JIGA 4B8WA 4MVJG 1YBMA 4NDNE 2JHFA 5F5LA 3RI3A 4HFNA 3WBFA 1NWHA 2ZQYA 4NFHA 4UULA 2JCXA 3IL2A 1A5ZA 2E6UX 1EBFA 5DN9A 4H15A 4CMKA 4C7KA 1SOVA 2NVBA 1Z45A 1O6ZA 4OKNA 4Q3EA 3H5NA 2JCYA 4PG7A 2R00A 4WEQA 3EY4A 1D1SA 1O0SA 1QORA 3QQPA 4FDAA 1N2SA 4GQAA 4KTTE 5F21A 1ISJA 1GCOA 1KVUA 4CMEA 3HADA 1PJ4A 1QKIA 1PJ3A 3ZWVA 5JMWA 1T2DA 2PKRA 2QYTA 3ZU4A 2GDZA 3ZWYA 2QRKA 4DUPA 5ADHA 3KETA 3OMLA 3PYLA 1WMAA 4Y6SA 3D3WB 4K26A 4D3SA 4DL9A 1YONA 3OJOA 3G49A 3ZNPA 4BOYA 4CPDA 2YW9A 4JLWA 3ROMA 4IDEA 2BHLA 4J0FA 1YOVB 2CZCA 3EZYA 3GQVA 3JQCA 5EQFA 3RBZA 3GPDG 1YL5A 2GZ2A 4UEOA 1PJQA 1ZK4A 3WIDA 3NDIA 3PTZA 5I7VA 4FJ0A 2W4QA 4GLOA 1EUZA 2PTGA 5JCXA 1E7WA 2C2YA 3OIFA 3Q2IA 4UEKA 1GAEO 2W90A 4M89A 3V2HA 1BXGB 1PGJA 4E6PA 5BR7A 3FRJA 3ZWBA 4R16A 3DQPA 3UVEA 4OL9A 4AVYA 5JBIA 1JU9A 1T1RA 3ICPA 5DCUA 4XQEA 1YRLA 2JD0A 4XJTA 5ES3A 3A9WA 9LDTA 5L7WA 2JJYA 5C7IO 1TA4A 1VM6A 3TQHA 3CEAA 3PQDA 3ZWMA 4LW8A 1PQUA 4WE3A 1CJCA 1ZH8A 3X2FA 2D4AA 4BO7A 3KUXA 3JQBA 1LDGA 2P2SA 4CLRB 1B8PA 4PFJA 2GF2A 1JAYA 1GEEA 3DAGA 3KHUA 3OF2A 3H9EO 1DRVA 2VYNA 5HWSA 2H1SA 1IHXA 4RORA 3AY3A 1YB5A 3QJ5A 2AQHA 2QQ5A 3S2IA 3TPCA 3ADPA 1ULUA 4YJHA 1EMDA 1SC6A 2DTDA 3ZWAA 1DEHA 3JQ8A 4KQXA 1CETA 4AJOA 2ILTA 3H65A 5IDYA 5CPFA 1SBYA 3WGGA 1PTJA 4NHEA 4YACA 2PZMA 1LDEA 1PGPA 4NFSA 2G5CA 5BSFA 4FIZA 2PLAA 1A7KA 3UKOA 3DAFA 1G1AA 1QP8A 1M75A 4MVJH 4J49A 5ITVA 3PZRA 3AJRA 4URFA 5ILOA 3I6IA 4ZA2A 1BW9A 1YBVA 4Q3AA 1C1DB 3VKUA 5EPOA 4RPJA 5BQFA 3GEGA 4XYMA 3QVOA 3GVXA 4YWJA 5JAMA 4A7PA 1YWGO 4YQZA 1NVMB 2J3IA 5JY1A 1VSVA 3BTUA 3HJAA 3K31A 3DHYA 3GNTA 4HNHA 5AXAA 2A92A 4GH5A 4RVHA 5TT0A 1EVJA 2I9PA 4QXMA 3TZKA 2AA3A 1V3UA 4J7CA 4NBUA 2WEKA 4TRNA 4DBZA 2FRDA 1EK6A 1HL3A 5A05A 4BMNA 1I2BA 3KVOA 4CQMD 3AI2A 3OICA 5L7YA 1E7YA 1PS9A 4BQRA 2D1YA 4CLDA 8LDHA 4BO5A 3SVTA 5HS4A 1ZIDA 1H6CA 3DO5A 4MO2A 3I1JA 2YUTA 1Z82A 4K9DA 3KYCA 1BDMA 1QLJA 4GVXA 3FNGA 3ZW8A 1VRWA 5TT1A 3RD5A 3WXBA 1WZIA 3KSDO 4M54A 4Z9YA 2DPGA 1CIVA 4D0RA 4U0JA 1VI2A 3E8XA 1HKUA 4JROA 4RDIA 4MJLA 4QQRA 2WSBA 4DMMA 3ROQA 4UVGA 4N7RA 4L4RA 3HNPA 1BMDA 1I01A 1L7DA 4E5KA 4DMLA 1LDYA 1BVUA 3U4CA 4JQCA 1B0AA 4MIYA 5T64A 1P44A 1YVEI 2BI8A 3ZGYA 4ALIA 1N8KA 2OORA 3PJDA 2OXIA 1IPEA 5ER9A 3WWYA 4B79A 3EVTA 2P91A 2HK8A 3GRPA 5C3MA 5CAEA 4JN6B 2IYOA 2O2YA 5CG1A 2FPGA 3RUFA 3JQAD 4XZ3A 5G0TA 5THQA 2FWMX 1F06A 3IMFA 1R0SA 3WTCA 3SX2A 5C37A 5CDGA 4JXKA 2VN8A 5ILGA 3ZWXA 4WNIA 1KC3A 5L4SA 3QIVA 4PG8A 3KEQA 1EE2A 4NPCA 3GF4A 3NJ4A 1E77A 5T57A 3ZHYA 2YYYA 3K6JA 2FR0A 4QUKA 2CF6A 3C7DB 1DAPA 3PHGA 2VHVA 1XQ1A 2R2GA 2X9VA 3NTRA 3GOHA 2X22A 1LRKA 4OAQA 1H93A 3NDJA 4FPXA 4ZQEA 1DHTA 2DVMA 1I3NA 4A5OA 2XF8A 3JD4A 4J1QA 2EV9A 4UUNA 2OUIA 2HMWA 4PG4A 4WECA 2Q4EA 3RUAA 3PRJA 1E7SA 1Y81A 3AM4A 4YJHB 2EKQA 5JSFA 5DNAA 3JQ8B 4K1LA 1Q2XA 2Z5LA 3OEWA 4WEOA 1ZZEA 3BMCA 4BKRA 4NJMA 1GQYA 3ETGA 2PA3A 3U62A 4EUEA 2P5UA 1T4BA 3KTDA 1KETA 2GZ1A 1NHWA 5FF9A 1HZJA 5DOZA 4MVJM 2VWQA 5U9CA 4YCAA 4YEDA 5TC4A 3RIHA 3L9XA 3UICA 2I76A 4NJOA 1YE3A 2Q45A 2DT5A 3W6UA 3EHEA 2JAHA 4YBZA 1XQ6A 1AN9A 3IJPA 1P77A 4CMJA 5GZ1A 4PLCA 1ONNA 2WM3A 1U5CA 2X9GA 3CXRA 4CM5A 1NNUA 1YJQA 1XELA 3HE3A 2OHXA 2Y0CA 3LZ6A 3U09A 1PEDA 2DBVO 3GG2A 3GVIA 4DA9A 2R6JA 4N5NA 1PGNA 1WDKA 3RUIA 3VAZA 3TN7A 4A0SA 2X4GA 3KEOA 4E5YA 4ONEA 1ZKMA 2OFPA 3R6DA 5A5FA 1MLDA 3CKYA 1FK8A 2I3AA 5AOVA 1N1GA 3DBLA 3KYCB 1PQWA 4UVDA 3U3XA 1U3VA 2C20A 2H5LA 4J2HA 3I9NA 3WGHA 3W1VA 1LJ8A 2WD8A 2B69A 3PIDA 4FB5A 4E13A 4FGWA 1YKFA 3RJ5A 5CDSA 4D79A 1D7OA 4XWYA 3WS7A 1I2CA 1O8CA 2O4UX 1TT5A 3OJLA 2FPIA 3V2GA 3OQ1A 4J7UA 3TOZA 5DBIA 3FNHA 1K2WA 4BVAA 3AOGA 2CVZA 3WWZA 1H5QA 3PWZA 5KJCA 4ALJA 3PK0A 1LA2A 1UZLA 1I10A 2EP7A 5MDHA 4KDFA 2X0NA 4X54A 5J23A 4RVSA 4Q3CA 1R15A 4HWKA 2YDXA 4OHUA 1NX6A 1WZEA 4BNZA 2P4HX 2B4QA 4BNFA 3G79A 4XCVA 3V8BA 3HQ4O 2O3UA 2C5AA 2HCTA 4II3A 1I33A 4IDCA 3WMXA 4WGGA 1WDMA 2R00C 4IJKA 3ROKA 2VUSA 1XEAA 2FSSA 4L73A 4WUVA 4BNVA 1GYQA 1HETA 1E3EA 1RM4A 1KERA 3RC9A 4IDGA 2O48X 3LT0A 3E5MA 3TDKA 4OOFA 2Y67A 3P2OA 4LRSB 1C14A 1GL3A 3ICCA 1WVGA 4OQYA 2XAAA 4DBVO 3ZN2A 4GGOA 1YL6A 4IS2A 3V1YA 4WLEA 1QV6A 2BFMA 3DHEA 4LCEA 1EUDA 3R3JA 1NASA 2P68A 3BMCB 5KJFA 5H81A 4JJGA 4NJMB 5L3ZA 2YZ7A 3GHYA 1PL8A 3W6ZA 1W8DA 2WDZA 3B1KA 5JY6A 4RZHA 5JO0A 4XD2A 5IJZA 4HFRA 5LDGA 5CDYA 3JQ7A 3VDQA 1NVGA 4IM7A 3OBBA 1PX0A 1EDZA 3BA1A 3F47A 1D3AA 4W7IA 3F4LA 1E1LA 3DBHA 1YS4A 1DIAA 4H16A 4YT8A 1HE4A 3WGZA 5A3JA 2C07A 1UH5A 1SEVA 2Q2QA 4WNCA 4FQ8A 1R0KA 2IEBA 5KVQA 4DVJA 4TKMA 4CQMA 2RIRA 1BSVA 3QY9A 4RGBA 4DC1A 2C7VA 2YHUA 2HMTA 4TSKA 3T7EA 4AG3A 3TFOA 3LC2O 2ZK7A 4B3HA 2Y1CA 3JD2A 3VPHA 4HP8A 3DBLB 4Z0TA 3I9JA 1FDUA 4DPKA 3VDRA 3K8ZA 5AXCA 4EJ0A 3DXFA 1V6AA 3D64A 4UEJA 2W2LA 3AUSA 3NRCA 1HXHA 4BB5A 4I5FA 5COBA 1T2FA 4BMSA 5AXBA 4IZIA 3WYEA 3EDMA 3PWSA 3ZWNA 1B8UA 4FOSA 1TT5B 3BMQA 3HN2A 3B1JA 2NU8A 2VZ8A 3MOIA 1E7QA 4D41A 1A9YA 1CEQA 1N1EA 4R3WA 3DAPA 3WMWA 5JPIA 2ZTLA 3OETA 3DWFA 