3H9QA

Crystal structure of e. coli mccb + semet mcca
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
348
structure length
337
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNNNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/antibiotic
molecule keywords MccB protein
total genus 96
structure length 337
sequence length 348
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h9qA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h9qA02
4IY1A 1D8AA 2GUGA 3DAPA 5A9SA 2EKQA 4J90A 4QECA 5CDUA 2X0RA 4RZIA 4MVJH 3ITDA 3WS7A 1YJQA 3A28A 3WYEA 4GSLA 4BQPA 4NFYA 2B5VA 5H82A 1T2CA 1XIVA 3K73O 2Y0EA 3C1OA 4CLRB 4D3DA 3K31A 2OOSA 2RBEA 1HSOA 5IN4A 4B8WA 4X54A 5IZCA 4BOYA 1UP6A 4A5OA 1QG6A 2YHIB 1ENOA 1LRLA 1U7HA 4WOJA 1ULSA 5JYEA 1R4MA 3JQCA 4CMEA 4NJMB 3ORFA 4JP3A 3JQ6A 1AHHA 1LSJA 3JQ9A 3NGXA 2HLPA 3VPHA 1CWUA 4OGWA 4CMKA 3RUIA 3QWHA 3OM9A 2CY0A 3R0IA 4PRKA 4E12A 4BUCA 3OA0A 3QVXA 4OQZA 2BGMA 4IQ0A 1RKXA 3TZKA 2B69A 3ZV3A 1DAOA 3KB6A 3IJPA 3OP4A 1GFSA 4FFOA 1TLTA 4GSKA 4J4HA 1Q0HA 2BD0A 3L4BA 1K5HA 1NXQA 1DOHA 1B2LA 5B4VA 4MKRA 4EI2A 4LW8A 3QLJA 4MDHA 1PL7A 1R12A 1RM0A 1VSUA 4ROSA 4TRJA 3JYNA 2IXAA 5EPOA 4YXFA 5MDHA 1LDMA 1KC3A 4DPKA 3RQSA 4CM8A 5IAAA 3DBLB 1JKIA 5FFFA 4BO9A 2ZTVA 2R00A 4CMCA 3NRCA 4QEDA 3DTTA 2JFHA 5I9NA 3ON5A 3EUWA 4LMRA 3RVDA 3AW9A 3LQFA 2GF2A 1QR6A 5T8KC 3GVHA 3D5TA 3O8QB 3DTYA 2CUKA 1HDCA 3QRWA 1ZJYA 1YWGO 2BKAA 1I5RA 4YJDA 4OMUA 1P9LA 4WLFA 4FB5A 4NH4A 1GUFA 1HDRA 4XGIA 4BGEA 5TJ9A 4CM3A 2ZB8A 1Q0LA 3CSDA 3HNPA 4I9NA 2EW2A 4EGFA 4BO5A 2VWHA 2VCYA 1ZSYA 4IDGA 1C1DB 1E3LA 2QHXA 4M49A 4AICA 4DC1A 4FC7A 3WSVA 3KRTA 1A5ZA 4WKGA 2PZKA 1QYDA 2QRLA 4XIYA 3NDIA 4LRSB 1C1XB 2W8ZA 1UDAA 5TRTA 1U3TA 3OEWA 1ZCJA 1I32A 1HDGO 1T4DA 1GZ4A 2Z1NA 2FOIA 1X15A 1WZIA 1B14A 1UXGA 2P91A 1E3JA 2OMEA 2VT2A 2X0IA 3WTCA 1FK8A 3F46A 1TEHA 4TMFA 4MIOA 3UCEA 3EHEA 1Y1PA 2C5EA 