3H9GA

Crystal structure of e. coli mccb + mcca-n7isoasn
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
346
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSNNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
molecule keywords MccB protein
total genus 106
structure length 346
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9gA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9gA02
2JD2A 3KVOA 1H93A 5J23A 2J3HA 3INGA 1XR3A 4LK3A 3WYCA 2Y0DA 4YT2A 1OC2A 5FYDA 1ZBQA 3HFSA 1U5CA 4PG8A 4J16A 2X6TA 1JVSA 4ALIA 4IQGA 1YONA 2UUOA 4GKVA 3NDJA 1RJWA 4CM4A 1Q0HA 1ZUD1 4GPD1 5FFFA 1E3JA 3H4VA 5EMHA 4BS9A 1H9BA 2BI7A 3D5QA 4MINA 4QT0A 3SX2A 2NLOA 3ITKA 5A9SB 4W7IA 2YV2A 3AI2A 2WSBA 1Y9EA 4Q3CA 4R1NA 3ON5A 2Y0EA 4QTZA 4ZRMA 2YY7A 1E77A 2EKLA 4FIZA 4M87A 5A9SA 3A9WA 2VT3A 4OIMA 1GEEA 1JKJA 4YR9A 3Q9NA 1BHSA 4D7AA 4PZEA 2IZ0A 2W90A 1UZLA 4CL3A 2AA3A 1UZMA 2UVDA 4FFRA 1B0AA 4CM4B 2FWMX 1LBEA 3AWDA 3GGPA 3RUEA 3SJUA 3VTZA 5IAAA 2JCVA 4M89A 4JBGA 3JQAD 5CHEA 3KYCA 1NQOA 4J4TA 2D59A 2PD6A 1R16A 2PR2A 3HFGA 4Z3KA 4HFJA 3DAGA 4I5DA 3RC9A 3TFQA 4FFPA 1NFFA 2ZB3A 4M49A 4OXYA 3LC1O 4E5YA 1Y1PA 3TWOA 1R4MA 3C7CB 4U6SA 2EW2A 3NV9A 1GZ3A 3E5RA 4GMFA 1ISMA 4MVJI 2PKRA 1X7HA 3JD2A 2BH9A 3GHHA 1YGYA 3DMYA 5JPIA 2X9GA 3GVCA 4R01A 2HUNA 4WOJA 4BGIA 4AJ1A 5AXDA 4JCOA 4UVIA 5GZ3A 1A4UA 1VJTA 5IDYA 4QSMA 2P5UA 4FOSA 2J8ZA 3A4VA 2X0IA 4IY1A 4OYRA 4XRGA 1VE9A 2IXBA 3G3EA 2JKVA 2AG8A 4TZKA 5F1KA 4KP7A 4CPDA 1PGOA 2V7PA 4CL8A 2W2LA 1IYZA 1HSOA 4YDRA 5DCUA 3WTBA 2NNLD 1KVTA 5I7FA 1JAXA 3CPSA 5G4KB 4LMPA 3IP3A 3I52A 2GO1A 4PCVA 4ZQGA 1PGJA 2NM0A 3GF4A 3NJ4A 4YRDA 2AEJA 4BMSA 2NWQA 4GGOA 3MEQA 5JAQA 3BYZA 1XQ6A 5IN4A 2JHFA 3E03A 3RFVA 1P1KA 4E3ZA 2QRJA 3PIIA 1JAYA 3ZWXA 1ZXLA 4CR8A 4MIEA 2DUWA 4OAQA 4AJNA 1PJBA 4X54A 1DIRA 3U4DA 4KMSA 1L7DA 1MG5A 4QO8A 4FSHA 3G0OA 4F6CA 2NU7A 3IC5A 4IIUA 1HE4A 2GR9A 2VRCD 3JQCA 2Q4EA 3PGJA 1K3TA 1P0CA 3AI1A 1C1DA 4KOAA 3WB9A 1QYWA 2DPHA 1R4NA 2FSSA 3AUAA 1DRVA 1ZXBA 3WGTA 4EBFA 3LDHA 3AY6A 4UVEA 3IUPA 1LC0A 2Z5LA 3GVHA 4HWKA 2NVBA 1ZK1A 1NAIA 2HRZA 3WGHA 4DPLA 1EMDA 3ETDA 5CEFA 2B83A 2AHRA 3TZ6A 4HADA 4URFA 2BF7A 2E4AA 1SO8A 3I4CA 2CY0A 4BNHA 2WJPA 1ID1A 1YBAA 1NAHA 3AU9A 3GLQA 3JYPA 4PLVA 3KYDA 5EESA 4BGVA 3EDMA 5ITVA 3F4BA 4BV8A 4YJHA 5JCJD 3QQPA 1YQDA 3SJ7A 3PI7A 2C2XA 1GADO 3BMCB 2NV6A 3R0IA 4B8ZA 3GDFA 4RPKA 3D5TA 3GOHA 3S2EA 4YAJA 1XU7A 1IPFA 3INTA 3QIVA 5H83A 3VDRA 1T2AA 4Q3BA 5K0ZA 4TWRA 1ENPA 1V9LA 2WMDA 5U1PA 4IS3A 3WGIA 1S7CA 5KJCA 3VPHA 5KVQA 1O0SA 3GAZA 4WPGA 4RPGA 3RUHA 3E9MA 3HB5X 2VUSA 3HADA 5IJZA 3AOEA 4UEJA 5A1TA 1JVBA 4JLWA 4P38A 3GC6A 4E2ZA 2PFGA 3DHEA 1E3IA 4J9UE 3K9QO 4E21A 2QX7A 2A4KA 2IYOA 3JQAA 4AJIA 2ZATA 3D3WA 3WS7A 4XGNA 4B4VA 2DBVO 3DHYA 2X0RA 4OHUA 4A27A 3DZGA 3H6KA 2VUTA 3GEGA 1U3WA 3PQDA 4E5PA 3VHRA 3NRCA 3ZW8A 3ZWAA 4IXWA 3ZNQA 3VH2A 1CRWG 3GVPA 3I1JA 3GQVA 4J43A 3KM0A 4NI5A 1DHRA 3B6ZA 3V2GA 3GG9A 4G81A 3VAZA 4P22A 4RDIA 2VNSA 4L73A 2JJYA 3KRTA 3RBXA 1CETA 5KWEA 4IQ8A 1R0SA 4ND1A 4N5NA 2J5RA 4B7UA 1PTJA 1NFRA 3L4SO 1EE9A 1ONNA 4TKLA 4GWGA 3FSRA 3PRJA 4Z3DA 3DR3A 2B5VA 4XA8A 3D4PA 4RPLA 1C14A 2ZCUA 1EZ4A 3ANNA 3CZRA 3NUGA 2VYVA 3RASA 3O9ZA 3OJLA 3TF5A 1PX0A 3PHHA 4F6LA 3JQGB 3JV7A 4UVHA 3GVIA 3RKUA 3PWKA 2NQTA 3MOGA 1B8UA 5HWSA 3OQ1A 4BL5A 4I08A 3BMQA 1U2DA 2VHXA 2Q46A 1Q0QA 3GZNA 5I8WA 2WEKA 5BSGA 4RVGA 3LSYA 5HS6A 5COQA 1ZK0A 5G0SA 3KSZO 4I9HA 7MDHA 4N54A 3PK0A 2EEZA 5JW6A 1PJTA 4YRAA 5IZ4A 1EK5A 5L9AA 1A7AA 2PY6A 1D8AA 1UP6A 4R41A 8ADHA 2PWZA 4BHTA 1E6WA 1R66A 4CMAA 3I9MA 4EYEA 4ZHSA 3ZI0A 3GFBA 3K8ZA 1HZJA 3JQGA 4BIIA 2JL1A 3EC7A 2JHGA 4OM8A 1U28A 3GNSA 5THQA 1EDZA 4AG3A 1GZ4A 1KERA 3C7DB 4PLFA 3IP1A 4B3IA 4FC6A 4G2NA 1E3WB 4R4JA 3NEPX 1MC5A 3EMKA 1Y8QA 4ALKA 4AJEA 2QZZA 4J4BA 3RI3A 1EVZA 5CEJA 1EUDA 2CVZA 4JNKA 4YXFA 1V6AA 2PGJA 4QXMA 3JQFC 2O4UX 3OP4A 1U8FO 1Y7TA 1FDSA 2XOXA 4J2HA 1DDOA 4XYEA 3N7UA 1B2LA 1C1DB 2O23A 3NDIA 5F1OA 2RH8A 3QWFA 4XGKA 1HDGO 2HMUA 2HMSA 3VZPA 3SXPA 4D3SA 3QY9A 1LSJA 2EHDA 3ROKA 1IPEA 1BDMA 1WMBA 1V3UA 1H6BA 4M1QA 3U62A 4B4WA 4Y6RA 2ZK7A 3I9OA 1LI4A 1MC4A 2JD0A 2X0JA 5IG2A 4I9NA 3TOZA 1X1EA 4INAA 4MVJM 1I8TA 3PQFA 1UR5A 1RWBA 2RHRA 1GUFA 1ADCA 4XYBA 2OP1A 3EHEA 4CMCA 1WVGA 1R4MB 3LVFO 5AXAA 4WLNA 3WGOA 5KTKA 4XKJA 2UDPA 5T5QA 3WGZA 1HXHA 3IKVA 4TKMA 4DPMA 1BXZA 1WDMA 2EP7A 1DB3A 4R1TA 3WWYA 4MDHA 4RLHA 1IB6A 2HMWA 1JN0A 2VWGA 1XG5A 2J3JA 4D44A 1G6KA 1KEWA 4MVJH 4YJDA 3K2BA 5KKAA 3N74A 3PIDA 4IDAA 1DHTA 5IZCC 1LSOA 1P44A 5DT9A 5B37A 1MG0A 1K2WA 4N5MA 4OMUA 1DOHA 1J0XO 4YJHB 3H2SA 4DREA 3VH3A 3WJAA 2P68A 3KYDB 1ZIDA 4YCAA 4S3MA 4D41A 2YW9A 2UV8A 3F1KA 4CMIA 3STHA 1HT0A 3TJRA 1OAAA 4NMHA 4CLDA 4JBIA 4K28A 1HEUA 5IDWA 4IDDA 1H0KA 1M66A 3U9LA 1XIVA 2B4RO 2GD1O 1E1KA 1WZEA 1DJQA 4R1SA 4W82A 5JMWA 1F12A 2WD7B 4WLFA 2CZCA 3H9EO 3QE3A 2CMDA 4HNGA 4ITUA 4YPOA 3DOJA 4XRRA 1ZSYA 2C5EA 1EUZA 1SBYA 3O03A 3PHLA 4GSLA 4EUHA 4CQMA 1F0YA 4YAIA 2CDAA 1MXFA 3GN2A 1KEPA 1F14A 3OEWA 1ISJA 3VPSA 1VRWA 1X0XA 2X58A 2DBQA 4II2A 4CUZA 4BGEA 5B4TA 3OIFA 4ZQFA 