3H9GA

Crystal structure of e. coli mccb + mcca-n7isoasn
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
346
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSNNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
total genus 106
structure length 346
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9gA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9gA02
1PS9A 5G4KA 4O6VA 1M6WA 1UXJA 3DOJA 4L4SA 1UZLA 5ILOA 1ZIDA 2TMGA 1I8TA 1YDEA 2C5EA 4O0LA 3ZHXA 2X86A 2PLAA 1B15A 3Q11A 5L3ZA 1GEGA 3DXFA 2PWZA 1ZK2A 2P9EA 3WGGA 3F46A 4NU6A 1F17A 3IJRA 3H5RA 1SNYA 4LMRA 4J4TA 3W6UA 4BO5A 4ZGWA 1WNTA 1XU7A 4R9RA 1DC5A 4Q3NA 5GZ6A 4YT4A 1O5IA 1VM6A 1NX6A 3UH1A 1ZXLA 4RDHA 4I9HA 1HDZA 3HB4X 2BH9A 3T7CA 3KOUA 3C3XA 2GDZA 2J3JA 3WGYA 3RU7A 4PLZA 1P3DA 5GMOA 3I9JA 5EQFA 2A94A 1ENOA 2YHIB 4HWKA 1E1MA 3BMCB 5L7YA 4AJOA 1PJ4A 2GYYA 1I36A 5TSDA 3UN1A 4E5YA 3CIFA 4IIUA 2OXIA 3EK2A 2NQ8A 2D0IA 1ML3A 4L0QA 4NNJA 3WOHA 1SCUA 3R6DA 1C1XB 3GT0A 3MTGA 4RF2A 2CF6A 4IMPA 3EW7A 5JY1A 3DZHA 2YDXA 3L07A 4JLWA 1NBOA 5FEUA 3H8VA 4YJHB 2VYND 2ZKLA 1FXSA 1HRDA 4CM9D 3JQFA 2YQ4A 2B36A 3AM5A 3QVXA 2O4CA 3ETEA 1LQTA 3PI7A 2JD2A 3E18A 2P91A 4J90A 3ADPA 5L4NA 5A05A 4EEZA 5KCZA 4IS3A 3DTYA 3WFJA 1CETA 5A3VA 2HMSA 4LW8A 4F46A 3F4BA 3KLMX 3VKVA 2FN7A 3GDGA 2EJVA 1PS0A 3WG9A 4PVCA 1RM3A 1ZSVA 2X22A 1M75A 3OMLA 5T64A 5DBFA 1GTMA 1N9GA 2YJZA 5L9AA 4CLEA 3KB6A 3K9QO 5DBGA 2WEKA 2D5CA 3AM4A 3OSUA 4URFA 4TRJA 4XB1A 4NR0A 4IIVA 2J8ZA 4CM5A 2JKVA 2BD0A 4O63O 3WIEA 5B12A 1HZZA 3GDFA 2Z1MA 1RWBA 5KJEA 2Q1UA 2EKQA 4FPXA 3JYOA 4L4XA 1UP6A 4CLHA 2DVMA 2EGGA 9LDTA 2G82A 3ZWMA 3TL3A 4A73A 2AA3A 2BF7A 3I23A 1IULA 2NADA 1PJTA 3BMNB 1EUCA 3INGA 3OM9A 4IQGA 4EZBA 1EBFA 3V1UA 4B8ZA 1BXZA 2XPCA 1R4MB 2PD4A 2ZATA 4R01A 1Y7TA 4OGWA 1GPDG 4YR9A 3HJAA 5CDYA 3PQDA 3ROKA 4DYVA 1MXFA 5FYDA 1I3MA 3OEWA 4YEDA 3V8BA 2FZEA 2IEBA 1W8DA 1XYGA 3MJEA 1GYPA 1X0XA 4DVJA 4HNGA 4LMPA 4ALIA 3IDSA 5L45A 3PYMA 4WNIA 3WGTA 3PRJA 5G0WA 3NJ8A 1PL6A 2AG5A 4UVIA 3C8MA 4BL5A 5CDSA 3ANMA 4E5PA 1TT5A 3HN7A 3FBTA 1W0CA 2J6IA 1BW9B 1NVMB 1L7EA 1J6UA 2FMUA 1C1DA 4JBGA 4NBRA 5T8KC 4CLRA 5IDQA 3EUWA 3GC6A 1WZEA 2JCVA 3F3SA 3AOEA 3ZGYA 4GKVA 1E3LA 3MCVA 4B3IA 3B20A 4NJOA 1ULSA 1EUZA 1NTOA 4N5LA 1E5QA 1NVTA 5BNIA 4BVAA 1MB4A 1MUUA 1JU9A 4IUYA 1R0KA 2CD9A 4ROSA 1DC3A 3QA9A 3TSCA 1AHIA 3H9GA 3TZHA 3H5NA 2ET6A 3KEQA 2ZB8A 3ICCA 1WWKA 2X1HA 1S7CA 4BO6A 3LLSA 3C1AA 1PTJA 5MDHA 4OJNA 3QVTA 4RPKA 1KVTA 3OJOA 5H81A 2YY7A 2EF1A 1ZVMA 2WMDA 4FCCA 5JO9A 5ENVA 3P2YA 4W7HA 2NU8A 4B79A 1U3UA 1B2LA 1V35A 1QV7A 2PY6A 2RH4A 3JYQA 4B4OA 5KWEA 3O8QB 4FJ1A 3CZRA 3MWEB 3GK3A 3P2OA 4MKXA 5BNFA 1I3KA 2GZ1A 1AE1A 4E2WA 3FNFA 5THQA 3Q0EA 3A9WA 1H6BA 1ZBQA 4PLPA 1Y8RB 1X13A 3OIGA 3U49A 2Y1DA 1NWHA 2EXXA 4G2NA 1H9BA 1LSOA 2PZKA 1K0UA 4CQMA 3PHLA 3VAZA 4K28A 1X0VA 2C7GA 4OXKA 1UDAA 1EZ4A 1WZIA 5C7OO 1ZK4A 3SC6A 3RCBA 3UFXA 4ZN6A 4NZ9A 1YJQA 1U7TA 4R1NA 1RYEA 4KUEA 5JMPA 3ZWXA 1VKNA 3PYLA 1ULUA 3L9WA 3JTMA 1D3AA 1IPEA 4WECA 2VT2A 2I66A 1ISFA 1P1KA 2B4TO 4GSLA 3ONFA 4JIGA 3EAGA 4UEKA 1GEEA 1A7AA 2NLOA 4PLHA 1ARZA 1E7YA 2PZMA 1B7GO 3RBXA 3VZRA 3E9QA 4IDGA 4BNMA 1VLLA 5K9ZA 4RZIA 2NU7A 4DLBA 2UAGA 4F3YA 3EDMA 1KVRA 3LK7A 3KYDB 2WM3A 3A06A 1PQUA 3QVWA 1SO8A 4FGWA 4LVCA 4OXYA 4NFSA 5TS3A 3OA2A 4E32A 3H9UA 3IUPA 4IDEA 4IZIA 4XQGA 3DBHA 1DSSG 1PSDA 4W99A 3WGOA 1FJHA 1ZXBA 1M76A 5COQA 1LX6A 4EUFA 2HK8A 3PHIA 4YAEA 4NG5A 5CEEA 3PIIA 4A10A 3ULKA 1PJLA 2V65A 3UUWA 3M1LA 3KHUA 4WCFC 3ZWNA 2OBNA 2C2XA 4BGIA 5ES3A 3JD3A 3S2EA 3UGKA 3SX2A 2Y99A 4XWYA 4OMUA 5A5FA 5A9SA 2PNFA 2QZ9A 3LT4A 4GKBA 3I9MA 1GYRA 2JD1A 4MP8A 1FDSA 3U0BA 1PZEA 1SOWA 1NPYA 1DB3A 1KVQA 1VRWA 3QRWA 1N7GA 4K1LA 4ND5A 1E3SA 3DBLA 4BKQA 1UXIA 4CQLA 1EK5A 1UR5A 2Y1FA 5AXDA 3FR8A 1E1NA 2Q1WA 3GMDA 5JY6A 4R9SA 5EN4A 3DMTC 3JQCA 4NBVA 4Y6RA 1KVSA 3ZWVA 3B6ZA 4YA6A 2QRLA 4WCFA 2H63A 2P5UA 4CMIB 4OO3A 3B1FA 1GU7A 3L4BA 4XZ3A 2GERA 3BMOA 5IN4A 3P7MA 2FHSA 5EESA 3ZWBA 2I9PA 2IYOA 3DFZA 2UYYA 4DIBA 2ZTVA 4P4LA 3V1TC 1IL0A 2GD1O 3DAGA 4RF3A 3Q1LA 1PWXA 1NWCA 1YVEI 3NT2A 1AXEA 5AQ1A 2HJSA 1A9ZA 4YRBA 3VPGA 3ZNQA 3LT1A 1HETA 4H7PA 3TFQA 1NYTA 3HSKA 2C20A 1LDNA 3DFUA 4PLYA 1E1LA 1Q1NA 5KKAA 1PR3A 1ZK0A 3TF5A 4G81A 1ZFNA 1GQ2A 3K96A 3ABIA 2EJWA 2IRWA 1RM0A 4BNKA 1V3UA 4YJGB 1E6WA 4R3WA 3PHJA 3UHAA 1P1FA 1LBEA 1SZJG 3M1AA 4KTVE 2UUOA 3OECA 4FOSA 3G17A 3FNHA 2X5JO 2Q46A 5EJ2A 3PZRA 5JAMA 4XYMA 1AGNA 4XD2A 4ALJA 1WDMA 1E1KA 2NV6A 2ZQZA 1AN9A 3DZFA 1I30A 2VHVA 2Y66A 3Q9NA 5BT9A 1ZNQO 3RIHA 3CTMA 4WEOA 2O3UA 3IQDB 4BNTA 1JAYA 4P8RA 5CEFA 1DIBA 3G3EA 3PQEA 4J43A 4K6CA 1VKOA 1BRMA 1BGVA 3F5QA 4GMFA 4IXWA 2GGSA 2FR0A 1NR1A 4Y67A 4ZRNA 3KTDA 1H6CA 1C14A 3HDHA 4YAJA 3WYCA 1I24A 4E2YA 2ZK7A 1NR7A 4IZHA 2Y05A 3L4SO 4Q9NA 4WOKA 4YWJA 3ROMA 3C1OA 1XU9A 1YL7A 3PVZA 1N1EA 3KV3O 1ZO8A 3NDRA 3DONA 4MP6A 1BTOA 3PJFA 2D1YA 3KSUA 5DN9A 4JJIA 5T57A 1HDRA 1ZCJA 5L53A 2PGJA 5AXCA 3WR5A 4B8WA 4RL6A 4NJMB 1EFLA 4UEOA 4CPDA 2DBZA 3AFNA 3N74A 3SBOA 5G0TA 3BYZA 4Y6PA 3I9NA 1DHRA 4F6CA 2B83A 1R15A 2I99A 4GL4A 