1TT7A 2O4CA 1PS9A 3HSKA 1IZ9A 4GX5A 4DLLA 4DIFA 2X23A 5I7FA 4K6FA 2G76A 4ONEA 4G81A 1SEPA 4RVDA 2GSDA 3G3EA 3D7LA 2CDCA 5F5LA 4JLWA 5F1PA 4R69A 2LDXA 1EK6A 5JMPA 3W8EA 4IDDA 5A3VA 2UYYA 3K8ZA 4GAEA 3UUWA 4UVGA 1NAHA 4DBVO 1F8FA 5I9LA 2X7HA 3DZIA 3PHLA 3EZLA 4AJ4A 4YT2A 4MOWA 4UVEA 4GWKA 4URFA 1I2ZA 5T8KA 1Z73A 1ZW1A 4JCOA 1HDZA 3HZZA 3OF2A 5AQ1A 2DUWA 3V1UA 2AG8A 2UUOA 2FHSA 3CPSA 5U9CA 3AY3A 3ASUA 1NPYA 1W73A 3OBBA 1F14A 4W82A 4ALMA 4U7WA 3W6ZA 1EQUA 1A7AA 2TMGA 3DMTA 3E6AA 3NX4A 4E5NA 3JYOA 3PHIA 2FSVA 4E32A 4IDFA 4AL4A 2PZJA 2Y1EA 1WZEA 2DUUA 3P19A 3SLKA 2B83A 4R51A 1P77A 5H81A 2BI7A 4AJLA 1HZZA 4E2WA 2PZMA 4NBVA 2VZ0A 4XJSA 3ETDA 2HMWA 1E6WA 5G4KB 4GI2A 5C37A 4FW8A 3ZWCA 3AK4A 3QJ5A 2D3TA 4GPD1 4DYDA 5KJ1A 1YE3A 2BHLA 2EP5A 5KVSA 1ZUD1 2GZ1A 1P1JA 2PKRA 3D1LA 3K6JA 3PP8A 1HT0A 5JAMA 4CLRA 4RGBA 1ONOA 2EKLA 3C7AA 3MJTA 3OEYA 5AXDA 1QKIA 3DXFA 1PU2A 4MP8A 1E1LA 3HHPA 3MOIA 4XR9A 3RBVA 1I30A 1N5DA 3T7CA 1Y7TA 5FWNA 3RUHA 4P4NA 3PYLA 1VPDA 3KVOA 1GZ3A 2JD2A 2G17A 3ZHYA 2JJYA 2E82A 3WX0A 3TWOA 1UXIA 3DB2A 3M1LA 1HRDA 1U3UA 1NVGA 4C7KA 3GMSA 1SB8A 4P8RA 3EY4A 3OECA 3TN7A 4BKRA 3PQEA 5JO9A 3OJ0A 1YOVB 1O95A 1IULA 4YPOA 5IJZA 2DC1A 1BWSA 1O89A 4OAQA 3H5NA 2ZQZA 3WNVA 5TC4A 3ENNA 3FD8A 4NG5A 4YJHB 5KVVA 1NM5A 3SLGA 1PSDA 8LDHA 1M66A 4YRBA 3DBHA 1YL5A 2Y05A 3FWNA 3PYMA 2VWQA 4AJJA 4BMNA 2GR9A 3I6QA 4CM6A 2R00C 2BRUA 4IQ8A 4E30A 4JN6B 5I7EA 1VJ1A 2Q2WA 1BTOA 3KYCB 3NAQA 3OHSX 4R4JA 4CQLA 2LDBA 1A71A 2BH9A 2P9GA 5L45A 3Q2IA 1ZBQA 3NT2A 1EBFA 4YAJA 1DRUA 4WECA 3Q1LA 2D4AA 5G0TA 5JC8A 1UDCA 5EMHA 3GEDA 1TI7A 3IIEA 4RORA 3VPXA 1E7RA 3WMWA 3QP9A 1ADFA 2Y99A 5DCWA 1P44A 2JD0A 1NYTA 1B8UA 3HDHA 4J4TA 1TB4A 3V5NA 3WQRA 4CV3A 1WW8A 3WQSB 3SC6A 2EEZA 4D3FA 1HE5A 3GHHA 3JQEA 1XCBA 5AXAA 4BNYA 1VLLA 3DZJA 2JAPA 1NASA 1EMDA 2RIRA 3TZCA 5A04A 1LC0A 4WGGA 1V3VA 3QY9A 3QA9A 4MPDA 3KLMX 1T4BA 3UICA 3WG9A 