4YJGB 4YJFA 5JAZA 3LT1A 3ZI0A 4NI5A 4XRGA 3GFGA 3TF5A 1B3BA 3ADOA 1U7HA 1KIFA 3IKVA 4OYRA 2VUTA 3IJRA 5AXDA 3BXXA 1G0OA 1NHGA 5TQVA 2H9IA 4I5GA 4XQCA 3WQSB 5A9RA 4R1SA 5U1PA 1X7DA 1XYGA 3JYPA 4PLGA 3FPCA 5KJEA 1VL6A 1SAYA 3GVHA 1PL7A 4ALLA 3KO8A 3UCXA 1ARZA 1H6DA 3LT4A 3P7MA 3TZCA 4BO1A 2EG9A 3DTTA 4NU6A 1K3TA 4GX2A 4AJIA 1ZSVA 3K2EA 1VJ1A 4NG5A 3TOXA 1FF9A 4Y6PA 4NMHA 1Z6ZA 3ETDA 4YYZA 3HDYA 3B20A 3FR7A 1UP7A 5F5NA 4LRTB 2A9FA 3K73O 1MFPA 3WSVA 1CQJA 4ZGWA 3I52A 1YL7A 4L0QA 5G4KA 1HF3A 1LSOA 3VZQA 2DAPA 3TJRA 2C0CA 4S1VA 2GLXA 2BD0A 2PWZA 3ONEA 1HYHA 4TWRA 2O23A 4HUJA 5THKA 4PRKA 3I9LA 5G4LA 2B37A 3FN4A 3GEMA 2PD6A 2Q1SA 4HFJA 2DM6A 3W8FA 4WCFC 2FSVA 1PJTA 3CE6A 4TQGA 4Z0HO 4BGEA 4ZVVA 4BGIA 2EW2A 3QVSA 4ZRMA 2A35A 2O3TA 2X1HA 3H9JA 3INRA 4RPHA 1XU7A 3BAZA 1ULSA 1LLDA 5CG2A 3DDNA 2BFOA 4Z3KA 3JTMA 3JQ7B 1BVRA 3U9LA 1DAOA 1BG6A 3ZV3A 1K6XA 5CEJA 4DTIA 8ADHA 2Z1NA 3DBHB 2FN7A 1PR9A 4J1NA 1BRMA 4GI2A 2J3JA 4FOOA 5I8ZA 3UF0A 4Y6RA 1E3SA 3SXPA 2QYSA 4IS3A 4OQZA 4CQMB 2GYYA 1D4FA 4MVJA 4EYEA 2Y1OA 1DRWA 2NUAA 3ETEA 3ZWCA 4BV9A 5GMOA 4DXHA 1CYDA 3JQ6A 2GRAA 1X0XA 3GK3A 2B35A 3M2TA 2NWQA 1E5LA 4R01A 2P9CA 2XOXA 3QHAA 1XDWA 1YDWA 4NBRA 3WJAA 3PVZA 1VSUA 1EBUA 4BNWA 4JGBA 4MVJP 1ZK2A 3PP8A 4B3JA 2PNFA 3ABIA 3ONFA 1F8FA 3UGKA 5L4LA 4DIOA 5TNXA 1EVYA 4J6FA 4WJZA 3RKRA 4IPTA 4G2NA 4Q3NA 4PZEA 4IQGA 4GAEA 3BMQB 2YV1A 4XIJA 3TL3A 2Z1MA 2NVWA 2V6GA 4ND4A 5KVSA 3I4CA 4O6VA 3M2PA 3PHLA 5IDWA 5ENDA 3DZIA 1EUCA 3D4NA 1L7EA 5CP8A 1RM5A 4YJFB 2RH8A 3D5QA 3H9UA 1MP0A 4J1TA 2BGKA 1IY8A 1R4MA 1UUFA 3GN2A 1IHYA 4J0EA 3IP1A 4WLNA 2D59A 1I3MA 1KY5A 3JQAB 2NVUA 5CEFA 5KJ1A 3OA2A 2PH3A 5I7FA 4BGUA 3L6EA 3LU1A 3I9OA 3M6IA 1K6JA 1Y9AA 1EZ4A 2QRLA 4N5LA 3W4IA 3UHAA 2Y05A 3EGOA 5JC1A 1UP4A 3IAHA 1GPDG 3VH2A 4FFPA 2DFDA 3A4VA 4KUEA 4NR0A 3RUHA 2C2XA 2Y66A 4HX5A 4BGVA 2LDXA 2VYVD 2XXJA 3RC1A 3C7CB 1CWUA 5G4KB 4FSHA 1UDCA 3AWDA 2NQTA 1FJHA 3GZNA 2B0JA 4WOKA 4PN3A 1P31A 1EK5A 2B4RO 1SPXA 2ZJ0A 4RF5A 4RCVA 3NGLA 3DEYX 3C8MA 3AM3A 2X6TA 3LVFO 3P5SA 4PLWA 5FEUA 5KVCA 5A9SA 3U5TA 1U3TA 2OBNA 1ZO8A 3OHSX 3UCEA 4CL3A 3QWBA 3GFBA 4U6SA 4R51A 4QTZA 3EAGA 3MJTA 3UAGA 1YQXA 3WBBA 3DHNA 5DF1A 4AFNA 4R1NA 3ZNOA 5IN5A 3VHRA 1EQ2A 2Y68A 4Z0PA 1U4OA 2ZYGA 1P1IA 2HO5A 3CTMA 2ZIZA 4UVHA 3VH1A 2RHCA 2Q2WA 2VQ3A 3OFSA 1LLQA 1IUKA 3LT2A 3WOHA 1DXYA 3GGGA 1JDJA 4AJLA 1BWSA 5LDHA 1T24A 1J5PA 5HM8A 2NACA 2OZPA 4BKOA 3HZZA 2VRCD 3ON5A 1QV7A 3RAJA 1NQTA 3FD8A 4Y9DA 2AMFA 3OSUA 1KC1A 1I30A 1FDVA 1XIVA 3GEDA 4PLVA 4CV2A 4EI2A 2UUOA 2PD3A 4KZPA 3EUWA 4WPGA 5I9NA 4ND1A 4CLHA 2I5PO 5JW6A 4NBTA 1UAYA 1NXQA 1P3DA 4RLSA 1KEVA 4WKGA 2EGHA 3CINA 4MKRA 4MKXA 1ZK3A 4C7JA 4NZ9A 1LQUA 2X5KO 1XLTA 2RHRA 5BNFA 1PL6A 1PJBA 3AFMA 3PZBA 5ICSA 1JKIA 1ZNQO 4NK4A 3BTSA 3FTPA 5TJ9A 4OH1A 2GASA 1LEHA 3S8MA 4G5HA 1GR0A 3ANNA 1AGNA 3PDJA 5I9LA 1PZHA 2CD9A 2I67A 2BKAA 3O26A 3TWOA 1I24A 1E1NA 3CMCO 4R1TA 5FWNA 2HMSA 4B8ZA 5TGDA 3VPXA 1T2EA 1R4MB 1P1HA 5BNIA 4W82A 3GLQA 1PS0A 1HRDA 3FSRA 1LTHR 5JE8A 2AEMA 2NVUB 3FNFA 1NAIA 1LUAA 4RF3A 2J8ZA 5A03A 3N7UA 1MGOA 2D2IA 4RQTA 1HTBA 1U4SA 2OOSA 3GHHA 4QO7A 4BNUA 4E2XA 2YHIA 5JO9A 4GX1A 2B36A 3RSHA 2AEJA 1WWKA 3LK7A 1XWFA 2HMVA 5L53A 2F1KA 5T67A 4MOWA 3DOCA 3NTQA 3WGOA 4PVDA 2E4AA 3GR6A 5KKAA 2Q1WA 3OEYA 2QHXA 4IMRA 4LSMA 1R0LA 4B4OA 1ZBQA 1NPTO 5JC8A 4DQVA 4DWVA 3D5TA 4RDHA 1P74A 3BTVA 4IDAA 1N5DA 4JX8A 4ZQGA 3GZNB 4CR6A 2QZZA 3QSGA 4K6CA 1NVTA 2EXXA 4IXWA 2O7QA 2EW8A 3MJEA 5A9SB 1X1TA 2IE0A 3ZU2A 2D8AA 4I8XA 4OIMA 1WW8A 4F6LA 4A2CA 4NK5A 5BSEA 3UH1A 3Q6IA 2IXBA 3CZMA 2UYYA 3IUSA 3ONDA 1Z75A 1MC5A 4IINA 4C4OA 1U8FO 4IBOA 1LLCA 4LMPA 4I1IA 1GCUA 2HRZA 3NT2A 3WNVA 3GDGA 4ROSA 1LSSA 4OXNA 3TZHA 3UW3A 4JP2A 4ALMA 4Z9FA 5L51A 2X58A 3QE3A 4BNXA 1BXKA 3E9QA 1E7RA 1X13A 3C3XA 1UJMA 3DFZA 4R68A 4XR9A 4DC0A 3CPSA 3E9MA 4I5EA 3FTNA 4E2ZA 2UAGA 3HB5X 3QWAA 5A3VA 4BKUA 1HYGA 3NGXA 2LDBA 2WD7A 5TRTA 2PK3A 3K9QO 1A9ZA 3PQEA 2C82A 3DC2A 4BL5A 1K0UA 1IPFA 4WCFA 1UXGA 4I9NA 1MV8A 2GR9A 5KIAA 4AJ4A 3FWZA 3R0IA 2VNSA 1VC2A 2X0JA 1ZFNA 1D8AA 5FI5A 1LC0A 4CM9D 3EW7A 1JN0A 1A71A 1X7HA 2I66A 5BSGA 1VE9A 3N74A 2DLDA 1RYEA 1V3VA 3O03A 1JKJA 4L8VA 1P1RA 1F14A 4YJDA 4KQWA 3ANMA 1F17A 2GGSA 4R9RA 4WLUA 3OQBA 4AICA 3SBOA 2NNLD 3D4PA 1E3IA 4CL8A 3WFJA 2Q50A 5C5IA 3RFVA 1LQTA 4QFCA 5DOVA 3GH3A 3DZJA 4IIUA 1ZEMA 5ICMA 4BNMA 1RM3A 3G17A 1V35A 2CDAA 4RV9A 5KTKA 3JQFC 1YQGA 3PWKA 2YDYA 1U1IA 3E48A 3F1KA 3VTFA 2Q49A 2EKLA 1DIRA 3KOUA 3O8QA 1GZ3A 4IMPA 1I32A 1VJ0A 3K30A 4XYLA 2HQ1A 2DBZA 4PZCA 3ROPA 4LMRA 1T2AA 3BMNA 2IRWA 3VPFA 1GQQA 1ENPA 2JD1A 2YHIB 3L6DA 3BTOA 3KSZO 1ADGA 4EJ6A 2C29D 2AQIA 3ITKA 3RFXA 2ZCVA 3S2GA 5DP2A 4HADA 1TT7A 2A4KA 1Q1NA 1YB1A 3DZKA 3D3EA 1P0CA 4BNLA 2PH5A 4N18A 2VYVA 2RAFA 4QO8A 4XYBA 3NAQA 4ZICA 5H82A 1U2GA 1GQ2A 2V6MA 1SB9A 4AL4A 3H5AA 3RUDA 2NTNA 3PYMA 1YQDA 1TI7A 4U6QA 3COSA 4TZTA 2DBRA 3OJFA 5TLSA 5KCZA 2BGLA 3MEQA 3GNQA 1Q7BA 4CMAA 