3ZHBA 4CL8A 3G1UA 3RC7A 1X7GA 2OP0A 1PQWA 3JQAA 2PZJA 1AHHA 1GR0A 3K31A 1PJ2A 2PV7A 4YB8A 5EPOA 5A03A 1SMKA 1I3NA 2NVBA 2OOSA 3OEYA 3H3JA 5B1YA 2ZYDA 3FR7A 4D7AA 4DYDA 3I6IA 1ONOA 1VSVA 3CMMA 4FW8A 1B26A 3MTJA 4RQTA 1GV0A 1U3VA 3LC7O 5A02A 5JXWA 2ZYGA 3PXXA 1YQDA 5JC1A 4JROA 3V5NA 3E82A 3GZNA 4UVHA 3O38A 4H3VA 2B5WA 3EY4A 1Y9EA 1T4DA 4ITUA 3OJLA 2CSUA 3EZLA 3CXRA 3PJGA 3WS7A 4U5QA 3ZV6A 3OP4A 1R66A 4MVJE 3ZU3A 2HK9A 9LDBA 5F5LA 1I2BA 1HDCA 2FWMX 3W1VA 3PHGA 1GV1A 2VTEA 1CRWG 3I9OA 3PWSA 4J7UA 4RF4A 3EZYA 5JLAA 2YDYA 4FSHA 3HHPA 3I9KA 3SVTA 1P74A 4RGBA 3F6YA 1P77A 3PYXA 3CE6A 1Q2XA 3GF4A 1XLTA 4JP2A 4MIYA 1U2DA 2X0IA 2O23A 4WE3A 4X54A 3H6KA 4BOYA 5LDHA 1AXGA 1EK6A 1UH5A 1PZHA 1UXHA 1YJ8A 5G0UA 1NP3A 4B3HA 4HFNA 4II3A 1D7OA 2P68A 4B4WA 4J4BA 1YBAA 5EMHA 1KOLA 3ZCXA 1LQUA 3RASA 2G5CA 4PIVA 4JP3A 1M66A 1EDOA 1Z45A 3WBFA 4XJTA 2C54A 4CMKA 3S2GA 3RUEA 1AUPA 1DIGA 3AW9A 3PLNA 5TT1A 5JYEA 1QXSA 1D4FA 1H2BA 2CDCA 3A4VA 4M89A 3QP9A 2CUKA 3ZW9A 2GNAA 4C4OA 4EW6A 4JX8A 3OBBA 4QEDA 1VSUA 3GRKA 1V0JA 3GPDG 1R0LA 1V3VA 3KZVA 1PS8A 2HRZA 1RM4A 3GEGA 3UCFA 1YO6A 1FK8A 1I2CA 1Q7CA 4GMGA 2GUGA 2DBVO 1GD1O 1QYCA 4CM3A 5K0ZA 2BFAA 1DIHA 5JPIA 4TVOA 4W7IA 5JCXA 1H6DA 2W8ZA 4OKNA 4OOEA 2WDZA 4R69A 4WLOA 2EKLA 1O9BA 4XX0A 5DZSA 2P9CA 6LDHA 4XB2A 4HNHA 4GI2A 3P19A 5EERA 3V1YA 3C7AA 2Y93A 1H9AA 5TC4A 4J91A 5I9NA 5T6BA 5TJHA 8ADHA 2JD0A 4XJSA 4A0SA 1OI7A 3BA1A 3NYWA 2BRUA 4PRLA 2HDHA 3VZPA 2NVUA 3HN2A 1P1HA 2JAHA 1V8BA 3LC2O 3EC7A 3MJCA 1YS4A 4MOWA 2OGUA 5BNTA 1IHXA 4AJNA 1XQ6A 4AL4A 4FGSA 4J6FA 5U1PA 5KVCA 4J49A 3K2BA 1N8KA 2IE0A 5ER6A 3TL2A 3FRJA 4B4UA 1HDXA 2YYYA 1GZ4A 1Z82A 4GAEA 5DP1A 2C82A 1PU2A 2CVQA 1E7SA 4ONEA 4CJXA 4NFHA 3JQ7B 5TGDA 3LSYA 2I6TA 4HFMA 4ND4A 1XQ1A 4PRKA 4DPLA 4IS2A 2PGDA 3O9ZA 1U2GA 4CM7A 1R4NA 4BNFA 3D3WB 3GY0A 4BS9A 1ZZEA 4WGGA 2E4AA 3JQGA 3JYLA 2GASA 3AI2A 1T1RA 3VPFA 3WIDA 2VOEA 3BHJA 5ER9A 4BO3A 4LRSB 1XEAA 4HX5A 1NAIA 3E8XA 5JFOA 3GZ4A 2BMAA 1NPTO 3K92A 3FTPA 2WD7B 4PG5A 3LLVA 3PP8A 5TRTA 4YJFB 3AOGA 2VNAA 3WLEA 4JBHA 3EYWA 1HYGA 1RM5A 1TT7A 2JCYA 1FDUA 3I1JA 1HEUA 2DUWA 4IXTA 4PG8A 1W4ZA 3JD1A 1SPXA 5I7SA 4A7PA 2H6EA 3GNQA 1YQXA 4DUPA 4MVJM 2BFPA 1F8FA 1EVJA 4R1TA 4CLOB 2ZB4A 1WP4A 2ZB3A 3I9LA 1EEHA 3RKRA 3VTFA 3KM0A 2AEMA 3F5SA 4BNWA 1LDMA 1E5LA 3GLQA 1LC3A 1J5PA 1GQYA 1PZFA 2H1SA 2J5KA 2Q45A 3LU1A 4IY1A 2G76A 4DTIA 4HP8A 5LCXA 1EQUA 2BI7A 2HUNA 3X2FA 3MJTA 2PKQO 2W90A 3EHEA 4NIMA 1ENZA 2FPPA 4CM9A 4ZJUA 2EWMA 4M49A 2YFHA 2OORA 3I6QA 4Y9DA 2YHIA 3TQHA 3IKTA 2HMVA 3BMCA 2D3TA 4M54A 2VOJA 2C2YA 1ENYA 1KVUA 4C7KA 3PJDA 4XIYA 3JQFC 4PCVA 3WWYA 4IDAA 2RHRA 1F12A 5F1OA 5T5QA 4R1SA 1HWYA 3ZU4A 4BMSA 2W2LD 2X7HA 3QJ5A 3RVDA 3ROQA 1C3VA 4GX1A 2R00A 4YJHA 3WBBA 1PL7A 4GLLA 3OIFA 2X5OA 3DR3A 1P33A 5IG2A 2P4QA 1C0LA 1P9LA 3SC4A 3HUDA 1JWAB 2Y0EA 1V3TA 3T7EA 1U8FO 1GPJA 1VE9A 4BIIA 4MJLA 4R41A 2AQIA 3KETA 4K26A 1PZGA 1I33A 1A71A 4Z9YA 4UVDA 1LLQA 4JJFA 1YBVA 1O95A 3AI1A 2P5YA 1ISHA 3OETA 3CEAA 1ZH8A 3NUGA 3R1IA 4HBGA 4O5OA 2NUAA 2J3HA 1EUDA 1HSZA 3JQ8B 1PGJA 1T26A 1LJ8A 2AQKA 2VQ3A 4BNXA 1PGOA 3D7LA 4Z9XA 1T24A 2C29D 3PFWO 4E12A 1LTHR 2NWQA 3WGZA 1F14A 1WW8A 3BMQB 1BDBA 2EW2A 5CAEA 1LLCA 1P1IA 2PA3A 3PJEA 4MVJP 5DOZA 2EERA 1E77A 2IZZA 2PKQP 5JSFA 1QRRA 2FR1A 4DREA 2W2KB 4OL9A 5L4SA 2C5AA 3ONEA 3JYNA 4CUJA 2PGLA 3W4KA 3DBRB 3RWBA 1MV8A 3ZWYA 4D43A 5ITVA 2OFPA 3ONDA 2CDBA 3JQ9C 2HU2A 4Q3EA 3H5AA 4WUVA 1B3RA 1ISGA 1G1AA 3MEQA 3ZDFA 4QECA 5CG2A 2D2IA 2Y1CA 3F9IA 4XDZA 2QYTA 1GQQA 3BMNA 2YV3A 1BMDA 4FR5A 2FR8A 4WKGA 3AU8A 3H7AA 3QWAA 4NBUA 4AJPA 4R68A 5I9LA 1R4MA 2DLDA 4M1QA 2X9NA 5KJ6A 1DBVO 2Y1GA 3U4DA 3IL2A 1T2CA 2DC1A 2XOXA 3KYCB 3ZU5A 1ENPA 1N9GB 5I8WA 3O03A 5KVSA 3DO5A 3GR6A 3LF1A 4G5HA 3JQ9A 5CDUA 4BHTA 4RVGA 1LU9A 3IP1A 3RUFA 3B1JA 2Q3EA 3VPSA 3EVTA 3S1LA 4Z6KA 3KSZO 2DBQA 4J4HA 1WPQA 1TXGA 1A9YA 2FSVA 3AOEC 3ITKA 4NBWA 3E5RA 4U7WA 2O7QA 2IYPA 2XXJA 4OAQA 4LSWA 5A06A 1KEPA 1BW9A 1M6HA 2B37A 3NRCA 4I5EA 1HYHA 4OH1A 1I3LA 1UDBA 2Z1NA 3NGXA 5IN5A 5U9CA 2DFVA 3G1TA 2BLLA 2VHYA 4LN1A 3JQ6A 4AJLA 2EHDA 4GBJA 3R3SA 4BO8A 3HQ4O 4N5NA 1U7HA 2AXQA 4MVJF 1XG5A 3LQFA 4ZQBA 4L4RA 3WTCA 4NK4A 2Q2WA 2AG8A 1BHSA 4L9RA 1LA2A 4PFJA 4AICA 4FFPA 1YE3A 2VCYA 1DAOA 3RI3A 3BTUA 3MJSA 1E7RA 1UZNA 4G65A 5DCUA 5CG1A 1O89A 4GGPA 4FC6A 1E6UA 1C0KA 1IHYA 2POQX 1NFRA 1ZSYA 5DULA 1E7WA 2I65A 5FI3A 1MP0A 1NAHA 2GRAA 3ETGA 5CDGA 3HG7A 4XRRA 3MWDB 2J5QA 4RPLA 2D59A 2ZQYA 3Q2KA 1O6ZA 4H15A 4HFRA 4QT0A 1E3IA 1C1DB 3O8QA 1JA9A 1SC6A 1Q7BA 1Q0HA 3FPLA 4MKRA 3T4EA 1FDTA 4ZHSA 5KJFA 4BMVA 1VC2A 3AUAA 1MC5A 4L73A 5DNAA 1NFQA 2LDXA 3ANLA 1Y8RA 2DPGA 2EEZA 4LCJA 4XDYA 3SJUA 4IDFA 4OIMA 2YZ7A 3ZV5A 3H2ZA 1R0SA 1DIAA 4XYLA 3UCEA 4KQWA 1E3WB 1VI2A 2Q49A 3HDYA 1YGYA 2NU6A 3X2EA 4HUJA 2VRCA 3WJAA 4CMEA 5HBRA 1UXGA 3FD8A 1U28A 3BHIA 1PGPA 3A14A 3Q2IA 4J1NA 4MVJI 3WICA 2ZTMA 3W6ZA 4CV3A 1D8AA 4DC1A 1IYZA 1XKQA 5ILGA 4KWHA 1WMBA 4TKLA 3CSDA 1O8CA 3DEYX 4XA8A 4Y6SA 4AJ2A 1M2WA 2O3RA 1NFFA 3E9NA 4XKJA 3ZV4A 2Q2VA 1PEDA 2YQ5A 5COAA 1SB8A 2W98A 4NQZA 3IIEA 1YRLA 