1E7WA 3PDUA 4ZRNA 1VM6A 5EIOA 1P31A 1DFHA 4YBZA 3W1VA 4U0JA 5ILGA 3RUIA 1HDZA 5F21A 5TIIA 1LEHA 3JCZA 1Z75A 4WCFB 2DT5A 1TEHA 4L9RA 1QXSA 3AM4A 1U8XX 1VSUA 1JU9A 3I5MA 3ST7A 4LSMA 4D0SA 2GRAA 4RF4A 4DLAA 1J5PA 5MGBA 3VOSA 1XELA 4OQZA 2RIRA 3C1TA 5L51A 1GYRA 3OICA 1W8DA 4JJGA 3MOIA 3TQHA 2C5AA 3I9KA 2Q1SA 3RQSA 1I5RA 1W73A 3VC7A 2XXBA 2QG4A 3OEYA 1M76A 4IM7A 3ENNA 1CEQA 3IQDB 1H2BA 4BB5A 5DDIP 2DTEA 1U3VA 4ROSA 1GU7A 4KUGA 3VPGA 3ZH2A 3BXXA 3JQ9A 5G0TA 5JYDA 4D3FA 2CDCA 4EUEA 4BQPA 1YE3A 1HETA 2WM3A 3GUYA 3NTQA 4TVBA 1HYGA 4DIBA 3ZWNA 4BNLA 1YBMA 3FD8A 5AQ1A 3ORFA 4IS2A 3W6ZA 3PJDA 4CV2A 2ZJ0A 1PL6A 4RZHA 2CNBA 2G82A 5CDUA 3S2GA 2WE8A 2AQIA 1QV6A 4IIVA 3LU1A 4UUPA 4NG5A 4FN4A 5HM8A 4YRBA 1EQ2A 4BKQA 5H82A 5KVSA 5ILOA 1LRJA 2VCYA 4GX0A 3KEQA 4HBGA 4R51A 4EEXA 1T4DA 1UXKA 3OF2A 1Q7BA 2DM6A 2P9GA 4EZBA 3IAHA 4WECA 1N1EA 2Y93A 4ONEA 3CSDA 4P4NA 1MFZA 1XKQA 4ALNA 1BW9B 1G0NA 5JC1A 3BZUA 4RPHA 3ENKA 3U0BA 4C7JA 1B14A 3E82A 4H16A 3VPXA 4BUCA 2VRCA 2QHXA 1YO6A 2PA3A 3PYXA 1H6DA 3OA0A 3ZWYA 3IJPA 4NIMA 2BLLA 3IOYA 1D4FA 3F1LA 3MWDB 2Z1MA 2EKQA 4MVJF 4NH4A 4EDFA 5A05A 5TT0A 1MFPA 2PGLA 3DWFA 1UDCA 1HL3A 1Q2XA 5DOZA 4CODB 4FQ8A 4ZGWA 2QIOA 3WWZA 1LRKA 1M75A 1V35A 5JSFA 2X8LA 1TB4A 4QFDA 4XWYA 5KVCA 2IEBA 1U5AA 2HMTA 3GMDA 1BXGA 1N9GA 3PWSA 1PGQA 2EP5A 4UUNA 2BFPA 1I2CA 2V6FA 1FDWA 2BGKA 3WOHA 2WYWA 4FGWA 4IDFA 5B1YA 1Z6ZA 4XQEA 3QVXA 4QEDA 1EBFA 3ZDFA 4FFOA 3ZV3A 2X9NA 2GPTA 1EUCA 3KTDA 3FR7A 1ZMOA 3L4BC 4HXYA 2AQ8A 4BVAA 5TRTA 4BGUA 2JAPA 3GHYA 4F3YA 2VTDA 1LLCA 3Q2KA 4DXHA 3PLRA 1UZNA 4E2XA 1ISHA 1DAOA 1NR7A 4ZQEA 5KOIA 1HWYA 5L4NA 2B0JA 2J6IA 3GT0A 3EVNA 4FR5A 3WIEA 4MIOA 2NTJA 2D5AA 1ZEJA 2NUAA 4HX5A 2C29D 1VJ1A 9LDBA 4R69A 4D0RA 1LDYA 1GTMA 4CR6A 2BD0A 3GRPA 4ND3A 3BMOA 2OOSA 3WXBA 3L0DA 4AJJA 5T6BA 3ZNOA 6ADHA 4JP2A 2FR1A 4B4OA 3V1TC 3ZHZA 4W6ZA 1YJ8A 3CIFA 3ZNPA 4CLEA 5G0WA 2DTDA 1JTVA 4CLRA 1KETA 1T25A 4FBGA 1PR9A 1UXJA 2ZB4A 4DYVA 5I7VA 3JYOA 4CQMB 2IZ1A 3QVWA 5CG2A 4NBWA 5BNFA 4K6FA 4IMRA 3WFIA 1GUYA 4LRSB 3JD1A 2A94A 2E49A 3SVTA 2PGDA 3KLMX 1PJLA 5A5EA 1HRDA 2NU8A 1KIFA 1U3TA 1BRMA 1SCUA 2Y1DA 1NNUA 2I65A 2QRLA 3VKVA 3WYEA 1LLQA 3DBRA 4J1QA 1JWBB 4CM5A 4FFLA 3MTGA 3DFUA 4J7CA 3ONEA 3L9XA 4ZN6A 4I9UA 2LDXA 3FN4A 4U7WA 4CM9D 2Y66A 3QRWA 5A3VA 2AW5A 3UH1A 4E2WA 1SOVA 2VWQA 1BXKA 3I6QA 1CYDA 3GK3A 3I6IA 1I30A 1AXEA 3ZN2A 1GQ2A 2YZ7A 3ZWPA 1ZK2A 3R3JA 3BIOA 5CFZA 3OQBA 1YXMA 2EIHA 3NTOA 5T8KC 1RM5A 3BMNB 2ET6A 4IJKA 4CM8B 4G65A 3U5TA 3BTSA 4L4SA 1PEDA 3ICPA 1LNQA 4ZVVA 2X23A 4DBZA 2W4QA 1Z82A 1IL0A 4FDAA 4BNXA 1F8GA 3A06A 1T2CA 1DEHA 1MLDA 3FNFA 3ROMA 3E8XA 4GLOA 1NQTA 1E5QA 4CM9A 3ABIA 1GYQA 4LMRA 2FP4A 5BSFA 4DLLA 1VL0A 2I3GA 3UXYA 5A9RA 1FF9A 2D8AA 1F17A 1NPYA 2Y68A 1QP8A 4N7RA 2A92A 4MVJG 2ZTUA 1Z7EA 3E9NA 3JQAB 2PH3A 1BWSA 5A9TA 1V0JA 2AMFA 2V6MA 3S55A 4DMLA 5JYEA 3ICCA 3ZHYA 1J49A 4OOFA 4R3NA 5DCWA 1PWXA 1OOEA 1YDWA 4XR4A 8LDHA 3UHAA 3ZHXA 3OMLA 1UAGA 2EG9A 2OL4A 2YJZA 3GR6A 4ZD6A 3RC1A 2GN6A 4DC1A 4MKXA 1I2ZA 1HTBA 2BGLA 4MVJP 4WKGA 1ENOA 3O26A 3DONA 3MWEB 4CLOB 4E32A 4ZICA 4WOKA 4GQAA 4U5QA 2DVMA 2O7QA 4MPDA 3UF0A 3RC7A 1KY4A 2B69A 3MJEA 1YS4A 2ZTMA 1I3NA 3QA9A 4BKOA 1EFKA 3UGKA 3GFGA 3K5PA 1GY8A 1U9JA 1DLJA 4R1UA 4D43A 4E2YA 1LX6A 1RM3A 3D4OA 2NQ8A 3DBLB 5DNAA 3ASUA 4EEZA 2TMGA 3CMMA 2G76A 3VZRA 2Z1NA 3ROQA 1PS0A 2E48A 4IDGA 3TSCA 4RPJA 2BFMA 3F9IA 4Z6KA 4HV4A 1RM0A 1ZSVA 2EERA 3HDYA 3I4FA 5G0VA 3DZIA 3B20A 3EW7A 4BKUA 4BNYA 3EZYA 3H3JA 3AUTA 3E6AA 4IDBA 5KJFA 3PFFA 4FJ0A 4PG5A 1UH5A 1GFSA 1PQPA 5THKA 1LSSA 1C0KA 1HE3A 5F1PA 2P9CA 3DZBA 3K2EA 1J6UA 1ONOA 3UOGA 3IL2A 2NU9A 3ADPA 1HDCA 2WD8A 4Q3AA 1FMCA 1E3LA 2X5KO 4A0SA 1QORA 4A73A 3ZCXA 4D45A 3WLEA 1C1XB 5DBIA 3NKLA 5G4LA 1XEAA 3JQ9C 4XYGA 1QKIA 3ANLA 1IOLA 3T4XA 3GA0A 4RDHA 1HDRA 5ADHA 5JO0A 1GV1A 3OHSX 3I23A 3K31A 3G1TA 1L7EA 1UDBA 3L07A 3X2EA 4S1VA 3DQPA 3KBOA 5F5LA 4DVJA 1HKUA 3GGGA 4PFJA 3RBZA 4MKZA 5C7IO 5JBIA 1D3AA 2Q4BA 4XD2A 4Q3NA 5B4VA 4BO9A 3AUSA 3H5NA 2Q3EA 5EL0A 3LK7A 2O4CA 1GYPA 5HA5A 3ZGYA 4ZQHA 1I0ZA 3FCOA 3ZW9A 3K73O 3ASVA 2OBNA 3E48A 1I33A 1KS9A 2G0TA 5F5NA 5I9NA 3COSA 1K6JA 4XB1A 1X13A 1HSZA 5L7WA 1X7GA 5G0UA 5A04A 4FD3A 4RVHA 4G5HA 1NFQA 5C3MA 3C3XA 1I24A 1ZJZA 4B7CA 3FBTA 4WCFC 2YQ5A 5TX7A 2ILTA 4E33A 4W99A 1LRLA 3H8VA 4CMBA 3UCFA 3PHJA 4BQRA 2QW8A 2X5OA 1UP7A 2EKPA 5AOVA 3U4HA 4K26A 2B36A 1G1AA 4PRLA 4E30A 3PLNA 3K6JA 1Q1NA 2I3AA 1GL3A 3OH8A 5FI3A 2PZJA 2PZKA 3C1AA 2X9VA 1V3VA 4ZU3A 3JQEA 3HDQA 4YWJA 1PJ2A 5ICMA 3VPFA 1JQBA 3N58A 2IE0A 5ENDA 5CP8A 2X7HA 2NVWA 3VZSA 2P4HX 1Z73A 4QFCA 5DZSA 1U4OA 4HFNA 1CJCA 1A72A 1VKNA 1QYXA 1EVYA 1X0VA 1UXHA 1MXHA 3TL3A 3KOUA 1Y8RA 1X7DA 1PJ3A 2Y05A 2EV9A 4LISA 4ND5A 5G4KA 2BHLA 3U4IA 4MOWA 3DZHA 5GZ6A 4BNGA 2PZLA 4L0QA 3SLKA 1T2EA 1H6AA 3GGOA 2NU6A 4RORA 2OP0A 2PKQP 3M1LA 5KKCA 1UUFA 4UULA 3Q2IA 1N1GA 4CMIB 1T2FA 3R1IA 3PGXA 3WJ7A 4BO0A 1OBFO 4E0BA 4FFNA 4ESOA 1DC6A 3F47A 3JD3A 2FZEA 1PGPA 5CDTA 1XLTA 4RL6A 4AL4A 3D1LA 3FWNA 3IMFA 4R68A 4IQ0A 4JN6B 1P1FA 3NYWA 2VTEA 1WXDA 1O9BA 5FI5A 3X2FA 1HE5A 