3L4BA 2AQ8A 2P9EA 3GG9A 3K5PA 4W99A 4TROA 3PIIA 4WCDA 3F6YA 3ZZNA 1U5AA 1ZMOA 4EUFA 2I6TA 1KVRA 3PHJA 3Q9NA 3U0BA 3ULKA 4GBJA 2WYWA 1E6EA 1SMKA 4B4WA 2VOEA 2ZJ1A 4GMGA 4E2YA 4WOJA 2NU6A 1G6KA 3GVPA 4R41A 1NBOA 3O4RA 1XU9A 4R54A 1TXGA 4PZDA 3RFTA 3VH4A 2WD7B 1V3TA 1GUZA 4E33A 2VWPA 1J0XO 4L9RA 4YRDA 2PKQP 3JD0A 4WCFB 3WSWA 3VPGA 4FCCA 3ZWOA 5IG2A 1LSUA 2DTXA 3QVWA 4OMUA 3ZV5A 3D1LA 4FFMA 4IDBA 4TVBA 1NAHA 4P8RA 3BIOA 3FCOA 5FI3A 3QLJA 2EEZA 2QRJA 4YJGA 2JD2A 1ISIA 4UUMA 1H6AA 3MOGA 4PCVA 1Q0LA 4EW6A 1C0LA 3RWBA 3TFQA 1GTMA 2UV8A 4MIEA 5KVVA 5TX7A 3NDRA 4JJIA 2CVQA 5CDUA 2W2KA 2GSDA 3KBOA 2O50A 1NYTA 4KWHA 2H63A 4RL6A 4R69A 1LXCA 3WYCA 1J49A 2GNAA 4R1UA 2Y1DA 5A9TA 2CSUA 4NIMA 3D4OA 1TLTA 1Y7TA 3EMKA 3PEFA 2PZKA 3IOYA 2F00A 2EWMA 4U7WA 4PGFA 1GEGA 1SCUA 4YVFA 1H9AA 1GUYA 5AQ1A 3E6AA 4RPGA 1LRJA 1W73A 5JYDA 1Y1PA 2QG4A 5HRUA 3H5RA 1X1EA 1QR6A 1TEHA 3F5SA 4NBWA 1J4AA 2HJSA 1IZ9A 2YFQA 3H2SA 4O63O 1WPQA 4N5MA 5K6AC 1VPDA 1RPNA 3WGQA 1B8VA 3O8QB 3Q11A 3RUCA 3Q3CA 3RBXA 2SCUA 3TZQA 3F46A 4YA6A 3M1LA 1ZUD1 2O3QA 3BMNB 4L4XA 3WICA 2GD1O 4XR4A 1BXZA 4DYDA 1GPJA 1I3KA 2WTBA 2GN9A 1PR3A 4XEHA 4RF4A 1HE2A 2PZLA 1QG6A 1S6YA 1GV1A 2VWGA 4AJKA 1DC4A 3I83A 1NFRA 5JAQA 1XR3A 2RH4A 5IN4A 3HDJA 3WGYA 4U0KA 4KUHA 3ZWPA 1HYEA 1Z74A 3IUPA 2AE2A 3QRWA 5A5EA 3C7AA 3BHMA 4L4SA 4J9VA 2JFFA 5A4DA 2Y0DA 2VT2A 3LSYA 5HA5A 3DMYA 4PG6A 1M2WA 3Q1LA 3I4FA 2O2SA 2VWHA 2Y1GA 4IJVA 5BT9A 4CR7A 3MWEB 2YY7A 3DOOA 2EP5A 2QX7A 3KYBA 4I9HA 3RROA 2YQ4A 5EESA 4UVEA 5KNLA 1ADCA 4D42A 4KUGA 5GZ3A 3V1TC 3RCBA 1DBVO 2HAEA 4D46A 4NH4A 3ZV4A 1QLHA 3INTA 1UXHA 3I6QA 3JSAA 1C0KA 4YRBA 2CMDA 3OH8A 2ZB8A 1QYVA 4QFDA 2DBQA 4Q39A 1E7MA 4KMSA 2A94A 1P33A 3VH3A 3BMOA 3WYBA 1ZCJA 2O3JA 4K28A 3MTGA 3QP9A 1TVEA 1H9BA 1T26A 4EBFA 1J6UA 4HY3A 2X8LA 2X5OA 4A03A 4XYGA 2VHZA 1LI4A 1N7HA 5T5QA 1UDBA 1Y9EA 3PI7A 4IQ0A 1Y8QA 3KZVA 1KBZA 1W6UA 3FPLA 1MXFA 2UVDA 4KOAA 2G1UA 1GYRA 4QECA 2FY8A 2POQX 5EERA 4TMFA 2X23A 4IGEA 4XB2A 1KVTA 4EGFA 4CJXA 3NJ8A 4RVUA 5ENVA 3U49A 3VZRA 4CM9A 1GY8A 2JHGA 3V2UA 3E03A 2JKVA 1NPYA 3ZW9A 2QZ9A 3I9MA 2PR2A 3JQAA 1U7TA 3DMTC 2W2KB 4B7CA 3BHIA 1N7GA 1PZEA 3RC2A 3RASA 2DQ4A 2HUNA 4ILKA 4PLPA 2YFHA 4W9NC 4II2A 3TSCA 2GUGA 4RPLA 5DBFA 4BNIA 3NKLA 3JV7A 3V5NA 3AU8A 4TZKA 1NQAO 1ADBA 4J7XA 3RUEA 1HDGO 1R6DA 2JCVA 2FR1A 4K6FA 3ZHZA 1NM5A 4CMIA 1AXEA 4RJTA 3T4XA 1LC3A 4L76A 5K0ZA 5DCYA 4CV1A 5B12A 5F3RA 5ITWA 3F5QA 4ALKA 4MVJE 4J90A 5KKCA 2J6IA 1HDRA 4G81A 2DTEA 3A14A 1AE1A 1DIGA 4CR8A 5B4VA 3HHPA 5IXYA 3E9NA 3E18A 3JYLA 1IULA 4YPOA 4F46A 4BNNA 4GGPA 5CFZA 1IOLA 5IZCC 1SNYA 4GSLA 4CM8B 2CNBA 2JFGA 3FR8A 2NTJA 3LQFA 4E5MA 3VZPA 1PJ2A 1BHSA 1WMBA 5EQDA 3MZ0A 4J9UE 4BB6A 1R66A 9LDBA 3PXXA 3FHLA 3OECA 1OOEA 1R4NA 2UDPA 4Y98A 4CUJA 3QA9A 4E31A 3HDQA 3JQFA 4BO0A 4DLLA 3JD3A 1E3LA 1ISGA 1YXMA 1DC3A 2V65A 1HEUA 4DIBA 3L9WA 4IY1A 3ZU3A 3PDUA 1KS9A 4GX5A 4BQPA 2GN6A 4IIVA 1IYZA 4CM3A 1Z7BA 5DDIP 4CUZA 1ZMTA 3SC6A 5IXSA 4DLAA 5FFFA 3DL2A 3U4HA 1WNTA 4ZD6A 4D3FA 1Z73A 3H3JA 1UR5A 1YBAA 3H4VA 4GSKA 4LN1A 3VZSA 4HV4A 5C7LO 1U3UA 5I7EA 5BNTA 4J4TA 3D7LA 5F1OA 3FBGA 3O38A 3BZUA 2E48A 4WLFA 2NSDA 1EFLA 2V7PA 5H83A 1DOHA 3BMOB 3DZBA 3AY6A 3L77A 1I3LA 1T2CA 1XG5A 1M6WA 4TVOA 3RKUA 4BO6A 5KJ6A 3DZFA 4DGSA 4J4HA 2E82A 4CLEA 1Q0QA 2NTVA 3AUTA 2CFCA 1CERA 1D1TA 3F9IA 3F1LA 1S7CA 4HNGA 2OMEA 2FHSA 1LU9A 5BSHA 1Y8QB 5DZSA 5JDIA 1MX3A 4E0BA 3EC7A 4AJHA 4J2OA 1U3WA 4EEZA 3WJ7A 2P5YA 3SC4A 1JW9B 3A1NA 3HWRA 2HRBA 2J3KA 3LLVA 4FW8A 3I9KA 4XQGA 1QMGA 1KVQA 4UAGA 1ZW1A 3HSKA 2BFPA 3KRTA 2J3HA 1QYDA 1HSZA 1ZK1A 2FZWA 4DYVA 1BTOA 5EL0A 1BGVA 1PWZA 2GZ3A 3WR5A 4I08A 3JD1A 1BDBA 4ZJUA 3NYWA 5EINA 2Y1FA 4D7AA 5CPBA 1HLDA 3QW2A 3L4BC 3WG9A 2W8ZA 4DQUA 4CMIB 3VPSA 3A06A 1QYCA 3P2YA 2Q2VA 4CM4A 5JS6A 4FFOA 1DFIA 1CRWG 4CMBA 5A06A 4R5MA 5K9ZA 1RWBA 6LDHA 3RJ9A 4A26A 1P0FA 1IL0A 3GC6A 1N9GB 4BKQA 1PZFA 2TMDA 3O9ZA 1X14A 3ZWWA 4BNKA 3IC5A 5TIIA 1DJQA 4D0SA 1HDCA 1ZXLA 2W98A 4FGSA 5IAAA 4IGFA 2J5RA 1VKNA 3WIEA 4DIFA 1A27A 1Q7CA 2G76A 1X7GA 4XGNA 4QT0A 1YO6A 1C1XA 1JTVA 1ISMA 1CQIA 1GUFA 1TB4A 3PPIA 4BMVA 4YRAA 4RF2A 1I2ZA 2EHDA 4BNYA 2CF5A 2J5KA 4MPDA 2ZATA 1R4NB 2D5AA 4BNJA 1Q0HA 1I5RA 2HU2A 1P45A 4RZIA 3DBRA 5F1PA 4NFYA 1VLLA 4FC7A 2O7SA 4PRLA 5EJ2A 4NQZA 4ND2A 5K6AA 5C7OO 1WDLA 1NP3A 1ZVMA 4AJ1A 4HXYA 4ESOA 4QEDA 3K2BA 4PG5A 3GMSA 4XQ9A 3LC7O 1DIBA 2C7GA 3PHIA 5B37A 5MGBA 1WAMA 1Q7GA 1SZJG 3ASVA 4ND5A 4R3NA 5JFOA 3Q9UA 1OMOA 1QYWA 4FR5A 4JBGA 1KVSA 4CM7A 2HSDA 3E1KA 5DBGA 1C3VA 5KOIA 1X15A 2HMUA 2D5CA 3HUDA 2VZ0A 5EIOA 4OJNA 1KEWA 4WK6A 5A02A 4XGKA 2VZ9A 4DPMA 1UXJA 1A4IA 2TMGA 2AG8A 2ZKLA 3JCZA 4FFLA 4JBIA 7MDHA 4YAIA 1NWCA 4F6CA 1JWAB 4LVUA 1SB8A 1PJSA 5TJHA 1Y5MA 3VVCA 5IDXA 2NV6A 3MCVA 2FP4A 3ZU5A 4YDRA 3AU9A 4A73A 4GKVA 4MKZA 3IDSA 1UAGA 1WLYA 3GUYA 5IFLA 3GGOA 3ITDA 2AEFA 3TZ6A 1OFGA 1U2DA 3G1TA 3OA0A 5EMHA 1K5HA 2DKNA 2EKPA 4UUOA 1FDTA 3GNSA 3ZH2A 3UN1A 3WX0A 3SLGA 