3H9QA

Crystal structure of e. coli mccb + semet mcca
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
348
structure length
337
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNNNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
molecule keywords MccB protein
total genus 96
structure length 337
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9qA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9qA02
1BVRA 2WD7A 3DR3A 1HDGO 1KETA 2GZ2A 3S1LA 4NNJA 4I9UA 4K6CA 4MP3A 4JN6B 4Q3AA 3F1LA 2W2LD 3BMOB 1IULA 1WDKA 4GBJA 4I9NA 3WGHA 3TL2A 2Z5LA 4PGFA 3UCXA 1FF9A 1NAIA 1MX3A 2R00A 3OICA 1I0ZA 3MTGA 4MVJF 2E4AA 4OJNA 4UVDA 1YOVA 4YJHA 3SJ7A 5IAAA 3KETA 2JAPA 1PGPA 2OORA 5MDHA 4WEOA 5CP8A 5JDCA 2C5AA 5ICSA 3B20A 1K0UA 3ROMA 2X5KO 4N18A 5BR7A 1CERA 3WG9A 1MFZA 5I7SA 3H3FA 4U5QA 4DLBA 2ZYDA 5KVSA 2PKQO 2FRDA 1U4SA 4NFHA 3LF1A 3CEAA 4AJEA 1N9GA 3DC2A 2YV1A 1LLCA 3S2EA 3K8ZA 3RIHA 4DIFA 1MV8A 4KZPA 1P77A 3GFBA 1JAXA 4MP6A 1ZJZA 2Q1SA 3C85A 4JROA 5AOVA 4D7AA 4FFOA 3WNVA 3DQPA 4KUGA 2GSDA 3T7CA 2IXBA 2ILTA 4QO7A 3TSCA 5HS6A 3X2EA 5JNLA 2AQ8A 1ZH8A 3ZU3A 2ZB4A 1GUZA 4M1QA 2Y1GA 3O26A 4A73A 3QWHA 4YVFA 5CPFA 4RCVA 1PR9A 4YT8A 2AMFA 3VVCA 4CUZA 2A94A 2ZYAA 4NR0A 3E18A 2X7HA 2BFMA 1BTOA 4J7XA 3V2HA 3EW7A 4OQYA 4BO5A 1DJQA 1EK6A 3GMDA 1EVYA 1PU2A 4L4RA 1BDMA 4CMCA 4LSMA 1V8BA 1KBZA 3KYDA 4GKVA 2P4HX 4EITA 4YTEA 2CNBA 5JDCC 4E13A 3D4NA 1GYRA 3IL2A 2AQHA 4DQUA 4ONEA 4UREA 2H6EA 2F1KA 4YCAA 3EK2A 1HE2A 1KVQA 3EAGA 3MOIA 4C7KA 4J7UA 1LSJA 4XEHA 4XRRA 4HNHA 4TQGA 3L4BA 2IODA 4AJHA 4XD2A 1E3EA 4BO2A 2VHXA 4MVJI 2ZTUA 5L95A 2GZ1A 3GRKA 1QLJA 2NWQA 5KJ6A 3MZ0A 4UVGA 4BO0A 3H9EO 1EQ2A 4CMAA 4EGFA 2Q50A 2FN7A 3VH2A 5IN5A 5DBIA 3QV1A 3GDGA 4NHEA 4KDFA 4O6VA 3ORFA 4EEZA 4J43A 4R69A 1XDWA 2HMTA 1XQ1A 3RUIA 4R1SA 2PK3A 3GZNA 4RZHA 2NQTA 1H94A 5AXCA 3ZU4A 4R01A 1NFFA 4HADA 5A3VA 2FY8A 2EIHA 1LDMA 2H9IA 3I4CA 4BVAA 1UAYA 5JAIA 2IDZA 1KYQA 1P0FA 3F47A 2YDYA 3S2GA 5BSEA 3DBRA 2IZ0A 4J4BA 4N7RA 5LC1A 3VOSA 1HXHA 4G81A 4ZICA 3CINA 4ZA2A 3CE6A 3QRWA 5IZ4A 4CUKA 5K9ZA 3I23A 1P1IA 1TEHA 1I36A 1BDBA 5ITWA 4NBTA 1WP4A 3S2IA 4AJPA 3KOUA 2ZJ0A 3PGXA 4OO3A 5JAMA 3I6IA 5TC4A 4CV2A 2QRLA 3PIDA 3I9MA 2Q1TA 1HYEA 4FIZA 2AG5A 3FRJA 4RVHA 4X54A 5L53A 1DC6A 1TT7A 1CETA 2UUPA 1TXGA 5JAZA 4YWJA 5G0WA 5BNIA 3LSYA 3HJAA 3IOYA 1HDZA 2P5UA 5IDYA 4PFJA 5TT1A 1C0PA 1NFRA 4BNUA 3AU9A 3PEFA 3E9QA 5KWEA 3TZHA 1HKUA 4CMBA 2CY0A 1JW9B 4WK6A 3VTFA 5JYDA 2NU8A 3LC7O 3EZLA 4WLNA 4CQMA 2CMDA 4RF4A 4U7WA 2PLAA 4RF3A 4RVSA 1EUDA 4W6ZA 2Z1NA 1I24A 3CMCO 4PLVA 2H5LA 3GUCA 1DC3A 2DTDA 3FF4A 4NJOA 1JVBA 4JBGA 3LLSA 3O4RA 1ZW1A 1V9LA 5JYEA 4J2OA 2A9FA 4DLAA 1GFSA 1PJCA 2VHWA 3NUGA 1DHRA 4IIVA 3GEMA 4R5HA 1DIAA 3A9WA 4PG8A 1P3DA 3P7MA 4ALIA 3SLGA 1UXGA 2QW8A 4JK3A 2DUUA 4EUHA 1CYDA 1UXKA 3DTTA 5AXAA 3GVXA 1DRVA 2GLXA 3Q0EA 2FR0A 1T4DA 4BMNA 2Q3EA 3WBBA 1HDYA 1NPYA 1V3VA 4I08A 2P9CA 2GD1O 4IMPA 4WEQA 4AVYA 1ISHA 2DKNA 4NJMA 1I2CA 3TPCA 4J4TA 3TN7A 1HE4A 3GT0A 1ADCA 3BXXA 3I3OA 5KJCA 2GUGA 5U9CA 1E6WA 2BI8A 1J4AA 4CM4B 1B8VA 3W1VA 4BKRA 1YS4A 2VWHA 1JDJA 1AHHA 2WMDA 1Q0QA 2GGSA 4YJDA 4NQZA 2AEFA 1XU9A 3RUEA 3NDJA 5G0TA 4D0RA 1J5PA 1DC5A 1XHLA 1NBOA 1HZJA 1PS8A 3I9OA 4IPTA 4RGBA 4M54A 3WGGA 2FSSA 3B1KA 3NKLA 3JQGB 1NAHA 3W8FA 3ZZNA 2C59A 1X13A 2NACA 1ZBQA 1EFKA 3PYMA 1M75A 4MVJD 3GNQA 2C07A 1LUAA 2H63A 3MJVA 4BMVA 3FWNA 3DZGA 4F6LA 4CLRA 1JKJA 1PJSA 2RHCA 3WTCA 1E1NA 4MKRA 1ZXBA 3KLMX 1TT5A 4FPXA 3DBLB 2VN8A 2JD1A 2PZLA 3RROA 1MC5A 4RL6A 4BNWA 5FWNA 3CXRA 4A26A 2IZ1A 4ALJA 2EHDA 2D1YA 1PQPA 4NU6A 1U8FO 3ZHBA 1PEDA 4U6QA 2OFPA 2XXBA 3ZCXA 2Y0EA 1Z82A 4TKLA 3V5NA 1C14A 2RAFA 1YRLA 2PZKA 1UAGA 3EGOA 1Y8RA 3Q9UA 1GYPA 5IXSA 4IY1A 1M2WA 1W0CA 2ZQYA 1PJLA 1U5AA 4GMFA 4R4JA 4GAEA 4J90A 3KXDA 1HWYA 3PDUA 3ICCA 3KTDA 1WNTA 1ENYA 1KVSA 1LXCA 1ONNA 4Q3NA 5GZ3A 3GGOA 1E3IA 4JNKA 4YA6A 2Q46A 3PP8A 1EEHA 4LK3A 4EEXA 5JCXA 1SEPA 1QV7A 1UJMA 2VZ9A 3OIGA 3QVXA 3Q3CA 3DBVO 2FHSA 4ND3A 2P9GA 4J4HA 4NFYA 1EUCA 3ONDA 4OYRA 2HCTA 3QQPA 3BTVA 3JQFC 1SCUA 1WDLA 3DMYA 4NG5A 4R54A 4HFNA 2EP5A 1XU7A 3MJSA 1CF2O 2W2KB 4B7CA 1SOWA 1RYDA 3GC6A 1B8PA 1ZKMA 3ADOA 1I2BA 3DEYX 1DPGA 3OHSX 2PKRA 1VL8A 4WGGA 2QG4A 1VJ1A 2CVZA 2X0RA 1UP6A 2WYUA 4Q9NA 3ZNQA 5ER6A 1IE3A 2R00C 1EDOA 1ZSNA 1T1RA 3SBOA 3DAPA 5F21A 1HZZA 3R3JA 4WPGA 5DCWA 4B8ZA 4BNNA 4ZN6A 1K2WA 4EBFA 1U3VA 1J0XO 1LRLA 1U3WA 3HZZA 3VKVA 2Q45A 2IEDA 1BXZA 1PJTA 3ANMA 1VLLA 1XGKA 1NVMB 4JGBA 1LTHR 4RDIA 3T7EA 4NPCA 5G0UA 1KY5A 2NVUA 3AU8A 3FR7A 2HJRA 3GK3A 4PIVA 5L4NA 1XG5A 4JXKA 1YDEA 2VOEA 3RD5A 1E7YA 1PJBA 3H2SA 4Q39A 2I3AA 4NK5A 3FD8A 1QYXA 1A9YA 1AXGA 2O4CA 1CEQA 3JSAA 2DFVA 3RKUA 1LX6A 1UH5A 2DBVO 3GVHA 1OMOA 1LBEA 3FNEA 2HRZA 4YT4A 5A02A 4XJTA 1LLUA 3F4LA 2P2SA 4DQVA 4BNLA 3ASUA 4XRGA 2NUAA 5KIAA 4B7UA 2X0IA 1AXEA 3ZV3A 4LN1A 1PZHA 1QYCA 3KSZO 3SC6A 2BLLA 3WYBA 5B1YA 3ZHYA 3FTNA 2D59A 4IDFA 4LMPA 4MOWA 5I8WA 4UUNA 5BSFA 2FWMX 2I65A 4J0EA 3GOHA 3ROPA 3L07A 1DAOA 4BO6A 1XSEA 4KUEA 4DBZA 2J3HA 2CFCA 2YV2A 1NR7A 3U5TA 2OO5A 5B12A 4E5KA 4XDZA 2P91A 