1LTHR 4BV8A 4PLGA 1B3RA 1SOVA 5TLSA 3C85A 3D64A 3DHNA 3PDJA 1AHIA 1JKJA 3CINA 2ZYAA 3LLVA 4IXWA 3RD5A 1WAMA 4EYEA 1PJ2A 1SNYA 1MGOA 1NPDA 2A94A 4YEDA 2VOEA 1Y8RB 1L1FA 1DIGA 4ZU3A 1IE3A 1VKOA 1D1SA 3NEPX 3S2GA 4E33A 3IAHA 5ICMA 3PWKA 1A72A 5AYVA 3ZWXA 3C1TA 1HLPA 2J3HA 4DTIA 1UUFA 1VSVA 2XAAA 2GERA 5K6AA 1AGNA 4E2XA 1WDLA 2CFCA 4YB8A 1BXGB 4INAA 5L7YA 2YQ5A 4RDIA 2PKQP 3ZV5A 1MFPA 4PLWA 2Q4EA 4JJIA 1X7DA 5TJHA 3QSGA 4YJGA 4J2OA 1OBFO 2OORA 2HRBA 2QYSA 3KTDA 4HKTA 1SO8A 4E6PA 2E49A 1N7GA 4Z9FA 1PTJA 1EVJA 4YTEA 1A7KA 3JD2A 3KSZO 4CPDA 2VZ8A 1HE4A 4L73A 1BW9B 4O5OA 4BGVA 1ID1A 4W7IA 1MXHA 3W8FA 1N9GA 1W4ZA 1ZMTA 4WE3A 4DBZA 1C0IA 1YVEI 3G1UA 2E37A 2Q46A 4WCFA 1PZGA 3OA2A 5CG2A 4MIYA 3JQAB 1BMDA 4TRRA 1SBYA 1KIFA 2GGSA 3AUAA 3RIHA 1WWKA 5BNFA 4IPTA 5HA5A 1Y6JA 2WWRA 1RYDA 1H5QA 2CSUA 5EQFA 1ISIA 1L7DA 2AEFA 3A4VA 1OFGA 3HG7A 2NVWA 2JAHA 1VL0A 2VQ3A 3G1TA 5ADHA 3PFWO 3D3EA 2PWZA 3BHJA 3PFFA 1CQIA 2V7PA 4Z9XA 5L40A 4R16A 1QSGA 2BFAA 3RKRA 3L07A 1V6AA 1CYDA 3GC6A 3PVZA 4UAGA 1B15A 1Q7CA 4NBTA 3UH1A 4CV0A 1EFLA 2POQX 4L0QA 3AFNA 3O8QA 4TKLA 1P74A 2EKPA 3SXPA 3ZNNA 2JKVA 1I3NA 1R0SA 1Z82A 3VZPA 4IDCA 3JQ7A 3DZHA 1O5IA 1R0KA 1KVTA 1EDOA 1E5QA 3W1VA 1O0SA 3CKYA 3T4EA 1P0CA 4GKVA 4R5MA 3IP1A 1LDNA 5COQA 4BKQA 5HS4A 4AJKA 2V6BA 4W9NC 3ZU3A 1C1XA 4CR6A 1QLHA 2QG4A 3F47A 7ADHA 5IFLA 1YONA 1NHGA 3RWBA 3PIDA 4EJ0A 1IYZA 2W2KA 3H4VA 3ZU2A 3O9ZA 3VZQA 4G5HA 4ALNA 2NVUA 3IDSA 4LGVA 4RCVA 4FSHA 4DRYA 3ZU5A 5CDGA 2EGGA 1QLJA 5JAIA 4IM7A 3RUCA 2FPPA 3AOEA 3R6DA 3ETGA 3ZN2A 4CLDA 3QIVA 4WLEA 2G5CA 2DTEA 1PJQA 1U1IA 3BMOB 5JCJA 4EUFA 3WSWA 5HTOA 1WDKA 3JQBA 4RPLA 4QSMA 1LLCA 1Q0QA 2XXJA 1WP4A 4PN3A 1DPGA 4WOKA 4PCVA 4HV4A 4OKNA 4A26A 3ZWNA 2DQ4A 2WSBA 1HF3A 1P1IA 1MV8A 3KYCA 2BGLA 1GL3A 3PEFA 4IDAA 5I7VA 3EYWA 4I5EA 2VYND 3I52A 2TMDA 4J7XA 1KOLA 4E2ZA 2Q1TA 4BNVA 3ENKA 1V3UA 3HB4X 2ZCVA 4E3ZA 5TT1A 4XEHA 