4N7RA 3DBVO 1WAMA 5HTOA 2GN8A 4BNYA 2VZ9A 5EQDA 5HA5A 4CMCA 4NBTA 2DT5A 1CERA 4RDIA 4W82A 5T67A 5KJ1A 1MC4A 3G49A 4IDCA 1QYVA 1F0YA 4O59O 4CLDA 4YXFA 1SEPA 3VC7A 2OHXA 1LSSA 2VUTA 1YB1A 3C85A 3K8ZA 3UW3A 7ADHA 1EVIA 3AY6A 3HFSA 4I8XA 1M67A 4UUPA 1EE9A 3DZJA 4YACA 4BB6A 3AUTA 1WLYA 3UKOA 1YXMA 4DXHA 1Y5RA 2OUIA 4HFJA 5JNLA 1KY4A 3L9XA 4LK3A 3VTZA 4EUEA 3GUYA 3RROA 4DMLA 5DCWA 1Y8QB 3CPSA 3L4BC 3QHAA 4N54A 2HKIA 1LSJA 3D4PA 3RC1A 5C7LO 2BGLA 3I52A 4J1TA 2Y68A 3NAQA 1R6DA 4A26A 3PTZA 3FNGA 1YWGO 3Q9UA 4BNHA 3RC2A 1LNQA 3RFVA 3D5TA 1TB4A 1PJBA 4QTZA 7MDHA 4FS3A 4UEJA 3NJ4A 4YVFA 5C3MA 2G1UA 5HS6A 1QYDA 1DLIA 2V6MA 2BHLA 2YFQA 4XYBA 3WB9A 3UF0A 5JMWA 3WYEA 4O1MA 1PJCA 4DPKA 3DMYA 5F5NA 3OA0A 1HZJA 1U3TA 3NTOA 1QLJA 4EI2A 1NXQA 1OZAA 1VJTA 4IJVA 1HDGO 3CMCO 3ORFA 3PQFA 4A5OA 4CR8A 1JVSA 1FDVA 4ZA2A 1ORRA 2RAFA 1MG5A 1TI7A 1H2HA 1EVZA 2FPGA 3AI3A 3W8DA 3I83A 2CVZA 2R2GA 4OXNA 4YJGA 1U5CA 5BSHA 5B4TA 4XQEA 1RKXA 5JO0A 3QVOA 3QSGA 4MVJD 3ZNOA 4WCFB 3RUHA 1MA0A 2V6GA 4DLLA 3LT2A 2DQ4A 1ZW1A 4IJWA 1S6YA 3R0IA 3GNTA 4P4GA 1PGQA 4YT5A 1H0KA 2B4RO 2QW8A 4IQ0A 4XQ9A 5JAIA 1DIRA 4RLSA 1WVGA 1NM5A 1K6JA 1F8GA 1LLUA 4Z0HO 3H65A 3DHEA 4MKZA 4A27A 2QRKA 2GZ3A 4FFLA 4PLVA 3FCOA 4MVJH 4J9UE 5TLSA 4QX6A 3TRIA 1P0FA 3N7UA 4F6LA 4OM8A 2RIRA 3DQPA 4Z3DA 2E37A 4Q3AA 3PHHA 4R16A 3W4JA 3ETDA 4S3MA 2PK3A 2EG9A 1K89A 1PIWA 4YYZA 1B14A 1DFIA 2JJYA 1BXGB 2EIHA 1KY5A 1YL5A 3NV9A 1MXHA 3U09A 3CKYA 4UUMA 2NM0A 3S2IA 4CV1A 1X7HA 2OBYA 4KZPA 3ENNA 3JCZA 3OFSA 1XHLA 2Q4BA 5KJCA 4GX0A 2BGKA 4RZHA 3COSA 1NASA 4YRDA 3DZGA 3GRPA 4U6QA 3FNEA 2AW5A 1HKUA 1T2AA 2NVWA 2C07A 4RF5A 5CP8A 3RBVA 4JGBA 3S55A 5JS6A 4CM4B 1EQ2A 3TZKA 4E5NA 4CM8A 3U5TA 1VL0A 2VWQA 4NI5A 4YT2A 1DOHA 4NJMA 3D5QA 2BKAA 5HWSA 2HLPA 3WTBA 3NX4A 2FSSA 3B70A 1MFPA 1A5ZA 4NMHA 4WNCA 3WJ7A 2J3IA 5CFZA 1A4IA 3P5SA 2X9GA 3ZH2A 4RQUA 4W4TA 4FOOA 1E7MA 1DAPA 1VL8A 4UUOA 1DC6A 1C0IA 3TPCA 1HE3A 2EW8A 2GF2A 4DLAA 5B4UA 1CYDA 1ONPA 1ZMOA 1NQTA 4KOAA 1OFGA 3GNSA 3W8EA 4ALMA 4BKUA 4XR4A 2X4GA 3FF4A 5EL0A 4JJGA 4XCVA 1EFKA 3PDUA 4CL3A 1P0CA 4XR9A 3UCXA 1SEVA 5DBIA 2I3GA 1UP7A 4FJ2A 1Y6JA 2XXBA 5GZ1A 2DAPA 4WLUA 1JAXA 3ENKA 4KWIA 4OOFA 1Y81A 3JQDA 3ITDA 4W9NA 3K73O 1OOEA 2WYVA 3GMSA 4Y8VA 1KETA 5CPFA 3PK0A 5F1KA 5L40A 3HNPA 4AJHA 5B4VA 4Z0PA 4YQYA 4WOJA 3FI9A 3D3EA 2YV1A 3NEPX 2EGHA 3L0DA 1D1SA 5IZCA 5IZ4A 1B3BA 1DJQA 4KUHA 3IJPA 1N5DA 3V2HA 4BGUA 4C7JA 2FY8A 5FI5A 3VPXA 1Z7EA 3FBGA 1YKFA 4BNJA 4OHUA 1K5HA 4B7CA 3I4FA 4CM1A 3VVBA 5IDWA 1QYXA 1ZUD1 1I5RA 5TIIA 2V6BA 5L7WA 1Z73A 1E6EA 1RJWA 2GLXA 3PZBA 4E4YA 3ASUA 3HDQA 2HMWA 1U4OA 1HYEA 5L95A 3U4IA 5TX7A 4YJDA 2HAEA 1DDOA 3NDJA 4R5HA 5JE8A 8LDHA 1HE4A 2NACA 4MVJG 4BKRA 4IJUA 1Z74A 1ID1A 4M55A 1LDBA 4P4NA 4BKPA 4D3SA 2JFFA 1V6AA 1XCBA 4YT8A 3MJVA 3GGGA 3RU9A 1QSGA 2Q1SA 3C24A 2GO1A 1T25A 1UXKA 4PZCA 3VZQA 3PWZA 4I08A 1LEHA 4J7XA 1XDWA 5F21A 1ADCA 3G79A 4PLGA 4E6PA 4RVFA 1YONA 3KVOA 3GVHA 1U4SA 4AJKA 1I2ZA 4IGEA 4U8GA 1OC2A 2NQTA 3AFMA 3GG9A 2DTEA 4I5GA 1G0OA 4DQUA 1FF9A 4EBFA 4J1QA 4WASA 2Y0DA 3ASVA 4BO1A 1YOVB 4GH5A 3CUKA 1OAAA 4PN3A 4L8VA 1YL6A 4RPHA 1TVEA 3HADA 4LSMA 1ZEJA 3ZHYA 4FFNA 1K6IA 2DKNA 2X9VA 2ZB7A 3DAPA 5I9MA 4KMSA 3TZQA 2NNLD 1R12A 4DC0A 2RHCA 1DRWA 1XR3A 3K30A 1YQGA 3E48A 5H83A 3ZV3A 4QSMA 1HSOA 1V9LA 1CDOA 3H2SA 3OH8A 4QXMA 1MFZA 2HK7A 3DWFA 3O26A 4RPGA 2I76A 5ICSA 1LRLA 3DHYA 2DTXA 1K6XA 1XELA 4EUHA 4ILKA 2I67A 2X58A 3TN7A 5HS4A 2NSDA 1Q7GA 4DA9A 3L6EA 4UULA 4CUKA 2JFHA 4UREA 5KVQA 4FD3A 3SJ7A 5I7VA 2H9IA 2CNBA 3NKLA 3F1KA 3RJ5A 1B8VA 3JQ7A 2WE7A 1X1EA 4BGEA 3E03A 4TRMA 4GVXA 4CMBA 3NT5A 1U8XX 3AK4A 1IPFA 5A5EA 2HMTA 2VHZA 1F06A 2J3KA 4RJTA 4FDAA 4KUGA 4TROA 4QFCA 5AXBA 3FTNA 5A3JA 1FDWA 2JCXA 2WD7A 2BELA 3L77A 4XGKA 2NVUB 3WQQA 4YJFA 3F47A 5JW6A 1A72A 1HF3A 3SXPA 3RSHA 4YTEA 2Q2QA 1K2WA 3D1LA 4I9UA 4M86A 4I5FA 5B37A 1XIVA 3QWIA 2QX7A 3WNVA 4U6SA 2A35A 4AJ4A 1HE2A 2CMDA 4HV4A 3QV1A 3PGJA 2CF5A 2OMEA 4ND2A 4BQRA 5L7TA 2CVOA 3PGXA 4CLOA 5J23A 4CR6A 3OIDA 5ENDA 2AHRA 3HZZA 4BO0A 4ZQEA 1HE5A 1A27A 2FOIA 5JCJD 1B8PA 3K2EA 3LYLA 4GWGA 1B16A 3ZWOA 5K6AC 1NVGA 1DHTA 5AXAA 3VVCA 2O2YA 1BXKA 3E6AA 2W2LA 3TOXA 1QORA 1H93A 3JQGB 4RV9A 4YBZA 2P9GA 1WDKA 3GA0A 3VHRA 2O7SA 3VH4A 3VKUA 4YPOA 3RUDA 2E6UX 2DBRA 3QY9A 4DPMA 4ALLA 2AE2A 4GGOA 1DJNA 1TLTA 2IZ0A 2ZTUA 1E3JA 1JVBA 1T2EA 3LZ6A 4FQ8A 5IFLA 2VYNA 4ALNA 1HT0A 1QV6A 4TZTA 2ZIZA 1C0PA 2NTVA 1CQJA 2R00C 5G4KB 4KDEA 4CM6A 3VOSA 5K6AA 2A92A 5HRUA 1PJQA 4RVUA 1J0XO 3HDJA 4RO0A 3RKUA 4AJJA 2PFGA 2CDAA 1CIVA 4J1SA 4BNIA 3K5PA 5GZ3A 2RCYA 4IMRA 4QUKA 2VWGA 1EBUA 3QIVA 4R4JA 4FFRA 1R16A 2RBEA 4WCDA 3MJ4A 4F45A 2NTJA 2UUPA 3RQSA 1NNUA 4QQRA 3AU9A 3INRA 1GUFA 1DO8A 1EMDA 4DIOA 3FWZA 1IZ9A 2W4QA 3BAZA 5ADHA 1C1XA 3U62A 2VYVD 4JBIA 3I4CA 3GVXA 2EV9A 2O4UX 4E0BA 3GGPA 4XGIA 2IXBA 1LRJA 2B5VA 1I10A 1O94A 2QZZA 4GX5A 1I32A 1DEHA 2X23A 3AWDA 3SEFA 1DRUA 1GCOA 2Y1EA 2C0CA 4BO9A 2NU9A 1PR9A 2TMDA 3BIOA 3V2UA 3LF2A 4B3JA 4BGVA 3JQ8A 4M8SA 5TQVA 2JHGA 4MIEA 4NU5A 4WPGA 1IOLA 3HB5X 1ZEMA 4GVLA 1DPGA 3BMQA 3PFFA 