1OC4A 1K6XA 3A1NA 3GG9A 4IJKA 4IM7A 5DOVA 4YT2A 1GTMA 3QWBA 1MGOA 2OHXA 4MIOA 4CV1A 3WIEA 2W2KA 1TA4A 1SB9A 2BGLA 4Y6RA 2PA3A 4CMHA 4WOJA 5TRTA 5T8KC 3O9ZA 1ZUD1 2VUUA 2JD0A 3C1OA 3F5QA 5ES3A 1C0IA 1R66A 2HQ1A 4OH1A 3TWOA 3ZWYA 4F3YA 1U28A 3U9LA 1YXMA 3WR5A 2CF5A 1B2LA 3DZHA 3L0DA 2YFHA 3WQSB 5T57A 1EUZA 1BG6A 1PJ2A 2Y0CA 3DZKA 4A03A 4KQXA 5JFOA 4XQ9A 3OIFA 4IGFA 2IEBA 4NH4A 5KJEA 4CLOA 3FCOA 4F46A 4BO8A 3RKRA 4CM3A 5JDIC 2VQ3A 4UVIA 4Y8VA 2WJPA 2O7QA 1C3VA 4PLZA 3AW9A 3ONEA 4K6FA 3VZRA 2EEZA 4OXNA 2X9GA 4BQRA 1R0SA 4GQAA 2WE7A 1Y8QB 3KEOA 4JCOA 4WLUA 2E48A 3K5PA 5BSGA 4A2CA 3OQBA 3OECA 3TFOA 1C1DB 1ZXLA 4L8VA 3WICA 1Z73A 3SEFA 5JO0A 1PQWA 5CHEA 1FDUA 1I5RA 4FSHA 2BF7A 2VHVA 3G49A 1B14A 4PVCA 2YYYA 4IIUA 3LDHA 3NGLA 3LF2A 5G4KB 4ZGWA 2ZB8A 3AFNA 3QSGA 5KVQA 4E2YA 3WFIA 2B4RO 1NHWA 3K2EA 3H3JA 4Y6PA 4BS9A 1E6UA 5CEFA 1B15A 4QSMA 1DJNA 3H5NA 1W6UA 1D7OA 1PSDA 2I66A 3ZU5A 4ZHSA 1Z45A 4P38A 1GEGA 2B0JA 1M66A 2SCUA 3GHYA 3KSDO 5FI3A 1I3NA 1RPNA 3Q11A 4GX0A 1HL3A 2J3JA 3KB6A 3BMOA 2BRUA 2HK7A 1V6AA 2C7GA 4Y9DA 5FYDA 3WQQA 2UDPA 5BQFA 3AI3A 1NQAO 3O8QB 4XX0A 3GZNB 1QRRA 2JFGA 1PWXA 4RJTA 1B8UA 3JD0A 4EJ6A 1O89A 1ZZEA 2O23A 1MLDA 4K9DA 3RC2A 2W98A 3V1TC 4NIMA 7MDHA 2NU6A 4DBVO 3HFSA 4ESOA 1LDGA 4IZIA 5TGDA 3ULKA 5HTOA 1KEVA 1XIVA 2EV9A 5U4QA 2OMEA 2VCYA 5L45A 4PZCA 4GH5A 4B3HA 1NVGA 3GEGA 1ZMTA 1SMKA 4E21A 1JAYA 3ZWMA 5DNAA 2P68A 4CM5A 4E0BA 3JQAD 2J3IA 1ZVMA 3NDRA 4DXHA 1B7GO 1VSVA 4MVJA 4D3SA 2C5EA 4D45A 1KEPA 3DWFA 1YBMA 4TWRA 2JCXA 5B4VA 4JLWA 1DIGA 1YOVB 4YJHB 1BGVA 1LRJA 3PHJA 4MIYA 3NTOA 4YQYA 2NTVA 4E5PA 3ENNA 4XKJA 3PFWO 3MEQA 5GZ1A 1SO8A 3DZIA 3V2UA 4D42A 4J91A 3A06A 4AICA 4E3ZA 3LC1O 1IOLA 1UDBA 4RZIA 5G0VA 1NPTO 1KERA 1N1GA 4FGWA 1BMDA 4XYBA 1HEUA 5MGBA 1NASA 4ILKA 5FFFA 5GY7A 1YBVA 1LC0A 2PZJA 3VDRA 5G4LA 2FPIA 4AJOA 2PH5A 4H3VA 1PGJA 1QYDA 3WMWA 1DSSG 4L73A 3GPDG 2B4QA 3QP9A 3ZU2A 4KOAA 5IDQA 1TLTA 3PJFA 5F5NA 3TNLA 5KKCA 1K5HA 3Q6IA 1J49A 2DBZA 2PWZA 4DPKA 4TSKA 1NVTA 5L7TA 1WZEA 1T1SA 1RM5A 4LSWA 4E6PA 3U4HA 2CDCA 1R6DA 2RH8A 4AJKA 3ZNPA 4DL9A 2GZ3A 1X1TA 2PGDA 1SBYA 1E1LA 1VKOA 3DXFA 4I8XA 2GDZA 4DMMA 3JQCA 3EVNA 4WASA 1EVIA 1E7WA 1N2SA 3HQ4O 3R6DA 3FNFA 3JD3A 4CM9A 3OF2A 4PLPA 3C8MA 4RV9A 4ZQGA 3FNGA 3VZPA 2GN9A 4INAA 5HA5A 5C7IO 1QYVA 4WNCA 3O38A 2E82A 3LLVA 4DC1A 1CWUA 5KJ1A 3UOGA 2O50A 3DZFA 3ZWAA 4L0QA 2FZEA 3NT2A 2CF6A 2BGMA 3FHLA 3HDQA 3QHAA 3DHEA 5I8ZA 4L76A 2DUWA 1X0VA 1G0NA 4XQGA 5L51A 4RORA 4W7IA 3IUPA 1EVZA 2WE8A 3N7UA 3RBXA 4GSKA 3V8BA 1U7HA 1GD1O 1PL6A 3GY0A 3PYXA 1SPXA 3GDFA 3VH3A 3RCBA 5L4LA 3GVPA 1G0OA 3OA2A 2DU8A 4GVXA 1I10A 4R1UA 4B79A 2D4AA 3GGPA 4WOKA 2GCGA 3ZV4A 5BNTA 1JWAB 3CMMA 3GG2A 3GNTA 4PLGA 1V0JA 3MWEB 4J1TA 2PV7A 2YUTA 3DZBA 3OEWA 4PN3A 3WLEA 4CODB 4XJSA 2HAEA 1JVSA 4GL4A 4UAGA 3N74A 4NBRA 1U2GA 3HG7A 1H6CA 4NBVA 4CM8B 3RBVA 3IS3A 1PZEA 1SC6A 5THKA 1JTVA 3ZNNA 1IPFA 1CQJA 1PGNA 4O5OA 1HSZA 3PRJA 2XF8A 4NDNE 4FCCA 4MDHA 2DVMA 2C20A 3ZWXA 2G5CA 5DCYA 5DT9A 4MVJE 4PLCA 4FB5A 1A7KA 4CQMB 3KZVA 4ND1A 4TVBA 1ZNQO 3B1FA 4J9VA 4YRBA 4WLVA 3NDIA 1G6KA 1U5CA 3LC2O 4EI2A 4K28A 3D1LA 2FZWA 4RPGA 4M86A 1MUUA 3DOOA 4EZBA 1OAAA 2GO1A 3AI1A 3DDNA 1N5DA 4PLYA 1I2ZA 2PZMA 4M89A 3WGIA 3C1AA 2ZKLA 3G1UA 1H6AA 1RKXA 4AJ1A 1ONPA 2HMUA 3K6JA 5JCJD 2UYYA 4N5MA 2NTNA 1DIHA 3GH3A 2WD7B 2YY7A 4ZQEA 3EHEA 2I5PO 1HDRA 1NWCA 2Y1DA 2PH3A 3PI7A 2HK8A 5IJZA 2VNSA 4M49A 2HRBA 5F1PA 4XYEA 1F8GA 2HK9A 4CMGA 2EGHA 3BMCB 3L9WA 5EL0A 2NVUB 2AE1A 4M8SA 3RFVA 5IDXA 1NNUA 1GQYA 2D5AA 3IC5A 1ZCJA 3NJ8A 2YHIB 4GI2A 3ZHXA 3ZWBA 5TT0A 2AQIA 2ZTLA 5JXWA 1UP4A 1VSUA 2WTBA 3QVSA 4WLOA 5EESA 4CPDA 2Y68A 3I4FA 1HLDA 1VJ0A 4W99A 4GWKA 1R16A 3QIVA 4PZDA 3VTZA 3KYCB 5LCXA 4S1VA 4BV9A 5HWSA 3FSRA 1K6IA 2O3SA 1XLTA 5B37A 1U1IA 5DDIP 3JD4A 4EUFA 3JQ8B 1EBUA 5IFLA 3RSHA 1F14A 1UXHA 3PTZA 4ND4A 2BFPA 3I1JA 1N8KA 3H4VA 2JHGA 4CMJA 3PIIA 3V1UA 1HDXA 1WDMA 5L9AA 3H8VA 1AUPA 1E1MA 4MO2A 3E8XA 3EZYA 4BGIA 4CL8A 3KM0A 3TFQA 3VDQA 1Q2XA 2FPPA 3Q9NA 1AGNA 5CPBA 3K30A 4W4TA 5IDWA 1QG6A 1GV0A 4DUPA 4WE3A 5EN4A 2Y1FA 1QSGA 1WW8A 4ND5A 4IINA 4YRDA 1IUKA 1E3WB 1TI7A 2TMDA 4E30A 2O3RA 4YACA 4Q3DA 3D7LA 1JKFA 4DLLA 4LGVA 4I5EA 1UP7A 2DAPA 1E5LA 4NK4A 1WWKA 2FSVA 4CLDA 2E37A 1BXGA 3W4IA 1GPDG 1JLLA 2O2YA 5COQA 3KVOA 1UUFA 1E5QA 1DFIA 1FK8A 1U7TA 7ADHA 3F9IA 1N1EA 3RU7A 1GQQA 2B37A 1RM3A 3IJPA 3GPIA 4QXMA 2J3KA 3VC7A 2I9PA 4BIIA 4N5LA 3ETDA 2WYVA 1F12A 4RPKA 1K6JA 4R5MA 1VM6A 3HDYA 1EZ4A 2YDXA 2B5WA 4MVJH 3E5RA 1NPDA 2IXAA 4HXYA 4DREA 1H5QA 4Y67A 1E1KA 2DTXA 4YJGA 4Z0TA 4WCFB 3SJUA 1KOLA 1X0XA 3U62A 2CD9A 2VYNA 1K89A 1LQUA 1E77A 4J16A 3KV3O 1VL6A 2JHFA 4OOFA 3DFZA 2VTEA 2YFQA 5ILOA 1YL5A 3MCVA 3HDHA 4R9RA 5CG1A 2VTDA 1GPJA 5DCUA 1EE2A 4BB6A 3PJEA 5K0ZA 2GR9A 1AHIA 3BMQA 3JQDA 4P8RA 4P4NA 4BO9A 1O95A 4DC0A 3ZDFA 3RUAA 5GZ6A 3LT1A 3HNPA 4XYLA 1X15A 2CVOA 3DBHA 2A35A 3ANNA 4ZRMA 3ZV5A 3LQFA 4KUHA 5T8KA 1OZAA 1FDWA 6LDHA 4RPJA 3VVBA 2PD6A 4RLHA 3RUDA 2EJVA 4RQUA 1GAEO 3H9QA 1HYGA 4ZQFA 3SVTA 2HKIA 1CQIA 4MP8A 2P5YA 4BNXA 4XB1A 3JQ9A 4YQZA 2CVQA 4WNIA 