1RM0A 3QVTA 4IDDA 4O1MA 1PU2A 3MJCA 4KTVE 2IZZA 3GGPA 4Q9NA 1DFHA 5JMPA 1JA9A 1AHIA 1V8BA 5AVOA 1UXKA 3AI3A 2Q99A 1DFGA 4CV3A 3RU9A 2BRUA 2Q4BA 1U28A 3GZ4A 3LF1A 4FC6A 2BFAA 2VCYA 4KP7A 4BO9A 4ID9A 5JXWA 1U8XX 4M87A 1IB6A 4ZQHA 5FYDA 3WLFA 2JAPA 1W0CA 4EITA 3PLRA 3GVCA 1P1JA 1O95A 4TKLA 2OP1A 4GMFA 2EIHA 4FFNA 3W4KA 1HWYA 3PFFA 3VOSA 5G2OA 4CM4B 4D3DA 1ADFA 3GAZA 1KEUA 3WNQA 3DR3A 1E6UA 2OL4A 2OBYA 3GA0A 3FBTA 3QWIA 1B2LA 1OBFO 1JAXA 1DIHA 3C1TA 3DMTA 5L9AA 1K6IA 4UUPA 1UP6A 1V0JA 5G0SA 5L4NA 1QSGA 1E92A 2Y0EA 4W9NA 3S2FA 4CM1A 1QYXA 3I23A 1C1XB 2ZB7A 4B7XA 1XKQA 4G65A 4GWGA 1CF2O 3E5RA 3HFSA 5JDCC 2QIOA 3WGTA 1ID1A 1E3WA 3G0OA 3JQ9C 2BI7A 3JQGA 1KY4A 3SJUA 4HFMA 4XKJA 2AXQA 3DBRB 3LC1O 1FMCA 3JQEA 5T6BA 5JCJD 1PGOA 3HG7A 3STHA 1LDMA 2E37A 2OO5A 4R5HA 2ZCUA 1FXSA 3AUAA 3JYQA 4B4VA 2VTDA 3H2ZA 2AE1A 4MVJI 4NU5A 4XRRA 2X7HA 4GPD1 3MJ4A 1M67A 3LLSA 4YT4A 3S55A 2PGDA 5IZCA 2BELA 2PD4A 5JYEA 2YQ5A 1MB4A 3B70A 4R4JA 4NNJA 3ASUA 5KWEA 4CV0A 3FNEA 4XYEA 2O3RA 1ZSYA 4O5OA 1H2BA 2JL1A 1XHLA 2B5WA 3KLMX 1GV0A 3NT4A 4IQ8A 4OGWA 4MP6A 4PLYA 4BO4A 5AYVA 4BHTA 1YB4A 3KV3O 3H9GA 3HFGA 1PSDA 4RVDA 4XB1A 2W2LD 2I3GA 4RVGA 2FOIA 2WYUA 3H8VA 3MTJA 4INAA 3HB4X 3OJ0A 3WTBA 4M49A 1CDOA 1EDOA 1PQPA 2G17A 4CMCA 3ENKA 2IZ1A 4Z3DA 1GADO 4XJSA 1L1FA 1R12A 2DC1A 5LC1A 3G3EA 1T4DA 3UCFA 1DLIA 1E0DA 1KEPA 3HN7A 1AUPA 4GWKA 4IJWA 4TRJA 4XDYA 3L0DA 2RCYA 1Z7EA 4MP3A 4JCOA 2VUUA 3GT0A 1RJWA 1T25A 4E4YA 2I65A 1M66A 3DFUA 1WXDA 4M55A 3KLPX 1ORRA 1C0IA 4PLZA 5COAA 4FS3A 4E30A 2BF7A 3DBVO 2DUWA 3ZDFA 2WMDA 4B7UA 1A4UA 1E1KA 4LGVA 5CDTA 1GFSA 2AQKA 1XCBA 5DT9A 1LNQA 2WE8A 1F0YA 4HKTA 4BV8A 1JVSA 2YV2A 1DC5A 5JAIA 4BIIA 4Q3BA 3ZNQA 3IIEA 1OAAA 3VVBA 1DC6A 2AHRA 1HDOA 5ER6A 1Y5RA 2O4CA 4MVJF 4AJ2A 4P38A 3AUUA 3RVDA 3L07A 2C5EA 4XGIA 1A72A 3UOGA 2WJPA 1O94A 2BH9A 1LLUA 3BHJA 3PLNA 4J4BA 1P1FA 3JQDA 2XXBA 4OXKA 3NX4A 1PWXA 3ZHXA 3PGXA 3DONA 4ZHSA 1MA0A 4H7PA 3AI1A 5JDIC 4TRRA 4BO8A 5I8WA 2I99A 5CEEA 4CODB 2NADA 5JLAA 3L6OO 4CLXA 1RYDA 3C1AA 1MG0A 1PJCA 1BW9B 2J5QA 5HTOA 4IUYA 2G82A 4PLTA 4LSWA 1ZJZA 2GPTA 4IJUA 1LDNA 2HDHA 1E3WB 3JQGB 4PIVA 4F45A 1M76A 2EF1A 4OO3A 3GY0A 3KSUA 2FR8A 2FZEA 4RLHA 3ORFA 1PIWA 3G1UA 1Y8RA 3CSDA 3WQRA 4CMHA 4E12A 4YT2A 2NQ8A 4RVFA 3RC7A 1A7AA 2NU7A 5F1KA 3SLKA 3D0OA 1DB3A 2DUUA 2HKIA 2C59A 3C1OA 2GN8A 2Q1TA 1LSJA 4MVJD 5HBRA 2X5JO 1GU7A 2VRCA 3QWHA 3W4JA 4FBGA 4F3YA 4O59O 2IEDA 4ZQFA 1UXIA 5T8KA 1JLLA 1E6WA 1VL8A 2X0IA 3AOEA 2IYPA 2QW8A 1GZ4A 2D3TA 2NM0A 1FDWA 3OM9A 3TRIA 4GL4A 2VHWA 4B4UA 4N54A 4GKBA 1LBEA 1ENZA 4ZN6A 3MWDB 2VRBA 5L95A 1T1SA 3GAFA 1GD1O 2Y1EA 3CMMA 2HLPA 4IZHA 4WLVA 3C24A 1ISFA 4MDHA 3RBVA 3EVNA 4FFRA 5L40A 2V6FA 4YT5A 5TS3A 1O5IA 2OP0A 4OSOA 4P4NA 4S3MA 4B3IA 2EERA 4XDZA 3I5MA 5G0VA 4YQYA 1UZMA 2ZQZA 4KDEA 1GDHA 3ENNA 1YJ8A 3E82A 2AW5A 4U5QA 4AJEA 4IXTA 4YTEA 4JJFA 2GO1A 3LDHA 3NT5A 4E5PA 1KOLA 4YB8A 2PZJA 4YAJA 3HDHA 3T7CA 1B14A 1WP4A 3CZRA 1H0KA 3K96A 1DO8A 1HDYA 2VT3A 4RPKA 3TNLA 3U4DA 2G0TA 4ZU3A 5U4QA 4M8SA 3SJ7A 3LYLA 1NPDA 4CMGA 1R37A 2DFVA 4PLHA 5DCWA 3B6ZA 3VTZA 1PZGA 4J1SA 1QXSA 3WLEA 4CM8A 3LF2A 1E1MA 4H3VA 5EN4A 2Y93A 4UREA 4DREA 4I9UA 1N92A 4W6ZA 4CMEC 3KYDA 1NFQA 4A27A 1PGQA 3GN1A 2FMUA 5G0WA 5A1TA 3CH6A 4CM6A 3H6KA 3Q0EA 3WDSA 3I3OA 1MFZA 1DPGA 1FDSA 3DZHA 3F4BA 2EJVA 1JQBA 1I0ZA 2OGUA 2X0RA 3T4EA 1VKOA 3OQ6A 4OKIA 5IZ4A 2DPHA 1VJTA 3NEPX 5GY7A 1H94A 3WQQA 1IZ0A 1PJLA 1F12A 1ENYA 2C54A 1C0PA 4M86A 4E2WA 1ONOA 3K92A 3PJFA 3WGIA 4PVCA 1YH3A 1XSEA 4YR9A 4YAGA 2IDZA 7ADHA 2PGJA 3GPIA 1RKXA 2X9NA 5B4UA 3IP3A 3S1LA 4E5NA 4I5DA 1DDOA 2HK9A 2ZYDA 4E3ZA 4DQXA 1V9LA 2IXAA 1G0NA 1EVZA 1EE9A 1Y8RB 1HSOA 4Y67A 5JCJA 2FPPA 2ZTUA 5COQA 4LCJA 1MC4A 4EEXA 3MJSA 1IE3A 3OIGA 4CLOA 2P9GA 5IDQA 3UFXA 4YXFA 1EVIA 3AK4A 2GCGA 1GYPA 1O9BA 3M1AA 4BO2A 3AY7A 3JQBC 4J3FA 2ZTVA 3W8DA 2PKQO 4DRYA 3PJGA 1DLJA 3RU7A 1GZ6A 1P9LA 4CQLA 1XA0A 4NBVA 4FN4A 3H9QA 3H3FA 5JDCA 3FF4A 1B16A 2RBEA 3CIFA 4P4GA 1HDZA 3R1IA 3ZNNA 1SOWA 2VHYA 3JQ9A 3KB6A 3IQDB 4TRMA 2NLOA 4RO0A 4RQUA 3TL2A 4EUHA 3L4SO 4YAKA 2P4QA 2X86A 5L7TA 2V6BA 3PFWO 3GMDA 4HBGA 4Z9XA 1F8GA 2B83A 4YAEA 4DPLA 1ZJYA 2EGGA 1H2HA 2NU9A 4OXYA 4CUKA 2PFGA 4O0LA 4R9SA 1JWBB 3AM5A 1YDEA 1ML3A 3B1FA 2CUKA 3BYZA 1MG5A 4P4LA 2VYND 2Q46A 3FI9A 2CVOA 1OC2A 4KWIA 2PY6A 3QVXA 4L75A 4ND3A 3PHHA 4QSMA 2Z95A 2ET6A 2BLLA 2AG5A 3FWNA 4GLLA 3X2EA 4E32A 1K89A 1N9GA 3INGA 1DRUA 2B5VA 4MIOA 1ZK0A 1NR1A 1DJNA 4DLBA 3UUWA 3JYNA 3MJVA 2WYVA 4FJ1A 3KYDB 1O89A 1VL0A 1HDXA 4JK3A 1B3RA 1SEPA 2WE7A 4MP8A 4FJ2A 3ANLA 3U4IA 4AJPA 1OC4A 1OI7A 2B4TO 4J16A 2CDCA 1OZAA 4LISA 3EZLA 1I8TA 4PLFA 1AXGA 4BNGA 4Y8VA 3KM0A 1LRLA 4D43A 5G0UA 3RQSA 2GN4A 3DOJA 4FD3A 4IDFA 1ENOA 1EEHA 1KYQA 1NR7A 3EK2A 3R3SA 1H6BA 5JNLA 1HE5A 2VTEA 4JBHA 1P1KA 2Y99A 4W4TA 2CY0A 5I9MA 1MUUA 2ZTMA 5TSDA 2BMAA 2GERA 3NV9A 4GX0A 5GZ6A 3WFIA 4EDFA 1E5QA 1JKFA 3P19A 4ZRNA 3OJEA 5B4TA 2ZB3A 4ZQBA 4EJMA 4Z6KA 3CUKA 3VC7A 4LK3A 5DP1A 3D3WA 3GDOA 2CDBA 4MINA 4AJNA 1JVBA 5IF3A 2WWRA 4BNHA 5B1YA 4ITUA 2PV7A 4CLOB 1YOVA 4XIYA 4OM8A 1M6HA 1R16A 2E49A 3UXYA 1HZZA 2VOJA 1LX6A 3GRKA 4JNKA 2HJRA 4LVCA 2Q1UA 5CHEA 1ZXBA 4JP3A 1HE3A 1NQ5A 1UZNA 1NFFA 2IZ0A 3DZGA 3NUGA 3ST7A 4CQLB 5I7SA 4OSPA 3EYWA 3ZCXA 1DSSG 1BXGA 1MXHA 1ISHA 4XA8A 3PGJA 3KXDA 3W8EA 4BS9A 3IKTA 1HT0A 5DULA 4W7HA 1NTOA 4UVIA 1X0VA 1Y6JA 2O3SA 3IS3A 4BKPA 1ZEJA