1HL3A 4DLAA 3S55A 5I8ZA 4MJLA 4XZ3A 5KJEA 4YAGA 4BS9A 3LSYA 1W8DA 2A92A 3STHA 1HTBA 4BIIA 3FBGA 1FXSA 1PGNA 3FPCA 1PR9A 5TIIA 3JD1A 3ONEA 1SCUA 1BXGA 2WMDA 1GQ2A 4CLHA 4HXYA 5JFOA 3BMCA 2IODA 1UH5A 2OL4A 3QVOA 3RKUA 4UUOA 1YH3A 1BW9A 1VC2A 4WEQA 2D2IA 4MVJM 5CAEA 1DLJA 1C1DA 3I4CA 1SB9A 2ZK7A 3TDKA 5KCZA 3I5MA 4PG4A 2IXBA 3G79A 5LDHA 2YZ7A 2GN9A 3R3JA 3WGIA 1JAXA 1R4NA 3VPGA 2WTBA 4M1QA 4YJFA 3QWBA 1E1MA 5G0VA 3WICA 1G6KA 2ZTMA 2NUAA 4R1UA 3PGJA 4PLFA 3INRA 2FN7A 2DPGA 3H7AA 3D4PA 3RBZA 3ROQA 3C24A 2DBZA 1JQBA 3VTZA 4J49A 1PZEA 4QX6A 5G2OA 4G65A 1KEUA 2FSSA 1LC3A 4F6CA 3B1FA 2VWPA 4ALJA 4BGIA 2NSDA 2GZ3A 1N1GA 3GG9A 1BSVA 4GVLA 1LUAA 3INTA 3P7MA 1N1EA 3MTJA 3B20A 1KEPA 3HFSA 4N5MA 4I5GA 1CERA 1EUCA 4XQGA 4G2NA 2Y1OA 4NFHA 4D44A 3RSHA 4B3HA 3HDJA 1YBMA 4RDHA 3P5SA 5GY7A 3VH2A 3H9QA 1HSZA 1U5AA 3DAGA 4IIVA 4KZPA 3ONDA 5U4QA 4KUHA 1F8GA 4ITUA 2AE2A 3PHHA 2ZTUA 3ASVA 4CUKA 1Q7BA 2IDZA 4N5LA 4OHUA 1YKFA 3SEFA 2IZ1A 2YQ4A 4YAEA 3IJRA 3IUSA 3TNLA 1HYGA 1MP0A 3NGLA 3MOGA 4RQUA 4HBGA 4HNHA 3KYBA 2GLXA 2E4AA 4ZQEA 3PQDA 4XWYA 4K26A 4H7PA 2Y68A 3FF4A 3RJ5A 4JJFA 3JQ9C 1EEHA 2VRCA 1LQUA 4J2HA 3IQDB 4QUKA 2VYNA 2B4TO 1QV6A 1P33A 3WLFA 4M86A 1R37A 4J1SA 4OSOA 4NJOA 1PWZA 3QHAA 3ZWYA 3KV3O 4FPXA 4D46A 3CH6A 4P4GA 4PG7A 4GGPA 1XR3A 3I9LA 5JDCC 1GADO 2WYVA 4NK5A 1IUKA 4KQWA 3DWFA 4YT8A 4RJTA 2VYVD 2C29D 1U3VA 1DIRA 3E82A 4XB1A 3V1YA 3VKUA 4MKXA 5LDGA 1IPEA 4CM4B 1U5CA 3PHGA 3EAGA 3UAGA 2B35A 3ZW8A 4U6QA 2YFQA 2UAGA 3E9MA 4R41A 1CEQA 3ADOA 5T6BA 4H16A 4FBGA 4J43A 2X9NA 4PVCA 1XEAA 2O7QA 3NTRA 2C20A 1NAIA 1RWBA 3F5QA 2WYUA 1Z7BA 1UDBA 3A9WA 4RZHA 1ZK0A 2PD4A 1PGPA 4W9NA 3AJRA 1A27A 2GDZA 4B4WA 4GMFA 5B37A 2O3JA 2AQKA 4UULA 2IZ0A 2WD7A 2CDAA 1K6IA 4JXKA 3BYZA 3GRPA 3WTBA 4B4VA 4BNJA 2QW8A 3KSUA 5DCYA 3M2TA 2W2LA 1IPFA 1NQOA 4CL8A 5JDIC 3WGHA 1LDYA 9LDTA 3HN7A 4YAIA 1I01A 3WGYA 1K0UA 4XD2A 5CEFA 3ROKA 