4K26A 4FQ8A 4PG7A 5A05A 1PL7A 2GF2A 3UH1A 2YQ4A 2Q99A 4A10A 1KVUA 4MVJM 3BTUA 2VRBA 1QYWA 4J1SA 3NX4A 3WWYA 1KEWA 3JQ9C 3H65A 3ZNOA 2J5QA 2X5JO 1OOEA 1E3WA 3NAQA 1AE1A 3K92A 5L7YA 1A4IA 4MVJP 2V6BA 3RBZA 1PWZA 5CDTA 5KJFA 1FXSA 1GZ4A 1HTBA 3C3XA 1R4MA 3JQ6A 3KBOA 4J9UE 3VPGA 4Q3EA 3OP4A 1DFGA 5CFZA 4CQLB 1ISJA 2IZZA 2OP0A 4DRYA 2DFDA 4ZRNA 5F1OA 5KOIA 4A0SA 4LRTB 4A27A 4TVOA 2WSBA 3INTA 3ZWCA 1Y5MA 1KC3A 3FBTA 3GUYA 2G17A 2Y1EA 4IXTA 1X7HA 1DHTA 3NTRA 1UDAA 4OKIA 5CDUA 2WEKA 3UAGA 3AY7A 2ZCVA 1ZSVA 3WSVA 2O48X 3CZRA 5K6AC 2D3TA 1CDOA 1WPQA 1GUFA 2J5RA 4U6SA 5T5QA 3EMKA 3CPSA 2WM3A 1P45A 3A28A 2X5OA 1VE9A 5A3JA 2X1HA 2EGGA 3EUWA 1N9GB 5ENVA 5ICMA 4LW8A 4CQLA 1NP3A 1R4MB 3H9UA 3KYDB 4RPLA 1YWGO 2C2XA 4ALNA 4D3FA 1Y9AA 3PJDA 1E92A 4Z3DA 3RC7A 4B3IA 1O8CA 4J2HA 4CR8A 5KCZA 1IB6A 5FF9A 1P9LA 1PGOA 3W6ZA 4UEKA 1DRUA 4EDFA 1ZK2A 1X7GA 4TZTA 1VPDA 3MJCA 2DT5A 4KTTE 3DTYA 1W8DA 1KS9A 5EINA 4D79A 4BL5A 2X9VA 3U49A 2X4GA 4EW6A 1PS9A 3QY9A 1I3MA 4CMEA 2Q2WA 4Z9FA 5AVOA 1ISFA 4L75A 3BZUA 5J23A 1JA9A 1I30A 1LU9A 4E2ZA 2D0IA 4GX1A 4OMUA 1JN0A 1MA0A 3W6UA 1DAPA 4CR7A 5EERA 4I9HA 3ON5A 1HRDA 4R41A 1OFGA 1DFHA 1IZ0A 4FN4A 3NRCA 5FEUA 4WCFA 1GL3A 2AG8A 1P1FA 4IDEA 1H6BA 1NFQA 3CUKA 5T6BA 5CDSA 2X22A 4H15A 4FC7A 5JC8A 3BMNA 4CMIB 4BQPA 1AN9A 4HP8A 1T4BA 4GX2A 4NU5A 3WMXA 4EYEA 4GWGA 1BW9A 1RWBA 4TRNA 4NFSA 4BNMA 4UEJA 1D1TA 5HRUA 2Y1OA 2CSUA 3OETA 3QW2A 1CRWG 4G5HA 5I9NA 3I6QA 5A06A 4BKQA 4E5YA 3GFGA 4JIGA 2NU9A 2Q49A 4QT0A 5JMPA 2V7PA 5TF4A 1H9AA 4W9NA 5EQFA 5JLAA 1WVGA 1EVJA 4DVJA 4JQCA 4F6CA 1Y8RB 3KLPX 1I3LA 4JBHA 4LMRA 4R51A 3L6DA 4WJZA 1XKQA 3QWFA 2BI7A 3PHLA 2B83A 2JFHA 4LVUA 1HE5A 5I9LA 1YVEI 1PIWA 3B6ZA 3Q2KA 3AUUA 3RFTA 3PQEA 1C1DA 1E7RA 4QUKA 4R1TA 3OQ1A 3AOEC 4W82A 4LRSB 3BHJA 3ENKA 1BXKA 2VT2A 4L4XA 2OXIA 2IE0A 2ZATA 2BD0A 1EE9A 4W9NC 4CM7A 3VH4A 3H9JA 1OC2A 3GMSA 1I33A 3TL3A 3TRIA 1PZFA 3HHPA 1GEEA 5CEJA 4YAEA 1Q1NA 1YE3A 3IP1A 5FI5A 1KVTA 3WS7A 4XYGA 3K2BA 4WUVA 3M2PA 4ALMA 1QR6A 2EERA 3LVFO 4II2A 4I5FA 3RU9A 2GYYA 3DHYA 3KO8A 2ZTVA 3LT2A 4PVDA 2UAGA 4PLTA 4WCFC 4P4GA 4LVCA 4BO1A 1LA2A 1PJ3A 4IDCA 2VNAA 2YHIA 3H6KA 4ND2A 4OL9A 2DLDA 5EMHA 4Z0PA 4PRLA 3ICPA 4R9SA 1F8FA 2VT3A 3NTQA 1BW9B 2VYVA 5CG2A 3IKTA 2FR1A 1B16A 3C24A 4CR6A 4FD3A 3H5RA 2OGUA 4Y6SA 3KEQA 4U0KA 4B4WA 3MTJA 3BMNB 4Z6KA 1GV1A 4FS3A 1EDZA 4ZJUA 2Z95A 2YQ5A 2XAAA 3I9LA 1T2CA 2HMVA 4YJFA 2BHLA 5T67A 3RUHA 2PKQP 5A9SB 1V35A 5CEEA 3AOEA 4JP3A 3ROQA 2W4QA 4FJ2A 4AJIA 1Q0LA 3ABIA 5EPOA 2D5CA 1GQ2A 5A4DA 5JY1A 3WYEA 4D41A 4E5MA 1UXJA 5BSHA 4IDAA 4J7CA 4WKGA 3ZWWA 2CZCA 4LISA 4XQEA 1E0DA 3BMQB 3B1JA 4HUJA 3EC7A 4ZQHA 4FOSA 3U4DA 1NHGA 1D8AA 2I76A 2QYSA 4I5DA 3U3XA 2PGLA 4XYMA 3X2FA 4CL3A 4E2XA 5F3RA 4YPOA 4E5NA 4WLEA 4P22A 3IUSA 5GMOA 4YJFB 3DB2A 1T24A 2ZQZA 5LDGA 4CMKA 1A27A 3NGXA 3F3SA 4ITUA 4JBIA 2PD3A 2VYND 4BB5A 1UR5A 9LDBA 5ITVA 2X86A 1I01A 4TZKA 3B70A 3ONFA 5H82A 1T2FA 5T64A 2VWGA 5JY6A 1BHSA 2EKLA 2ZYGA 3VPSA 3JQ8A 3D5TA 5A04A 1GU7A 1JWBB 1T26A 1ZK4A 2I67A 4FFMA 4MINA 5DP1A 3ZI0A 1U8XX 3D3WB 3QLJA 4BGVA 2I6TA 1XWFA 4CJXA 2V65A 3E6AA 3WX0A 2H1SA 3UFXA 5L40A 4GLLA 2PTGA 3UW3A 1DLIA 2RBEA 4Z9XA 4B4VA 1XELA 3BTSA 1ADGA 3E9NA 5B4UA 4RF2A 2Z1MA 2AHRA 1MB4A 1GCOA 4IQ0A 3JYOA 3RC9A 4AJ4A 2GASA 4EJMA 5I9MA 2JFFA 4J3FA 4MKXA 3I52A 1Y1PA 4OHUA 9LDTA 4TKMA 3GVIA 3HADA 2O4UX 3OJOA 4AL4A 2WWRA 3N58A 4BUCA 3IJRA 4IDDA 4A7PA 4BOYA 3ITKA 4IS2A 1NWHA 5H83A 1D1SA 1LSOA 1NTOA 1P33A 1Y5RA 3RWBA 4HY3A 4MKZA 3M2TA 3WLFA 2Y05A 5H81A 3DBHB 2X23A 4QO8A 4ZD6A 5U1PA 2JKVA 5G0SA 2BMAA 1PS0A 1QKIA 3WSWA 4ROSA 4BGUA 2E6UX 3G0OA 2RIRA 1MG0A 3DMTC 3WJ7A 4PG6A 4BHTA 5G4KA 3K9QO 4NBWA 2Y1CA 2JAHA 1PGQA 2NVBA 1S6YA 4RVDA 5BNFA 1E3JA 5ADHA 1DIRA 2ZCUA 3UF0A 4IZHA 3H9GA 4OSOA 2UUOA 4UUMA 3DMTA 3VHRA 2OZPA 3UICA 5TJHA 5L4SA 1YJ8A 1GZ6A 4E12A 3GEDA 3JTMA 1VC2A 4QEDA 3S2FA 4BKOA 1ZK3A 4IDGA 5HBRA 4Q3CA 4BNYA 1M6WA 4BNFA 3RJ5A 1ULUA 4URFA 4RDHA 4J49A 4DGSA 3OM9A 1R37A 3TF5A 1XA0A 3RASA 1R4NA 3GAFA 4R3NA 1EBFA 3JYLA 2B4TO 2V6GA 1H2HA 1YGYA 1B0AA 4CM6A 3RUCA 1YH3A 2QIOA 5IZCA 1P1HA 2YHUA 2Q1UA 1P44A 5IN4A 1CJCA 4Z9YA 1VL0A 2B36A 3DOJA 4GLOA 1W73A 4XGKA 2O3JA 1T2DA 2CDBA 3L6EA 1KVRA 1HT0A 3FNHA 2I3GA 1A7AA 1Y81A 1ORRA 3FPCA 1NQOA 4J0FA 3UHAA 1MFPA 1NYTA 4DMLA 8LDHA 1H9BA 2FOIA 2QZZA 2VOJA 3P5SA 1LSUA 4RO0A 4IDBA 2G1UA 1ZO8A 4PLHA 2VUSA 1BWSA 1A9ZA 2TMGA 2ZK7A 3WJAA 2YV3A 2WYWA 4I5GA 5TQVA 1LJ8A 2YZ7A 4QFDA 4HV4A 4IJVA 2W90A 4GGOA 4W7HA 5A5FA 4QQRA 2CUKA 1PL8A 3K96A 3ZHZA 4OKNA 1TVEA 3WGTA 2O3UA 2G76A 3R3SA 3AOGA 4GGPA 1GR0A 1E7MA 2QZ9A 1EMDA 2JD2A 1T2EA 1H6DA 2NV6A 4BKPA 3PZBA 2XPCA 3TZCA 4CLHA 3KHUA 1DO8A 3GQVA 1HETA 1TT5B 3STHA 2WDZA 3L4BC 1ZK1A 4OXYA 3F6YA 2HLPA 2C29D 2DTEA 3FN4A 2O3QA 3VH1A 3WXBA 4KP7A 4R3WA 4B7XA 3OQ6A 3IP3A 3F4BA 1JQBA 2BELA 2CDAA 1JKIA 4XWYA 1LDEA 3WNQA 2J6IA 1SNYA 2OUIA 3JQBA 4OAQA 5IF3A 3AJRA 3HFGA 1HLPA 1P74A 2Y99A 3IQDB 3LYLA 1PX0A 3AUAA 1WZIA 1X7DA 1J6UA 2EF1A 4NI5A 3SC4A 2PY6A 1NR1A 2OP1A 3GZ4A 4M87A 5K6AA 1ENPA 4ZQBA 3SX2A 3OBBA 4RF5A 2C54A 4PG4A 3PXXA 1LEHA 1QORA 