2GSDA 1PJ4A 1N5DA 3RFXA 1DIAA 1ADFA 3DMTC 4J7XA 3SBOA 4C4OA 1EDOA 3DZFA 3KO8A 3RSHA 3W8FA 1U4SA 5MDHA 5DP2A 4CR7A 1PU2A 4EJ0A 2DFDA 2YHUA 4AFNA 2UYYA 2OZPA 4JQCA 4QQRA 4B79A 1E1MA 3EUWA 2AQKA 3SEFA 1Q0LA 2NSDA 1H2HA 1YVEI 3TZCA 2HRBA 2BGMA 4PG7A 1H6CA 1AUPA 2GZ3A 4PG6A 4GX1A 1W6UA 3FR8A 4L8VA 1ZMTA 1WAMA 3M2TA 3CKYA 3OQ6A 3JYQA 4M8SA 2G1UA 3ZV6A 4BO8A 3RROA 3H3FA 3H5RA 4OKIA 2EXXA 5A5FA 2Y1EA 3UICA 4D3DA 1U3UA 5JDCC 3WQQA 4B3JA 4PLTA 3F46A 4FOOA 1VI2A 3BTOA 3GUCA 4BNNA 1R0KA 2GASA 2AXQA 1BMDA 5JMPA 4MIYA 5B4UA 2YYYA 2EJVA 5I9MA 2Z95A 2AG5A 3TZHA 1LTHR 1QYCA 2HLPA 1OMOA 2NADA 4BNFA 3EZLA 4Q3DA 3IS3A 1VPDA 1YDEA 3JQDA 3OJEA 2NTVA 2OBYA 3VZQA 2B5WA 4LN1A 2AE1A 4PLPA 4R3WA 5EERA 5JAIA 3C85A 3ROPA 4FJ1A 1ISFA 3H9QA 1ENZA 2X5JO 1ZH8A 3CEAA 4R5HA 3QWAA 4J6FA 2GN8A 4E6PA 5A06A 3WMXA 5DCYA 5I7SA 2P91A 5JFOA 1QG6A 1ISGA 4XZ3A 1WDLA 4DMMA 3V8BA 4GWKA 2F1KA 1KVSA 4DQVA 1IULA 5TSDA 3BTVA 4PIVA 1KC3A 3HB4X 4D46A 1TT7A 3W8EA 4CQLA 4L4RA 1KVRA 2DKNA 3PYLA 4JJIA 2J3IA 2JAHA 1NTOA 5HRUA 3DXFA 3UUWA 3RU9A 4M54A 3ZHBA 4ND4A 3WX0A 1QV7A 5KJ6A 3PPIA 1YL6A 1LLUA 4OJNA 2W2KA 3LLSA 4PVDA 2Y1FA 1GR0A 2HU2A 4CMEC 1XDWA 1ZVMA 3V2HA 1V3TA 2Q2VA 4NHEA 4YAGA 3TRIA 4IDEA 1XWFA 5EINA 2VN8A 4FB5A 5F3RA 1E7YA 2ZB8A 2GDZA 3F3SA 3QVTA 3T7EA 1NPTO 3E5MA 4XYMA 3LT2A 1DIHA 5TT1A 2VHYA 3IJRA 4J1SA 4Z0TA 1X14A 3GDOA 3LF2A 4JK3A 5BQFA 5COBA 4J2OA 1Y5MA 4LRTB 1FXSA 4WNIA 1R0LA 2EF1A 2VYNA 1PL7A 1PL8A 4IJUA 4NFYA 4CM8A 3ZWCA 1SEVA 2HAEA 1XA0A 4I5GA 4M55A 2JD1A 4E31A 3KUXA 5KIAA 3RFTA 3BHMA 3L4BA 3HG7A 4TQGA 1ISIA 1UDAA 3T4EA 3VH4A 3WFJA 1B26A 2V6BA 5I7EA 1T24A 4TMFA 3WLFA 2E82A 2O48X 1R37A 1BGVA 3DEYX 3GZ4A 3OIDA 1W4ZA 4JX8A 1A9YA 4PN3A 1EEHA 2YV3A 4PLZA 5CDGA 3WDSA 1AN9A 3O4RA 5A3JA 5JO9A 3FRJA 3D3WB 3OA2A 4AVYA 4EGFA 5KVVA 4AJPA 1I2BA 4I1IA 3TZKA 3EVTA 1E3SA 2DTXA 5AXCA 1TVEA 3KXDA 3L6OO 3QVSA 4LCEA 1B3BA 3PVZA 1NXQA 2BFAA 3KV3O 4Q9NA 5JE8A 1A7KA 2PTGA 1DFGA 1E7MA 3P19A 3U49A 4MP6A 2IZZA 4R9SA 4BMVA 1SOWA 3GEDA 1ADBA 4MO2A 1T2DA 4CUKA 5GY7A 1SNYA 3FPLA 4PZCA 4DRYA 4KQWA 4EITA 5CPBA 2HCTA 1Z45A 2D3TA 3U4CA 3LYLA 1P45A 1YOVB 3VTFA 1O8CA 2HJSA 4R5MA 2EW8A 4NZ9A 2QZ9A 3IKTA 3MJCA 3W6UA 5LDHA 1DRWA 3Q1LA 5K6AA 1QMGA 4WEQA 3VVCA 4ZJUA 4DWVA 5JS6A 1S6YA 4EJMA 3AOGA 4U8GA 4ND2A 2XXJA 3NDRA 1DIBA 4OXNA 1HE2A 4DQUA 3QSGA 3HSKA 5T8KA 3JSAA 5DBFA 5L4LA 1PJQA 4GAEA 2RAFA 5DF1A 2VHZA 2FPPA 2OHXA 4J0EA 1I01A 3GNQA 1LDGA 1LDMA 3OM9A 4CLXA 1I32A 4DYDA 4RLSA 4CLHA 1IE3A 4H15A 1EVIA 1LQUA 2AEFA 4NDNE 2DQ4A 3UN1A 2YHIA 4EW6A 4RCVA 3G17A 5K6AC 1B3RA 3ZWBA 4A10A 1DIGA 5LCXA 4AJOA 5ENVA 4HFMA 5ER9A 3PTZA 3KSDO 2A9FA 2NTNA 4YT8A 4YJFA 1P1IA 1Y81A 3INRA 1GCUA 3E18A 3KHUA 5U4QA 1TLTA 3D4NA 3BMNA 4UREA 1QLHA 4O0LA 1Q7CA 4J7UA 1M67A 2AE2A 4KTVE 3JQ8A 1VL6A 4Z9FA 3AOEC 4IDCA 3DTTA 1L1FA 1C0LA 4FW8A 1ORRA 2I76A 1UP4A 3FTPA 2VQ3A 3R3SA 4YT5A 1O95A 3BMOB 4CM6A 2CFCA 4L4XA 3S8MA 4DTIA 1PS8A 2VHWA 4E5NA 5CDSA 3W4IA 1U7HA 4WNCA 4AJ4A 4RVFA 3SC4A 4MKRA 2HKIA 3DC2A 5BT9A 2PH5A 4L75A 4NBTA 4PLWA 4E12A 4ALJA 1NP3A 4DBVO 3FF4A 2GUGA 1K6XA 3P7MA 5C7OO 1B8PA 1PSDA 1E5LA 4DC0A 4CLOA 2FSVA 1KYQA 1YKFA 4R9RA 4XCVA 4WUVA 5ES3A 5BNTA 1R15A 3OSUA 1CQJA 1I36A 3IDSA 3WBFA 1NQ5A 1LSUA 4XQGA 1Y6JA 3V5NA 1AHHA 1SAYA 4UVGA 4I5EA 3Q9UA 1YL7A 2Y1OA 3K92A 3CTMA 4YQYA 1N7HA 5L7YA 2CDBA 2PZMA 3OETA 2X22A 3RJ9A 2D0IA 1C1XA 1R12A 3FWZA 4OQYA 3TL2A 4J1TA 4KQXA 2FZWA 4UUMA 1PJSA 2ZTVA 1JKFA 4XIJA 3RIHA 1GCOA 2G5CA 4NFHA 2GGSA 3KLPX 5LC1A 1BTOA 1SMKA 4YACA 4BO3A 1ULUA 5H81A 5JY1A 3OJFA 1JA9A 2C54A 4KTTE 1NWCA 3FNEA 2VZ8A 2HQ1A 3E9QA 3P2OA 1NWHA 1UJMA 3UKOA 4XIYA 2R00C 1HLDA 4Z0PA 5JNLA 3F6YA 1O94A 2ZYGA 3VH1A 1E7RA 2HSDA 3H65A 4RF5A 3PWZA 3ANMA 5IDXA 1BVUA 3MJTA 4CM7A 1EK6A 1CQIA 2HK7A 3RCBA 5FEUA 1A4IA 4JGBA 4YJGB 3HQ4O 5JY6A 1DRUA 2EWMA 1T4BA 1ZO8A 4OOEA 5EJ2A 4JROA 3V1YA 3WGGA 3SC6A 6LDHA 3O8QB 4RGBA 2DU8A 3NGXA 1ZKMA 3WNQA 3KEOA 4IPTA 2CF6A 1T1RA 4W9NC 5CAEA 2HK9A 2ZTLA 3OIGA 1GD1O 4HKTA 4KWHA 5DP1A 4RVDA 4DIOA 1PZGA 4I5FA 4IGFA 2PD3A 4R54A 1ZSNA 3KSUA 2C59A 4Z0HO 4OKNA 3V2UA 3MJSA 4W4TA 4Y6SA 5JCXA 3JQ7B 1EQUA 1NPDA 2CD9A 1DPGA 3Q0EA 1I10A 4OH1A 3AY7A 1HDYA 2DUUA 1E1NA 3KETA 2FPGA 5JAZA 1XYGA 2VOJA 1C0IA 2E37A 1JW9B 3D3EA 1D1TA 5AVOA 3L77A 5TNXA 1QSGA 4KUEA 3M1AA 2BI8A 2OMEA 3AFNA 1LDNA 4D42A 1H9AA 1UXIA 2YDXA 3ONFA 1QRRA 1P1RA 1KY5A 4TROA 4WLOA 2HMVA 3CXRA 3LT1A 4Y6PA 5TJ9A 2X1HA 2C7GA 4O6VA 2ZYDA 3C8MA 3QWIA 2OO5A 4K9DA 3FBGA 4IXTA 4WCFA 4W9NA 2DBRA 2YV1A 2P2SA 1PWZA 5T64A 1NX6A 5TQVA 5TS3A 1KOLA 4J9VA 2EGGA 1P9LA 2WDZA 4PLHA 1Y8QB 3I9JA 4CMEA 3LQFA 4J0FA 4UEKA 1PR3A 2D1YA 4CUJA 3FNGA 3AY3A 3JQ7A 1DC5A 1XHLA 2O3TA 2QYSA 1AHIA 3TN7A 2ZQYA 3JQ8B 1E92A 3LLVA 2P9EA 2HDHA 2QQ5A 2V6GA 2C7VA 1A71A 1Y5RA 4D79A 5TLSA 2BELA 1VJ0A 4KDEA 4AJKA 4KWIA 2F00A 4WASA 2WYVA 1N7GA 3DBHB 1QYVA 1YB4A 1YQGA 4Y98A 5KJ1A 2R00A 4YJFB 5ICSA 3I9LA 2C20A 4IZHA 1K5HA 3LC7O 1UXGA 1DFIA 2B37A 3WSVA 2HK8A 4AJHA 2W8ZA 3HZZA 5EQDA 5JXWA 4Q3EA 3DOCA 4HP8A 3GZNB 4BNMA 1ZW1A 2XPCA 3SLGA 3B1JA 5A4DA 2W2KB 1LA2A 4H7PA 4FPXA 4BO6A 3BTUA 1MP0A 3AM5A 