4EJ0A 2BI8A 2F1KA 1CJCA 1PGNA 3AUSA 4D3DA 4D44A 2D8AA 2W2KA 4D41A 4IQ8A 2WJPA 1EDZA 2E49A 3IS3A 3DBRA 4ID9A 1X1TA 2AE1A 2ZYAA 1U3WA 3SLGA 4D79A 4WJZA 4E5MA 4E31A 3TOZA 1NQAO 2YHUA 3GHHA 3CINA 4QO7A 5FFFA 5AVOA 1LRKA 2GPTA 3F1LA 4IDDA 2HJRA 4WLFA 3QWHA 2GN4A 2VUUA 2YV2A 1TA4A 4HKTA 4J7CA 1P31A 4EYEA 3FHLA 2J5RA 2JL1A 2PH3A 5IXYA 3AJRA 1L7DA 3JSAA 3KUXA 3KYCA 5BR7A 4BNVA 1Y5MA 1NQOA 1KBZA 4ZQHA 3B1KA 4TSKA 3WDSA 3DOOA 1XSEA 1GUZA 1GCUA 2IEDA 5EINA 1KEVA 3VPHA 4BO2A 1UAYA 1ADFA 2O3TA 2B4QA 3BTVA 3FPCA 5JDIC 2Y1OA 4INAA 2VUSA 3FSRA 5L4LA 3ZN2A 2X8LA 5KKCA 4OQYA 1LC0A 3IC5A 4EDFA 4D0SA 2WTBA 3INTA 1JQBA 2WYUA 3GOHA 3ZWAA 4H16A 1VL6A 3H4VA 2O3JA 2EP5A 4XYEA 2IZ1A 1P44A 3GEDA 2D5AA 3O4RA 4KTTE 1MX3A 3GDOA 4DQVA 3CZMA 5CHEA 3GEMA 4N5MA 1GAEO 3DB2A 3D0OA 5THKA 1EE2A 2ZTLA 2QQ5A 1QYWA 3PLRA 4FIZA 5JDIA 3C7DB 5COBA 4KDFA 1N92A 4LCEA 2VWPA 5FWNA 4EEXA 4PLCA 4YAIA 2VNSA 1EVYA 1I01A 4AJIA 3ZNNA 3UICA 2H5LA 4J9VA 2VRBA 3ZZNA 4BQPA 4E5KA 4PG4A 1CF2O 2LDBA 1BVUA 2X5KO 1JTVA 1SOVA 2HCTA 3OQ6A 2VN8A 4E30A 3GN1A 3S8MA 2PTGA 4YAGA 5KOIA 1E92A 3GG2A 1XGKA 4J0FA 4J3FA 1TT5B 3F4LA 1R37A 5G2OA 4BV8A 4ZVVA 3M6IA 2PD6A 4CMEC 1G0NA 2WE8A 4PVDA 3TWOA 4CLRB 3BXXA 4FC7A 1GYQA 3BTSA 3D4OA 2OO5A 3FN4A 1BWSA 5DF1A 3DZKA 4YRAA 3W4IA 1E3WA 3E9MA 2G0TA 1SAYA 2AQHA 1GZ3A 4PLWA 1UZMA 3I5MA 4XRGA 3SLKA 3DZBA 4J16A 2GN6A 1E0DA 4XQCA 2AEFA 3OQ1A 2EKPA 5F3RA 5DP2A 4ESOA 5T8KA 4JN6B 1WMAA 1UAGA 5BSFA 3WQSB 4R54A 3TNLA 3KRTA 4BNZA 3U4CA 3VH1A 3KXDA 2A9FA 1D1TA 1ISMA 4WLNA 4DIFA 3E1KA 1HDOA 1IZ0A 3GHYA 1JKIA 1LSUA 1HXHA 1KS9A 4JQCA 2VZ0A 4L76A 3PDJA 4P38A 1X15A 4BNUA 2O48X 1QKIA 4TMFA 3WLFA 3DC2A 3KYDA 5KNLA 3U3XA 1DLJA 3ST7A 1O0SA 3PWKA 4BNGA 1VJ0A 4I1IA 3WFIA 4BMNA 3GUCA 4JCOA 4Q3BA 1PL8A 1HLDA 4KP7A 4YDRA 1JKJA 5CDTA 3ZI0A 4CQMB 1W73A 1KEWA 1NQ5A 2UDPA 3PPIA 2JFGA 5LC1A 4BO4A 3GVPA 3GAZA 3AM3A 1DXYA 3GGOA 3EVNA 3RD5A 3RBZA 3VH3A 4PG7A 4RLHA 3UXYA 4E3ZA 3OJFA 1GY8A 3Q3CA 2I5PO 4NK5A 1DRVA 4IDBA 3H3FA 1Y8QA 5TJ9A 4GX2A 4MP3A 5IAAA 4NPCA 3GPIA 3C7CB 2VT3A 4WK6A 3ANNA 3NTQA 4R51A 5JAZA 2UVDA 3NGLA 3TFOA 3EMKA 4RORA 2DU8A 5ICMA 3W8FA 2ZJ1A 3KYBA 3IKVA 3LC1O 4ND3A 2VRCD 1KC3A 3QWBA 3BTOA 5C5IA 3M2TA 2CY0A 2XF8A 4CQMD 1DFGA 4MDHA 3GAFA 4ND1A 4MVJA 4B7UA 4K9DA 4E33A 3PIDA 4FJ0A 5F1PA 4CMIA 5H82A 4XIJA 3DDNA 3U9LA 4AJ1A 1HLPA 4BNLA 2PZLA 2WSBA 4GWKA 2FPIA 1UDCA 3FWNA 4TRRA 4EJ6A 2O2SA 3DBHB 4FFMA 4R3NA 4PG6A 4TQGA 1H5QA 3NT4A 3RFTA 1PJSA 1JWBB 4Y98A 1P1RA 1MLDA 2D4AA 4DBVO 2BGMA 3LDHA 1LDYA 3KBOA 1JW9B 1HL3A 1E3EA 1B0AA 4GPD1 2AQ8A 3JQEA 1SBYA 5A9SB 1U9JA 5IJZA 4IPTA 1CWUA 5DDIP 4E13A 3WQRA 4HADA 4I9NA 2SCUA 3ZWCA 1MGOA 4MO2A 5DOVA 4E2XA 5TNXA 2O50A 3L6OO 1ONNA 3AY7A 1ZJZA 3S2FA 1FMCA 3DBLB 4CQLB 4K6FA 2I3AA 1UJMA 5C37A 3ZNPA 2GR9A 4BV9A 2QIOA 5JAQA 4CLXA 1VJ1A 4BUCA 3NTRA 1IB6A 3QE3A 3BMOB 1CQIA 1DC4A 2WYWA 4QO8A 4BO7A 4GSKA 4S1VA 3MOIA 4TZKA 3L6DA 2P2SA 1PX0A 3WYBA 1GZ6A 4NH4A 4Z9FA 3GN2A 3DAFA 4J2OA 1QMGA 4ZD6A 3H9EO 1LDEA 1J4AA 3DMTA 3LT0A 5KTKA 3GVIA 2JAPA 4R5MA 3I3OA 5I8ZA 4AG3A 1QG6A 1LDGA 2GSDA 4M87A 5HM8A 4FFOA 1PJ3A 3CH6A 3DZIA 2ILTA 4TRNA 4EGFA 1BXGA 1GL3A 1QLHA 2A4KA 4PGFA 3GVCA 5LDGA 1I0ZA 4XEHA 4CMJA 2Q99A 3WGQA 2Q4EA 2WD8A 2B0JA 3WWZA 2PR2A 4B4VA 4D45A 2V6FA 4ZQGA 1WXDA 4I5DA 3WMXA 5IXSA 4E2ZA 5EIOA 3WSVA 4CM4A 3GFBA 4CMGA 3WNQA 2NTNA 5A04A 2EP7A 5L51A 2X0JA 3OHSX 2HQ1A 2ZCVA 5KIAA 4D42A 4IGFA 3JV7A 3QLJA 3D4NA 1KERA 2X0RA 4Q3CA 4WEQA 3TJRA 4DRYA 1LUAA 1GDHA 2IDZA 4Q39A 2E82A 3JQBC 3IOYA 3N58A 2DTDA 3OJEA 1N7HA 3TDKA 3QQPA 4RPJA 5A9RA 1X14A 2ZCUA 5U4QA 1T2DA 3QVSA 1KIFA 1JKFA 2FP4A 1IE3A 2HSDA 4PZDA 3OJ0A 2HRBA 3MZ0A 5FF9A 1A4UA 4W9NC 3OF2A 4TKMA 5IDYA 3PEFA 4Q3DA 1YH3A 4U0KA 3AUUA 4AFNA 3RC9A 1YBMA 4NHEA 4XYGA 2X0NA 4TWRA 5IZCC 4EJMA 3JQBA 1NHWA 2AMFA 2Q50A 2QYSA 1H94A 4XGNA 3ZHZA 4NFYA 3VDQA 1JLLA 4CM8B 5BSGA 2DPHA 4DGSA 2R6JA 4TVBA 1PQPA 3KLPX 3HWRA 1H6AA 5BSEA 4CR7A 1G6KA 4D3FA 3WMWA 3H9QA 2GN9A 3IAHA 2BFOA 1P45A 4D46A 1QP8A 5JC8A 5DCYA 1ISIA 1P1JA 2HMUA 3ICPA 3WSWA 2DM6A 5AYVA 4BKOA 3LVFO 2V7PA 1ZK1A 1GUYA 2DUUA 3AY3A 4DQXA 4AJEA 4KQXA 3JQAB 1ADGA 4ZRMA 2Z5LA 1T2FA 4HY3A 2CFCA 4NDNE 2OZPA 5TF4A 4ZU3A 4OQZA 3JD2A 4FN4A 3VDRA 2F00A 4JK3A 3GQVA 4RVDA 3GH3A 1XWFA 1RYDA 1NPDA 1PWZA 1Y1PA 1UUFA 1YB5A 3ADOA 3BHMA 2GZ2A 3HE3A 2O3SA 4OYRA 1J49A 3OICA 4LGVA 3D64A 5GY7A 3H9JA 3E5MA 3NDIA 1U1IA 5JDCC 1ZJYA 4IINA 1BDMA 3GZNB 1TEHA 1Q0QA 5G4LA 3QW2A 5TT0A 3RUCA 2FZWA 4DL9A 5G0VA 1Z7BA 4CMAA 4IBOA 1YDWA 3EGOA 3JYPA 2IODA 2ZJ0A 3DHNA 3MOGA 3JQAD 2QG4A 3QWFA 1DFHA 3OQBA 4CMHA 4MIOA 4FBGA 2IXAA 4J0EA 1LI4A 5IF3A 4CV2A 4GQAA 4JNKA 5G0SA 5JYDA 1E7QA 3WGIA 3JD4A 3RUAA 3TZ6A 3ON5A 1BSVA 1ZMTA 1ZSNA 5JDCA 2P4HX 3UAGA 3IMFA 1YOVA 1N2SA 6ADHA 3TZCA 3RFXA 4OSPA 1U5AA 5KVVA 3RJ9A 4E21A 3K6JA 4N18A 3DL2A 3GFGA 5A1TA 4DWVA 4LVUA 5I7FA 3WX0A 3A1NA 3RAJA 1MG0A 1WDLA 3VZSA 2AEJA 5C7IO 1HTBA 1Z75A 1BVRA 2PD3A 1T1SA 1A7KA 3IUSA 4Z0TA 1RPNA 4BNNA 3UOGA 3UVEA 3ZWWA 3KSDO 1HDYA 3BZUA 2B69A 5CPBA 2Y0CA 2PKRA 2UV8A 1KYQA 4YCAA 1SB9A 1GADO 4PLFA 3JD0A 1OBFO 4EITA 1LXCA 1KC1A 