3GLQA 1WLYA 1FDTA 2X58A 3GF4A 3UUWA 3M1AA 2Q2QA 3W8DA 1IHYA 2GERA 3WDSA 3PQFA 4FR5A 3U09A 1M6HA 4G2NA 4BMSA 3IDSA 3WOHA 6ADHA 4PLWA 5DP2A 1T25A 1ISIA 3HWRA 4P4LA 1XYGA 1HDCA 2PGJA 3OFSA 3F1KA 1NQTA 3QWIA 5COAA 1ZK0A 3EY4A 4MJLA 5TIIA 4KWHA 3D5QA 5B4TA 2O7SA 2X0NA 2J8ZA 3OH8A 1YKFA 1Z7BA 1G1AA 1Z7EA 4E31A 4IQ8A 2NLOA 4ALKA 5A9SA 2C0CA 1O6ZA 1C1XB 4YB8A 4GX5A 4YAGA 4CM8A 1IYZA 2NM0A 1MC4A 3E1KA 2PD4A 1U2DA 3OJ0A 3RFXA 1IHXA 2Q4EA 4YAIA 1TB4A 3F46A 1UZLA 1T2AA 5JCJA 1E3SA 1GDHA 1SOVA 5KKAA 4TROA 3ZW9A 5I7EA 1VJTA 2DM6A 4CMIA 3WTBA 1GYQA 1X1EA 4NBUA 1GY8A 4IJUA 4PG5A 1I8TA 3ADPA 1R4NB 3SLKA 1PQUA 5IXYA 1M76A 1ZSYA 4RLSA 1R0LA 3UXYA 3NEPX 1PJ4A 4BNGA 4KDEA 4U0JA 1X14A 3PLNA 4YJGB 3GAZA 2GN8A 2FP4A 4CLEA 4UUPA 1E3LA 2GN6A 2RH4A 3BAZA 3FI9A 3NV9A 4DTIA 5JS6A 4ID9A 4DQXA 1YB4A 4YBZA 4IGEA 4QTZA 4MPDA 5EIOA 4GPD1 3OIDA 2BKAA 2F00A 3PYLA 2WD8A 3AWDA 4IBOA 4KMSA 4CV3A 3Q1LA 4Y98A 5HS4A 1SZJG 3ST7A 2GRAA 3E03A 5JAQA 4MVJG 2Q4BA 4QECA 2JCVA 2P4QA 1KEUA 2DPGA 1RM4A 1ARZA 2C82A 2Q1WA 1YQDA 1UXIA 3LK7A 4E4YA 4YYZA 4B8WA 5ILGA 5DF1A 4J6FA 3QVTA 2B35A 3VZQA 3H7AA 1LDYA 1I3KA 2XXJA 3AK4A 3L6OO 2HUNA 2HMSA 4CQMD 1LLDA 1NQ5A 4HFJA 5C7LO 1L7EA 2FMUA 1ONOA 2HSDA 2YJZA 3GHHA 4KTVE 1P1KA 4DYDA 3VPXA 2QYTA 3M6IA 3W4JA 2GPTA 1A4UA 2W8ZA 4RVGA 5A9RA 2BH9A 1YB5A 1VKNA 3MWDB 3ROKA 1V3TA 1Q7GA 1Z74A 1YO6A 3JYNA 4D44A 1Y8QA 3TQHA 4FFRA 1A5ZA 1QMGA 4IXWA 3TJRA 3E82A 4G65A 3WIDA 1D4FA 3BHIA 3QVWA 5EQDA 3T4EA 3DBRB 4F45A 3FWZA 3P2OA 5L7WA 5G2OA 1B26A 2HO5A 3DAFA 3QJ5A 4XR9A 3WBFA 2PR2A 5DN9A 1S7CA 2A4KA 4KWIA 4AG3A 1Y7TA 1ZIDA 1HYHA 3PJGA 1XQ6A 4BV8A 5A1TA 1ZEMA 2AA3A 2NTJA 1ZFNA 2DBQA 2ZJ1A 5AXBA 1B3RA 2G82A 3K31A 3MJTA 3DOCA 1FJHA 2XOXA 1U4OA 1YQGA 3HUDA 4DYVA 4I1IA 3IIEA 2OOSA 3IAHA 1DLJA 4II3A 1P1JA 3WQRA 4DWVA 2AE2A 2PFGA 2QRJA 2X9NA 4O63O 3WB9A 1O9BA 3WGYA 2UV8A 4Q3BA 5CAEA 1YL7A 3F5SA 4ZVVA 5I7VA 3BHMA 3PQDA 1H0KA 1MP0A 5LDHA 1YDWA 2QX7A 3ASVA 4B3JA 3JQEA 3MJ4A 4NJMB 1O5IA 3GDOA 4CM1A 4BNTA 3HDJA 2VWQA 3FR8A 4Z3KA 3M1LA 4QX6A 3WGQA 4KQWA 2B5VA 2ZB7A 2EKQA 3LU1A 2NU7A 3JYPA 2LDBA 4HFRA 3PWZA 3INGA 1ENZA 5IG2A 3GVCA 4FBGA 2ZTMA 1DEHA 2IRWA 1DOHA 3ZN2A 4GKBA 3BTOA 4CUJA 4DA9A 3D3WA 1LLQA 1WMBA 2NSDA 1NXQA 1O0SA 3G3EA 4FJ1A 2X6TA 4JJFA 1ZEJA 3BIOA 5C37A 3CTMA 1E7SA 4YAJA 3AUTA 4YR9A 4MIEA 4UEOA 1PTJA 2X8LA 2ZIZA 3CIFA 1L7DA 2BGKA 3AFMA 3NT5A 1DXYA 2ET6A 3ZWPA 5JMWA 3BA1A 3JD1A 3LT0A 1GCUA 4OGWA 3DFUA 4N54A 4L4SA 5A03A 1UZMA 3I83A 4BNHA 1YQXA 4HNGA 3WFJA 1RYEA 3A14A 5TSDA 4EUEA 3VZSA 3TZQA 3OA0A 4BNKA 3RQSA 4O1MA 3IMFA 2VZ8A 4XGIA 3PPIA 4XCVA 1LQTA 1LSSA 1P31A 4IJWA 2EXXA 4XIYA 1FDVA 2NVWA 1LDNA 1UZNA 3O03A 1D3AA 3UVEA 2AXQA 3TDKA 4CLXA 3JQBC 5JE8A 1Z6ZA 3DAGA 2EKPA 2VRCD 1ADFA 3UCFA 4XZ3A 5TLSA 2NQ8A 2VZ0A 4LCJA 1ISMA 3NJ4A 4AJNA 3IKVA 3HB4X 1A71A 3AM5A 4XIJA 1YB1A 2EJWA 4N5NA 1DBVO 3CSDA 5L3ZA 3EYWA 2W2LA 4YRAA 4AFNA 1IY8A 1EQUA 1PR3A 3QE3A 1ZJYA 1U9JA 3L9XA 4Z0HO 3PWKA 3HE3A 1YL6A 2UVDA 2Y66A 3AM3A 1DC4A 4FW8A 1BSVA 3HN2A 3ZGYA 3NT4A 1BXGB 3E5MA 3ITDA 4XA8A 3I9KA 4R68A 4CV0A 5AYVA 3JV7A 3VPHA 3RUFA 4XGNA 4AJLA 4R16A 4DIOA 1ZMOA 4QFCA 2VUTA 5JW6A 2DQ4A 1WXDA 3QVOA 3OMLA 1Q7BA 3JQFA 5HM8A 3SXPA 4L74A 3E9MA 3FTPA 1C0KA 3QWAA 4TRRA 5TX7A 1OI7A 4EJ0A 5KVCA 3COSA 3T4XA 3ZWOA 5KTKA 1SEVA 3VAZA 2AQKA 3TZKA 4BNZA 5IZCC 2LDXA 4E33A 2JJYA 2NNLD 1F0YA 3PDJA 4PLFA 5F1KA 1PZGA 3GN2A 2EG9A 2GN4A 2HJSA 4BO7A 4OOEA 1LDBA 4PCVA 2A92A 4CLRB 3PK0A 8ADHA 2E49A 2Y0DA 4OXKA 5TNXA 3RC1A 4CLOB 2QHXA 2JL1A 2NADA 5TS3A 3V1YA 1KIFA 1YBAA 1GUYA 4FC6A 4C7JA 1XEAA 4B4OA 3D3EA 4ALLA 1U3UA 5CDYA 3DZJA 4YDRA 1ENOA 2J5KA 3DONA 5A9TA 4JX8A 4M55A 2EW2A 3RJ9A 4UULA 3KRTA 3OJEA 3P2YA 1XR3A 1N7HA 3RVDA 5F5LA 5DZSA 3W8EA 3ZWVA 4DIBA 4IMRA 3ZWNA 1EK5A 3UKOA 1PJQA 1HF3A 2Q2VA 4RVUA 4BKUA 3E48A 2X0JA 4J1QA 1IL0A 1QLHA 2PNFA 3L4SO 2RHRA 3D4OA 1WAMA 1HDOA 2BFOA 2AEJA 3RAJA 2C7VA 4HBGA 1OBFO 1N92A 3GR6A 1ID1A 4WLFA 1LC3A 4ZU3A 1K3TA 5JO9A 1Y9EA 5JBIA 3AI2A 4RPHA 5DOZA 2IYPA 2JCYA 3ETGA 1QP8A 1YJQA 2QQ5A 3BYZA 1LRKA 1GZ3A 3PVZA 1CIVA 5BT9A 3S8MA 1ISGA 3KUXA 3JQAB 3CKYA 2HMWA 4UUOA 1RJWA 4CMEC 5I7FA 4IQGA 2D2IA 1DB3A 2I99A 4D43A 3C7DB 2B69A 4RVFA 2VHZA 1MXFA 2VWPA 1F06A 4D46A 3U0BA 1XCBA 1WMAA 2BFAA 2HU2A 4HFMA 3U4CA 4PZEA 1ML3A 3GNSA 3PZRA 1HE3A 4RQTA 3BMCA 4GSLA 3ZV6A 4BNIA 5JSFA 4J1NA 1C0LA 3Q2IA 4FDAA 2HDHA 1L1FA 2VYVD 2QRKA 4IS3A 3PGJA 1LI4A 2V6MA 3KYBA 4XR4A 3ZW8A 1C1XA 1FMCA 4LCEA 4CM4A 3AM4A 3HN7A 3D0OA 4AJJA 4UVHA 1IPEA 2O2SA 4XQCA 1YONA 1BRMA 1DIBA 1VI2A 4TMFA 4JJIA 4UVEA 4BO4A 2FR8A 3U4IA 5ENDA 1I32A 1R15A 4TRJA 5TJ9A 4DPLA 3ANLA 3GA0A 3JCZA 3I9NA 3H5AA 3V2GA 5EJ2A 2P9EA 4HX5A 1P1RA 4NMHA 3MOGA 3TOZA 3INRA 3PHGA 1E7QA 1V3UA 4D0SA 1IZ9A 4L9RA 4E32A 3VPFA 3EVTA 4OSPA 3AUSA 4YXFA 2VHYA 3C7CB 3L77A 5AQ1A 3I5MA 3OEYA 3P19A 2EW8A 3AY3A 4OIMA 3I9JA 1Z75A 4BO3A 3D4PA 4JP2A 1SB8A 3ZH2A 3R1IA 3LT4A 3QA9A 3JD2A 4GVLA 3S55A 3UGKA 3DBLA 1R0KA 1W4ZA 5THQA 1NX6A 2V6FA 4FGSA 1FDSA 1MXHA 3WGOA 4YAKA 4OM8A 2IYOA 4O0LA 4U8GA 3HB5X 2O3TA 4FFLA 3DO5A 2Y67A 3JQAA 4GMGA 4E2WA 5C3MA 4BNVA 4H16A 3JYQA 