1NBOA 1VLLA 3WGYA 3OBBA 2AQHA 4MJLA 1GPJA 1D7OA 2YUTA 1HYHA 2JFGA 1PIWA 2Q50A 3AW9A 2R6JA 4NK5A 1PQWA 3JQBC 1VKOA 4PGFA 1N2SA 3GEMA 4OSPA 1LQTA 2Q1UA 1NVMB 3PHGA 3QLJA 1HZZA 4RF2A 4RVSA 3RUAA 1MUUA 4MP3A 1UAYA 2Q99A 3EAGA 4ALLA 2ZB7A 3DOOA 3OJOA 3PZBA 5AYVA 4E13A 1MB4A 4B4UA 3WICA 1BW9A 1P77A 3B70A 5L45A 2I67A 4NJMA 1NASA 4I8XA 1TT5A 1NR1A 1DBVO 1XGKA 5BR7A 1SZJG 4P4LA 1KEUA 2D4AA 4RQTA 3V1UA 3L6DA 2NVUB 3CINA 1IZ0A 4YQZA 3DZJA 3HUDA 3QW2A 2HJRA 4Z9YA 1ZFNA 3AJRA 4HFRA 3KB6A 3TOXA 3OECA 1B7GO 2OUIA 1OZAA 4TVOA 3NX4A 3DBVO 3WG9A 4W7HA 1I3LA 4XGIA 5EN4A 3NT4A 3HE3A 5LDGA 3GVXA 2ZYAA 1QR6A 3DBHA 1D1SA 3HN7A 3S2IA 5BSHA 4GMGA 2Y1CA 2IYPA 4N18A 3ZU5A 4BO7A 3DFZA 2O3QA 3G79A 3EGOA 1F06A 2GF2A 4A5OA 4BO2A 2Q1TA 2Q1WA 2IEDA 3NT2A 1ZNQO 4PVCA 2VWHA 3RU7A 4TRMA 3KZVA 2FR8A 4BNVA 1IHXA 1DJNA 5COAA 3G1UA 1SB9A 3W8DA 4TRJA 1LLDA 2GLXA 3FTNA 1YL5A 4JBHA 3ETGA 3PYMA 5C7LO 9LDTA 2WTBA 5HS4A 2C82A 4Z9XA 4XJSA 4XEHA 5A02A 1YOVA 4WLVA 2C2YA 5IDQA 1TA4A 1YB1A 1A9ZA 4R16A 3TNLA 3WQSB 5DOVA 1ML3A 1NHGA 1NM5A 4WLUA 3UAGA 3H9GA 5JDCA 1GV0A 2CVQA 2PNFA 1FJHA 3ZU3A 1P1HA 2Q2QA 4RF3A 3ZWOA 4CV1A 3W4KA 1RPNA 4HUJA 3DL2A 3PZRA 4WK6A 3H9JA 1I3KA 2VZ0A 3QWBA 4MVJE 5AXBA 1XU9A 1Z7BA 4YJGA 3C7AA 3JQBA 3PP8A 2Y1GA 4J49A 4DPKA 1PZHA 2I9PA 4II3A 4BNZA 4GVXA 1B8VA 5K9ZA 3DO5A 3MJVA 3P2YA 1SEPA 1DC4A 1SB8A 1YQXA 4ZA2A 3HDJA 5KJEA 4IINA 2O50A 1VSVA 2FOIA 2W98A 5CEEA 1PZEA 1EE2A 1KEVA 4GLLA 4IJWA 4IUYA 4L74A 1CF2O 4QUKA 3DAPA 2IODA 3D7LA 2RCYA 4TRNA 4XYLA 3WQRA 4UUOA 1FDUA 3AU8A 4IGEA 1E3WA 1R6DA 3NT5A 2TMDA 2YQ4A 4ALMA 3JQ6A 4PLGA 4RO0A 5FWNA 1BXGB 3DB2A 3GNTA 3UVEA 4BNJA 4E5MA 1M2WA 2A35A 4IJVA 5DBGA 3MZ0A 4GBJA 1YRLA 4PLCA 1AXGA 3MTJA 4TZTA 4KDFA 2CUKA 3L6EA 3VVBA 4DL9A 2P4QA 1DLIA 4TSKA 5L4SA 1BG6A 4J91A 5EPOA 1I3MA 2WE7A 4XJTA 2R2GA 5IFLA 1ADGA 3DAFA 4NR0A 2DFVA 4CJXA 3QVOA 3RUFA 3A28A 4E5KA 4YTEA 1GEGA 1E0DA 1C3VA 2GN4A 1JDJA 2DLDA 1P33A 2NACA 3FPCA 3IUSA 5TF4A 1TI7A 1ZK4A 1GDHA 2ZIZA 4ILKA 1ZZEA 2OXIA 4F45A 4YAKA 1YB5A 2I66A 4Y8VA 3EK2A 4M86A 5CDYA 1E1LA 2Q45A 3F5QA 1P3DA 1R4NB 3UW3A 2X0NA 1EBUA 3DDNA 4CMKA 3I83A 4HY3A 1PS9A 1P74A 4BO5A 1E6EA 2JFFA 2DC1A 3A1NA 3GDGA 2ZJ1A 1O89A 2Q49A 3Q11A 3T7CA 1SPXA 5IF3A 4AJLA 1ZCJA 4LSWA 3DTYA 2X86A 1N8KA 1OC4A 1HYEA 1ULSA 3GMSA 3JQFA 5G2OA 3ZWMA 3RAJA 4B3HA 2PKQO 3JYLA 5JDIA 1X15A 4YYZA 3RKRA 4PZDA 4P8RA 2Y67A 2H9IA 4NJMB 1DO8A 1BDBA 1Y9AA 2JCXA 2WYUA 4QO7A 3CE6A 2WD7A 3BAZA 2J3KA 1HDXA 1P0FA 2BKAA 2DPGA 1EVJA 5U9CA 4Y67A 3MCVA 2IRWA 3AI3A 4K1LA 3BMCA 2GZ2A 3WNVA 1GQYA 2GCGA 4BKPA 1HDOA 1ENYA 4LGVA 4WE3A 3EYWA 2CSUA 2WWRA 4YB8A 3H7AA 4EI2A 2I6TA 3PQEA 3PJEA 1JKIA 3ULKA 3OFSA 3BA1A 3PJGA 4BV9A 2VYVD 4PG4A 4PLYA 2VOEA 2J5QA 3PEFA 4AICA 1JWAB 4DIFA 4XQ9A 4A7PA 4EUFA 2BFOA 4JJFA 1ZJYA 3ZV5A 2GERA 3LT4A 1E6UA 1WLYA 3HN2A 4ID9A 4YVFA 3WSWA 2H1SA 2XF8A 1QYDA 5A03A 4MVJD 1WZIA 3RUDA 1GUZA 3NAQA 2RBEA 2H5LA 1CWUA 4J1NA 3QP9A 3BHJA 2ZQZA 3H5AA 1ZEMA 4LW8A 2H6EA 5JDIC 3P5SA 3UCEA 2FR0A 5L7TA 2BMAA 5KCZA 4CMGA 2C07A 5JAMA 4JXKA 4FC7A 4DGSA 1YWGO 3RC2A 3ZU4A 4MP8A 3KYBA 2I99A 1T1SA 4BNUA 2FMUA 2LDBA 4KUHA 3ZWVA 4H3VA 4LVCA 3FHLA 4NBRA 4A26A 3QJ5A 3Q3CA 2UUPA 2DBZA 1IUKA 4XX0A 1WPQA 5I9LA 4QX6A 3C24A 3MJ4A 3ZU2A 1Q7GA 3C1OA 3F5SA 4JIGA 4FGSA 4DA9A 3M6IA 1H94A 3ZNNA 4P4GA 2IDZA 1ARZA 2PLAA 2VWPA 1NQAO 5L53A 5T57A 3R6DA 2PD4A 2QRKA 3GG2A 3GH3A 3DHNA 3ONDA 3S2FA 4BB6A 4DQXA 2SCUA 4GH5A 2Y99A 4ZQBA 1DC3A 4WCDA 3LZ6A 2VNAA 3JD4A 4YEDA 5KNLA 1PGNA 4GSKA 3PHIA 3FNHA 1AE1A 2VZ9A 3WMWA 2I5PO 1Z74A 4OO3A 7ADHA 4OGWA 1P1JA 1KVQA 4LVUA 1U2GA 2GYYA 3RVDA 1O5IA 5IN5A 3CH6A 2OFPA 3O38A 1N92A 1G0OA 4OSOA 4KZPA 5ITWA 1U1IA 1CDOA 5GMOA 1ONPA 1YH3A 1K0UA 2O3UA 3A14A 3CMCO 2H63A 5JCJA 2FRDA 5FF9A 1A5ZA 2OGUA 4IZIA 2O3JA 5JLAA 1FK8A 1E3EA 1NVTA 1HLPA 3HDHA 3E1KA 1B16A 4N5LA 4RV9A 3AK4A 3O8QA 5B12A 4RZIA 2CF5A 1E7QA 1OI7A 3CZMA 3DZKA 5IXYA 2C0CA 4O5OA 2J5KA 4J4HA 3RJ5A 2G17A 4TRRA 1V8BA 2B4TO 3VDQA 2FN7A 2X4GA 5IXSA 1RKXA 1WP4A 2POQX 3B1KA 1O6ZA 3L9WA 3ZZNA 2O7SA 4GKBA 4A2CA 1FDVA 1LUAA 4YAEA 3EY4A 3WTCA 2D5CA 5JC8A 5L40A 2GZ1A 2VRBA 4OXKA 1CERA 3LF1A 2RHCA 4CV3A 4WGGA 1FDTA 1DSSG 3QHAA 1IHYA 1OFGA 2PK3A 5CG1A 3LT0A 1VC2A 1WWKA 1DXYA 3ZWWA 1LU9A 2B35A 5BNIA 3PJFA 4NBVA 5HBRA 2FHSA 3HNPA 1RYDA 2Q2WA 1B15A 4IMPA 3ADOA 4CMHA 4O59O 1RM4A 4MVJA 2VT2A 4IBOA 5I8ZA 4NK4A 2OORA 4NU6A 1WW8A 3OJ0A 1KC1A 1IZ9A 4BMNA 1RYEA 2GN9A 2YDYA 4AJ2A 4UVDA 4LCJA 4OL9A 1W0CA 4CQMD 2O2YA 1NHWA 2O3SA 4JP3A 3WR5A 3GY0A 4GGPA 1JLLA 4GX2A 1GAEO 5L3ZA 1PJCA 3VKUA 1MGOA 4NBUA 2GNAA 4GL4A 1MX3A 3WBBA 2VUUA 1VL8A 2ZCVA 3GN1A 4XDZA 1IY8A 3U09A 1QLJA 4CV0A 1C0PA 5TC4A 3TZQA 3IIEA 3JTMA 1U7TA 1LDEA 5T67A 3AUUA 4BO4A 3RWBA 4J3FA 3I9NA 1E7SA 2CVOA 1NYTA 2JFHA 2AEMA 4NFSA 1XQ1A 4U0KA 4CM3A 2HO5A 1KVUA 4F46A 3WIDA 4WLEA 5HTOA 4FS3A 1XSEA 2BRUA 2E6UX 3FI9A 3PDJA 4CMJA 4YT4A 1H5QA 4BKRA 3GPDG 3BHIA 4RQUA 3B1FA 4FFMA 2EGHA 5DN9A 2XAAA 4K6CA 2P5YA 3M2PA 4WJZA 2QYTA 5C5IA 1YBVA 3G49A 1WNTA 3JD0A 3QWHA 4A03A 3UCXA 4NNJA 5TGDA 4E4YA 4DLBA 3PFWO 1LXCA 3GRKA 3HWRA 5BSEA 1WMAA 3U3XA 1TXGA 