4TKMA 4BL5A 2C2YA 3HJAA 1V8BA 3ZI0A 1PJSA 1ZXLA 2X5OA 5DULA 4RO0A 4EW6A 3NT4A 4D7AA 3AU9A 3PRJA 1ARZA 1HYHA 1XU9A 4CLOB 5DBGA 4FFMA 3TSCA 3O38A 5TSDA 4UUPA 4PFJA 1DJQA 1H94A 3F4BA 2BI8A 3GDFA 4YJFB 1DFGA 1LSSA 4Q3CA 1ZKMA 2VZ9A 5KOIA 2EGHA 3OSUA 1G0NA 1FMCA 1T2FA 2J8ZA 2J5KA 4Q3NA 4J7UA 5MGBA 5A5EA 2NTVA 4BGUA 1WPQA 2WE8A 5FI5A 2D1YA 1P31A 1OI7A 4R1SA 5ITVA 2GASA 4J16A 3K96A 3NYWA 2B4QA 3EW7A 3PK0A 1DDOA 1HYEA 1B26A 2ZATA 3Q9NA 4PGFA 1ZNQO 4ZA2A 3BMCB 5THKA 3PJEA 4AJPA 3D3WA 4XQEA 5I8WA 1PS8A 4J0FA 3SJUA 4FIZA 3WGOA 4PZDA 2PD6A 3ANNA 2YY7A 5GMOA 1QYXA 5EN4A 3VAZA 4B3JA 4YAKA 1NP3A 2R6JA 3GAZA 4Y98A 1JA9A 1ZVMA 5B1YA 1GTMA 1J0XO 1E7YA 3TF5A 3DBVO 3KEQA 2X5JO 4O6VA 2V6FA 4NPCA 4EJMA 1DXYA 4E4YA 1ENYA 5BSGA 1V3TA 2VUUA 5BR7A 2I9PA 4XCVA 2QX7A 3N58A 1YQDA 8ADHA 1ENZA 3OQBA 5TQVA 5A5FA 3LC1O 5EQDA 2BLLA 2EIHA 3PJDA 4UVDA 3GZNB 2RHRA 1HEUA 1M67A 1BRMA 5TGDA 1YB4A 4RVUA 5DOZA 2Q3EA 3GDGA 1GCUA 4N18A 1G1AA 2C2XA 3EGOA 3VH3A 3B1JA 5H83A 4BMVA 2J3KA 1B3BA 2J5QA 5JCXA 3HADA 3R1IA 4JP2A 2BFOA 1U2GA 2O23A 3IKVA 4RVHA 3C7CB 3LT4A 2A4KA 3B1KA 3UXYA 4YRAA 3DZBA 1GV1A 4DQVA 4UVIA 1V35A 3KHUA 1Z45A 2YUTA 4IUYA 4IDBA 4AJHA 3L6OO 1U8FO 1PIWA 2EG9A 2W2KB 1TT5A 4BO1A 4Z0HO 5JY1A 2I67A 2AHRA 1GPJA 3EC7A 1U8XX 3M1AA 2YDXA 5TX7A 4ALKA 1XKQA 4JX8A 3RBXA 5IZCC 4GLLA 3K30A 3PWSA 2IZZA 1KVQA 4BO0A 4XQ9A 1XWFA 2AXQA 1X7HA 4KUEA 4E2YA 5HWSA 2O48X 1H93A 3M2PA 1BG6A 3FHLA 2X9VA 3GN2A 1YGYA 3DONA 2DU8A 3F1KA 2PV7A 3F4LA 4GQAA 5EIOA 5JXWA 3DBLA 4PZCA 4Z3KA 2Y1GA 3E5MA 4OIMA 3VKVA 1M2WA 4CMJA 5L4NA 2DVMA 4BNXA 4LCJA 4ZJUA 1XGKA 4IS2A 4L4RA 1VE9A 2X86A 3IUPA 4MVJA 2PH5A 5A9SB 4UEOA 3ZNOA 5JO0A 4NFSA 4R68A 4R1NA 1I2BA 1M75A 1PL8A 4XRRA 1P45A 4BB6A 5AXCA 1DHRA 4NQZA 2YFHA 3LF2A 3ZHZA 5K6AC 4NJMA 4HFNA 3V2UA 4QO7A 4TSKA 1MC4A 4WASA 4BMSA 3KETA 4FD3A 4DIOA 1YRLA 2OBNA 3JCZA 4S3MA 4LVCA 5F1OA 4LISA 1A9YA 3DMTC 3ONFA 5DP1A 