chains in the Genus database with same CATH superfamily
5HS6A 1E0AA 4FFBA 5H20A 5ENZA 3BRQA 3TW8A 2XROA 4E21A 1PHRA 5IKPA 2JJMA 3OP4A 1GUBA 4D44A 4R2LA 4RPIA 1MHPA 3UBMA 3R0VA 4WBNA 5CVVA 5DUIA 2OVFA 3R8XA 4H1WA 2NO4A 3WB9A 1F4VA 2OD7A 1A36A 4ZI2A 2ZRPA 4DJ5X 4J91A 3HKCA 2ANBA 2XRLA 3B8EA 3HVRA 4R8VA 3RB8A 2IEGA 1UDAA 2GYVA 5MN4A 1UBFA 3UK6A 2ALJA 2P5KA 4C7KA 5KKNB 2MU1A 3H5NA 4CDRA 4YJ3F 4I1RA 2OD2A 2RSLA 4LE2A 4HDSB 4Y6SA 4BOYA 2P4WA 3IXQA 4D25A 2BEUB 2RH5A 3RC8A 3BDVA 5D86A 4UFOA 2HL6A 3FBNB 2FOWA 1VPLA 3DQPA 4UM9B 1VMDA 1NBWB 2DA4A 2VP4A 5ES3A 3NONA 5L7WA 2JJYA 2CE2X 3KKEA 3OC6A 2Y1WA 3ZWMA 4XX0B 1UM9A 3DFIA 3UWKA 1JAYA 4M83A 3OF2A 1EFHA 1IHXA 2XBLA 1EUQA 4GYKA 3AL3A 4BQFA 1EMDA 1CRPA 1VQ8I 5AD1A 3LCVB 1ZI9A 1JR4A 4S12A 1I3OA 5I9IA 3W79A 1SXJC 3CZ4A 3LJKA 1Z08A 1W88B 1R9JA 1WZNA 5CJ2A 1T2VA 4XYMA 3V7WA 2WKSA 3WGKA 2O8BB 2FE1A 2WJ6A 5AXAA 2A92A 2MIIA 2AA3A 4DBZA 4BMNA 3KVOA 3UFBA 3DHWC 4KRXA 1X74A 2PR7A 1T4CA 1F5SA 2QRHA 3DLIA 2RE8A 2DECA 3ER9A 4WY8A 2A9PA 4N40A 2RHDA 4CG0A 4KG7A 3FNGA 1V5GA 2JKZA 5H9WA 3AFHA 4U0JA 1R0CA 3EJ6A 3I4NJ 4DMMA 1KO1A 4LHZA 3HNPA 3R7DA 3U4CA 1YVEI 2OORA 2R8OA 1H42A 2VSYA 3MBOA 3VR2D 1W9HA 1DT3A 4WGFA 3WP0A 4XZ3A 3W2IA 2FWMX 3T4PA 3KXPA 1NUQA 5ILGA 3ZWXA 4KIFA 4BNCA 4GDFA 1UDXA 1KC3A 2LRDA 3BF7A 4N5HX 2KPMA 2I7XA 5T57A 3K6JA 4Q7JB 3Q0VA 2H2AA 2X9VA 1HOXA 1KJNA 4S04A 1I6XA 1RHJA 1OPCA 4J1QA 4WT7A 1QTQA 2Q4EA 1T5BA 2EILH 2OHIA 2VJ4A 4M71A 2JPDA 3K9HA 4JUIA 1KA9H 4BKRA 1SBIA 3PTAA 3DLPX 4RJ2A 5E1WA 3OD1A 3UICA 2JAHA 2BEWB 1AN9A 5DMHA 2OK8A 3CVJA 2ODQA 4BL0B 4CM5A 1YJQA 2K85A 2WWHA 3BKWA 4JX6A 2M2IA 2D7DA 2XQGA 3MCUA 4G56A 4A0SA 3LKBA 3KEOA 2X4GA 1E18A 2REXB 3A4LA 2P9FA 2LYCA 1BOAA 2AXLA 1K5GA 4D79A 3WU1B 4JI8B 2DPDA 2CEKA 1O8CA 3ZK7A 1JG2A 4EY8A 1YGPA 8ATCA 5IANA 3GLGA 3JVUA 1DS6A 4ZQIA 1TAHA 5ALJA 2EFQA 2Q8QA 3ZDRA 3KWLA 3KUDA 2ZNYA 2G71A 4WGGA 1KQOA 2JA2A 2PBRA 1IUFA 5JI6A 4WN3A 5AI6A 2Y67A 3NASA 3ZN2A 4KACA 1PYVA 1QOPB 2LMDA 2Y27A 1H2AS 5JVDB 3UHPA 1PK9A 1Y0UA 1MB3A 4FSDA 4AXXA 1KZYC 1D3AA 4W7IA 1RPWA 4YIIA 3NOXA 4N8DA 3HVJA 1UMBA 1GIAA 5LA6B 5I01A 3C5EA 3G8AA 3LX4A 4YRTA 2QTWB 5KVQA 2K4BA 2WWGA 3HU5A 3Q85A 3LC2O 2ZK7A 3LP5A 1WQ4A 5EIEA 3AFIA 4UE3S 1YKSA 1U31A 3DXFA 1XAHA 1HXHA 3CLSC 1UK9A 4P53A 1A9YA 2ZFWA 2BFEA 2QE7D 4I2NA 1TZJA 2PMKA 2V0GA 1J5EB 1U7HA 3CC7I 2ZBFA 3OIYA 4RS8A 4MVXA 3KO8A 4X1OA 3UCXA 3ABSB 1VKRA 1K3TA 4MR9A 4RUKA 2R1VA 5BQPA 3F78A 1Q0SA 2YFYA 4GUAA 5JISA 1T5DX 4QQKA 1P17A 2X42A 1P61B 2IP1A 3U7JA 5EE9A 3T8YA 3K5IA 4QODA 1DQRA 4KR0A 3KCQA 3ZX5A 4OIFA 1Z7LA 2ZJ4A 3BAZA 1XU4A 1RP1A 4F52A 3EBLA 3CG4A 1KAHA 2B2NA 1C7IA 4RTSA 2FA5A 4OK6A 4A23A 4EM1A 4MEJA 4OQZA 2JGDB 2ZIWB 4UNOA 1N36B 1KZ7B 2VBZA 4Q9KA 2GRAA 2NWQA 3H4IA 1YDWA 2IYEA 1V2HE 3KT0A 3N0TA 1KPHA 4YJ2F 1ZUHA 1EVYA 1HR0B 4PZEA 1ZK8A 4ERNA 5JASA 3I2IA 2ZRQA 1RE1A 3AG5A 2DO7A 5KWSA 1X8LA 2HOAA 4RADA 2ORED 1G3SA 3ML6A 2J32A 1SCQA 3TM5A 4N76A 2NVTJ 3ZDEA 4Z3OA 2QRLA 3W4IA 5LBTA 5HM6A 1JSRA 2JFUA 1YTYA 3WNZA 1AKNA 1KO4A 1W5AA 2B30A 1VLMA 2VL7A 3RC1A 2QM7A 3R4CA 2XGMA 3GZNA 4AZ0B 2REQB 1H66A 2F43A 3P5SA 3K70B 3RV4A 4CKCA 3U5TA 4EYKA 4UU0A 4U6SA 1J0RA 1S2LA 3OCWA 4QTZA 3ZNOA 1U4OA 4HDRA 4V03A 1JHPA 1Z05A 4JJ8A 3T9FA 4QUEA 1SG6A 2Z30A 3ASNH 4CKEB 1LB2A 2YC4C 1Q3HA 2LR8A 4N0PA 4KLCA 1QFXA 2IELA 3L5OA 2X6QA 4I7EA 5JW6A 4EK9A 1LK0A 4D8VA 2EGHA 2Q9AA 4X84A 3QMWA 4GC9A 3H86A 3RH0A 3B78A 1IV6A 4LOLA 4OH1A 2AFIB 4YX9A 3IHWA 4ZCTA 2QRMA 1PZHA 1EUCB 2MTBA 2NPOA 1H69A 4K86A 4WK0B 4OEHA 1U4SA 4CTJA 3LX5A 4GX1A 2DPLA 1MO6A 1NI4B 3L2QA 4MOWA 4XCQA 3FXUA 1JDPA 2JGLA 3C5WP 3WK7A 3S1RJ 1PG0A 3EQ7A 3NHRA 5JPDA 5IP9J 5GONF 5KX5A 2HKOA 4F6LA 4O6JA 1T38A 3PF9A 3BD8A 2SBTA 4Q1FA 1MC5A 1FOXA 5C8YF 3C98A 2PQ0A 3RS4A 5IK2A 4NE2A 1OW3B 4ZAXA 1Z2OX 1MQ9A 4LD5A 3TS1A 1D09A 1PVEA 5PGMA 3OE4A 1H65A 4DY6A 2OKGA 2EFOA 2IHKA 2LSOA 1K6EA 3HCBA 2QN9A 4ZEOA 3AB3A 3QU3A 2AX3A 1ZOIA 1US8A 3R0IA 3CC2I 2X0JA 5KYXA 2KMLA 3GW8A 1K4MA 1AHDP 4YRIA 2XHZA 4E5VA 2EBFX 2ZXEA 3PJRA 3D4PA 4PFPA 1M8JA 5LBIA 5C5IA 2PT9A 2VJIA 3OPYA 3HDVA 2A7QA 4PHCA 3KOUA 1EFVA 2YX4A 1GNRA 1GAJA 3R7AA 3NNSA 4L95C 4CCNA 1BMFD 4W1QA 3O90A 4OGKA 3RFXA 4PYOA 5DH9A 3GFIA 4IDOA 3KQVA 1CULC 4ZK2A 4BNLA 1YAJA 2QTMA 4Z4FA 2I2CA 2NO7A 1OU4A 4DV7B 5J1RA 3L1HA 2R7FA 4PHFA 3ZHCA 3LCMA 1MNEA 2P9TA 3F6YA 3A9SA 1YR8A 3RAEC 3BWCA 4B87A 3D0QA 1RQPA 4B4WA 1EI9A 4TTTS 4MR8A 1C7EA 1CRQA 1FSHA 2R8PA 1JH9A 1V3TA 1HF0A 2NUPB 4R2WA 2K87A 4WCFB 1DP7P 2GVNA 1LSUA 4IHTA 2HA0A 1SQGA 