3ETEA 2YHIB 3F4LA 4XDYA 5L95A 1A27A 2B4QA 3PXXA 4FJ2A 4C7KA 4RJTA 2YFHA 1MV8A 1T26A 3K30A 4L76A 3CUKA 5IZCA 4B8WA 1PQUA 1BSVA 3TPCA 2VHVA 3NGLA 1KBZA 1LJ8A 1GQQA 1XCBA 2D2IA 3QV1A 2PV7A 5CPFA 1TT5B 1GPDG 2UAGA 3DMTA 5GZ1A 4BNKA 4CQLB 4WEOA 4U6QA 1Y8RB 4NQZA 3S1LA 1EFLA 2DAPA 3KYCB 1K89A 4BNWA 3I3OA 3UFXA 1LDBA 4XQCA 4J90A 4B7XA 3GPIA 3JYNA 4Y9DA 3WGQA 4BNIA 2W2LD 4NJOA 5ER6A 4O1MA 3TFOA 1AGNA 4BO1A 3HJAA 4CLRB 3AM3A 2O2SA 5EQFA 1YJQA 1CIVA 2ZKLA 4GI2A 4O63O 3W4JA 1LC3A 3H9UA 3HHPA 3D64A 1M6HA 4FCCA 3NTRA 4GX5A 2VYND 3AFMA 4XB2A 5DULA 4NPCA 2FY8A 2Y0CA 1ZK3A 4DUPA 4RVUA 2V65A 2JCYA 3DBRB 3BMQB 5C37A 3H2ZA 3DBLA 3RBVA 1F8FA 4QECA 3ITDA 3ZV4A 1K6IA 1WDKA 2FPIA 3GAFA 4HNHA 4PRKA 1X1TA 4Q39A 1DAPA 2O3RA 4UAGA 5TJHA 1MA0A 1BVRA 2IXAA 3LC2O 1NVGA 3K96A 1M6WA 1J4AA 1SC6A 4XR9A 3RD5A 4YA6A 2NVUA 3TDKA 4GVLA 4UEOA 1HF3A 3D0OA 4NU5A 1GZ6A 1PZFA 4BOYA 4EJ6A 2EJWA 2RH4A 3Q6IA 2YFQA 3WYBA 3RUCA 3NJ8A 4BNTA 4CM1A 1N9GB
chains in the Genus database with same CATH superfamily
1SUBA 1VNDA 2A6PA 1TNTA 2JD2A 1K8XB 3KVOA 4EPTA 4OQ4A 3GLFB 3S70A 4HAMA 2B78A 2QQ0A 4LK3A 1WXHA 2I7DA 2Y0DA 5C1OA 1UJ8A 4OIPF 3KB1A 4HJXA 1T1EA 2GPNA 2ADUA 1TJPB 4IQGA 4D4KA 3K2ZA 4AJ9A 3NDJA 4M1TA 1TE2A 1Q0HA 3PX3A 4RKEA 2I62A 13PKA 1ORDA 5FFFA 1U0HC 1O77A 2Q2EB 1E3JA 1P0PA 4MRNA 2F5FA 4BS9A 1KNXA 1L4HA 1W9MA 3R3ZA 1RI5A 2G88A 1BCRA 4PBTA 3LHFA 2AZTA 4MINA 2Q2NA 2N8GA 2O52A 4UBNA 3AF3A 2C96A 4JX9A 3SX2A 1QS0A 2OV4A 4M1MA 1Z5NA 3WHLA 5JH7B 1AZTA 1EP3B 4GBGA 1YI1A 5F3DA 1MNMC 1QK4A 4IDPA 3NHKA 1TAHA 1Y9EA 3I9V6 2WHXA 4JUCA 1M8GA 4Q3CA 5LHHA 4QTZA 4ZRMA 2R85A 4Y1RA 4TZ0A 2HDWA 3L6RA 3R6WA 3DFGA 3OZXA 4QJ3A 1KRXA 1GEEA 4YR9A 5LSAA 2D1RA 3Q9NA 3HRIA 1RRFA 1JHMA 1RFGE 2FAXA 4CCSA 2W90A 2VJ4A 4CL3A 2FUG6 2AA3A 3WA6A 1FPMA 1B1AA 3W5SA 1UJ6A 2CQXA 2QLZA 2XRFA 5FFMA 2JUCA 3ASZA 1RWOA 3GGPA 3RUEA 4ENMA 1JR2A 1THZA 3VTZA 4FKZA 2F3UA 3PKIA 1XVTA 1ZQ9A 5IAAA 3Q5FA 3NUZA 1B6SA 3JQAD 4Q24A 5IJ9A 4MB6A 3KYCA 4KW7A 1NQOA 4EB8A 1E5XA 2Z5UA 3HFGA 2XCOA 4HDRB 4X1EA 3SFVA 2HR1A 4WNAA 2QUBA 5CJJA 1TO1E 5F76A 3TGPA 3FPBA 2X9QA 2B7LA 3KHKA 2NPOA 4I5DA 4QBTA 1BE0A 3RC9A 4V19K 1I3OA 3ASOH 3OG9A 2YCBA 4U02A 4DCJA 5FADA 2WSIA 5DCMA 4E5YA 2PBRA 2ZEJA 5TPWA 1FNBA 5B3JC 3FGOA 2CJXA 2VDOB 3C7CB 5CFRA 3VODA 3NV9A 4B71A 1AU9A 4GMFA 2HWWA 5U4XA 1IUFA 5TY0A 4MVJI 4UAUA 2DY1A 4OAZA 1JH8A 4AP9A 4XTRA 3I2HA 4BE7B 2FMHA 1HNNA 2GS9A 2BH9A 1GA1A 1RLMA 3DMYA 4QL3A 1AU7A 4Q4AB 2QY6A 2ZLBA 1XTRA 4BGIA 3NBXX 4QPPA 2MBFA 2DKFA 2BMFA 5HJ2A 1WQ4A 3EVDA 2HJVA 1XD2B 1TDJA 1OXXK 5GZ3A 1THMA 2O0KA 5DEQA 2QSJA 3HR8A 3DE2X 4OQXA 3F7NA 4Q93A 5DASA 3T7TA 1PNVA 4N41A 5BYAA 5IS2A 2P5UA 4IY1A 3A4VA 4GI7A 5D6EA 2R8EA 3P8ZA 1WLSA 2HWKA 4K8OA 2VHTA 4KDCA 3A1YA 4BEBA 4DCSA 5JFTA 3JRDA 2YNMD 3NAGA 3PKZA 2KZGA 1ZLJA 2V7PA 2B4YA 4KP7A 4TL6A 5DCUA 1B4DA 3WTBA 4LJ4A 1TPZA 2NNLD 5EAIA 4C2UA 3AUXA 5HE9A 3RS7A 4HEJA 1W36C 3ZY3A 4KXLA 4BFUA 4Q3KA 2PKWA 1JAXA 2OUMA 3W2WA 1DP3A 4KMRA 5G4KB 1F4VA 2XAJA 4MUYA 4OMDA 4QBHA 4Z9AA 2GO1A 1XMOB 4HV5A 1PGJA 1DGWY 1R0ZA 3NJ4A 4E7OA 3BCRA 1YDFA 4AN4A 4RTMA 4ZYHA 4RLFA 2NWQA 3C5VA 1KJZA 1KZ7B 2OJED 2IVZA 1S7EA 4TTSA 4YFYA 5CT4A 1MH9A 2JHFA 3DVSX 5J4VA 4C4ZA 1SCAA 3RS3A 4E3WA 5KTPA 2QRJA 1F38A 2QQ8A 5BNZA 3AUYA 4A1OA 3ZE0B 2WF9A 4AJPA 4X66B 5AIQA 4QPDA 2C00A 2ME6A 1T6XA 2MA3A 2V7UA 1I6LA 5F4ZA 4U0WA 4LV5B 4H35A 4AJNA 4BKXA 1PJBA 2ZVPX 3H5TA 1RAGA 4Q6WA 3R24A 3BGDA 5F1JA 6REQA 1M0TA 3QVUA 2QTFA 1ZWLA 3OQPA 3A1TA 4FSHA 4OP2A 1AQ6A 4TS4A 2WAQN 1R4AA 3J7ZI 2EEPA 3VSLA 1G4HA 2VRCD 3KYLA 1MH1A 4YCDA 3W7VA 5DM2A 5K05A 3UPUA 3KLOA 2WADA 1NYQA 1CUWA 2PX3A 3EC1A 4EJSA 1LBTA 2ISYA 5BXYA 1C80A 5IVKA 1CQTA 4EGYA 2DPHA 1U7UA 3T9CA 2IQIA 4ZYGA 3WGTA 4M1ZA 3HEAA 4R8VA 2DI3A 3LDHA 1O7LA 1U6GA 1C1HA 1KMQA 3TD6A 3PSFA 2B9EA 2XV4S 3QJYA 3T9DA 9GPBA 1SRQA 5JNSA 1KSJA 3WGHA 1DKPA 1LC0A 2NVBA 3GVHA 3QMMA 3FMFA 4P3YA 4XD7D 4DPLA 1VJDA 2DULA 2WPDA 1UT8A 4JEHA 3HIFA 4EO4A 4BLUA 3ICOA 3HOTA 3QYFA 1V47A 1Y7LA 1WJEA 1N2OA 1TJNA 4JP1A 4AG5A 5E3MA 1MF7A 2FEZA 1E8NA 1Z0FA 3KYDA 5PGMA 2ZRHA 2W2NA 5FOUA 1EH5A 4ZYEA 2DR0A 1Y4SA 2IK8A 2OCXA 3F4BA 3R3XA 1TYDE 4YRFA 5ES4B 2CNLA 3SJ7A 2C9DA 2H6CA 2HA3A 4B85A 3GDWA 2OHFA 2QQFA 3PI7A 5DNYB 4K9RA 1WPKA 3BROA 2FPWA 1PT7A 2XECA 3CVOA 3R3VA 1V96A 1NV8A 1FBSA 4MA0A 4MCIA 3OU2A 1T2NA 4PTYA 3M6WA 3L1KA 2CXOA 2HH9A 3D5TA 4R1QA 4AWBA 4EGQA 8MHTA 2JIMA 4MI1A 1QIKA 2NG1A 1VE7A 4REOA 4ZVUA 3LUJA 4L78A 4ER3A 4A5NA 1NX9A 3INTA 1VCHA 3L2OB 4EFKA 3BE8A 3C3YA 1RPWA 4TWRA 3RJZA 3WK5A 3MFYA 4WN9A 5IVPA 3TGLA 2HHJA 3IT3A 3FBIB 3WGIA 3EULA 5D6OA 1UL1X 5EXEA 3SZUA 3VSBA 3KQOA 4EATA 2IWRA 2G9ZA 3WTTC 3LUGA 3RVPA 4DMGA 1F5TA 2VJJA 3UB3A 3O4JA 2LY9A 2ATVA 3E9MA 1ZA2A 4X60A 1S3JA 2VUSA 3L0ZA 3GRUA 3P97A 4H7KA 5BV2P 2WT8A 2QW0X 1E63A 4AZ0A 4U2GA 4B75A 1LDJA 4L0YB 1JDPA 2CVFA 2PFGA 3HKCA 4MGYR 4LJRA 3BWGA 1E3IA 3K9QO 1WGXA 4J9UE 4M0LA 4C3VA 1J22A 4E21A 3NM5A 4HB0A 3NP7A 1FFGA 4GOOD 2A4KA 2IYOA 3FSGA 3FVVA 4KJXA 4QRDA 1G59A 1JDBB 2VS1A 1SUEA 3MRVA 4EJWA 3IV5A 1JUSA 4TZ6A 1L4KA 1CIPA 2X0RA 3RVMA 4A27A 2CWEA 