1VPDA 1XA0A 2YW9A 4J2HA 4CODB 4R1UA 3KEOA 2B35A 2CZCA 1QR6A 2C59A 1ISJA 4RVHA 2VTDA 4GLOA 2O3QA 4II2A 3Q6IA 4CUZA 4MINA 5AOVA 2XAAA 3C1TA 4PZEA 4LISA 4B7XA 1NHGA 2OL4A 1Q0LA 3DOCA 3ZW8A 1IY8A 4IM7A 3IP3A 3RUIA 4WLEA 3V2GA 4HXYA 1X7DA 3VH2A 2HO5A 2Z95A 1GFSA 1ZKMA 2FRDA 5JCJA 4YQZA 4D0RA 3A28A 4UUNA 3STHA 4UAGA 5I7EA 1KEUA 4FB5A 3WGHA 1W6UA 4CV0A 3D3WA 3T4XA 1OC4A 2G17A 4UVEA 4PLTA 2WWRA 4LRTB 2BFMA 1K3TA 3WXBA 2PH5A 1T4BA 2X6TA 4U0JA 4MPDA 2RH8A 4JXKA 2YUTA 5MGBA 3ROPA 1Z6ZA 2C7VA 4BB5A 4A2CA 2OP1A 1JDJA 5A9TA 5BQFA 1OMOA 4IJKA 1L1FA 4DMMA 4DBZA 4UVGA 5CEJA 4Z3KA 4L75A 4A03A 3DTTA 3HFGA 1UP4A 4W6ZA 3R3JA 4RCVA 1N1GA 4RVSA 2JHFA 2VHWA 4L74A 1BG6A 3ZU2A 1ADBA 4QFDA 1Y9AA 5A4DA 2QHXA 2VHXA 4ZICA 1ZK3A 4ALKA 4ZQFA 3ZWPA 2Q1TA 3G0OA 3U4HA 1B8UA 1JN0A 2VYVA 4OSOA 1R4NB 2Y67A 5IDXA 3KO8A 1YB4A 1LLDA 2DFDA 2VWHA 1CEQA 2VZ8A 2GCGA 4WLVA 2E48A 5DT9A 4AVYA 5ITWA 3M2PA 1IUKA 4P22A 2QRJA 4OKIA 5JBIA 4YAKA
chains in the Genus database with same CATH superfamily
1ZRHA 4AY3A 3EEBA 1NJFA 3FRHA 2F6RA 2O5VA 3J7YJ 2HSZA 2QT9A 1RLOA 3BUSA 3HVKA 4ZIRA 4IIJA 4WOPA 4LUCA 3OLZA 5LOVB 4CKZA 4RDHA 1FOXA 3U3OA 3C3XA 3RU7A 3V7YA 5A6SB 2BHSA 3HB9A 2XCUA 1ENOA 4D6PA 4YIHA 5JAHA 3GH1A 1M2VB 2WIKA 4CKEB 1A2QA 3IQIX 3ZJ5A 2M87A 5DYGA 3EK2A 2P2YA 1U1FA 1Z5VA 2ZDGA 5FL3A 4R8MA 4DMGA 2NXNA 5JY1A 5AWFC 1U2EA 3IUEA 2JA5J 1VKJA 2YDXA 2I1VB 5D3MB 2V8BA 3OZCA 3RRMA 4QNMA 2ZETA 4MGIR 4H4EA 4B5LA 2PVPA 4IS3A 1YUMA 2D2VA 4HWTA 1A8UA 1L1RA 2AN4A 3VKVA 2EJVA 5IK2D 1PK8A 2DFKB 1M75A 3PBKA 3NDBB 1WY7A 3M4ZA 3ZY5A 5EP1A 1GPLA 2D5CA 4XB1A 2I2FA 6GPBA 4O63O 3DKIA 1SBTA 3AG6A 1Y42X 2QX9A 1X1CA 2AA3A 2Z2YA 1PFUA 2H57A 2VQ6A 1Q21A 3MW8A 3RKQA 2HWVA 3KJEA 1ZM4A 1MCZA 1XTUA 3A6EA 2ZIGA 4Z2YA 1S72I 3TLGB 1VJRA 2AG5A 2Y1LA 1NIPA 3NV7A 1RCUA 4DSAA 4J16C 3MTIA 1DOAA 4MRSA 4LDRA 5E3LA 3EUWA 3L7CA 1CUUA 4TMWA 1IEXA 3K4HA 3K8QA 3CO5A 5M34A 3R5XA 1NVTA 2H2IA 4IUYA 3H9GA 1WJAA 3H8WA 1X7YB 3SS7X 4GXNA 3HSFA 2BW0A 2RV8A 2OY0A 4LDQA 1EFRA 2UZAA 1QIMA 4RZ2A 1T9KA 4OUDB 8ABPA 4XLEA 5HUQA 4PSKA 2VKDA 4OXXA 4PLPA 1OFVA 4Z4EA 3DB1A 3H83A 4G4SO 1SBNE 3PHLA 4N47A 4A3JJ 4PQRA 4BFYA 1OTXA 1EZ4A 5JEDA 1MQAA 3ZDYB 1R71A 1A9OA 3U9SA 4IUCS 1ISFA 3EAGA 9ATCA 1GEEA 3UQZA 1XB2A 2KPOA 2GBFA 5K9ZA 4L6CA 1U7DA 1GJRA 1N75A 3DBHA 2OBNA 1RKBA 4KYVA 4YRFA 4XWYA 3D81A 1V1RB 3SG0A 2ZKIA 2VAWA 3QRWA 4CQLA 2I7TA 1S5LC 2VKVA 4L9AA 3RVPA 2COUA 1G3YA 4NBVA 4Y6RA 3ZGOA 4OO3A 1I4LD 3IAEA 1T8WA 2EU8A 3DFZA 3JSXA 4LFUA 1J8VA 1AXEA 4UTVA 2PZFA 3VPGA 4TV9F 2Q41A 4JR2A 4HQOA 1JH9A 2J08A 3U1TA 3K2IA 2VAMA 5KU7A 4ZTFA 3OQHA 3L1PA 4GBMA 1E6WA 4LOLA 2Q5FA 3DMPA 3ZK9A 3HOZJ 3FKQA 1OYVA 3GEIA 4G1UC 4U3JB 2F17A 1MBEA 4GPEA 4LBZA 1XV5A 3DZFA 1NP6A 4BDYA 2HCBA 2Y66A 2H94A 2IGTA 3HEMA 3TD9A 3PQEA 3AERA 2X6QA 4IXWA 4LD5A 3KTDA 4AUEA 3J7AC 2Q6IA 4YIFA 3OPQA 2UUCB 2FQ1A 3L4SO 4MKIA 3I42A 3NDRA 2CKDA 4MKHA 1UFKA 3A01A 2FUEA 3AG5A 1Q0ZA 2R7RA 3H19A 1NLYA 2P2DA 4P55A 5CITA 1PNVA 4ESJA 3AFNA 3MWKA 1GVHA 1Y0UA 3HCWA 5TF0A 4CL8A 3QU6A 2NVBA 1UKBA 4CG2A 3CPHA 5C1OA 2XPVA 1ZU4A 4IGAA 3CX4A 1GV0A 2H7XA 5EWLA 1FFSA 3ZLVA 2ZYGA 1QOPB 2JAWA 2STWA 3MYYA 4QJ5A 1Y3DE 1T4DA 3R74A 4MV7A 3PNMA 1JB1A 2ZFUA 2VTEA 5BOXA 1XTPA 1FYLA 5IM5A 4DCCA 3AHJA 1ZWLA 3CE6A 1CY0A 2WHRA 3ZDAA 2AWOA 2WICA 3T6KA 2C2MA 4LF8B 5GGYA 4JLPA 2WT4A 4IH1A 1JR2A 1F8UA 1E8DA 1Z5OA 3SIWA 4J4BA 2C2GA 3WK5A 2GTHA 3G2NA 1I7NA 3SQOA 4I0BA 3AW9A 3ZE2B 4Q01A 1H2BA 2CDCA 2HBQA 2PX6A 3VSCA 1HT3A 3OURA 3W2FA 1B6TA 2X3UA 3P20A 2L3DA 1HT2E 1L1EA 2V1DA 3KJGA 1RNLA 1GAQA 1E4YA 2AG1A 2IHTA 4ZVMA 4HNHA 3EVGA 2HLDA 4LJ9A 3GEEA 1JEOA 4K3VA 121PA 5DASA 2GBLA 5IYZB 1S8FA 4JEHA 4ABZA 1RXVA 1PD0A 2NO1A 1FOYA 3VAAA 1L1QA 3JZDA 2XMZA 3J81Z 1R1TA 4AJNA 4FGSA 4QDTA 1XTVA 3QU3A 5CXXA 1JAHA 1JE1A 1D4AA 3EZ6A 2QA4I 2PJRA 3PDCA 3FIWA 2VOEA 3ABSB 2ICWG 4LRSB 4HOYA 3M8JA 1EAYA 4L9NA 2J09A 2DWPA 5JVGF 3EZXA 1FDUA 1QE3A 2G4VA 3EPZA 4KL8S 1MR3F 3VR3A 5KMGA 5EP3A 2CXRA 3H4IA 3RKRA 3HOVJ 1P1BA 2GPSA 1GQYA 3CGGA 1SH7A 5DV5A 2Q27A 1G7SA 2W90A 3R5TA 1H1TA 4ZMRA 4PPYA 5D6FA 1CK4A 1WM1A 1IBMB 2OGWA 1G6Q1 3W5DA 3Q0IA 1O96B 5K4GA 2W2LD 4L5YA 2R84A 4BRWA 1OBVA 4Z0NA 3JALB 2WTNA 2NPIA 1XD7A 4TTVA 4KIJA 3SC4A 3Q85A 5DB4A 4R41A 2J1LA 1QBGA 1FSFA 1PZGA 3A0BC 1OFHA 3PNSA 3KR1A 2WY8Q 1HZZC 4KZKA 3CG0A 3BE8A 2B30A 1XEXB 4LPSA 1DTSA 4V2GA 2QX4A 3I2FA 1H42A 4P7JA 1IXRC 1RYFA 2HU2A 2XDAA 3QPHA 1TWHJ 3NEUA 1LNSA 4RH3A 3VEPA 1Z7YA 2HRDA 2O61A 2FR8A 4ZCQA 4M1QA 1A5JA 1XZKA 3WRVA 3A04A 3F9CA 3BQYA 2DC1A 2REQA 2YKGA 2ZUTA 5HF5A 4L8YA 2K9MA 4FCYA 1NLUA 2BWJA 3AOEC 3E3VA 2D0DA 4QYSA 4F97A 3VYVA 3E70C 2O7QA 2WVGA 5A06A 1W4CA 3AMVA 1I3LA 1UDBA 2AZTA 3G4SI 1GGNA 4FOLA 4XBFA 3NWJA 4N6OA 2X0FA 3HQ4O 2HA4A 4O4HB 3CS3A 1NULA 4RK6A 1ZRDA 1XNQB 3TD2A 2B8NA 4FYPA 3HTSB 4OLJA 5CDGA 2PKXA 4ABTA 3G13A 1SC6A 1L7PA 2HL6A 4G0VA 5D85A 3VYUB 1S96A 3UCEA 1E3WB 5KNBD 1P3JA 3HN6A 1U28A 3IIMA 4MVJI 2ZTMA 3FYTA 4RD2A 4KBGA 5KTSA 4R8RA 1MMSA 2M7BA 1W0JA 3HZRA 2QBYA 2QAGA 1MNAA 3OX1A 4BNYA 3HACA 1YC5A 4WFQA 1UG2A 2ZSUA 3OCVA 2DFTA 3TLYA 3G49A 4O59O 4YXFA 