2ZB3A 3CH6A 3LZ6A 5A5EA 3WGZA 1M67A 5JDIA 3WWZA 4JJGA 3DL2A 3PHHA 2OBNA 4H7PA 1Q0HA 3A4VA 4FOOA 3W4KA 3OSUA 3VKUA 3OJLA 4K1LA 5JPIA 2AW5A 1A72A 3FBGA 3GN1A 3JQ7A 5DULA 1SAYA 1HSOA 3C7AA 3UCEA 2EP7A 1QXSA 3JQGA 3ETEA 3MJEA 4XB2A 1UDCA 3HSKA 3PWSA 2YW9A 3K73O 4TRMA 1QV6A 4A5OA 5DBFA 4BNJA 3G1TA 3G17A 3WYCA 5DBGA 4FFNA 4NZ9A 1RM0A 4FFPA 3H2ZA 5JC1A 4YT5A 4OQZA 4BGEA 3TZ6A 5C7OO 2R6JA 1E6EA 1N7GA 4PRKA 3DHNA 3PFFA 3TOXA 3FPLA 4WCDA 2R2GA 2DC1A 1GADO 2GNAA 2OBYA 3GGGA 3KSUA 2C2YA 2FPGA 1LNQA 1NM5A 2DPHA 3GRPA 1O94A 3JQ7B 3KYCA 2D8AA 5C5IA 2AEMA 4YEDA 4R1NA 2RCYA 2G0TA 3O8QA 3UN1A 5CDGA 1JU9A 4FJ0A 1Q7CA 1KY4A 1Y6JA 5AXDA 3EDMA 4CM9D 4C4OA 4D3DA 3G79A 4DPMA 2DBRA 3RI3A 1MG5A 2Y93A 1F17A 4XDYA 4HWKA 3PHIA 3AY6A 1KC1A 3PLRA 5KNLA 1ADBA 2EWMA 1EFLA 3R0IA 1R12A 1ULSA 2POQX 3OJFA 3C1TA 1H93A 4IUYA 4WECA 4O59O 5ER9A 1B3BA 1U3TA 2OL4A 1DRWA 4HKTA 4AJ2A 5KVVA 1P0CA 4S3MA 1BVUA 4B4UA 2VRCA 3D64A 1DDOA 1H2BA 5COBA 3NYWA 3CZMA 1VRWA
chains in the Genus database with same CATH superfamily
2IGKA 5KOJB 3I2IA 3UW1A 3BD9A 1AQJA 2EOAA 2YWXA 2BFNA 1J0BA 4WA7A 4ER0A 4F5YA 2VDNB 4H1VA 1JUPA 5BNGA 3C4QA 3KJHA 3P2IA 4L7QA 4O4IA 5J1TB 2HKOA 1IWBB 5KDLA 2BBWA 4C0BA 4XLNF 3J81k 4JN6B 1QNLA 1T0FA 1S2OA 1ZRHA 4JQFA 2I6FA 2Q62A 3F1LA 1WDKA 2X6WA 3AR4A 4E7OA 4A0ZA 2Z5LA 4PGFA 5DGXA 3FYDA 2PH7A 3UCXA 4BASA 4BAUA 4ZYGA 1FMLA 3OICA 1GXPA 4JXJA 4QDXA 4X7PA 2A7XA 3C6XA 4ZPJA 3SJ7A 4EMSA 3GBVA 1RJ9A 2IYLD 4YXWA 4QYIA 1E96A 1JEDA 3WGMA 1S2GA 2AG0A 3N39C 3WMEA 1DCTA 1IIBA 3KXLA 4Q3OA 2BEWA 3V6LA 1X74A 2MR5A 3B20A 4FNAA 3SS9X 4MR7B 1N32B 3GELA 4UTZA 5ILQA 5BR7A 2VUMJ 3R8XA 1MFZA 1RC9A 4ZDIA 3SR3A 4WBSA 5E1DA 1LVHA 2PKQO 1KE2A 2GM9A 3AEKB 2BZ1A 4LKOA 5A0VA 4RS8A 1CY7A 1UBCA 3ESZA 3BEOA 4LZAA 1YNSA 1HRKA 4URZR 1N9GA 3B1XA 2H4JA 4O4IB 1YC2A 4S1TA 5CT4A 1XTSA 1EAMA 2NPIA 3K8ZA 3CURA 3I0TA 1FW8A 2OV4A 2CFXA 4OAZA 2IBMA 1XU4A 2VPTA 1MB3A 3QOFA 3FMGA 4TWJA 3AC0A 1XDUA 2HV8A 3MNFA 1ZJZA 4TXNA 3UWDA 3EGEA 3LY5A 4JROA 2JIPA 3IA7A 4ZHQA 2DJIA 3CX8A 3DQPA 4KUGA 3L8HA 3E5UA 3ED1A 3LWFA 3DD1A 4A3DJ 1WPXA 4GWLA 2GKGA 1IB0A 2E9SA 2ILTA 3IV9A 1ECPA 4G5SA 3TSCA 5D5UB 3PFKA 3IBSA 5JD4A 1XEXA 1L1QA 5DEQA 521PA 4HF2A 1WSAA 2HK6A 2NO1A 3ESDA 3PCXA 2J0UB 1AKTA 1NZJA 1RI4A 1DX6A 1OXMA 4AWBA 4M7PA 3D6UA 4E7JA 1Q14A 4HGOA 1AV6A 3O26A 1QAMA 1A36A 2SICE 4A73A 2WTAA 3QWHA 2XMSA 3PGMA 3VODA 2DHEA 4FCVA 4JB3A 4RVNA 4RYLA 3WNCA 1KPIA 3I34X 3GD7A 4ZAVA 2ZYSA 3QLTA 5BOVA 4Q6WA 3VPCA 4TVSA 1NMZA 3HJTA 1BGWA 1GRCA 1W5BA 2X7HA 2GK7A 5BWCA 4J7XA 2FP4B 4A6PA 3EW7A 1DJQA 4UNSA 1EVYA 3TECE 5DEIA 1QFYA 4J01A 3CO5A 2HZBA 4OMDA 5DYWA 1UJBA 1B23P 1G63A 2I4IA 2BPOA 1N57A 4TUYA 4Y2HA 2NO5A 3FXLA 2O2JA 1GKUB 1SC9A 1UK6A 2CNBA 5MN6A 4DT1B 2WC2A 1XRJA 2AQHA 4ONEA 1XOIA 1EM8B 2VJ5A 3Q3IA 2D2XA 4GNKA 2H6EA 2F1KA 3NWOA 4MV5A 3AG2H 3KZZA 3WB0A 2J4CA 1LZLA 1WW3A 4Q12A 3A6HA 4YMIA 1OFHA 1RLIA 3EIXA 4H1HA 2FSUA 3SIXA 4XEHA 1A97A 1P17A 3SM3A 5BV8A 2HQOA 2IODA 3L4BA 4AJHA 3QFSA 3PUKA 8OHMA 3HBFA 1F2DA 1SG9A 4MVJI 4BBAA 5L95A 2XUDA 3GRKA 5KJ6A 1QLJA 5J4VA 5AK3A 5IXJA 1ETKA 3EISA 3MZ0A 2RK6A 4OG2A 1WI9A 4UVGA 4GOXA 4UHJA 4YRSA 5K2OA 5A0TA 3PIPF 1EQ2A 2CHFA 3A9VA 3EXHA 3IT3A 4UJ5A 3K6SA 2XYHA 2JJ8A 4FMCB 5EIHA 3KUUA 4ENPA 1RXUA 1XCJA 2CNDA 2HFHA 1RNLA 4PQYA 3TUZC 2H1WA 3G2PA 3QF4B 2BUAA 4Y1RA 1NJGA 1AT1A 3FGZA 4KDFA 4WJLA 4POOA 4WZZA 4RHYA 4R69A 2DWCA 3RUIA 4TZ0A 3PENA 4YMTA 1C30A 4BRWA 1Y1QA 3K2ZA 1W93A 1TWHJ 4I01A 1ZLYA 4ISBA 3K5IA 2WV0A 1XLTC 1RVV1 1NFFA 3U1KA 1LPNA 3MBIA 4R01A 4V2UA 1LDMA 3U0VA 2RGRA 1BL0A 3R3YA 2OCXA 5FNZA 1UAYA 4ZP1A 5CFOA 4G1MB 2EB7A 2ZUSA 4LYGA 1EM6A 4NMXB 5JAIA 5JNSA 1U7UA 2GPBA 2IDZA 1ZVJA 3GJ3A 4O08A 4BO2A 1P0FA 3R24A 5IBQA 3O3OB 2AFIE 2AMVA 1L4UA 3WIUA 1YVRA 3CH4B 2B34A 3DBRA 2P2LA 3HCDA 1KHHA 1IGNA 4J4BA 1H8HD 2Z0MA 3VOSA 2F9LA 2G7HA 3LA6A 5EJEA 5LNK1 3CINA 2V4UA 2B0LA 2CC2A 2XQJA 3PI6A 1XP5A 4NBNA 4YMUA 4EB8A 2PJDA 4JWTA 2Z16A 1M6EX 2R8XA 2Y0SA 1RKBA 1CIJA 1SXJE 4NBTA 3PSIA 1FOYA 1HQKA 1W85A 1NSYA 1WP4A 1DKRA 1AS2A 2X2PA 3FPKA 4ZV7A 3KOUA 5M5XJ 2YIVX 1Q20A 4V0SA 1MNMC 3SP1A 2IOHA 4CV2A 5K8CA 1NH3A 3CJQB 4HPJB 2Q1TA 3BN3A 2AG5A 1IEXA 4RVHA 5L53A 1KFEB 3RPQA 3A6DA 1WMEA 3CLRC 1CETA 1RXCA 2C9ZA 2VCEA 1TXGA 2FBKA 1CY6A 3WHLA 5JAZA 4JT8A 3QFCA 1PHRA 4MYHA 1E79A 2KMLA 3HJAA 4JQSA 4LJ4A 2EFJA 2OMKA 2G0NA 5AJYA 1URPA 5E6UB 5AM5A 1K6YA 4OM7A 3K7AJ 1NI5A 4C88A 1RE0A 4BNUA 5M5WJ 1NFRA 2LPMA 5LHHA 2ARKA 4C04A 4BEWA 1TCVA 5EZYB 1C3XA 4MQ9F 3ITEA 1AQNA 1XZCA 3E2PA 1HKUA 4NMMA 4JOMA 4XN0A 2CY0A 2DI3A 3SOZA 5E1MA 2FFHA 3DM9B 4OQNA 4WK6A 2NU8A 3C7KA 4PGAA 4OB6A 4QC2A 4AT1A 2HA2A 1O95C 3U7RA 4DLUA 3E97A 4UMVA 3UOWA 1G20E 2CMDA 3FGNA 3IP5A 1FSZA 4UTRA 4DA6A 2WP8J 4D99A 1E2FA 1Q7TA 1CUEA 3C1UA 5JQGF 4UVCA 1I24A 4PZJA 4HDSA 4IUDS 2BM1A 2H5LA 3RTAA 2MCFA 2IU6A 3FF4A 4NJOA 4QQ8A 1FU8A 1XALA 3UATA 5JTUA 5HRCA 1MO5A 1X3SA 2C2WA 2E4YA 1UJ6A 5EHIA 1QM5A 5HVNA 2AF4C 1IQRA 3M1IA 4QL3A 2M7AA 2OYRA 2BRUC 3ZWQA 1R22A 4UDYX 2OGTA 3G0GA 4OYHA 4PWZA 5DM7F 1G41A 2JLSA 4YQFA 1C9DB 1W7PD 1UT6A 2AJBA 2VP3A 3OF5A 2D7DA 1H9CA 