3PXAA 4XMYA 1NAHA 3QFRA 2W85A 1E9SA 2G04A 3QLJA 3VYUB 2QJWA 3K0KA 5J2TB 2G25A 4F38A 2IRFG 5EJ6A 5M3BA 4Q3OA 1D2GA 2ZCWA 1L7QA 2HB6A 3PEFA 4TZ6A 2JATA 4NX2A 4BN0A 5IRCD 1W0TA 3ECSA 5EAIA 3VR4H 1AO3A 3TDZC 2BP7A 3RUCA 1YOBA 3WLQA 2PO5A 2WTBA 5IAKA 4YLYA 1QG6A 1SURA 1TTTA 4RHYA 5DLQC 5A5EA 1NBME 2ONZA 5JMOA 4L4SA 4D1QA 3JQQA 2Z2IA 3L7CA 3GMIA 3RNLA 4QBFA 2YQ4A 4D42A 1IDZA 3T12A 2QSFX 1U90A 2FFJA 2I2FA 1D4ZA 3Q3VA 3VH3A 2ZYRA 1ZCJA 4JP1A 2BRUC 1JUDA 3V8RA 4X9XA 4B1RA 1H9BA 2G28A 4F5DA 1QH0A 1QK5A 2ZZKA 2BI4A 3AEXA 1U8YA 2G1UA 3PA8A 1B1BA 4EJWA 2VK1A 1NVVR 3QXCA 1RI7A 1GY8A 2JHGA 4BLUA 2HUPA 4TYYA 3JQAA 3JTHA 1XRJA 2ZU0C 3RRXA 2NV0A 3RC2A 5A0FA 2JVGA 2YFHA 4LIVA 2P3QA 1L7VC 4D4LA 1KONA 4HI0E 3RIMA 4N03A 2GTPA 1UAAA 4XOUA 4EHLA 2I1QA 3ANYB 3MELA 5F3RA 3M6VA 5IC4A 2LBFA 3RKXA 4FMCB 4Y7NJ 1XTZA 4DR4B 4G81A 5KB3A 5CT8A 1FXUA 3OIPA 2Z2SB 4B6GA 4JP8A 3EGEA 2NMVA 1KORA 2XCRB 5IVKA 3DQQA 1BHSA 4Q1AA 1NLFA 2R5ZB 3QA9A 3E3LA 1TM1E 3L9WA 4BQPA 2H08A 4D5FA 4FISA 3GYHX 2EJTA 4J03A 1DCFA 3P2EA 4Q1VA 4ZD6A 2H1IA 3H4VA 3K71B 4HV4A 1VZ0A 2ZNZA 3ER6A 3GT3A 3ND7A 2DX7A 5E6SB 2HF7A 1ODCA 4YIKA 4RKRA 3L77A 5JZVA 2EA2A 2PGNA 1ZD8A 2W2PA 3FCXA 1CERA 2NZXA 1X7XA 3W5HA 2W42A 3BA6A 4AU1A 3SHTA 4WXPA 2ZTSA 4EKYA 3HWRA 4IIJF 3GLIE 4FW8A 2HQSA 1YRYE 2EQRA 2GXUA 1ZW1A 1ZR2A 3U7HB 2AK3A 3KEFA 1F6WA 5CB4A 5B6IA 4U6NA 3EA4A 4GWLA 4K03A 3X1ZA 1BI2A 5KNCA 4DMFA 3RJMA 1BOOA 4WESB 1S3SA 4QATA 4GXOA 1COZA 3WG9A 3EN0A 1B1AA 3ZQCA 2GLOA 1URPA 1ZS9A 3C3KA 4NOLA 3MGGA 3CG0A 2DWPA 4MICA 5AIQA 1VCMA 4IHQA 2IGKA 3IH2A 1C1XA 4U4AA 2KISA 4LDNA 4QYWA 4RMHA 3CVWA 1VLLA 4ND2A 5C7OO 4RDXA 1E1CA 4QEDA 3UT5A 2Q0XA 4QOFA 7YASA 5DE3A 4EVRA 5E1ZB 4V0LA 1H2XA 5B36A 5LXTA 1K63A 1H2RS 3H8SA 5C31A 3SC2A 4IZZA 2AMLA 3WXMA 2F90A 3O2PE 4YN3A 3SQOA 1SVNA 1IONA 5M5WJ 4CFZA 5LQRA 3OA0A 4HGQA 3ABTA 2VKDA 3VDNB 5K0GA 2XYGA 2M0MA 3PX2A 5FFXA 2REOA 3L7IA 3EGDA 1K3FA 4FC6A 2ZJ2A 4QOEA 4JENA 1KDVA 1O95A 5TQ0B 3S7TA 1VJRA 3WZ2A 2Z5GA 5TGZA 1CF4A 4CWAA 4HDUA 3KPHA 1OPRA 1IN1A 4XM1A 1ON1A 2RN7A 5BUQA 2R3SA 1UIRA 4FDLA 2WIFA 1DE0A 1Y63A 3VPDA 2G80A 1P2DA 4J29A 5KO2A 2J31A 3N2KA 4HMQA 3I37X 4QLAA 3HY4A 4D97A 1VQNI 1M5TA 3T1YB 4XRRA 3MJ4A 3S70A 4A3MJ 5JYEA 3AETB 4NNJA 1C4WA 3ASUA 1A1VA 5HF9A 4ZIRA 4XYEA 2ZUSA 3IB3A 3SQDA 1XGNA 3I8OA 1GV0A 1XD2A 5JFGA 1QYRA 4GNKA 3MWDA 2PA0A 5EJIA 1WG8A 3I2YX 3GTKJ 1X38A 3M8KA 2H6CA 1QVUA 1Y82A 1MNDA 1FS6A 2XUBA 4M4SA 4WN9B 5JALA 1V16A 1KDRA 3OJXA 2WF8A 2BBYA 2ODBA 4MP3A 4TVKA 4K87A 3KCCA 4POOA 4PC7A 3DFUA 1C0IA 4MV7A 4TWZA 3S99A 2ZJBA 5F04A 1GFSA 3P9QA 4X90A 4WXRA 2F1RA 5K4GA 4JV5B 4Q3BA 4MEBA 3U56A 1EV7A 2YWEA 4C89A 3HEAA 4UBIA 2ORYA 5IEJA 4NAVA 3G7SA 5T4HA 4H7PA 5AW9A 2HCFA 2TCTA 5I8WA 3HSEA 2HVQA 5CEEA 1UMCA 1U98A 4PIVA 5FPTA 6REQA 4HB3A 4RVFA 1Q7TA 3TTTA 3OEHA 3PFNA 1X1RA 3WMEA 4TTJA 4U9HS 3DVAB 1LPMA 4JITA 4WZ6A 1A5JA 2JIDA 2AHOA 4G0UA 3OM9A 1Z38A 2R8YA 4JL8A 5EVJA 2VHWA 3ETLA 5JATA 3GRRA 2OECA 2VDUE 3H92A 4L9AA 4FFRA 2P65A 1HI9A 2ZC2A 1RLIA 2AW5A 1I94B 1TBXA 1PR2A 1U9OA 3WIVA 3D43A 2LK2A 2CUZA 4ZU3A 3HP7A 2BZTA 2DMTA 3CCFA 2C84A 4FI3F 3DEZA 2CVFA 2IEAA 1I4OA 3EIOA 2Y93A 3KYDA 4A27A 2X0EA 1G7RA 3HCFA 1EVQA 5EGSA 3DZHA 2I7TA 4HZIA 2VJJA 3DCNA 4OQ4A 1PJLA 3K1ZA 1C0PA 4YR9A 4L18B 4M7PA 1CIJA 4ZTBA 1QH9A 2G7HA 4H2DA 1T0JB 1EVZA 1EE9A 4LJYA 5COQA 1DX4A 1MC4A 4R1LA 1V4VA 4DLPA 2P9GA 3UFXA 1XTRA 3W8DA 2Y8EA 3KJZA 4OMZA 1V8DA 4NBVA 1XCGB 1SD4A 1TK2A 5BV7A 1O87A 1WJ5A 5GPAA 4RO0A 4RQUA 1RLOA 2ZJFA 4NARA 3ONQA 2RC5A 4Z1OA 1GCIA 5EUQB 2PZBA 4OI2A 1UADA 4JJKA 3R23A 1EH5A 1ZVQA 1DQSA 1MG5A 3PQ7A 5HKLA 3DAYA 3QVXA 2NO0A 4GLLA 2YYZA 1SUSA 2I2WA 2QAJA 3UUWA 1IRZA 1WF6A 4UDOA 2JFWA 2RK4A 2B0CA 4GLJA 3R3YA 4ZVQA 3D7NA 4C6TB 1DWUA 3IP6A 5GWXA 1I8TA 2G6TA 5KYTA 1ZI8A 4XM0A 3RQSA 3SKVA 2PZGA 1HE5A 2V0CA 2DSNA 2FGKA 3I54A 3OZVA 4Q3LA 3TQQA 5C1PA 4M9CA 2EL7A 3HRUA 3HEMA 4ZQBA 3VC7A 1HKHA 1JXQA 4U2GA 4LGYA 2QXYA 5BO5A 1NYQA 4DYHA 2BN4A 5G1OA 4L9VA 1ZYUA 4CQLB 3IAXA 1X0VA 3FFXA 2YJNA 3TOVA 3QV1A 4WK8F 1W59A 2X5NA 1G21E 1ONPA 2NXEA 1N2CB 5EXPA 3IE2A 3WMGA 2GPJA 1YJ5A 3QFSA 3TFWA 2ZRGA 1BVYF 2ZYAA 3MAJA 3ZTTA 1JA0A 4GM0A 4PXYA 2EWWA 3OLVA 3N59A 4EZBA 1ACJA 4ALNA 4AJJA 2P5LC 2HEOA 3FYUB 1P5ZB 5EWMA 3GDFA 4PK4A 5FXMA 2QAGB 3AEYA 2P7VB 3HU2A 1ZIPA 4MXDA 3GLIA 3OZAA 4IHJB 1CEYA 1BC5A 3KK0A 4H15A 2VT7A 4I9GA 3COAC 1Z45A 2I4NA 3OOSA 4BE1A 3QPWA 4EMSA 3LKVA 2HIMA 4UXHA 2W24A 2O2GA 1M73E 1KMMA 5F7ZA 2AFHE 3I42A 5DXFA 1NZJA 1Q1ZA 1MJHA 4JLWA 1JECA 5K3FA 1GVJA 5IHPA 3AJ8A 1G19A 3PTZA 2JEOA 2W4QA 4V0ME 3B36A 1OR7C 4UEKA 4BRWA 1DDGA 3P27A 2XUKA 3CNQS 3E5HA 3ZLJA 3DDZX 3WTXC 4Y2HA 3EGVA 3ZEAA 9LDTA 3EEIA 4ZTUB 1GDDA 3CEAA 2GOYA 4KAJA 3X2FA 1U78A 1I2AA 5EWJB 2FUG6 5AK6A 1PT9A 1ZUIA 3JR3A 2ACJA 2OCKA 2HTEA 3VR6A 2AQHA 4J3NA 1NXPA 4G67A 2G63A 2ILTA 2UKDA 2QD2A 1CVIA 4MV8A 1E1QA 4MUYA 3UG7A 2DFEA 2PYIA 2QN2A 4B4KA 3I6IA 3PO2J 5BQFA 1I7SB 4YWJA 2DHEA 1GGNA 1R0YA 1KU9A 4TWAA 