3NKVA 4P9FA 1OU0A 2VUIB 3TKAA 4I8XA 1JKJB 3MRSA 1J20A 2QPAA 1G3WA 4H4CA 3IA7A 2G70A 1M0EA 5C7YA 1TM3E 1ST3A 1PBNA 3SU8A 2I4OA 3N6VA 2MC4A 3FHTA 2W5UA 2BFBA 2YZMA 1BMFA 2IPAB 1C3JA 3V1LA 1U8YA 3NJ4A 2FYTA 4FS8A 4LEIA 2BHLA 1C7ZA 3P9SA 2LVBA 2HGCA 1P5FA 2CLHB 3DEFA 4DPKA 4EJ2A 3W1EA 2WI8A 5F5NA 4C3VA 1KR2A 3HKCA 1L9KA 1FSSA 5GV7A 1BCSB 1ZH0A 5E95A 5SY6A 3OE1A 1M34E 4YN3A 1UQTA 2DA1A 1PCXA 1WPKA 3K6RA 5C8VA 3NNNA 3QVOA 3R0ZA 3A1SA 2LIVA 3CSSA 3I6BA 3ZI7A 1WVGA 2I4RA 3KEYA 2WNIA 2FA5A 4MKZA 3EIEA 3FCOA 3ZE1B 4KX5A 2QU8A 2BONA 3PA6A 3C3DA 4R16A 1WCYA 3T7TA 1FYMA 3N2NA 1IEWA 1X7HA 2C31A 4UQLA 1YW7A 4M1TA 3SVZA 5JAOA 2Y2UA 1T4GA 2ASEA 3QMMA 1RXYA 3DZGA 4X0GA 1YF3A 3FNEA 4B6OA 5CP8A 1J2XA 3AL0B 2WSMA 2WJGA 4LJRA 1ZJ6A 3D5QA 4A92A 2P4WA 1N2BA 4BP8A 4JASB 1KYTA 3PUWA 1HE3A 4HMPA 5B4UA 1CRZA 1Q1VA 2X4GA 5CT8A 1LF5A 5IW8A 1BD4A 3A9RA 2JASA 1R6XA 1SKYB 3PC3A 5M29A 3OWHA 2H4XA 1G5IA 4DABA 1Z4NA 3CTPA 4OHUA 1A8QA 1BO6A 2I22A 4B7CA 2RAPA 1LFAA 3BGIA 4EX7A 3SQDA 3WHPA 5TX7A 1O77A 1SC4A 1DG3A 3P8ZA 3OEHA 4YNBA 3HPRA 4M55A 4FE4A 4IHQA 4TV8B 1SQ5A 1Z0ZA 1M6NA 1C4XA 2HF2A 2GFQA 4AJKA 4FMCF 1L5HB 3U3DA 2O6GE 1LB2A 3M8KA 3CUKA 3TL4X 3EWSA 2V4ZA 5JXJA 2W2XA 4QTYA 4N9HA 4HDRA 4XGQA 4IIJF 2IV3A 4HAVA 4D80A 3TZQA 2LXNA 2RHCA 3C16C 2F3TA 4QIHA 2PUHA 3U3KA 2YRFA 2EDAA 4BTEA 4OHOA 5BPIA 4RPGA 2R8OA 5ICSA 1LRLA 2GA8A 3ESAA 2OHOA 5CTJA 2NSDA 2CNDA 1XPOA 1P7JA 3ILXA 2BCEA 3FF5A 2IF2A 2OZEA 2QRHA 4X00A 3RJ5A 2SICE 3WL6A 4I1RA 2VQDA 5KDDA 2V3WA 4FDAA 4MB0A 3IP7A 4QFCA 4Z4GA 3ABZA 1WXHA 1PD1A 3W2VA 4TLEA 1M8KA 3D1LA 2HD4A 1KJJA 4M86A 3N2ZB 1F0PA 4P3OA 2ADMA 2DPUA 1ZVVA 2BW3A 2AHRA 3FOWA 4BO0A 3D5EA 2OORC 2FXIA 1P8JA 1G2OA 1ZA2A 1AQNA 2IYZA 3GA0A 3VH4A 2E6UX 4RXMA 4PGMA 2O2IA 4CHGA 2ZTUA 1JVBA 2BMJA 5IFLA 4ALNA 2IJLA 2ZOSA 5E2IA 1TUEA 3TDZC 4LF6B 4KDEA 4AIKA 2OBXA 3G9TA 5KYUB 2Z5FA 4II7A 2JFNA 4HAWA 3QIVA 5KI6A 2DMUA 5JAPA 4Z6YA 4KPEC 3ZDRA 3R9XB 1SOUA 2ZZKA 2AR0A 2W2TA 2QL6A 1NMSA 3WTWC 3VZCA 3CC8A 3Q3VA 2B5VA 3OMWA 4GX5A 1I32A 4UV8A 5JQGF 1FBQA 3TTVA 5ETJA 2X6YA 1Z25A 2MHCA 5JATA 3F0TA 3VKWA 4U2EA 3GTLJ 4HTAA 3AUSA 1RRPA 3C5CA 2WJPA 2XCQA 1G20E 3DBRA 1X1TA 4MAFA 4E31A 3ANYB 4LF5B 4I0WB 3RU3A 2VUUA 3F0CA 4P7GA 4A91A 2WIGA 5IXYA 1FQKA 1SRRA 5AVKA 5HUHA 2FWIA 1IWPB 3PDHA 3LPDA 3T9DA 3FPCA 1FC3A 4R2JA 4J75A 1JI3A 4I4TF 3MTDA 1TKBA 2ZSAA 3RGGA 4EDFA 2WTBA 1JEYA 5JNWA 2OILA 3OOUA 1EIWA 3RADC 2HSWA 3Q8KA 2DK8A 3SE7A 3RF6A 3KYLA 1MEOA 3CLHA 3D0OA 4JDPA 3ZR4B 3TOBA 1DO0A 2ISSD 4JXXA 1RPAA 1QHGA 3SF8B 3HWWA 5J4KA 4J6EA 5A3SA 4AJIA 2F9MA 4ZAWA 3IDAA 1Z6AA 4Q7EA 4C4SA 1VHQA 1SOVA 2GAAA 4CN8A 2ZS7A 5H3CA 3M7GA 1MBZA 1M1NB 2PT6A 5LR6A 1D8JA 3E9MA 5LA6B 4PLWA 3WK9A 3U17A 4Z8XA 5CQGA 3D7NA 2AEFA 2WV1A 3IVAA 2BH2A 3M89A 4BNZA 3KJZA 3SP1A 2CK3A 1Y0NA 5G1PA 3GHYA 4PINA 3ONWA 1A9SA 1LSUA 2O54A 4F3CA 5JCPA 3DLPX 4KXMA 3KZCA 3WLFA 1N2XA 1JEAA 3PI6A 3TGPA 1HLDA 1WQ4A 4INJA 3FWPA 3GVPA 4XWKA 3SVLA 3EA4A 3RBZA 4JYBA 3W2AA 3Q7QA 2QTHA 2V4JC 3NDPA 4EQ6B 1T3LA 3HJBA 3NGLA 1Y8ZA 4DT1B 4CFYA 1ISPA 4M98A 4V2IA 1GT91 2NU7B 4I99C 1KAGA 1XHEA 1RQRA 1ZQ9A 3RG8A 4EB0A 4EW3A 4BE1A 4Z86A 5IS2A 2WSBA 3N7TA 5FWYB 4ENKA 2R1UA 2YVUA 4LI3X 2GD2A 4WXHA 3H0CA 4WJKB 2OBMA 4UFOA 4ZTZB 4E2FA 4FBLA 1Y7IA 1EFDN 4RSRA 5IJZA 2IOFA 3AR5A 1ATZA 3F49S 3QTLA 2N0SA 1VJCA 3DBLB 3U13A 2J0UB 5C37A 3RB8A 4Y6OA 3OV8A 3NTRA 2XODA 3TTWA 2W0MA 4BO7A 1TC1A 5KB3A 4C2UA 4EZEA 1QTQA 1QIGA 1QBKC 3DAFA 2GLUA 4JLMA 1PDWA 3CEPB 1Z7GA 1Z4KA 3OYBA 4KQ2A 1WQ3A 3K6GA 1P1CA 4CUGA 2PMBA 1F4KA 3VYTB 5K8TA 2PR2A 1BQ3A 4EIWA 4B3AA 5H9WA 2Z6AA 2J9RA 3HNOA 4HS4A 3D7MA 4NCXA 3RVBA 1PT5A 4BQOA 4UM8B 3DFMA 2OBFA 1OGJA 2BM8A 2HLNA 5I9TA 1J2EA 1SCQA 5BMVB 3V7RA 1U7WA 3QHQA 1UBOS 4EB3A 4GIBA 3S29A 5CB4A 2K7FA 1AZTA 3BSWA 4DDKA 5K20A 4HI0E 2Q0QA 4CR7A 3WMFA 3M1CA 1P4AA 3NIDB 3WNZA 4D46A 1NQUA 3MGBA 3HR7A 3WSWA 1SD1A 1SXJC 3LSPA 4N9IA 1BKSB 2XGDA 1M33A 2AF3C 4L9WA 4JK3A 2EFGA 3GJRA 3E22B 3QK7A 4KX3A 3VNVA 2L42A 16PKA 3E8SA 4UCQA 2HBYA 5JDCC 2GOXB 5G4LA 3E3LA 1GR1A 2CFSA 1J7KA 2GF0A 2QG4A 3LJKA 4Y33A 2DUJA 3MWGA 4UXIA 2LR8A 1Y4ZA 1DUSA 2YIVX 3U0VA 3AGPA 4LGMA 3KXPA 2KRHA 3HDGA 4D9MA 4B46A 1NKTA 2Q3LA 2BHNA 4E21A 4N18A 1EP3B 3AIOA 4RK5A 2VJOA 4FX0A 1ES9A 1TWFJ 3TEFA 4M8LA 2Y0CA 4EITA 3A10A 4L78A 1EZZA 4R8LA 3UJ6A 3FMQA 1TADA 4L2IA 4EGZA 1SXJD 2Q6KA 2AOUB 4GLOA 1YMQA 5INTA 3ICQB 3UJ7A 4NDLA 1SC7A 2XAAA 3KTFA 4PZ9A 5IYBJ 5DM1A 5HR5A 4RESA 3ZW8A 1QQ6A 1JDPA 3ISPA 1GFSA 1ZIOA 1AHPA 4K9PA 5CVTA 4N40A 3STHA 4PXYA 2JZYA 3FCCA 2QR3A 1X1AA 2V7BA 3EQ8A 3UM9A 2OM2A 4XN0A 4ZAZA 1JUSA 2HQ5A 5LZ2A 3BTCA 2Z98A 4MV9A 2XZLA 1MOZA 1OX6A 1RS0A 1YI1A 2YBDA 5IU6A 1XZAA 2I8DA 1IZ8A 4RVSA 2OTCA 4MX8A 4F0JA 2H8GA 4QFDA 2QHXA 2VHXA 3MAJA 1DQUA 4DGQA 1H2AS 2WKWA 5FOVA 2G71A 1MB3A 1LH0A 3IESA 3GA7A 2I80A 1G59A 4MRAA 1JKRC 1APBA 5EJCA 1VQNI 1TLHB 2IHNA 4U1RA 1E66A 1ETUA 2OV8A 1ORVA 3BZ6A 1POGA 1VMIA 2A0KA 5EQFA 5FROA 1KH2A 2A3RA 4CF6A 3VSAA 2LIPA 1E3PA 2VI5A 3IQGX 4LYFA 4CN9A 3DDWA 1RVV1 1UJBA 4ZYVA 3AZOA 4YALA 1XN1A 2WKQA 1BX1A 3QVXA 3ETEA 2BEOA 1OCCH 3I0NA 