3OSGA 3T8RA 2ZW9A 3H86A 1BIAA 4PG8A 2HYGD 5CA0B 1P3DA 4DFDA 1MO6A 2P9YA 1KK3A 1PNVA 2QW8A 3KE9A 1L5MA 3SBEA 1DJPA 3DTTA 4ETNA 2W42A 2QAGB 3GVXA 2L0XA 4L72A 4QGHA 3W04A 3HXMA 2V9CA 4I19A 1TJ4A 2FR0A 1UG2A 1T4DA 3HYLA 2Z6UA 4DYHA 2Q3EA 1P7VA 5ECGC 1X1QA 1CJKC 3PA6A 4OQFA 1NXXA 3FNBA 5HKLA 4B3AA 3I2GA 1FLAA 1V3VA 4JXZA 1G98A 2BEKA 2DKNA 4NJMA 5HKBA 1I2CA 4J4TA 4PC3A 5HIKA 1SD1A 1F9AA 1JHYA 2QW1A 1FLNA 2E71A 2QTGA 3N3AC 1KR5A 3BXXA 2OCEA 1GGMA 2BBSA 2GUGA 2JFNA 2YCBA 3LHFA 2BI8A 3DCNA 3LOUA 3CNLA 5JFRA 2EZ8A 1J4AA 2QVCA 2X1MA 2ZEJA 1UG0A 4RV5A 1NNI1 1ZW6A 2OCBA 3R7FA 1JDJA 2DY0A 5HZKA 3FFXA 1Q0QA 1JLRA 2G88A 1QGAA 2FVXA 2GGSA 3CR7A 4F5EA 2FBIA 1WD7A 3EXEB 5I6DA 2AS5F 1SIBE 3VOBA 2F8TA 1QPGA 1J5PA 1JXSA 1XHLA 5HLIA 2IGBA 4PYQA 1DX9A 3BWVA 1T36B 4IPTA 2Q5LA 2CLFB 2PQ6A 1RQ2A 2BEUA 4U3JA 1H69A 1HA3A 2YVKA 5FWDA 2VDWA 4QOHA 3RSLA 3NKLA 4GQIA 3JQGB 1NAHA 4MR9A 1O94D 1FU4A 5AHXA 2C59A 5G02A 3W8FA 4KJZA 1TWGJ 1ZLKA 1XB2A 1XE3A 2OZUA 2R5WA 4L85A 2JAWA 3THXB 4MVJD 2Q8KA 1BX1A 1VBKA 5BUQA 1JUSA 2C07A 4GC9A 4EPRA 4XOPA 3H0EA 1W96A 4OEHA 3DZGA 2B8TA 4MMXB 1GHTA 5HDBB 3COYA 5C9ZA 2G72A 3UPUA 3UT6A 4DMUB 4D96A 4DWWA 1RJDA 2R0QC 4LZOA 3VKGA 2FJUA 1VA5A 2LTPA 1F36A 7REQA 4M0MA 3DBLB 2IGMA 2YASA 3VYWA 2JD1A 2PZLA 4J7AA 1BIBA 2PN1A 4FZJA 4JHXA 4WL0A 4A26A 1YFLA 3I01M 4QPPA 1Q15A 2GFIA 4WVFA 3E0QA 1U8YA 3AYXB 1OVMA 2J48A 4DARA 3G9TA 3K9LA 2IYWA 3E7PA 1A4XA 3ZCXA 2Y0EA 3V5NA 1D1BA 1D1CA 1BR2A 1E2NA 2RAFA 1QV9A 1YRLA 2M2IA 1YDGA 2OLEA 1AOYA 3LXXA 4IOKA 3ZVNA 3RC3A 3TINA 1W0CA 5IXSA 2GA8A 4GT1A 4LWOA 3OR1C 2NS7A 4AN4A 2EHJA 1UL1X 1XMQB 4K9MA 1WP9A 4R4JA 5F9HA 1SKQA 4J90A 2H1LA 4NMLA 3HNOA 1KGSA 4FDTA 4WW0A 1KFBB 2BOVA 4D7NA 3HWSA 1CR0A 3RVSA 4JZKA 3ICCA 3OJXA 1WNTA 2O03A 1Z83A 3IKLA 3N2LA 3NRJA 4DEVA 2C5SA 3EXFA 4JOSA 2BL4A 3VJKA 5A6SA 3P2EA 2JVKA 7REQB 1E3IA 1VHTA 1DJOA 2VL7A 2BSXA 2Q46A 1A9SA 1C9YA 2B6NA 2RHJA 3PP8A 2KP6A 4JJEA 4X6UA 3WYDA 3IRVA 5JT1A 3H35A 2G36A 2LE0A 3B6JA 3D8SA 2VZ9A 4HAYA 5AVJA 3BGWA 3Q3CA 2FHSA 3IULA 5BQTA 4J4HA 4P3YA 4Z99A 3KIPA 5D8KB 4NFYA 1EUCA 4B85A 3KB2A 4G4SO 2GF0A 2XUPA 2X0EA 4DE5A 3BTVA 1XAJA 4PR3A 1RRGA 5KYUA 1BHQ1 2HHJA 3LY9A 5CA1F 4R9NA 3WTTC 2EP5A 2XGGA 4MWCA 3SXYA 5EKXA 1APBA 4BE9A 1RYDA 4FHDA 2H0AA 3GC6A 5REQA 2CLLB 2Q29A 4W5HA 3DEYX 1EP2B 1VYVA 1GPYA 1KP3A 4BEVA 1T3LA 2GZAA 3F72A 4PM4A 3OT1A 2I78A 4D9MA 1XXHE 5KO2A 1XDSA 1VDMA 1VL8A 3GNLA 4CETA 3VR3D 3FPJA 2VAXA 3E4DA 4GI1A 4TTTS 1XQVA 4LXQA 1UP6A 5IC5A 2WYUA 2JN6A 5FUYA 5DNYB 4FB4A 1A5SB 5BUSA 4BE2A 4CZCA 3ABOB 1K4SA 3AHHA 3H2HA 4JC4A 4EPTA 2W8BA 5DTDA 1PG0A 1UIRA 2PS0A 2WKWA 3LSGA 2H92A 2QY9A 3DF7A 4H4DA 1PT6A 4HXEB 5AW0A 2D1QA 1CZRA 3LHSA 4ZAWA 4DG9A 3JW4A 1IFXA 4F06A 1J0XO 4JI4B 2RHHA 1YMVA 2XYGA 4ENMA 3CEJA 3M1CA 3KELA 3WK8A 2YVLA 1LS1A 1GV5A 2CV1A 3FKQA 3MQFA 4UBMA 5F12A 4ZIRA 4W5TA 4HDQB 3O7MA 5DM0A 1EEXB 1VLLA 3D7MA 4A3GJ 4L3WA 2X48A 3FPGA 3R76A 1II0A 1BR4A 4NPCA 1DAKA 2P0YA 2R84A 1TTYA 4KICA 3DNFA 3ME5A 3NHRA 4QULA 4OU0A 5L4NA 1PG5A 1XEWX 4JXKA 3AG4H 3RD5A 1XV5A 3UJHA 4Q39A 2C7PA 4NK5A 5IRCD 5ICCA 1A9YA 1JHDA 1FYWA 1Y98A 2P77A 3TQQA 2O4CA 1CEQA 1JR3E 2VK1A 1QDUA 3JSAA 2ZBGA 3RKUA 4JI3B 1GV2A 1QX3A 4YRLA 1WXHA 4EPWA 2ASEA 1V96A 1LTQA 2RK3A 4KFCA 1LBEA 1MJ9A 1N8NA 2WG0A 3MUNA 4YT4A 1LLUA 1HBXG 3O6VA 2P2SA 1UBOS 2QVXX 5ED0A 2J85A 1WDWB 3ASUA 2YXPX 4BNLA 2R9VA 5AJUA 5BVGA 5J9FA 5KIAA 5CYPA 5JYBA 3ZV3A 1QYCA 1W7AA 2ZSUA 1X39A 1QH1B 3C7TA 1RYYA 4IDHA 4LYFA 1JR6A 3FTNA 4GO1A 1ZZGA 2D59A 3CZ5A 4GBMA 2J9ZB 4IX9A 2A57A 2VQDA 2J30A 1SXJB 1MIJA 2ZT6A 4MOWA 4UUNA 3NV7A 4DF3A 5FB3A 5I8WA 1IY2A 5IMSA 2GM4A 1A76A 3L07A 3FPHA 3QUQA 1GSIA 3RVQA 1XSEA 1GDDA 4AZ0A 1QQ6A 1U2GC 2GJ4A 4YDSA 4A12A 4M9SA 1CR6A 3CWZA 3FY4A 3CJQA 4OUDB 5HFNA 4DLYA 5G53C 2P4UA 1XK7A 3BVPA 5B12A 1TT0A 4KA4A 4U9HS 2M6KA 4EW3A 3PF9A 2DFIA 3U7JA 4JX5A 4IJKA 4DR6B 1B6TA 3CX7A 1JRLA 3VJRA 4MI9A 4RA6B 2ZT7A 4RNDB 1I5EA 4MGZR 4OQDA 5BVHA 3QKSB 3WIEA 1TA4A 4NS4A 2P8SA 3T3DA 4DIDA 2ZKZA 3HB9A 4IUCS 4ESJA 3CLHA 3U6BA 3W5VA 2HQ1A 4YV7A 2IX3A 5FJ8J 4J6EA 5ALMA 4NONA 3VNQA 3U60B 4KPUB 1L4NA 3ZY6A 4MZXA 2AWOA 3TM4A 1FTYA 4LJAA 4X62B 1A9PA 3A10A 2KISA 2XAQA 2XNHA 3GLFA 1ITYA 3DZKA 1ZH5A 4RK1A 1DXOA 1ODFA 5HIMA 3HEFA 2LD5A 3OIFA 5AOBA 3ROTA 4AZTA 3H0GJ 5HE8A 2HADA 4UOEA 1MMGA 3OYEA 1VQLI 2F64A 2FMTA 5LUAA 4CM3A 5ISMA 4BB0A 1JE0A 2GNPA 3BFVA 4H7HA 4RPCA 1XZMA 4F3QA 4Y8VA 3H1AA 1XTTA 4ZDOA 4UZEA 3KAJA 5EMKA 1DAIA 5IKPA 2DR2A 3K4KA 2Y6VA 2O7QA 3Q87B 3S15J 1ZK8A 1M2OB 5DGTA 4YP6A 5JNUA 4K6FA 2BEOA 5AD1A 3V7WA 1T4GA 3B3GA 5JZ9A 2GN2A 4WLUA 1SC1A 2Q5IA 4A2CA 2VASA 1LK5A 3OECA 3MT0A 1AVTA 1MB0A 5IUNC 1JSLA 3SEFA 1MPTA 3N2GA 1RYBA 4IMIB 5CHEA 4MHGA 1FDUA 4M0KA 4RHTA 5EUBA 1I5RA 1MMFB 4PHHA 3T9DA 4FSHA 5LVAA 3VNBA 1JR2A 3GLFB 2BM9A 2HYJA 4B1RA 3AZQA 5D1HA 3U7QB 4FGLA 4JL8A 3HPRA 1GR1A 4DV6B 1N5JA 3FYUC 4HH0A 5G4KB 3MGGA 3LX6A 4LZPA 1XRMA 4EG7A 5I8PA 1NHWA 1AG9A 1IHDA 2FLKA 2BKVA 4I55F 4Y2GA 4BS9A 5CEFA 3IPXA 4QSMA 1W6UA 3F67A 1H2ZA 4PX9A 3SICE 2Y0MA 3ZU5A 1A9OA 4EFDA 1OH7A 1RTKA 4NJEB 1MABB 1Z45A 1R8JA 2VQHA 