1N5KA 2I9PA 4QXMA 4J7CA 1L7XA 1HL3A 1GPLA 1PUFB 3G5AA 4P3YA 3L1UA 4Q7LA 8LDHA 3T7SA 1ZIDA 5BV1A 5F2NA 1J8FA 3HKEB 4AIJA 2D74A 4PYQA 3JALA 3RD5A 3ZIDA 2JA8J 1LB1B 5I4KA 1BR1A 2RGVA 3U31A 1EFUA 4EX6A 2C8VA 4MTEA 4DMLA 4D3ZA 1X1SA 4EQZA 2VQHA 2HRRA 2G09A 4FLFA 1KGSA 5B6PA 2VLAA 4O4JB 3O7WA 1KR2A 4Q3KA 4F1JA 4EPVA 4AIDA 4AMVA 5L4SA 3WLLA 1TZKA 2BY4A 5LHHA 2GHQA 1T35A 2CF6A 4XPIB 2WAAA 1W4BA 3KP5A 4A0HA 4ZQEA 4FDTA 4BB0A 3MKYB 2CKMA 3L0CA 2EKQA 4Y9UA 4ILEA 2DMRA 3NWOA 2E5WA 3CR7A 3U62A 2K7FA 4YEDA 2C3OA 3L9XA 1YE3A 3W6UA 4YBZA 1R6UA 1UC9A 3OF5A 3ZMSA 4RNCA 3H19A 4CMJA 2QQAA 1FLNA 4MRNA 1ZCFA 4O33A 1Y80A 3EXFA 2CNWA 2J9ZB 3L0OA 1XRPA 2V9ZA 3N8HA 5TE9A 3JX9A 3CKYA 4JB0A 1R7RA 2XZPA 3KZ1E 3CCCA 3R9XA 3I9NA 3GWGA 5LMCA 5CDSA 4QASA 3GJ5A 1X8XA 4M21A 5EIHA 2EIXA 1KYWA 2YV4A 5ERYA 3GJSA 3DTEA 3KAQA 2ODEA 1X9HA 2QB5A 3Q0TA 4BNZA 3KSMA 5I4IA 1Z63A 2FPWA 4PSVA 3QYPA 3BE8A 1R5JA 4BNVA 2P9YA 2O54A 4Q4JA 3T7IA 1E3EA 2C0PA 4I8DA 2O48X 1V48A 4KKXB 2G88A 4OOFA 4QICA 3ICCA 1U7WA 3EZ7A 3UZUA 1J9EA 5JAPA 4D9IA 5DI3A 1EUDA 5JZ9A 5CX1B 2HPMA 5FULA 1WU7A 3K9NA 4BMPB 1U1CA 4ZTJA 2ZKZA 5HK8A 1OBCA 1BX0A 1Q3KA 3ILYA 3M4XA 3E7LA 5BPHA 1ZVVA 4DBLC 2RGXA 5H1YA 5JAHA 1N3LA 4OIOF 2ID9A 2VK4A 4QPZA 2H2WA 4XKBA 3FNBA 3UHFA 1TLHB 1R36A 2HMTA 2AJ8A 4TXLA 4X1IB 3CEHA 3K4LA 3T1VA 1YK1A 4QHSA 3RWOA 3LUGA 2WMOB 4Q7MB 2W2LA 2F3UA 1RC1A 3I9FA 3QEBZ 1X58A 1TWCJ 5B7PA 1RKQA 2QT9A 1OZFA 4MV4A 3MOIA 2HF8A 1NOJA 1OCPA 5JPIA 1CEEA 4LYGA 1XLWA 1GRCA 2F5FA 2I1LA 2PX8A 1ATIA 2ZJPF 4MCHA 3BXXA 2IYWA 4KQGA 3WHPA 1X7WB 1X7DA 1LFUP 5ALSA 4ALLA 2J4FA 3LT4A 4W9MC 1BH2A 4AO8A 4XRSG 2EG9A 3E70C 1SIBE 4YYZA 2HVRA 3K73O 3FHZA 1MFPA 1CDEA 4RX1A 5FLYA 4MUIA 1E2UA 4JVSB 5EZYB 3VA7A 1H0HA 1TAGA 3TNJA 2J0UA 4HUJA 2JLVA 3AO0B 1GL9B 1QHFA 5DMXA 3CT6A 1I7QB 2M5WA 1LCIA 1RUOA 1HFJA 2ZI7A 1LF5A 2QEXI 4DF3A 1FCJA 1C4OA 3ZV3A 4TMTA 2YIMA 4DTIA 1L4FA 3EEFA 3ZCTA 3UF0A 1Q16A 5KS2A 2VEOA 2MSYA 1D4FA 4NMLA 5L3QB 1W34A 3G6KA 3I5XA 2NUAA 1T2UA 2YSRA 5GMOA 3LUBA 3LXXA 1YR6A 5I7EA 3ZP5A 2O8NA 3HPHA 3ZV7A 2QUJA 3PP8A 1ZISA 2AQFA 2ON6A 4GAEA 3GLRA 3RM3A 2PDAA 1QU3A 3AERA 2IPQX 4O6VA 2Y1KA 1HQKA 1RM5A 3PDWA 3E8SA 4IRHA 1MH3A 3O4HA 4J0EA 4V2GA 1Q0UA 5KDLA 3I04M 1K4YA 1W0KD 2WWFA 4GLFA 1JV2B 2XKBA 2R7XA 3C5VA 3N2EA 2QUZA 1E6LA 4IWXA 1DO0A 2ZI3A 1WV0A 2WYHA 2DFDA 3L8FA 4HX5A 4IJAA 1EH8A 4OFBA 1A88A 4CCJA 4ARAA 1B41A 3OQMA 3R5SA 3LVFO 1DCMA 1KH3A 2C00A 2VDPB 3KVYA 5F64A 2PSJA 4R51A 5H8WA 2H59A 2GZRA 4RZ2A 3KQSA 3UH0A 2ZIZA 3K5HA 3VR3A 2H2GA 4FCVA 1G21A 3MLEA 3O1IC 4FYWA 3FUCA 2D8MA 1RQ7A 4X8LA 4WL0A 3IE0A 2AMFA 1KC1A 4CV2A 1OCOH 5I48A 3MOSA 1QVAA 4NBTA 1ZWLA 4NZZA 3WGUA 2FPXA 4B09A 3K8QA 2ZZNA 3W6KB 3WK6A 3JYHA 4UPEA 5ICSA 2ZANA 4JOMA 3QVKA 1R5BA 1GR0A 4AIHA 1FYLA 2BSQA 2JF0A 3NEUA 3O26A 2PKEA 1XPXA 2PJDA 1GT6A 2AYZA 3SVLA 3KIPA 4WDQA 4KE9A 4MZXA 2XUGA 3FNFA 3GPLA 4QPJC 1JXMA 2OPHA 1CJTC 5A5VA 3DE3X 3T34A 5FI1B 1S5PA 3QF4B 2IWRA 3UJ7A 5KQRA 2FU4A 2AFHA 2QHXA 3SI7A 1W4AA 1FLAA 1RXEA 4Z5XA 3CVXA 2PUHA 3EAFA 3T06B 4V0MA 3C18A 4YRGA 4DCOA 1WSUA 1OXMA 1RADA 3CZMA 2RGUA 4GMKA 4S0ZA 1G66A 4I1IA 4IYRA 1C30A 1C0EA 1ZN9A 1BXKA 4N4OB 4JFRA 2E4XA 3EX7C 1C7FA 4PPNA 1A9ZA 4BL5A 4LRWA 1GP2A 4RGQA 4DDHA 2SKEA 3VHXA 1D8AA 2FWJA 4BMDA 2CLKB 3G85A 4QVKA 3AESA 3S32A 2GGSA 1VNDA 3OFND 4AICA 4HDMA 4E7LA 4JDPA 2LCQA 1GNTA 1YITI 2OILA 1Y3DE 3MKZA 1E8MA 1PF7E 1W1IA 2AJLI 3COJA 1QUEA 4RGUA 4YFXF 1HXDA 3KVRA 3HKZA 1PZXA 4RGXA 5E8RA 2B8WA 2C29D 4A9AA 2VBXA 1XSXA 5DP2A 1D9ZA 3DJFA 2FK8A 4FT2A 2F64A 3DKPA 4KQ9A 3MM4A 4HSGA 1ZARA 1NF2A 3FSJX 5TLSA 4NQWB 4OQLA 4TROA 1Z12A 5CUQA 4HYQA 3SDBA 1GQOA 3G6WA 4YV0A 5F4BA 5BW8A 1LBSA 2VOEA 4E2YA 4JZKA 1QIKA 1XTIA 3RFTA 3L5KA 4LQLA 1VIDA 2VWPA 2WSSA 1KQ3A 3QOFA 3TOAA 2GPBA 5ES4B 5E6RB 3BE6A 3BCBA 1Q0LA 3NHAA 3PTLA 2CVQA 2M6RA 1NYTA 4KWHA 2KHMA 4F56A 4R69A 4W8OA 4UM8B 3BC1A 4YVFA 5LLSA 3NNNA 3GMEA 3EF3A 4R9VA 3TOSA 4ARCA 3MIZA 2W6IA 2GKOA 1FNNA 3SE7A 2SCUA 4UUSA 3JWHA 1DBWA 1GPJA 2CGPA 5BSUA 3WWDA 2CWEA 1DC4A 3ICQB 4FHEA 3ZWPA 3OY7A 1XT6A 2BKEA 2W82A 1UMKA 4G9BA 1EX9A 5JLXA 3LSYA 1QGDA 4YELA 1FRZA 3B6EA 4CR7A 5KNLA 2H4WA 1S8FA 2HA3A 2ZB8A 2ACKA 2ZO4A 1ZRCA 4KMSA 1LNSA 4DZRA 3WL3A 3QP9A 4X6LA 1WSWA 5CTJA 2X8JA 4EBFA 4JP5A 1LI4A 1XS9A 3HXTA 4JD5A 2FY8A 2WHYA 1RS0A 4DTCA 4PGMA 3JARA 3UWOA 5GQSA 4EUSA 4F5YA 5FHQA 2JKVA 3Q3JB 1FZPB 5FOSA 3PO3J 4WA8A 2HUNA 2PUEA 5J6XA 3V5NA 3IAFA 1QFSA 1X86B 2J0QA 4UU8A 5FTMA 3S3MA 3BEOA 1U8TA 4YCMA 4M1WA 4JLKA 6YASA 2JEZA 3A14A 5BXYA 4YPOA 1ZKDA 3MUFA 2M3AA 3FR8A 2ESHA 4YFYA 4YR7A 3VZPA 1QA6A 3KD2A 1MVLA 4YMWA 1C8KA 4FGZA 1IJBA 1OOEA 2QLJA 4DFDA 4KB5A 2NNYA 4F2GA 4KISA 1WL8A 3QX7A 2Q1ZB 4XARA 4LOIA 3GELA 3N75A 3AF2A 3V55A 1M2VA 3SNHA 5D5QA 2JK0A 2YU3A 3QSYA 2IUFA 2Q2NA 1YZQA 4KAXA 1NMSA 3O38A 4FMPA 1EFLA 4RA6B 1M2OB 3ICWA 3BMOB 2OE2A 1HMYA 3CE9A 3WKBA 1G8JA 1S3GA 4D2IA 1ESMA 1CJKC 3L6BA 4E0BA 1Y3CE 3WJ7A 3GI1A 1JW9B 1OFTA 1OXKB 3NPAA 