4MS1B 3ZCTA 1LWNA 3GX4X 3GEGA 1GXQA 4GDFA 4CEJA 3MRXA 3DNFA 3IEIA 3VHRA 3ZW8A 3I61A 2ERYA 1DO0A 1TJ5A 1T6SA 5EMNA 2BSXA 2QG9A 3G9ZA 3PNPA 4LX0A 4U7TB 2BFBA 4AVZA 3ZNQA 4QXPA 3PE4A 3GLFE 4E70A 2KWIA 2VA8A 3LVBA 4J43A 2E1OA 2H85A 2LY2A 1GNLA 4JS0A 3GF2A 2PJZA 1QQ5A 1UDRA 3IMEA 4G81A 4M98A 3VAZA 4RDIA 2V1XA 1E2LA 1NXPA 5LZ8A 2O8BA 2IYXA 4HK4A 2OCPA 4EENA 3V7CA 3FFXA 3RR2A 3JASB 5J4LA 1KPGA 5KWEA 1R0SA 1E3OC 3MBIA 4ND1A 3UEOA 5ALUA 3BQYA 4HJRA 5DRTA 1L4YA 2ZP1A 3A8TA 1GLGA 3K8QA 1NW7A 2RGBA 4B7UA 4TKLA 5K0EA 1YIOA 4QBIA 4Y0AA 3FSRA 4ZH4F 1U8TA 4L8WB 2EFOA 3K0FA 3PC7A 5A4MS 3CF0A 2AZXA 3BXZA 1VTNC 3F6EX 4XA8A 1SD1A 5ILUA 4YGYA 2HIGA 3T8YA 4DTCA 5ETJA 4XD7A 2PJRB 2ZCUA 4BWYA 2H2WA 1W7AA 1M2VB 1FW8A 2QTMA 1XXHB 5A6SB 4RJIA 3VMMA 1HBXG 2Z4RA 3ND6A 1XGNA 4BU1A 3TF5A 4LVOA 1YYVA 1BX3A 4HTFB 4DNQA 3J7AC 3U3KA 5LXTA 3PHHA 4XLCA 3O91A 3UY4A 3JQGB 4F6LA 3AR3A 2LCIA 4GIBA 4UVHA 4BIMA 4NEGA 3K9BA 4A2PA 1MKYA 1E61A 3K2AA 2PEYA 3OQ1A 2OC6A 3DEEA 4KFUA 5K5EA 4QATA 1U2DA 2CCJA 2VHXA 3FCEA 3PFCA 3PNBA 3CO6C 3EN0A 3S28A 2Z2KA 5BN5B 3GT3A 4DYHA 4XM1A 2I4TA 2Y3IA 3LSYA 2GZHA 1VIYA 1X1BA 5CNJA 2QTAA 5G3YA 3ZD9A 2C7OA 1WXIA 3TINA 2GEDA 3G5AA 2OVFA 5JW6A 1ABBA 1EK5A 2WM8A 3ZX5A 2PY6A 4R41A 1R5ID 3GGDA 1E3HA 1TBXA 2J5PA 1PKEA 3AHEA 3ESBA 3KU4A 2ACVA 3NWJA 4KQFA 1JXOA 4LXTA 3TD2A 1Q1HA 3P9SA 1ZKGA 4EYEA 2EKBA 4TV8F 3K8ZA 1EDDA 4OXXA 4KO2S 4UXJA 1ZICA 4R8HA 1SD2A 4Y7CA 2QRHA 4BIIA 3SBXA 4EY5A 1G2QA 2JL1A 1E5VA 1I2DA 3TMOA 1UJBA 1LQ1A 2AS0A 2JHGA 3WO1A 3T3HA 2JDIA 1NW8A 2QY9A 2FXAA 1GZ4A 2GLOA 1LNZA 3C7DB 2J07A 3FPHA 1MAVA 3L6UA 1FWZA 4PLFA 2PNJA 3CCVI 2PVSA 5BWOA 4KIBA 2QMUA 4BPRA 1VHLA 1MC5A 4XOUA 4QPZA 5DJ5A 1Y8QA 2AOTB 2W48A 1F20A 3MRSA 5ARCA 1OD6A 1AKQA 1EIZA 1FTNA 3V7UA 3AONB 1Z5PA 2VCHA 2XB9A 3TLXA 4UM7A 2MD0A 3WJ2A 4PJLA 2F55A 3FHTA 4NCJA 3RI3A 5CEJA 3PHCA 4FFVA 1M1YA 2L9VA 2W2OA 3P9RA 4QXMA 1JEYB 4YG2F 1SCQA 2YFKA 2QTZA 2XUAA 1PQYA 3W5AA 3BJEA 4HNTA 2FUCA 3AJ9A 1F48A 1TWAJ 2WYOA 2IBTA 1DDOA 2YWEA 3BCAA 4HYEA 1B2LA 4XYEA 4E2FA 1VQ8I 1IY2A 2MW8A 2O23A 4LLLA 1G8PA 2AZMA 4PYQA 2RH8A 2JLRA 2G0EA 4M1WA 5FLEX 3L1HA 4D3SA 5JH7A 1BS1A 2JPCA 2DYRH 1CJVC 3M1EA 2W7NA 3QY9A 1Z8FA 4L4ZA 3SD7A 2AC2A 1QQBA 1BDMA 1SKQA 1WMBA 2G40A 1T35A 2EAUA 1RRMA 4PZ9A 4B0PA 4FD2A 2H57A 2N0SA 4P4UA 2RHBA 3NRJA 3I9OA 4E7KA 1ITYA 2ECFA 1MC4A 1SHZA 2VPXA 3I2JA 2JD0A 3E9CA 4I2OA 2C8LA 2X0JA 3ZIAD 4ENQA 4I9NA 4KWEA 1XSXA 4MWTA 1DV1A 4INAA 4HAZA 4MVJM 1EA7A 4FDUA 5LYJF 1Q83A 2J87A 3CW8X 5G3ZA 3NUQA 1L5HB 3ADDA 4TYYA 5DGDA 1IDOA 5E1DA 5LU9A 1NP6A 4EZIA 1CQJB 1XKLA 4ERNA 1KMIY 1XZAA 2FFBA 4WXCA 5AXAA 4MYUA 5E8GA 3LRPA 1JQJC 4TUYB 1VLZA 4P80A 3O75A 3AKZA 3HVIA 2Y4OA 3TLJA 1XLUA 1XJQA 3NS7A 3RFUA 1SKAA 3GJXC 3LFKA 5CLIA 1FOKA 3ZGNA 4DQKA 4F2WA 1WDMA 1YQUA 3U6KA 2G0NA 1T5LA 1C4KA 4OVKA 4HG2A 3PNSA 3WWYA 3DLTA 2PQMA 4B2LA 1Y3CE 3Q8KA 1V45E 2L69A 2Q5OA 1OVGA 1L4LA 1NLZA 1XG5A 4GDMA 4H6VA 3QPAA 2J3JA 5EYPB 3QX9A 3U7QB 4BX9A 4DF3A 2HW8A 1KEWA 3ZOZA 3LBFA 2WI8A 2LWIA 3K2BA 5KKAA 4EKDA 3K20A 3DEFA 2PQ6A 1WPXA 3PIDA 4QPJC 3IALA 3OIWA 2GZMA 5JQGA 3E5NA 3OC0A 5EXDA 1AA6A 3RVQA 5IZCC 3K94A 2DKOA 1UPBA 2Q0SA 4IYJA 3QUCA 2MMGA 3WGKA 2EIXA 4G8JA 4I1UA 1KONA 4MV3A 4N5MA 4OMUA 5DKFA 4DMHA 3THYB 3RJTA 5KDOA 3X1DA 4OM7A 1KKLA 1SCDA 1XDUA 2P68A 3KYDB 3HLTA 4FX4A 4YCAA 4XX1A 4QBKA 1DKUA 1Y1TA 2OHVA 1RWMA 4BPBA 4JYZA 4Q9LA 3OJCA 3ZR4B 3JQPA 1IEXA 4PXYA 3STHA 2I9KA 1YTYA 1HT0A 3TJRA 1YHZA 1N3IA 1C4WA 1ONBA 3ELUA 3HA5A 4WZBA 4CLDA 3WKDA 4UNQA 1K5PA 1DELA 4GP9A 4CKWA 3OCWA 3IIJA 4RUKA 3HUGB 1H0KA 5F73A 4D9BA 1SRRA 3H05A 1H4SA 4RKYA 1QHEA 3AERB 3SJMA 3HJGA 1E1KA 2AR0A 1Z4OA 4H0FA 4D5GA 5ITZA 2CHQA 2CZCA 1XL1A 3JALB 3QE3A 4N0PA 5E3LA 1B93A 3L0SA 3OX3A 5FAXA 3ZY5A 3ZS9A 1IEVA 3DOJA 1EM8B 1ZSYA 2WFLB 3SHFA 2I54A 3HJNA 4XUCA 1EUZA 3PHLA 1RJEA 4GSLA 1P61B 4RK0A 2EATA 2ZRPA 2J3MA 5B36A 3VR0A 1CEXA 1F0YA 1PFYA 3B1VA 5JBNA 1X58A 4NLLA 4NX2A 2O7RA 4UTVA 1N32B 5SV2A 6PAXA 3A6DA 4MQEA 3SQMA 4B3SB 1X0XA 4LV6A 2Y0SN 1NNLA 3RO7A 8ABPA 3K1NA 2QTVB 5LMUB 4ZQFA 2NT3A 4AKEA 5B7QA 2QF7A 3NWPA 3NBUA 4UOZA 2EDCA 6CHYA 5HKBA 4TN1A 3LCRA 4FMPA 1DT3A 1TK9A 3HGGA 2Q5QA 3VTAA 1ZJWA 2I6GA 4AP5A 5AIPA 4ESBA 5FBKA 3OAAD 4OP1A 4BU0A 3PDHA 1J5EB 1ISPA 2VNKA 4W9RA 2DT5A 1BQEA 4UNIA 5F7JA 3WMGA 2G5TA 1QH8B 3L8FA 3PEVA 2JLBA 3AM4A 2A0YA 3AIOA 1U8XX 3ECAA 4ZCPA 2XQJA 3UMVA 3AL3A 2WSSD 4D0SA 3KB2A 1H85A 3RYFB 4OYHA 4RF4A 2ENWA 3H1GA 3Q40A 2X2OA 2ZCWA 2I2BA 4CN9A 2W9XA 3C1TA 4DEVA 4BVJA 1Y39A 5L51A 2I4MA 4F9FA 2EV6A 1F9AA 3W6PA 3IQWA 1U90A 2OESA 3MOIA 1KHTA 2V1NA 3CVXA 3AZOA 4U6NA 2AMYA 1JHXA 5E3NA 1U2ZA 3I9KA 4WXYB 3TQHA 4C7XA 4DDWA 2P2CA 3QPDA 2IHUA 3VZBA 1C8KA 3G0IA 4CN8A 3GJRA 5CA1F 1A4XA 3OIPA 2OAEA 2VJLA 5AHRA 2HS5A 1AUVA 4LGCA 1M76A 3PDIA 3UWSA 5F04A 5IUNC 3ENNA 3NMUF 1HG0A 1ZOPA 4PSDA 2YXEA 2BJWA 2HB6A 4KIUA 2AXEA 4F2GA 5DDIP 3WGMA 2DTEA 4IDNA 1U3GA 2C4MA 1TLLA 2IHJA 3LDUA 4KUGA 3VI3B 3ZH2A 4EEKA 3BXXA 2ATIA 4C0WA 2DPLA 5JYDA 1BA2A 3OPNA 2CDCA 4EUEA 4V3BA 3JPWA 3CH4B 3E6BA 1YE3A 3NTQA 1JIUA 4Y18A 2H2FA 3DKVA 2PT7A 4OU5A 1G4UR 