1I6KA 2CSOA 1EV7A 3FHOA 1NOKA 2COMA 5TRDA 1CT9A 2B0JA 5SY6A 2G7ZA 1OH6A 3NQOA 4Z8YA 3OYDA 4M1ZA 4U3JB 3QG1A 3VKHA 4EGYA 5KK1A 5EUMA 1TO1E 1JEEA 3W5UA 1FNDA 4HH3C 1IK6A 4R79A 1H2XA 2C7GA 5BQFA 5AVRA 3AI3A 1U7ZA 1NQAO 2E2WA 2RKWA 3GGSA 4ZEVA 4ER7A 3O3MB 3RWMB 2FJPA 2JBAB 4B4CA 2P0EA 3MRTA 2ZYIA 2Q2EB 3VYSB 1J2RA 4XKBA 2L2OA 1SU7A 3CCRI 2LRHA 1O89A 2GK6A 3PA8A 2VKEA 4YP1A 2JA6J 2IZ5A 2RAPA 4K9DA 1AK2A 1L5HA 3AV3A 3RC2A 3VR5A 3ZE0B 4C14A 2NU6A 2IUYA 1TGYA 4W5OA 3ZDQA 2AX4A 3ZZUA 5A5DA 4E70A 4KX5A 4DSNA 1P60A 1TCUA 2REBA 1P5RA 5C1OA 3E9EA 3ZEIA 1KEVA 1H9GA 3U44A 1PT9A 1H1LA 1NMXA 3WI7A 4CEHA 1PTKA 4LBYA 2BBYA 2AXLA 2EV9A 3CLTD 5CDFA 2QAGC 3WE3A 3FDFA 3UJ6A 1I2AA 5HUQA 2KE5A 3M6MD 4BQEA 4GPAA 3DD5A 4BBRJ 2N46A 1NVGA 3GEGA 2TMKA 4CU2A 4ZGBA 4JI0B 3TQNA 1SMKA 1ORWA 1XWIA 4XFJA 1BWQA 4C0HA 3ZS8A 2CNNA 2MSEB 4HH4A 3TR5A 3JQAD 1YCDA 4E51A 5CBPB 2M9MA 4F2WA 3NDRA 4IOMA 5IHXA 4RIGA 1XWWA 5IS2A 3E7XA 3ZD6A 1B73A 1KEPA 5DHQA 3IUOA 4TWRA 2VI5A 3IUEA 1JL3A 2JCXA 5IULC 1N2XA 1RCTE 3FIJA 4ON9A 2XVMA 4X9XA 4ZYHA 1DIGA 1RBMA 1U0NA 2XSZD 4BFUA 5KYWA 3FZVA 1TMOA 3FMFA 2V45A 2XF7A 2Y2ZA 3R6WA 3VO8A 1FPQA 1QHEA 3OOWA 4G41A 4LYJA 3KJGA 4X44A 2W2VA 4H6XA 4A8TA 4E5PA 4NE7A 5LQRA 2VF2A 3DM5A 3NFYA 1UJCA 1OR7A 5BQ5A 1HKHA 3JPWA 4DLXA 3R9XB 3CZ6A 4PAOA 2JK3A 2CUFA 1N6OA 4NPAA 4M3EA 3H19A 3SN6A 1MH4A 3DZIA 5KWIA 5FNVB 5TQ0B 4I02A 4EBBA 4AICA 2OV7A 3IOBA 4E3ZA 3D2AA 1LFUP 1IZZA 4Q15A 4B2PA 3LC1O 4I4TB 3RS7A 1NPTO 2NAPA 3BWMA 4DMRA 1WE2A 4V0NA 1HEUA 3O0DA 1QAOA 1UPUA 4PN7A 1WBDA 3D6TB 4HDRB 3ASYA 5HDNA 2W71A 3FVQA 3ML6A 4G5QA 4M1EA 4R9UC 1NY5A 1LF0A 3QU7A 1Z4MA 2FPIA 4OP1A 3WZLA 1PGJA 5TY0A 1W59A 3SYLA 2B4QA 5I5EA 5JJLA 3EIHA 3HS3A 1G2HA 2NPOA 4CTMA 1J9IA 2EQBA 2JPCA 5A4MS 1SURA 2DTZA 2F43A 4XX0B 3IAEA 2ZRMA 2FWJA 2XUFA 4M0DA 3C3WA 3A0RB 1KI7A 2ERXA 3L2VA 1ZNYA 1IQPA 1T1SA 2GOYA 5CB4F 4UBLA 2Q2OA 4LFCB 1P7CA 2M1XA 1XD2B 3SSAA 1D6SA 4HO1X 2JFVA 5HE9A 2RH8A 3WV4A 1FY7A 1NC3A 2QN2A 4Q9LA 3ABUA 4EGSA 2IP4A 5CK4A 3DXFA 5JXJA 3JQCA 3DLPX 2YS7A 3BCAA 3HYRA 2GXSA 4XIFA 1EVIA 2KFDA 3A1CA 3R6DA 2ZUTA 3FNFA 3JD3A 3M1EA 3GFMA 3NORA 3IRRA 2ZBEA 4KQ9A 2BMDA 1ACIA 2H48A 5KAIC 1JDSA 2KIMA 1BD3A 4JLSA 4RD6A 1ZUWA 3GJ7A 3H2YA 3RFUA 4DLAA 3BKWA 1SKMA 2GN9A 4ZIRB 2WAOA 4INAA 3M8EA 1Y1RA 3OE7D 4I1OA 3B3JA 1AHNA 4DC1A 3MGBA 1KDTA 2BY4A 1CWUA 2QL6A 5LXTF 3CMEI 1IV6A 2I62A 4TPKA 2HWKA 1E98A 1M8FA 3UYLA 2VRNA 3BC8A 2XAHA 2BGMA 2R7DA 3LSTA 2CQKA 3ABTA 4JJZA 2YHAA 4TUYB 4UXJA 4CDNA 4DAOA 2VNIA 2QN3A 4MQVA 1RABA 5HMMA 1K9VF 4X1YB 2RKHA 4MS1B 3CGWA 4QGGA 5L51A 4G1FA 5E3OA 1CK4A 3EXIB 1WOYA 1ZGCA 3IUPA 2QRVA 2WE8A 3V8BA 1Z9BA 1EP9A 3CZ9A 4I6ZA 1GD1O 4K3UA 3GY0A 5LD2B 3CPEA 3GDFA 3WLLA 3GZTB 4U9IS 5FPKA 1X7XA 2OQ2A 3GVPA 1CUWA 3A4TA 3OA2A 1TFRA 2DU8A 1BVYF 1NX9A 1W35A 1ULHA 4R1UA 1UOQA 4B79A 5D8LB 1N6KA 1SJ9A 2Q8NA 3A0UA 2W1OA 2GCGA 4B34A 3L2WA 1R9MA 2VODA 4YQEA 3D5RC 1O4VA 5IAKA 3ZV4A 3AEUB 5BNTA 5AIQA 1B9NA 1GTVA 3LT5A 2GDJA 3VR4H 2XVCA 2V4JC 1V0JA 2PV7A 3MWEB 4J1TA 4NDZA 4PN3A 5EZ5A 2OXEA 4Q5IA 3HOWJ 1U0GA 3DDSA 2QGUA 1VIVA 4MGIR 4RIHA 4WNAB 5EP2A 2WWIA 5I45A 1R6XA 2PU5A 3LYAA 4OCZA 4D8UA 4BY9E 2BMWA 2MOKA 3KFVA 4TSRA 2FFAA 4IVNA 1J8YF 1KJZA 3KAKA 3QELA 3IS3A 3AKZA 3D6HA 1PZEA 3PUFA 2OHFA 4MGYR 1Z9CA 1XZAA 5FOVA 1PGNA 2KPMA 2CHEA 1HSZA 1GA1A 3NYQA 1MEOA 2FEWB 2ME6A 1KGDA 3B82A 3DW1X 1D1AA 1I4DD 1JZSA 3S6JA 1ZRFA 5EXSA 1KDZA 3ZE2B 2PX8A 1A5JA 2R86A 1EPUA 1U2EA 2DVMA 3A6PC 4TM7A 1MBHA 5ILVA 1I80A 4EZIA 3JRAA 5JEEA 1SKBA 2GHTA 4PLCA 1Z3XA 1V7PC 1BOBA 1VHQA 2HQNA 1J06A 4CQMB 1LJLA 5D5PA 1BCRA 2PCJA 2F3PA 2KLBA 5ALQA 4ZMBA 3MA0A 2WJHA 4WLVA 2OD7A 2MD0A 1W52X 4ESHA 3B5JA 1U5CA 4E7HA 3EULA 4RK5A 4ZI5A 1M6VB 1L5QA 4ZYZA 2FZWA 2PTHA 3HZOA 4BX9A 4E11A 2MFZA 3AL0B 1OXSC 2WJZB 2J08A 1OAAA 3ZLBA 3K9WA 1M8KA 3PFIA 1DEOA 4URHA 4FTHA 1YI0A 3QJYA 4YMVA 1CY1A 3AI1A 1T2KA 1N5DA 3THXA 1VFCA 5L3EA 4MW1A 3A9SA 1UKVY 3BCUA 4ESBA 1KMIY 5DYIA 1PV4A 1RPJA 4Q4DA 3NALA 2V7VA 1QH1A 2FK8A 4WXCA 4NEHB 3AG3H 1VQ6I 1SD7A 4A3BJ 2HMUA 4AJ1A 2WB2A 4MH0R 2WD7B 5FLVA 2YY7A 3L6CA 3LI2A 1AKYA 1D7AA 3NWEA 3R5KA 3EHEA 2AW3A 2I5PO 4WZBE 3E6CC 1NWCA 1J2EA 3B53X 1CUZA 2G83A 3ESQA 3V8MA 4HUQA 1XUOA 2Z2XA 2HK8A 2VRWA 3WZ2A 5FUVA 1NSTA 2HREA 2VQEB 4QXPA 1XTJA 3O4IA 1L7VC 4M49A 4R81A 4DR3B 4XYEA 1E4EB 3PKZA 2HK9A 1U5BA 2B21A 4E94A 3BMCB 3L9WA 4Q19A 5EL0A 2A88A 2AE1A 3FNIA 3RFVA 1Z2AA 2D5AA 3ZHXA 1ZCJA 3QI2A 4JUDX 3S29A 2I71A 2AUMA 1NVVQ 3HCWA 4I0WB 4B35A 4LPSA 3FYCA 2K7LA 1MNQA 3E3LA 3JRXA 5FTJA 1E2EA 1NJ5A 1Q0PA 3DXJF 5EJ6A 3UA4A 2WTBA 4OAPA 2Y68A 1RYNA 4F2DA 4GF5A 5ALPA 5U4XA 3LRXA 3KYCB 4L9AA 4S1VA 4BV9A 3GJ6A 1OWOA 1PR0A 2GD0A 3AFGA 4BIMA 4D57A 5JC1A 4NXNB 1ZYRF 1N33B 1OQAA 4OIPF 3CIOA 4OGFA 1N1DA 3HG9A 1X7WB 3E9DA 1QVAA 2D5BA 2R97A 4MQ4A 1P1BA 5B37A 4CVNA 2COKA 3FWKA 2QZ4A 4B81A 5BPFA 3DKYA 2CL6X 2ZRBA 5H3HA 1GRVA 3RRJA 5IFLA 5BYAA 3EASA 2JANA 4YJ2A 1MBEA 2E2IJ 3PTZA 3T52A 1DI0A 2P0WA 5EJMA 2BFPA 5BYJA 4TSFA 3I1JA 1CZLA 3PUVA 5C4GB 2DFEA 4J29A 4B4DA 3FFAA 3PIIA 5L9AA 1WDMA 1BOAA 2GRUA 1AUPA 1E1MA 1UFOA 2AB0A 3E81A 