4F8YA 2DJNA 5LZ8A 5EJ5A 4IG9A 1RCFA 4GE3A 4OJYA 2FLKA 1CD5A 5F76A 2GNOA 3JD1A 1CUZA 3BR1A 4XVUA 2RGAA 5JS6A 3NAZA 1BRTA 1P0FA 3GC6A 2CSXA 1E3QA 4R6WA 1X14A 3WOVA 1HDCA 1H3NA 1X7GA 1YO6A 1GUFA 4JI4B 1G6HA 4AUKA 1TWGJ 3K4CA 3JW8A 3FNIA 2ZVPX 4U7GA 5F9FA 1GFIA 5J5CA 4F04A 1F2TB 4NQZA 1WDLA 2DULA 3E97A 2FUKA 3E6DA 5KNDD 3NHPA 4M0FA 1U0OC 5F6FA 1W52X 2EOAA 1JLHA 2X1MA 2FVYA 4J2TA 4ESEA 2RB5A 2N75A 4DSAA 1WPRA 5FWYB 3LFHA 1UG2A 2BM1A 1PJSA 4FZ5A 4JLOA 4N65A 2NQ2C 1W44A 1BKSB 1U2DA 1K5HA 3CVUA 4ESVA 3SLGA 4IDDA 5J63A 4KTVE 2CWWA 2XT0A 3BDAA 1S4MA 4BO9A 3GZ4A 3M1CA 2KQUA 5IU6A 3RPUA 3DFKA 1K79A 2GN2A 5ALHA 3OS1A 4I36A 3T3HA 3M4NA 1BX1A 4LB6B 1DQNA 4FX4A 1O2DA 4LF9B 1CQWA 1W2WB 3S2FA 4GKAA 1FTWA 3EUHC 5SY4A 4C4TA 1T3ZA 4TMXA 1E3WA 4AIKA 2O05A 2AXQA 1J20A 2ZBRA 2VUIB 1L1EA 3STHA 3H2YA 2EGUA 1SWVA 1T6ZA 3DTVD 5DLEA 3MHPA 3QPUA 3K2IA 2AE1A 2RHGB 2QTTA 3EAQA 1SUAA 2X7HA 3E9DA 1M67A 4IZ6A 2IVFA 2R7QA 3ADBA 1QH8A 3O91A 1HV8A 2HM7A 3AVUA 1U5TB 3IBGA 1YB4A 2PBIA 3HFGA 1MMSA 4IGKA 1OJ7A 2EZ8A 3OJ0A 1YW8A 4M49A 3SHFA 1AK1A 4YV1A 1X1QA 2WB4A 1A9SA 3VSLA 3AEQA 1F5NA 4CFSA 4XDYA 2JLAA 4N3AA 2A5WA 4YXWA 1L0BA 4M8NE 4WX9A 5FWXB 2D5IA 3IQGX 4BV8A 3W7AA 3QOYA 4A0XA 2QLTA 2LIVA 5REQA 3H99A 5IX8A 4BY7J 5LQCA 4IF6A 4J4BA 5GOZA 1HZZC 1R7JA 3RTBA 5J3LA 5JSKA 4CU2A 4EOGA 2J5QA 5FJIA 2GPTA 2GYWA 3HJHA 4BP3A 4XJXA 2EF1A 3GY0A 2Y2UA 3RC7A 2WAQA 1JHVA 1KFJB 2KZGA 1JFTA 1XA4A 4G86A 4JOSA 3QXGA 4E7IA 4R1QA 2IYPA 1OI3A 1MT0A 1FDWA 4P7GA 4M9UA 5TARA 2O0LA 5D2CA 1V25A 1LBQA 1I7DA 4HPWA 3ENNA 3QAHA 4JR0A 4MR7B 2GO1A 3TH5A 5FGMA 3I45A 5AKZA 3X1DA 3EGWA 4CMGA 5DCWA 1D07A 1GZ5A 3WLEA 5EN4A 1D2AA 4OM7A 3GN1A 2ZUCA 4K81B 4LZOA 4HWRA 1G5RA 3MZ8A 2JCGA 2EJVA 4YIFA 2V4UA 3CPEA 1NMEA 1QBKC 1N78A 4V1CI 2QTFA 3JSXA 3QUBA 2B82A 1JFFB 3HKDA 4JJZA 3TIGA 1QC5B 3BK2A 1U81A 3RVPA 5JBQA 1HSOA 2NU7B 1XEWY 3RYIA 4XOTA 2D5VA 1JB9A 1FBTA 1QVZA 3TL4X 3AY7A 1H2EA 2PN1A 3GYGA 2OYRA 5KSWB 2CMFA 5DHRA 1DTSA 3NMUF 2NYAA 4ZHQA 4LK1F 3SG0A 1Z91A 2QSUA 1JSCA 3JY6A 5EG0A 3CJQB 3NC4A 3FOCA 4B17A 4G0XA 1CNFA 3FWPA 5EVCA 2V3CC 4R0VA 4CUKA 2ZAIA 1H2FA 4G63A 1KGDA 4MYRA 4QJBA 4FHCA 2PH7A 2Y77A 1QO0D 4O2BF 4MKHA 4XORA 4G4JA 3C4JA 2Q3HA 1DVRA 1NR1A 4HPQA 1YS1X 2M32A 5FLMJ 5T4BA 2Z9BA 1KBOA 4BUZA 4HQEA 1P9NA 1A9RA 3WLMA 4EEFG 1ZW6A 3N3BC 4WKOA 3EZLA 2H2DA 4WVLA 4KXQA 3THSA 3TLXA 1T36A 3SQWA 5LP6A 2OQVA 2BVMA 3I01A 4I8IA 1D5CA 1N5JA 1MDFA 4B8YA 5I9MA 2GERA 5IJ9A 3W2WA 1I13A 2HTJA 4B3DA 5B4TA 2VCEA 2JLCA 4J0JA 2ZIVB 4AJNA 4DCUA 3S17J 4DM3A 1FYXA 1ECJA 4CLOB 1AOYA 1NXSA 2CLMB 3GGJA 3NWPA 4OAOA 2VOJA 3UB4A 1F9AA 1C8BA 1CXZA 4J0DA 1UZNA 4OBXA 2P2LA 2VJNA 2IHJA 2V4ZA 3PR1A 4DLRA 4AX8A 2H92A 1QRAA 3CTAA 3KWFA 4OIRF 2OCIA 1G8YA 2FPUA 4TTIA 3GLHB 1Q1EA 4DLYA 1NVVQ 4AMUA 2DMUA 5FR1A 3HIFA 1CR0A 4LXIA 1XTSA 3CLVA 3VKVA 1DHRA 2AN5A 1THTA 1JTEA 4PX2A 2QTZA 3WO1A 1MT3A 5AVKA 3ZHBA 1QJ4A 1XMVA 5EHNA 4BO3A 3U4AA 3IALA 2BE9A 2INGX 4MRPA 2ZJ5A 3OTGA 3ZTWA 1PFGA 2IODA 5D3QA 4MW5A 1E9CA 2QX4A 1XZBA 1ZSNA 3EIEA 5EIXA 1E6MA 4AULA 3FHCB 1XL1A 1GNQA 221PA 4G01B 4UULA 1XTTA 1LKXA 5K6RA 1K5PA 2EQ5A 2C9ZA 3EXHB 4GQAA 5K4HA 3AYXB 3EFOB 2QRKA 5ADHA 2IJLA 5FUYA 3D3WB 4XM2A 3GQVA 1U6GA 1RRCA 1X2BA 2GZ2A 1JJ7A 3OI7A 3SJZA 2PL1A 5K8VA 1TTPB 4BIMA 1SWWA 1NL3A 3T6KA 2UZIR 1AQLA 2Q5OA 5JQGF 3GFFA 2IVMA 1NI5A 1NMXA 5HXAA 1VM6A 2CDRA 3AG3H 5CJJA 4KK3A 5HKKD 4HQOA 1JIKA 3QVGA 3OS2A 1VTKA 3LBYA 3CX6A 5GJWC 3G9TA 4TL7A 2QQ5A 3S2IA 4Q19A 3SSMA 1TX4B 3H65A 5CPFA 4XIFA 4YACA 1VHWA 3BJEA 4JC5A 4P32A 4HH4A 1XMJA 5IJ0B 3PFCA 2ZM5A 2C1EA 2EZLA 4R71A 1NVMB 2FW8A 3HJAA 5F52A 3GNTA 1W93A 3Q3HA 1NDQA 1V3UA 1PJAA 3M89A 2K9QA 1UBTS 5A05A 4RXTA 3DU6A 1V4BA 4PO3X 1YRWA 1A77A 3LNQA 1WZUA 1AG9A 1PNTA 1NC3A 1X6VA 1WW2A 1P81A 2Y6VA 1RI5A 1KSFX 3F49S 3ROQA 2UZ1B 2O0JA 2AH5A 1KARA 2NZVG 4MUBA 1NUAA 1P3JA 4EYQA 1GV5A 4PC2A 2BI8A 4ALIA 4AWXA 3Q6MA 1P60A 3MFYA 2R87A 1E59A 3FCSB 4JN6B 1DTEA 2DYKA 3IMFA 1M3SA 5IT0A 5G53C 3GF4A 4Q5IA 4HNRA 5JXGA 2VHVA 3FPBA 1GSIA 1MNQA 3NDJA 3RYFA 2H4ZA 4ZVRA 2AIRA 1MJNA 1NG1A 4WECA 2CO5A 4FE4A 4REQB 3OEWA 4BDZA 1NLUA 4YLEA 3ORYA 1CQZA 3RIHA 3E35A 1CP3A 2B7BA 2Q45A 2J87A 3IJPA 1P77A 4EI7A 4US2R 2X9GA 1U5CA 4R40A 2CDNA 1WDKA 4ZZLA 1B1CA 3KZOA 1XCJA 3E61A 3H04A 3J7AO 1J75A 4MGZR 1SFEA 2WT8A 3ZDXB 4LKRA 4XWYA 3PU6A 4MRVA 2JBAA 4E03A 4E1AA 3OU7A 4HN2A 3DA8A 3GTLJ 4CT5A 4JLAA 3RRMA 3VO9A 4D81A 3LSRA 2CVZA 3EULA 4E94A 8AT1A 4CCLA 2CLHB 4Q3CA 4EKDA 4LJAA 3GMTA 3KL2A 4A91A 3WE7A 4A3KJ 2O3UA 1I33A 4Q1CA 1H23A 3TZBA 3M6FA 4WUVA 2R2AA 1EIZA 4F6RA 4ZVSA 4ER3A 4BBSJ 4D4KA 3PC3A 5P21A 5BPDA 1N5OX 5BWBA 4H08A 2C1ZA 4WLEA 3DHEA 2QVLA 5KJFA 5CIQA 2YZ7A 5JV5A 2QA4I 5HDBB 3GHYA 4WK4B 1Z0XA 2KFDA 3CCUI 4XD2A 4AP6A 1V7CA 2V9VA 1NVGA 2L18A 2SICE 1FOEB 3F47A 3MS7A 1M34B 4TN5A 2IE8A 3Q0WA 5E79C 3DPIA 1MB2A 3N1UA 1SEVA 1SZPA 2EX4A 3L93A 2BGJA 4WNCA 2X2EA 4LDRA 1CHNA 3TMAA 1IMJA 3IOCA 2X5XA 2D7CA 3HB0A 3HH8A 2H0AA 1G6Q1 3MTIA