4DIBA 3ZWNA 4A3MJ 3FFWA 4J0FA 2QAJA 1T0FA 3FD8A 3MWKA 3KOMA 1HORA 3FDXA 2LVBA 3LWZA 1YCFA 1H2AS 2V7WA 2W2PA 4HB4A 1A7UA 1KAEA 3W6ZA 5ABPA 1PP8F 2ZJ0A 4KVAA 4RZHA 3G0HA 3TDNA 1QV6A 4IIVA 3L7BA 4QLCU 4UUPA 4NG5A 5HM8A 3KJNA 4ZO6A 1J70A 1K79A 1GRNA 2VDWA 1SBCA 3MTQA 4JU8A 4YV2A 3UG7A 2XA9A 3QP5A 3ZQ6A 5BSKA 5ILOA 1YU6A 1IBLB 2NYVA 9ANTA 1QE3A 4GXQA 4M7RA 4R51A 4IPAA 1B00A 3ZUGA 2P35A 3UMGA 4EEXA 2ZBPA 1X1QA 1D9ZA 3VRHA 3N4MA 4EQ6A 4W5NA 2CH0A 1UXKA 3KP4A 1R6VA 2DM6A 4LKRA 3GXOA 4MO7A 1LFDB 3E53A 1NUSA 3IAHA 5ALPA 2COBA 2BEUA 1N1EA 2XMCA 3V8EA 5KX5A 1XKQA 4EW1A 3RQIA 4ALNA 3MLAA 2FK7A 2ID8A 3IAEA 5C18A 5DHQA 5JC1A 1UKBA 2C8KA 3ENKA 2BEJA 2YYAA 1B14A 2WHRA 3KAQA 3MWJA 4C7OB 2VDVE 3B2EA 4BUCA 2ZOSA 4FDTA 4ND8A 1SXJB 2E4YA 1H6DA 4UZSA 1T10A 3OA0A 3LOPA 2C95A 2ZAMA 3IOYA 5DGIA 3BJAA 3ZTTA 1I7LA 1E4YA 3F1LA 3MWDB 5DD4A 4JC5A 4NH4A 3OIVA 4EDFA 2XADA 2EBUA 3QPCA 5A05A 1VMDA 3EZ6A 1UANA 5TT0A 2WMYA 1DMSA 3VWBA 1JMYA 1QH9A 1HL3A 2E4WA 1FZPB 1MQ8B 1HDEA 4ZGWA 1L0OC 2QIOA 1RXCA 5FWYA 1ZD4A 2RI1A 1NOJA 1JKXA 1D1CA 4K6MA 4M0UA 3GLGE 1BM9A 3CMAI 3B6KA 2IEBA 1OBOA 3D6VA 3GMDA 3K9HA 3OLQA 4GYWA 2QVZX 4MRMA 2YR2A 1E18A 2IJLA 2GJKA 4U2BA 4DLVA 2LF7A 2J3QA 5DM1A 4FDLA 3DU5A 4YPVA 2V6FA 5KQGA 4KRFA 3KR1A 5LZ5A 2W70A 4IDFA 4H0CA 5KNDH 5ESXA 1JV2B 1Z6ZA 4LOLA 3OOEA 4NOKA 3Q15C 2FX5A 2UKDA 2GCEA 2P3QA 4A0RA 2AMVA 1FYXA 4ZC1A 3MWFA 4O25A 1VDMA 4WKNA 5B1IA 3T9AA 3G4SI 3EEYA 3MGKA 5LB4A 5BN3B 2EV5A 4OATA 5TRTA 2QBYA 3G2IA 3GHYA 3DF8A 2RGWA 4P34A 5HCUA 3SFTA 1V7PC 2HOSA 3IPYA 3RAEC 1AKHA 1ZI6A 5CT5A 4E2XA 2PMZN 2PUTA 1NR7A 1ECPA 2D1SA 2P11A 3TW7A 5FV4A 4G2TA 2KJCA 1CY0A 3M8FA 5JAIA 1IOZA 2IBSA 2V7XA 3DL0A 3HHEA 3Q8XB 7MHTA 2B0JA 3QFRA 2QM3A 1ZY2A 4BE9A 1A2KC 2Z58A 3EVNA 2Z8YA 5AIBA 3QUQA 1L4FA 1SCKA 1A97A 2GEVA 1Q77A 1MORA 2NUAA 3H2HA 1POWA 4HX5A 3CO7C 4RH1A 4ZCIA 2C29D 1TA0A 2HMAA 2JIQA 3MA0A 4AZSA 3FKSD 5FV7A 3OO1A 3MD9A 4ND3A 5BWBA 2JA7J 4BL0B 1K4YA 1O0CA 1JDVA 1JHPA 2C8VA 3PXUA 1X92A 5DXJA 1R1VA 4LK0F 1D1PA 2YWFA 3WB0A 3ZNOA 2FR1A 5AVKA 4Q4JB 2ZDHA 4W6ZA 3CIFA 5EZ6B 4CLEA 4J76A 3PC8A 4QDKA 5G0WA 1KETA 1T25A 2RHTA 1PR9A 2ZB4A 5GGYA 1BIAA 4EZEA 5I7VA 3JYOA 4CQMB 2QM8A 4ER0A 4JLDA 4B8ZA 3RHFA 1NW6A 3RIYA 4NNOA 2YJ6A 4D0NA 3H5OA 3G2MA 4R31A 3LTEA 3IBTA 5LP6A 4MH0R 3WFIA 3GP8A 2P65A 4XLZA 4KN7X 1TL8A 2G5PA 1SFRA 3JD1A 3CMEI 4KI7A 4RCYA 4F96A 2A94A 2E49A 3BDAA 5KOHB 3KLMX 2X15A 5BPDA 3NALA 2L42A 4RADA 1ZGAA 4JB3A 1P92A 2PU7A 1QX3A 3MLEA 2QORA 1NGSA 1SCUA 3IESA 2O8FB 1BZYA 4Y13A 1ETOA 3TCNA 1A69A 2C5LA 2JGNA 1OR7A 4J1QA 1MHTA 2OHOA 2KDZA 2DR3A 2XVXA 3UV3A 2WTEA 3ZLBA 5AD1A 3DKPA 1W0KD 1VIVA 4I9UA 3KKKA 5JS1A 3LI2A 4U7WA 3SP1A 4CM9D 2P4UA 5TMEA 4R1HA 2AW5A 5TRDA 4E1VA 3ER8A 4YV1A 2UVQA 4IKEA 2CLIB 3G8YA 3JZAA 1BXKA 1I5EA 2BW0A 2P27A 2HOTA 4QGGA 2IZ5A 5IT9A 2B4AA 3FPKA 1U6JA 2RE8A 3CO5A 1I30A 3NPAA 4HH3C 1MC8A 2A0WA 3KUUA 3I76A 3R3JA 4W1QA 5EGNA 2EZUA 2LNDA 4DYQA 5FUVA 2ISQA 3AHGA 1AOYA 4IXNA 3IHLA 4O4HB 4B31A 1M8JA 4ARAA 1AKUA 2QU8A 3D54D 3VBEA 1I4DD 1NKVA 4G65A 4L8GA 3U5TA 1COZA 3S1RJ 4G9EA 3RFCA 3U1VA 3VGJA 2IAIA 1BIBA 3LYUA 1RIIA 1SVOA 3M8EA 2WF7A 1IMJA 4ARUA 4DSTA 4RDUA 2R7OA 4S05A 1W19A 2IIQA 5J4HA 2EC5A 3AR5A 1Z29A 2HOAA 1JG1A 3WZMA 5CLGA 2K27A 3IEXA 3LYAA 1ZK8A 1TJ3A 4IRXA 1T2CA 1UOEA 1V25A 1DEHA 3KWJA 3ROMA 1L2TA 1TQDA 1MX5A 1FU4A 3HP7A 3OX4A 2A57A 1KAGA 4MVCA 2XUIA 3K0AA 1XMQB 1KARA 3KWLA 2HX1A 2F62A 4NQRA 5F1RA 2D2XA 3R3UA 5E2IA 4LMRA 3TEFA 1F2VA 2B2XA 3B1WA 4H1WA 1KEKA 3CHYA 2REQA 2VF7A 5J9FA 5BSFA 4MGHA 5FWNA 1OCPA 4DLLA 3MTBA 2OCKA 5F51A 2I3GA 4TT3A 4B2PA 2XCRB 2RB5A 4IJ5A 5TEVA 1F17A 2RGEA 4LGYA 2F1IA 1QP8A 1ST2A 2BAGA 2AFIA 2ZBEA 3DE5X 4OIOF 1XMJA 1CY2A 1YZLA 3HGQA 4HEHA 4MVJG 5JASA 2L2OA 3E6DA 2UUCB 5KC8A 4FCWA 2PH3A 2P2NA 1HT2E 1YZNA 1UWVA 4OHOA 2AMFA 3BFPA 3RF7A 4G12A 3J81K 4G5XA 3N2YA 3ZHYA 3TB6A 2PS0A 4CRWB 2P9ZA 4HMOA 4R3NA 1T0PA 4O0MA 1L0BA 3CVYA 1MKMA 1J9EA 1VI0A 1G8JA 4B33A 5IPFA 5ALYA 3JAWA 3UHAA 1NU6A 1FLVA 4HMQA 3BIFA 3N70A 2XKJE 5C35A 2GA2A 3A6JA 1RSZA 3EETA 1HTBA 2BGLA 3H75A 1SQSA 3PGMA 3TTSA 5B7GA 1T8YA 1C8LA 1EHIA 3DONA 3FPSA 4JYBA 5MHTA 4L15A 1Q7RA 4TKUB 1IH8A 4MJ3A 3QHQA 4Q39A 3GEEA 1JQDA 2DVMA 3WK4A 2ZZKA 3AF5A 1WBJB 3UF0A 3UQZA 1X3ZB 5T6MA 1MT0A 3MJEA 2DPUA 2ZMEB 4GNKA 1BW5A 4HQ6A 3SBDA 3ZKAA 3RRYA 3L4KA 4AUEA 4E7HA 4RVSA 4BKOA 4H31A 1D1QA 1EFKA 2R79A 1DEOA 3ZCRA 2IPAB 2VQHA 5HZKA 1MCZA 4GR5A 4D43A 2MH9A 1LX6A 3V7SA 1SMYF 3D4OA 2NQ8A 3DBLB 4ZPJA 4E2YA 1W9HA 2A4MA 1LKZA 1B72A 2HZBA 3EZ2A 2Z1NA 3TSCA 3F9IA 4Z6KA 3JRCA 1TUGA 5FTWA 1N25A 4JGIA 5KNBA 2VBIA 2EERA 4YWHA 3UJDA 2OV7A 3LSPA 3I4FA 2YUSA 2P2GA 1SVLA 3B20A 2QSFX 3E22A 3GFSA 3P2EA 2GJAA 4BFVA 2DWUA 2WU0A 4AWXB 1KP2A 4IDBA 4M21A 1T0JB 5SZHB 5TXGA 5BNGA 1SVNA 1QS0B 1PEKE 4BXOA 1KJQA 5AUOB 4EPRA 1Q6ZA 1MD0A 4KMOA 3RYHB 2FD5A 1PQPA 4YRKA 3CEHA 3OZTA 3ECCA 5F1PA 3S2HJ 3DZBA 3I5YA 1J6UA 1QHHB 3HJTA 3SZ3A 1QYRA 4EVIA 5UKDA 4AO6A 4KIFA 1JT2A 1VIAA 3BERA 2WD8A 5C8YA 3ABRB 3MNFA 3EARA 2V79A 1E3LA 4PWZA 2ODAA 5HX7A 1RP7A 4A1FA 4B9AA 2JA6J 2EPFA 1QORA 2WRZA 3DZCA 