4JITA 3R5HA 2X2PA 2FG5A 1DIOB 1VFNA 4ZH4F 2Z4TA 2WPDA 2YU9J 1W581 4L85A 1RKTA 4CLEA 1ZG5A 2X9LA 3OSUA 2ECOA 4CM5A 2QN7A 1LVUA 1RWBA 2VYCA 4NS4A 2W7NA 1KQFA 3I54A 4AP5A 1N3YA 5I9SA 3DV0B 2AQEA 3O9MA 1T5DX 2JI6A 4P33A 2R5ZB 3KFVA 4O2BA 3INGA 3T5PA 2JVHA 2ZATA 4YR9A 1BN7A 5CDYA 3BFJA 3L7MA 4NC6A 5H20A 1D6MA 3LMKA 3AIIA 3PFCA 3WK4A 1PFQA 3HCOA 3PUXA 4BL5A 1W0CA 2R7LA 1XT6A 4QVGA 4DZJA 3ZGYA 1IRFA 1CZRA 3AFOA 3B20A 1K5DA 5CK5A 1ULSA 1EUZA 1NTOA 2WUVA 3RVSA 4ARCA 1S8NA 3FSGA 5LLDA 1ZD9A 1SVLA 4MQLA 1ZN9A 3A4TA 3L7IA 3LLSA 5MDHA 2MD5A 5JO9A 2AUTA 2EBHX 4W7HA 1V35A 1FT9A 1RESA 3ZGXA 5THQA 3GIWA 4QDZA 5FPTA 2CVPA 1YMVA 1X13A 4Q15A 1PJZA 4AW9A 1U3DA 3SC6A 4XEUA 1QU2A 1LNWA 2VQSA 3JAKB 2IZOA 1G2QA 2AFHE 4NAVA 1HBXG 1E7YA 2PMCA 1RC0A 1QE5A 1E1YA 4OHRA 3C3EA 5EWJB 4EUSA 2EFPA 1MDMA 2Z3VA 2DBBA 4TLLB 5COQA 1RRKA 4EATA 1C81A 3I4NJ 5HSGA 4PCQA 5E8RA 1LW7A 4MVWA 1VTNC 2CBGA 1XDBA 5F6FA 1FDSA 2PXHA 3ND6A 1K6OA 2QN9A 4BBJA 5AXDA 3IHWA 5FFNA 5E3NA 3P7MA 1HNNA 3ZWBA 4W9MC 2Z2ZA 1FQWA 3NBAA 4WZAA 2GD1O 4WXPA 1H69A 4HDKB 1BX3A 5BN1A 1T2VA 2WB2A 3I6MA 4M0PA 2FN9A 1ZFNA 4BNKA 3DSRA 1UMCB 2VP0A 2VDQB 4R3WA 4UTRA 1Z16A 1S2NA 3F8NA 4F1KA 2XMGA 4MLDA 1DU4A 4Z4QA 2QN6A 3PEUA 1ESEA 1UBMS 1AN9A 4L16A 2IV7A 1X1DA 2H16A 4IVQA 1XEWY 2O3UA 3EFOA 4P8RA 3IAAA 3I3LA 4J43A 4MKFA 3O92A 4L8GA 2C2ZA 1YS6A 3VR6D 2P4UA 3RI4A 5A7FA 3IDFA 1GPUA 4LJYA 3VHXA 2BFEA 2F55A 4XJVA 1IHOA 3V4OA 1IBRA 3IULA 2NPOA 2QW0X 3I9NA 4F6CA 3G1UA 1VE1A 4P7FA 1I7LA 5BN4A 2L69A 3U80A 3GJSA 2ZR8A 5IEBA 3U4QB 1AQYA 3BMXA 3P5JA 2RGWA 3IURA 4RQTA 3RK0A 3L09A 2C5SA 1WHSA 1KI2A 2XAHA 1VG1A 3E82A 4BBPA 4F5EA 4UVHA 2GNPA 3O38A 2WU3A 5A3RA 5CLFA 4LLGF 4DANA 3PJGA 1LE8A 4K87A 1U78A 4MQUA 3X1ZA 5DM0A 1GV1A 1EWTA 4RF4A 4RMIA 2R6DA 2K85A 2IA0A 1WZUA 4DM3A 5BRAA 3NKFA 4YAUA 2Z09A 3KYIB 1E0JA 3TNFA 3NEYA 1ZYRF 4O5AA 1FSEA 4OBBA 1Z45A 2XX3A 5M5WJ 3NVAA 4BJ3A 2O8XA 3N2EA 4KREA 1EHIA 3KE9A 3LPAA 1OV4A 4YASA 3A4VA 3QP9A 3HHGA 3P9QA 1GTRA 3H0EA 4ZI7B 3OWTA 3D9QX 3DOIA 3S2UA 4MQBA 1JAIA 3UCFA 1FK8A 2BRUC 2ECCA 1Q7CA 2OBBA 3OZEA 4O1IA 1GD1O 2C94A 2BE5F 5ALNA 3HKEB 2EKLA 2P9CA 4BMOB 2ATXA 2TMKA 4U2DA 3RIEA 4MK4A 1DPFA 2HWUA 1DDIA 5HDGA 4XJSA 4A0SA 3C3YA 3W8NA 1UKYA 1DXOA 3MFQA 3OD1A 1XZIA 4EKDA 1ZCZA 1AKVA 3VZPA 3EXEA 2R1ZA 3J80A 4MOWA 2QUJA 2UUZA 4AL4A 1EFPA 2X4DA 1KSGA 1QHHA 3HJUA 5LMNB 5JNTA 1G6NA 5HX7A 3BWEA 4IS2A 4BNFA 2F3QA 1FXUA 4LY3A 1TIPA 4UJ5A 4HQ6A 1NPTO 4YJFB 5I5GA 3HY4A 5I7WA 1B72A 4FWIB 4XCXA 1W4ZA 1FX0A 5AJUA 4MCHA 5A0FA 1QBJA 1OYYA 4MAAA 5CURA 1X3UA 3PGA1 1BW6A 4B3CA 1XNJA 1UJ5A 4PBTA 5LWQA 4Z54A 4RHTA 2DXIA 1WPRA 3G1OA 3DPSA 4RL4A 3U40A 1X9IA 3UXHA 3B38A 4Y30A 3CBGA 3TQHA 2VOJA 3IODA 1BN6A 1ENYA 3QXXA 1XJCA 4EO4A 5LD2C 4LJ6A 1W94A 1YZVA 2X7HA 2EJBA 4KRFA 2XDQB 4KR2A 5DYNA 5EC8A 2V6CA 1P33A 3BXFA 5CYPA 4KFSA 4KIWA 3W0LB 1J0BA 2QKMB 1CQPA 1T4CA 1MJHA 4K26A 2V9PA 1Z4PX 2X4LA 1HX7A 1UBUS 1YBVA 4FM9A 3CEAA 1TCBA 1C7IA 2WIDA 3QYEA 3F8FA 4JU9A 1ORKA 5KHDA 2E7ZA 2V9KA 2KJQA 4K86A 5L4SA 2ZRJA 1WZCA 2OFPA 4TKUB 2EIKH 5DO9A 3CMYA 2XEDA 4PYRA 2Y0MA 3WE3A 2JGKA 1KZ4A 3KFXA 4X20B 4QECA 3CTAA 2Z4RA 4U39A 1F0NA 3I01M 2EBUA 4ZO9A 2I0FA 5I9LA 1R4MA 1J09A 3RPUD 1T2CA 4JI5B 3QEJA 4ND8B 1ZU5A 1CZKA 3FCEA 3E5RA 2W6JA 4FCWA 3S8YA 3G2LA 3NRCA 4K40A 2B37A 4I5EA 1L8LA 2XVCA 2AJTA 2ODPA 2JGJA 1EK0A 1B2RA 5CVRA 1A04A 4RY2A 4GBJA 2WVJA 3WKCA 4TTPA 1SCNE 2CLCX 2QI9F 4NK4A 1BHSA 3T5BA 3U7RA 3PB3A 3FDXA 1BJKA 1TJ4A 2VYQA 3BTUA 3THRA 3W5JA 4QYXA 2JKZA 4CKCB 3UJCA 4RPLA 2ZQYA 1NVAA 3AUFA 3WTSC 2NX2A 1VC2A 3GO4A 1N33B 1AGXA 2G3YA 4QOGA 3WC4A 3H11B 2VNHA 2MSEB 2R4UA 4O4IF 3WICA 3SQMA 2ZRCA 4DEYA 4RAZA 3C6MA 3KVVA 4DC1A 5DNYB 3A1FA 2HOEA 1I2MA 3E9NA 1VYTA 4JL6A 2CUJA 5COAA 4NQZA 4IQFA 1MKMA 1KBOA 3E35A 4CMCA 1WJBA 1FDIA 5E1XA 4QBKA 4RDIA 3VYRB 4U2FA 4MS1A 1YB1A 3OM1A 5FTNA 4U63A 3UFXB 2QYHA 3CVWA 5BRNA 2VBGA 3R77A 4Z9BA 4UAJA 2RMKA 2O1XA 3ZGLA 4BQEA 1OFTA 1WQ2A 5C7LO 1VHWA 2QP9X 5I7HA 1TZLA 3PTZA 2VP6A 3AI7A 2ZJOA 3L41A 3H87A 3CC7I 3W9SA 3IB3A 1UFMA 4JY7A 5JMWA 1TM1E 2FMTA 2V3CC 2A9JA 1I4EB 3B9RA 1HZJA 1AUXA 3JR7A 2GHQA 1U0JA 3OS2A 4CR8A 5LFAA 2PS0A 3BG3A 1DAHA 3C3KA 4BHCA 1W6RA 2CNWA 3Q3SA 1PUEE 4LZZA 3ZNOA 4DLLA 3BG5A 1WCXA 1S6YA 3SHFA 4LNUA 3DNFA 1Y7PA 3F5DA 1WRJA 3H65A 4Q19A 4MVJH 4JLDA 1TW2A 3GNLA 2RIRA 1H0SA 3W4JA 3QEAZ 2PK3A 3AKDA 2Q8NA 3NCHA 1XHLA 2Q4BA 3FVWA 4DDVA 5KJCA 4BQAA 4AI6A 1UPFA 5BP7A 3EXHC 3PUIA 2V5UA 1O3QA 4YIRX 1DOHA 3EBOA 3WTBA 1TU3A 1M2OB 2PSSA 4UBOA 4OF4A 2J3IA 4JBNA 1FYDA 3SY8A 2OKGA 1CUHA 1E0AA 3T52A 5KWVA 1NQTA 4QPOA 1AQUA 5EL0A 3D43A 1SEVA 1EM6A 5KX5B 3KQSA 5BOVA 4PFQA 2R5FA 4L5AA 3ENKA 4XL9A 1PAUA 4BPRA 3K73O 4QTXA 3GMSA 1TCUA 3FPFA 4WOJA 3R76A 2ZCJA 4BGDA 5IZCA 5BNZA 1G21A 2L7MP 1JKOC 5CNKA 4MI9A 1SFUA 4NJEB 5AJHA 2DI3A 1NBEA 4ENJA 4J0JA 3HUEA 3BR5A 1FX1A 4MH0R 3A2MA 3T9CA 3A6JA 1TEVA 3CW9A 3HR8A 4XH9B 1GNVA 2AS5F 1SAXA 2GO1A 5DTJA 2YJ4A 1JYFA 3A1VA 4RVFA 5FKLA 3WADA 3GVHA 5HKAA 2HQSA 5ALZA 2DTEA 2RB4A 1JHDA 3REGA 1X1BA 3LUAA 3KVRA 4QLOA 4IO0A 4KGZA 4L8VA 5JROA 3HADA 5HDBB 3OHMA 5I9MA 