3KCNA 4MO2A 3EZYA 3UIEA 1FSEA 3OEEA 1LPSA 1EIWA 4TTIA 1V1RA 1C2TA 2FPPA 4ZT7A 3TP3A 3R9XA 2KRCA 3OD5A 2PA0A 3GI1A 1ZGAA 1AGNA 3Q9NA 1JFSA 4LXGA 3GGCA 2IBSA 3CLQA 4F97A 4XE5A 2I1VB 2X7JA 1ZTRA 1Q91A 1WVMA 4PFOA 1R6BX 2Q0QA 2OBXA 2Y1FA 4R83A 5LMUB 5AK0A 1AKHA 2WFMA 1J07A 5B1EA 1N5OX 2LRDA 4AVZA 4OI0A 4M73A 2G9NA 4FT4A 1P6UA 4G4SP 4I5EA 3SQWA 1VSTA 2AD1A 2ACWA 4NK4A 1E5LA 2M8EA 3UMJA 1E6CA 1PNQA 4C5CA 5KPJA 4F55A 2AKEA 1GZUA 4NQWA 1OBVA 3QYAA 1FP2A 3FXMA 5KTTA 3BR6A 4F8EA 2DMTA 1U2ZA 3W4IA 1N2HA 1TW2A 1GPDG 2CHGA 3V8LA 1AZLA 2O2YA 4XLHA 3MFKA 1RACA 2QSJA 1HNNA 3O73A 3OLVA 1KDPA 2QKMB 2CLHB 2CL5A 1VQ1A 3X1WA 2P2CA 5KTOA 4P1ZA 4FDMA 4OHWA 3WYAA 1BS9A 1Z6PA 3U26A 3ZGXA 2VK4A 3S1NJ 1E62A 1QO7A 3C6BA 3RU7A 5BY2A 4JVOA 1RM3A 4RWZA 4TV8B 1FP7A 2W6PA 2ZBRA 4CIVA 4ZYWA 2IHUA 5DLEA 3AETA 4NZYA 3W79A 4M7WA 3UTDA 4EGJA 4I1PA 4PFKA 5JXIA 1LNZA 2GAUA 2XRNA 3DLLF 1KQPA 3EEQA 3DMNA 4DJDC 1EZ4A 4XQFA 2B5WA 2ETXA 4MVJH 2IXAA 3ECOA 2MG4A 4HXYA 3OZFA 4HWTA 4XSHA 4TTJA 1E1KA 2BFEA 1HW2A 3N2NA 4WCFB 5E4JA 4AO6A 2VBWA 3BT9A 2BTOA 4O5AA 3U62A 3WL4A 1KU2A 3ZYZA 5FBVB 4JJ7A 4FZRA 3UJ8A 1N6NA 4OOFA 3DFZA 3VTZA 1UMQA 4Z7QB 3CGGA 1V41E 1D03A 1TX4B 1NW4A 2YFQA 3ITNA 4P98A 4UTXA 4ZZ3A 2AVNA 2VSNA 4Q1EA 4DDVA 5B55A 2VTDA 1OYVA 1CUCA 2J4DA 1GPJA 4BB6A 3MM4A 1I50J 1C7QA 1QO0A 1JDPA 2HHCA 1AKVA 1G9XA 2AG1A 1AHIA 4WESA 1JJ7A 2W2NA 3JQDA 4AKHA 4DC0A 2YFKA 1J1ZA 3ZDFA 1WPRA 4ENJA 1KDOA 1HOTA 3FGOA 5GZ6A 2VXDA 1W0JD 4LNHA 1GTSA 5A3RA 1WF6A 3GL9A 5ADVA 5ITZA 2Q4DA 1L3IA 2AV6A 4AY6A 3ANNA 1FRFS 2BGUA 2XUAA 3LQFA 2E2JJ 1M54A 4ZRMA 1PDVA 3LG2A 4FGJA 3G9XA 4ZVNA 2O57A 3WO1A 4C0LA 1Q3KA 1S1CA 3VVBA 4RTRA 2QUHA 3QMPA 3KALA 2TMYA 2GPNA 3RUDA 3ILSA 5KBYA 2YR0A 3FK7A 1UFMA 3H9QA 4L07A 2YV5A 3V1MA 1C41A 1HYGA 1XQ9A 2QM8A 4MP8A 1CQIA 3SVTA 4TZ6A 4XB1A 4CF5A 4KN7X 2CVQA 4HLYA 3CMYA 2QTLA 4WOCA 3IHUA 3DVAA 3LUCA 4K26A 2GA1A 2X6RA 2YQ4A 5B3JA 2ESHA 2PMWB 1QRSA 2BDUA 1KVUA 2W00A 3DJFA 1JSCA 3T9EA 3AFHA 1Z25A 2WT9A 2J7KA 3NX4A 4J1SA 3AEKA 4EKEA 3OWOA 3H3ZA 2FOXA 2VPIA 1ZPDA 4PC2A 1O4WA 4B46A 1SXJC 4F2HA 2A4MA 2CO5A 5EXTA 2EQAA 3R0AA 1E3WA 1AE1A 4ZU1X 3IIMA 2UYQA 1TEXA 2V6BA 2QBYA 4MVJP 3RBZA 4BXOB 1GZ4A 2M34A 3C3BA 4J9UE 5E1ZB 2G07A 1ODTC 1F3LA 1D6MA 2IT1A 1ZUHA 1KZ7B 3F2VA 4KWEA 4Q3EA 4EPYA 5CFZA 2HDOA 3AVOA 1P5HA 5HILA 5AW4A 4LK0F 2JJ2D 4J76A 3SD7A 5BSVA 3L0CA 1O3RA 2WSMA 3LSKA 3NM6B 4NOKA 3INTA 3WIOA 3EZXA 3ZR8X 4XLPF 3KT8A 4PYLA 1BI1A 2K9QA 2AIRA 2C0QA 1FU7A 4U7JA 3TTUA 3WHKA 3R3VA 1KC3A 4LXHA 2KRFA 4AYTA 2GAJA 4R9SA 5KKNB 5KNBH 3NTRA 4LZNA 5GAJA 2YR2A 4BFZA 5J2UF 2IH4A 4G3XA 3ZGVA 5FTNA 1WUYA 2WEKA 4PAGA 1ZL0A 4TYNA 4CA0A 5CNIA 2VE8A 2WM9B 2C84A 3LPLA 2DFLA 1RFLA 2O48X 3FXRA 1NSFA 2D3TA 2W43A 3CNOA 3CUUA 4IFTA 1WPQA 1LKZA 4U6SA 4YHBA 1VP3A 3A6EA 3KR9A 4BXXJ 1T8SA 4FR0A 2J87A 3CPSA 1QK5A 3EDYA 4AYBA 1IEQA 1MABA 1JG7A 3HXKA 2ZG6A 4K6KA 1AF7A 4L5CA 2J5OA 5AKIA 5DNWA 2X1HA 3TIVA 1CG6A 4GYIA 2ON6A 4LDZA 4RE6A 2QMEA 3SAJA 2AZXA 3NNDA 3NH9A 3K1TA 1FIAA 4BN4A 2R92J 3ZVRA 2BFBB 1KIMA 1VMKA 4ALNA 3LSIA 4MKHA 1SHZA 2ZT8A 2ZYVX 4D3FA 4KXVA 1BKYA 1BS2A 2DHCA 4CR8A 4Z6YA 3MWGA 5HG0A 4B82A 1AKNA 3R3HA 1P9LA 3LQ4A 1EJ0A 1DRUA 1YZFA 4EDFA 4I7HA 2DGDA 2EU8A 4EQ6B 1X7GA 2Y48A 4HZIA 3BE4A 3N7AA 4FYVA 3BL5A 3KTOA 1ISRA 5I7RA 2EINH 2PO7A 2YZGA 1T8YA 3HCNA 3MJCA 3RAGA 3DTYA 3UH0A 2P35A 5A4JA 1KOFA 2HCBA 3KQTA 1JDVA 4HZGA 2QR5A 3DULA 5ABPA 2CGPA 1HC7A 3J81A 1V43A 1XN4A 3SCZA 4D79A 3PC3A 5TMPA 3VPRA 1ODSA 1KSHA 4XSXF 3U44B 5IC6A 1I3MA 2WAXA 4PZPA 4AC9A 4PYJA 5JNVA 1ISFA 2GA2A 1ZD8A 3R5SA 5GV7A 5GPCA 1JA9A 1I30A 1LU9A 2RAVA 4S2EA 5GINE 1Z17A 1LY1A 3O2JA 1USUA 2IPNA 4GX1A 3GLIA 1MA0A 1XPJA 3HVIA 1DAPA 5GV8A 1L4FA 5DX1A 5LZ7A 4DUGD 5KNCD 3E5QA 1USGA 1OFGA 2G67A 3M3PA 3WDKA 3BWBA 2C2OA 4PQRA 3PUXA 5TGTA 4DN6A 1T1EA 5IU6A 1GL3A 2AG8A 1CUUA 1L8XA 2E5WA 4IDEA 1NFQA 4WZBA 3IALA 4MUBA 5CJ2A 4EP1A 1OXXK 2RNJA 1OTHA 2IUEA 1YDFA 4F96A 2LP4Y 4DLSA 1IMOA 5JC8A 3CC7I 3UK2A 1PI3A 4EG1A 3IA2A 3ZHOA 1C8LA 1G7SA 1CS4C 1PTJC 2WR8A 3CZQA 3PC6A 1T5TA 4DSUA 3PFYA 5G1OA 1C4OA 3IMGA 4TRNA 2Q7DA 4GSYA 2Q6TA 4BNMA 1YE9A 2G9RA 4UEJA 3LO5A 3N28A 3B3AA 3C48A 4X84A 3OVMA 2Y1OA 4M99A 5HRUA 2V97A 4W9MC 3YASA 3K9TA 2HPIA 2FEPA 3IKJA 3NBAA 3QW2A 3BR3A 1M34E 4G5HA 3WGKA 2A3NA 4P5DA 4W5WA 3AG1H 1JHFA 4MQLA 4WBNF 5A06A 4EO9A 5KSOA 1YZTA 1BQ4A 4QT0A 2C2MA 5ETJA 5JMPA 5T41A 4ZYXA 4PSWA 1H9AA 1VDZA 3E8MA 1T5SA 4W9NA 4ZQIA 5FAKA 5LNK6 4JQCA 3UMCA 3KLPX 2KS6A 1HOXA 1HPLA 4PQFA 2G9UA 1LV7A 5JCPA 1XKQA 2ZI5A 1JAHA 3D8UA 4OP2A 2JFHA 4IHJB 4LVUA 3IAS2 4XTCS 1U4NA 4N3AA 3B52X 1UODA 3H11A 2AN1A 3R5FA 2A07F 2YZMA 4IKOA 4K5QA 3DFGA 1O96B 4KGZA 1AU7A 1T9KA 1XRLA 3AUUA 3F6SA 5LP6C 2AJTA 4C6RA 4KR2A 4QUKA 5ALZA 4UTOA 4MDYA 2HPVA 1Y89A 4EATA 3C3YA 2EYUA 4FWTA 5LYJB 4YUAA 4KW7A 2YJNA 2YU3A 2NAFA 4A8JB 4BLQA 3BR0A 3BGOS 4QNMA 2NV2B 2CXPA 4XWTA 5JZBA 1GAWA 2W93A 1J21A 4BC1A 2OXIA 3ZHQA 1C9EA 2ZATA 1ULTA 5CDHA 3BJIC 2CXNA 5LMCA 4DNCA 2ONKA 4DSAA 5CX1A 1OKRA 3H9JA 1YRNA 1I33A 3TAUA 1YUNA 1RXSA 2B9EA 3QG5A 3HHPA 1WV0A 2CVPA 1GEEA 3U40A 3ZHTA 4HAIA