1XHFA 1MBHA 2C61A 4NBSA 4P4SB 3JW8A 3F8TA 4DIEA 1C1XB 2CLOB 1O7FA 3L18A 3NKLA 4ZHQA 1HNZB 5BQPA 1XEAA 4O29A 4XYGA 4G0PA 1QKIA 1CYEA 3RTGA 2EU8A 2XGGA 1IOLA 1VJRA 2Q3MA 3MLBA 4Y9RA 2AFIE 3EDYA 4YRTA 3HUGA 1B8NA 3ZH9B 4DA7A 3CUOA 4XXHA 3IUYA 3CZ5A 2Y4NA 2TECE 1N0HA 3OEHD 3G1TA 1L7EA 2MC3A 2KMLA 4PFKA 1B1BA 2O3FA 4RTLA 3DQPA 3KBOA 5GVSA 4DVJA 1KMNA 3ZZMA 4S2EA 1QTIA 3M34A 2NZXA 4Q9IA 1A9PA 2UZ1B 5JJLA 4R40A 4LSZA 3AUSA 1Y3FE 3IIKA 4L50A 5IP5A 5HA5A 3ZGYA 2RC6A 2EFYA 2XUDA 2YMMA 4GSYA 3K73O 5IJ0A 2OBNA 5JANA 1I33A 3K53A 1XT6A 4YAFA 5F5NA 2J3DA 4BLWA 4CKEB 2AC7A 1XQYA 5I9NA 1VE5A 4I6EA 2VPZA 5FLYA 4XB1A 4LYFA 3ZQFA 2I4OA 3KCCA 1T8WA 3SXJA 5DS9A 2WJ6A 1P80A 4G5HA 1XK7A 3HMQA 5DIFA 1E69A 3ZI4A 5C3MA 3REQA 3REOA 1CCWA 2B25A 2ZVQX 1G7SA 3C3XA 2XUKA 5EZQA 4HNRA 1Y7HA 4YAWA 2B2CA 5BVHB 4QZVA 2PM8A 4MB0A 4KDPA 1UDXA 3H8VA 2E18A 4LDRA 3UCFA 4F93B 4RFLA 4JJ6A 4K26A 3B1YA 1X2BA 1TNDA 3LAPA 3JZIA 1MB0A 1G9SA 3HVUA 2I3AA 4HS9A 4TT8A 1GL3A 3I73A 4KYVA 4A0GA 4CCYA 4D9CA 3OYAA 2PZJA 2PZKA 3TNJA 3Q8LA 1M6EX 3GLLA 3Q9LA 2WW8A 1JQBA 4OMFG 4WY2A 2IE0A 5HQJA 3VZSA 1IPHA 2JFXA 2JVIA 2ZKZA 5CCEA 3BRWD 5CB0A 1VI5A 2D1QA 1WI3A 4BDZA 5DZSA 4PPGA 1A9SA 5HDBB 5I3CA 3L8YA 1VKNA 4QG7A 3S81A 3LBAA 1X0VA 1QFMA 1J8DA 3ZY2A 3CCYA 1Y8RA 4LG1A 4M9RA 4BWFB 2WZBA 3U4QB 2EV9A 3PEYA 4OFXA 2DQSA 4XRSG 1H42A 2WJWA 3F74A 4L0QA 4C0JA 1S3IA 5AM4A 3GGOA 1H6AA 3SLKA 4MNTA 4UUAA 2JASA 2RGNC 3JWGA 2PKQP 3M1LA 1NK3P 2EYQA 4YRPA 1UUFA 5IKMA 4HOYA 5F4BA 4CMIB 1T2FA 4EAAA 2AUTA 2VJPA 4COKA 3HTXA 3O84A 4BO0A 1BWQA 1IN5A 1HW1A 4QGHA 1OBFO 3FUTA 4C1NA 3R60A 4ZJPA 4BQAA 1DC6A 4AWAA 3KE9A 2FZEA 4U87A 1ZKDA 2O0MA 4NAVA 4FQ7A 1VQ5I 1V5GA 3E5QA 2VHEA 1XZ8A 3JRNA 1YJ5A 4MSUA 3NQOA 1XLTA 4PZUA 4ZU1X 4OIFA 1HDDC 1PNOA 1VMIA 1EP2B 5DIZA 2HF2A 4N48A 2Q5JA 2R62A 3LPDA 3CX3A 4KHPB 2J0UB 4EM0B 3L2WA 2OO5C 1MEJA 3R74A 3GJ5A 4OB6A 2ASVA 1MABB 5FI5A 3VJMA 4UQLA 1HE5A 1R27A 2GSDA 2DN0A 4BAZA 3UJ3X 3K0CC 1DIAA 4RULA 2OYSA 1Q22A 4IYRA 3DMTC 4B3RB 3SBOA 2OQVA 2DJIA 3M07A 2G7MC 3DZFA 3HBFA 4QPCA 4V2IA 5AJHA 5B3LA 4BUJA 1XTPA 4Z49A 4EB3A 1LK5A 3VYUB 2Q3HA 2VJDA 5KYNA 1XGSA 2DFDA 2YHUA 4AFNA 1EEXB 1X19A 5EJ5A 5CD1A 1XC7A 3GAMA 4FR0A 4DZRA 5ESWA 3M6UA 2BFDA 4JQCA 5FPTA 1NURA 2IYZA 4LQDA 4R7TA 3EUWA 3SEFA 1H2RS 1Q0LA 3T54A 3TZCA 1N3YA 1Q1BA 2L7FP 1E5TA 4M74A 4A3IJ 4IQ4A 4KR3A 4D74A 1H6CA 1AUPA 1NF2A 1J59A 3L2UA 2AVDA 2GZ3A 2IPNA 3DDWA 1A9XB 2GRUA 2D1VA 1NXWA 1WAMA 3FLMA 1WH7A 1DT5A 5FTKA 1GGHA 1YTUA 1DADA 5FI0B 1ZESA 1C1YA 2YINC 4BO8A 4XONA 4BE2A 3H5RA 3HJRA 4LTDA 521PA 5A5FA 3MWYW 2HYDA 2IYUA 3CZCA 5ULLA 4B3JA 4UPEA 1JUDA 3HYTA 3OZBA 3V4GA 4PLTA 2QTHA 3T15A 4FOOA 4KIWA 1KH1A 1CUCA 1DJMA 4BNNA 3EXFA 3CC7I 1HFEL 2GASA 2B9VA 3C8UA 3OE5A 5IT3A 4WZAA 5GONB 5KQMA 1GTZA 5JMPA 1OBVA 5AMXA 2KZVA 4EFNA 1E0JA 4W5QA 1NJ8A 2DECA 2YICA 3BTCA 1SAUA 5AHWA 1BC8C 4B3BA 2BI4A 4N7MA 1A2OA 1ZI8A 4BNFA 2FSUA 2X19A 3EZLA 3UHFA 1VPDA 3TZBA 4QOGA 5FTNA 4IVNA 1RZ4A 3ELWA 1WCXA 2CD7A 2NTVA 3J7AO 1O54A 2OBYA 3EQ6A 1L5LA 4BXUA 1GHCA 2R92J 3I6MA 4UCWA 4CTKA 3AMVA 5E3IA 1WXXA 2LYCA 2E1PA 3C85A 3HHGA 3D6MA 4FJ1A 5EERA 3H9QA 1ENZA 3CEAA 3EAQA 4R5HA 2I6SA 1BOAA 1KDPA 2GN8A 3EA5A 1S7AA 1SG6A 3KTAA 1YZHA 2EBFX 4LF5B 4G07A 3AHJA 4BVKA 1J99A 4I01A 3TMYA 2Q6IA 1N4DA 5AKZA 1XEWY 1OI4A 4GWKA 2F1KA 2RAEA 2XI4A 3CISA 5AJXA 5TSDA 5JARA 2JC3A 1KC3A 2F17A 4W5RA 4E46A 2ZSFA 3D3KA 3HB4X 3S1SA 3W8EA 1X7XB 1Z4NA 1JHQA 1L4BA 3DF9A 1O5TA 3RSZA 4AO7A 1KVRA 5E0OA 1NBHA 3IQEA 1M1YE 2A5JA 2B61A 2OQIA 3W2HA 4F3NA 2BHTA 4P0QB 2UYQA 2ECCA 1LKXA 1XLVA 1M0SA 5GTHC 3PPIA 3T61A 1TQMA 3WSWA 5C8YB 1ZCFA 1IN6A 4HX7A 2YKGA 5DN6A 2QUKA 3LLSA 4JX6A 4NWIA 4OJYA 4RY2A 1S3GA 1X1RA 4UNPA 5EMMA 2HU2A 1MPTA 1PFQA 1NBMD 1XDWA 3W7BA 3F90A 1CUZA 1TPYA 1V3TA 2P9JA 2Q2VA 2VJOA 4WFQA 1P0QA 4AS3A 2JEYA 3G85A 4KNVA 3GLSA 4H59A 2IGNA 1GFWA 1E7YA 1KQNA 1OXMA 2XF7A 1ZAOA 1E3DA 2ZB8A 4MRSA 2BC9A 3RVNA 3WNBA 2WC2A 3U61B 2RK6A 3HKZN 4PGMA 4GRIA 2PLNA 3ESWB 2PUVA 3E22B 3GBPA 4LJZF 2VHYA 3G0DA 3K09C 5TT1A 3UK0A 3VNRA 5C52B 2FUNB 1KOLA 3GDOA 3LF2A 4JK3A 1ZAYA 3CUQC 1Q3TA 2HJWA 2E19A 3CKLA 2HRCA 3V8RA 1PG0A 2L9RA 4D1YA 4LRTB 1G5HA 4Y2QA 1T43A 4WNIA 5JIBA 3U4GA 1KP9A 4JQFA 3IRRA 2EF1A 2JCBA 4HQRA 3MWGA 4MLDA 3OAAA 4PYMA 2QU7A 2FI1A 3SKYA 1GN9A 1T2VA 1JDSA 1DBPA 4FLEA 4HNQA 4CM8A 3SGLA 4RYLA 4HYYA 4C4AA 1CZHA 2QVOA 4URYR 4HDSA 5HVNA 5H20A 2XSZD 5DV9A 4XRMA 2F59A 1XA0A 3BRCA 4E31A 5HUJA 3OZGA 3EF1A 4YX9A 3UOAB 2IS4A 3KUXA 1CEYA 1RNLA 1SXGA 1YZTA 3A4LA 1VBKA 4ZARA 4CDMA 4R1MA 3WVNA 1UHSA 2X6XA 1UBGA 3AEKB 3KT0A 2KI5A 2PA0A 2AW3A 1ZL0A 3QLVC 1B26A 2V6BA 4LYEA 2E7ZA 1T24A 4DYRA 1CF7A 3RRFA 5I7EA 1SQFA 4WOPA 4ZPXA 1N7JA 1R37A 3BORA 1AZSC 1OQAA 2F3RA 1A9YA 1SXIA 4BCBA 2YV3A 3LK6A 1IK6A 3NOOA 5KAPA 2FBKA 1XX5A 3B3JA 1BYIA 3O4RA 5A3JA 3GIWA 5IH3A 4N82A 2Q7OE 5J1SB 2FNPA 5IAEA 2H8WA 2IOQA 1PEAA 4IR7A 4Q7KA 1QB8A 1U1EA 2DTXA 1JLRA 1J8VA 1P9QC 1EYZA 5GPAA 2OGTA 4ZP1A 4RA2A 4XNFA 5DNVA 5BS6A 3H42B 4Y9SA 4E4RA 4QTUB 5TJJA 2FFRA 4QBGB 4X65B 1STZA 2XX3A 3DPLC 4Q9NA 3C3EA 3FTQA 2EFJA 4EJTA 5JE8A 4HF2A