2NSJA 5L3QA 1P81A 4A5MA 3NEAA 3ZCVA 4RY8A 4XN3A 4M74A 1XXHA 2KLHA 5ERXA 2RJOA 3RUPA 1VE7A 4HQKA 2G1KA 3PM1A 3TN7A 1BMTA 2P6SA 3NHFA 1W47A 4ZVOA 5ADWA 3EE6A 3LFHA 3KCQA 1FYVA 2Q28A 1DX6A 4J00A 2VHZA 4JODA 4CIYA 5AXBA 5ITZB 1H05A 4Q4CA 1XRLA 3BT7A 1RJ9A 2F8MA 2NVUB 2R7WA 3PSAA 4GFBA 1HF3A 4K5QA 3A4LA 4I9UA 4I5FA 3S40A 4M99A 2BISA 2FEWB 2WW8A 3RIRA 3BULA 3CRW1 4NZZA 4WCVA 4PZLA 3P4UA 5K6AC 4ZO6A 3K9NA 5FBRB 3I2YX 2O7SA 3RUDA 4MA0A 2YMMA 3MMZA 2JCBA 1YJNI 1C0PA 3S3NA 3K53A 1FW6A 1Z3IX 4RO0A 4QUKA 1I5OA 2GEJA 4KHPB 3CT4A 3T8RA 1F6BA 2V1XA 1AU9A 2O19A 1GQSA 1C4OA 3AF6A 3KHSA 3HXMA 3IE1A 4DSTA 1KRXA 4X5OA 3VU8A 3TXXA 4KR6A 4V0OA 4F3KA 3NIFB 2PZBA 5HZGA 5FGMA 3BZWA 2ESHA 2PMFA 3OMXA 2TMDA 4RGYA 3D59A 4NU5A 2HCFA 2A1UA 2CJXA 1CQZA 1UK7A 2ZM6B 2HHJA 3R23A 4D44A 3JRGA 4GYYA 4D41A 1SA0B 2E49A 2JIRA 1GKYA 1NBMA 4IDDA 3T1OA 1EFAA 5JHUA 3MGCA 2Q7DA 1T1IA 2ZS8A 4QDKA 4LQDA 4C1BA 2Z0MA 1I1GA 3JWEA 1ADFA 1KRWA 4AROA 1L8OA 3WHKA 1A8SA 4UHJA 2BV6A 3JATB 2QG9A 3ZY4A 1Z68A 3FW1A 3P96A 3G9QA 2ADUA 3EXIA 5CYOA 1QYWA 4GXTA 2WHPB 1OH8A 4LCEA 4D98A 4FYWA 2QTLA 1DPRA 1E0EA 3V9AA 3L02A 3NP9A 4YUWA 3AONB 3UIEA 4PG4A 1TL8A 2HLHA 1JTVA 4DR4B 4AYBN 1FP2A 4ZDJA 3L05A 4Q5IA 4QDOA 5DN6A 1G0NA 2WE8A 4MUFA 3IUQA 3NWBA 4CLRB 3BXXA 2JCGA 1UXOA 3FN4A 1G3TA 4ES6A 3A6PC 5CYFA 3TUZC 2CL5A 1GZ5A 5DP2A 3RTAA 3HYIA 2W6ZA 4ZDWA 3CUQC 3PEYA 5BSFA 1X77A 3OKCA 3HOYJ 4XM3A 1D1TA 2IUSA 1KU2A 4YDHB 3TIVA 1TTHA 1DAIA 4L76A 4NS1A 2O48X 1ZD4A 3LSHA 3QE9Y 1O0SA 3PWKA 5EJ8A 4UUQA 3HB0A 3GUCA 1ZLXA 1N2ZA 5LC1A 1XBTA 3NTUA 3RS0A 4DV5B 4Z7OB 4K03A 3KB8A 4GDFA 3AVPA 1MPXA 1NONA 1T8IA 3NW9A 1BN5A 1ECLA 3DTVB 4ZZ0A 3OYIA 3KYBA 1J59A 2QD5A 1ZL0A 2XF8A 2I87A 1UDCA 1KSJA 3QHPA 1RZVA 4DBVO 3CCSI 4RTLA 2J9GA 3NWOA 2J4CA 1JHVA 4XD7D 1PLJA 4E2XA 4YQFA 2VHJA 1ONNA 4PE5B 3S2FA 1FMCA 1QR2A 3EA5A 3QKRB 2MYNA 3W3AD 4X1OA 5FCDA 1DC4A 4TZKA 4OBWA 3LCVB 4PN7A 2NOJB 5KTKA 4RENA 1AWCA 4C7OB 5KWSA 1WSDA 2WG2A 3R41A 4WT7A 1BXGA 1DPUA 1HOXA 1VTKA 1EX7A 1YR7A 1PDNC 4RY9A 4BDTA 1SR8A 3Q0UA 1Z2OX 2DMPA 3Q15C 4EL0A 5AQEA 1R1VA 2D1HA 3G6EI 4FDTA 3LUDA 1OWNA 4U7FA 3W3ZB 2DERA 2IDZA 5B30A 3IOYA 1L4MA 1X14A 3EWIA 1IJBA 1IE3A 2KZGA 3LLUA 4Q7QA 2FLKA 4A8HA 3I01A 1OWLA 2UVQA 4D6XA 4N5DA 4U0KA 3G8DA 1ZD3A 3RC9A 1KJ8A 3GT3A 3SZLA 1V5EA 1QGED 2NV2B 4AWXA 1JLLA 3GQBB 4RJJA 3AAFA 3II6X 1VHLA 1FVHA 3KD2A 2BFOA 4D96A 3QFCA 4ON9A 4G0XA 5FBVB 2ORIA 2V7PA 5BS6A 1ECBA 4G84A 4KQXA 3PSIA 3BFKA 1JDUA 1SGWA 4ZU3A 4H6PA 1TLLA 3PXCX 3ASZA 3UWOA 1MRSA 3ADOA 4FDUA 1KKUA 1TCVA 4KK4A 4OEHA 4OVKA 2ZRMA 3E5MA 3NDIA 3KP7A 1BDMA 5AKJA 1FUUA 3JYPA 3HRHA 2OQGA 1L4HA 1JP7A 5JDCA 3DLLF 3AVWA 4C3IJ 2QTBA 4TLCA 1R1UA 1RAAA 3DL2A 3ABMH 4DWVA 4JOQA 4KQIA 4TL7A 3VZSA 2W4IA 3PPVA 1T1SA 5CPBA 3CF5F 4EH1A 5DLYA 4X6UA 3KEOA 1QDEA 1SZCA 2GEBA 2I3BA 4R2LA 3UEOA 2VTDA 1U31A 2EFWA 4CUZA 1DX4A 3OYFA 1YV9A 3C1TA 1W25A 3TIIA 3TH5A 1PNQA 1QH1A 1OFCX 3RUIA 3X1DA 4Y18A 1OCZH 3TM4A 5K3FA 2P67A 5I7EA 2E4YA 1A9TA 4RKFA 5T4BA 4FR0A 5JHFA 2X6TA 4U0JA 3KEMA 1O6BA 3TG2A 2FUG6 1L3BA 3O0DA 3ESBA 3BIXA 4RX1A 2PLWA 3ZU2A 5A4DA 2VRNA 2H1LA 1K4KA 4EJUA 1X80A 1NHAA 4OAPA 2XB6A 1R4NB 4KBYA 3ECSA 3KB2A 3KUUA 3VZDA 4OHWA 1YI0A 4AVYA 1Y0BA 5KO2A 1LUJB 2QRJA 4P22A 5CM2Z 4JNCA 3AB8A 1SPBS 2G6TA 3OE5A 2YXDA 3B5JA 5EJ9A 5GQSA 3QNMA 1A7UA 4RGRA 1RRGA 5GONA 1FTQA 3ISTA 4MFDA 4F91B 1V43A 4G9YA 5AH0A 1XU7A 3N2IA 3O1IC 4E14A 4P83A 2FEMA 2FPPB 1DZIA 2ATIA 5BWLA 5JS7A 5KOYA 2VXBA 1H4TA 3ZKWA 1SQSA 1ML3A 1Z8NA 1E3HA 3GUDA 2XTMA 3C7KA 3OE7A 1R1DA 1LNZA 2W6MA 4JLWA 1NVVR 4YJHB 2WJ6A 1W9MA 3T7AA 2OQVA 4RHFA 1E96A 2XE6A 2WUWE 3ADPA 3G5UA 1W7PA 2ZIWB 4HAYA 3WFJA 4PTYA 3PUJA 3TMYA 4B5KA 2X22A 2NSLA 2KL4A 5DBFA 3FMPB 5DTDA 3K9QO 3ENZA 2WEKA 4B3FX 2ENUA 3NEJA 5BN5B 4FGLA 3NAMA 3GLFA 3PQCA 4WX9A 4UBLA 3HC7A 3I4PA 4MUGA 1N4AA 3I23A 5ALTA 1HQDA 2H4WA 3MHPA 4FHGA 2H2WA 2FLVA 5A5DA 2PD4A 5EG0A 2VT7A 2ZT6A 1ULAA 5EHQA 3HM2A 4YUYA 1XFDA 1YD7A 2IEBA 2IPMA 5EKXA 5IABA 1XYGA 2Y0SN 2FA9A 1HTTA 3TW8B 2JJ1A 3DE3X 1TVCA 5ALRA 2FG7C 4KC0A 2X7XA 1QQAA 3KP4A 2QXTA 3ANMA 4MUBA 4NUBA 1ILEA 4QYIB 1QNTA 2HWYA 1K97A 1IZ7A 3QA3E 1UINA 1MDFA 3RHTA 4BFZA 4C3HJ 1XVAA 3KQTA 4NJOA 3NHPA 3O82A 1D5VA 4HYQA 1E5QA 3KSMA 4Y17A 4B3GA 3H5NA 2V6JA 1QZXA 3LZCA 2ZB8A 1RRFA 2LVSA 5CK4A 4BB0A 1W52X 1SIWA 5AW2A 5FXMA 1WIWA 4E7KA 4L15A 1A2KC 4ZK6A 4DV4B 1NJSA 3C45A 4F71A 3RYRA 2HPZA 3M6VA 1P5HA 5AHOA 5DWVA 1EWQA 3P32A 4D92A 1R50A 2I6FA 4Y15A 1YJQA 2I7DA 3MRVA 1QQIA 5KSPA 1RMTA 4KIGA 2I66A 4JIGA 3LIPA 1G60A 4C0JA 1Y6ZA 4KWTA 4HYYA 3P5BA 1XMJA 2ZROA 2ZITA 3ZBPA 3DKRA 2OFXA 2DR2A 1YB6A 3F9RA 4N82A 1TCCA 1Z0SA 2Z58A 5JSYA 4G85A 1EWVA 1SD2A 5EEHA 1VA5A 3JD3A 3KJQA 4OMUA 2JJ2A 1VRWA 1UXIA 1R8XA 1UR5A 3LGSA 5FEMA 3D6UA 4G4SP 3GMDA 1MRNA 3DWIA 1Z0XA 3J81A 1AMNA 3URMA 5DCFA 1K7AA 3WDKA 4NC9A 1Y6FA 5DSTA 4DIBA 4A0XA 2PDAA 5E8GA 1IL0A 2A57A 2ZT5A 5B1IA 3T9AA 1YVEI 3CJTB 4QOIA 1IZZA 1OPXA 2LG4A 3FYUB 2XYGA 3M1EA 2VO1A 1BEZA 2FPLA 2VBWA 2VTVA 4PTZA 4NAUA 4KGVA 4KXQA 2VC2B 5FKMA 1IN5A 1GZHB 1SZJG 3RODA 3KHKA 4FMDB 2OD5A 5BV2P 2J4FA 4XD2A