2ZQYA 5GZ6A 3PGXA 4HNGA 5BT9A 2Y67A 3V2HA 1R15A 4CM8B 2J3JA 3Q3CA 3X2EA 1U9JA 2VUTA 3D4OA 3RAJA 1UXKA 4I5DA 4HUJA 4II2A 3PI7A 3AFMA 4MVJI 1C0PA 2XOXA 4OM8A 3ABIA 3L9WA 1UAYA 3ANLA 1YL7A 4ND3A 4D0SA 3RROA 2BELA 3OJOA 1GEGA 1BDMA 1H2HA 4ZD6A 3DBRB 4WK6A 1DIHA 1E0DA 1CIVA 3PHJA 4FCCA 4L4SA 2Y1CA 4A03A 3COSA 4M54A 3H9GA 2PY6A 3DZFA 4J1QA 5L4SA 1ZK2A 2NVBA 4FDAA 1L7EA 4A0SA 1GYQA 3HN2A 4YVFA 4LK3A 1NR1A 4LSMA 5HRUA 1DC4A 3QVWA 4YBZA 5G4LA 5HBRA 3VH4A 4GKBA 1IHXA 4AJOA 3E48A 4U6SA 2P9EA 1E77A 2VN8A 1R4MB 2AQHA 5K9ZA 3ICPA 1LDEA 3Q0EA 1SEVA 3ZW9A 1EVIA 3U49A 4W4TA 1U4OA 4AG3A 3OETA 4TRMA 1CQJA 3I9MA 3UVEA 1JLLA 2Y93A 3WJ7A 4HX5A 2YJZA 1BDBA 1R66A 1UXHA 4R01A 4P4LA 2WE7A 4IJWA 4BO4A 5IDWA 1B7GO 4FR5A 1QYVA 1YQXA 4EDFA 1BXKA 2O2SA 4XDZA 1XA0A 1ISHA 3FNHA 3P2YA 3FWZA 1FDUA 2VOJA 3C1AA 1LNQA 3K2EA 1OZAA 5DP2A 1WMBA 1M6HA 1ZH8A 2CNBA 2GRAA 4GX0A 1XU7A 4AFNA 3H9UA 2I6TA 4PRLA 5JDCA 5KJFA 2DM6A 1Y8QA 1ZSVA 4E5MA 2P5UA 1EBUA 4E5YA 4BNHA 4BQRA 4M55A 5EINA 4RF5A 1XLTA 1KEWA 1Q2XA 4J9VA 4A73A 1H9BA 3ICCA 5C3MA 6LDHA 3PYXA 2W2LD 1Y9AA 4JK3A 1FDSA 1LA2A 4QFDA 1HLDA 2I5PO 2PFGA 5TS3A 3I9KA 4MP6A 3LZ6A 2PK3A 2FY8A 4IZIA 1BVRA 2DPHA 1X13A 3BTVA 3JYPA 3LT2A 4Y67A 2PD3A 5G0SA 1E3IA 3C3XA 4NBWA 4OQYA 4NMHA 1CETA 5DCUA 1AUPA 1JW9B 1YBVA 4FOSA 5F5NA 2HMSA 1K6JA 3GGGA 2NWQA 2WM3A 1J49A 2OZPA 4RVGA 4WEOA 3SC4A 3GY0A 2PR2A 1C0LA 1UP7A 3OIDA 2C7GA 1P1RA 4OJNA 3LC2O 1T2DA 2PZLA 2BMAA 3CTMA 4CMEC 1TVEA 1S7CA 3WB9A 4OKIA 2FR0A 4MVJP 2NQTA 5FI3A 4J7CA 1UAGA 2BF7A 4L9RA 3AY6A 4J0EA 1NQ5A 4BV9A 4DLBA 2YYYA 3ZCXA 2Z5LA 4FFRA 1MC5A 4B7CA 4D79A 3D5QA 3I83A 3BIOA 3PTZA 4TVBA 1GPDG 3KO8A 4B7XA 1TXGA 3U0BA 4XDYA 2Q50A 2V6GA 3K2BA 4NDNE 4EJ6A 3DOJA 5C7OO 2HKIA 1SAYA 3H65A 2GPTA 1E1KA 3JQGB 4FFPA 4HFJA 4IJVA 2OFPA 4PVDA 4IS3A 2Y66A 2C7VA 4MVJE 1VJ0A 4FOOA 4YR9A 4MKZA 4IIUA 5JAQA 1QP8A 4NBRA 4ZQGA 1SC6A 1F0YA 3U3XA 1X1EA 2WD7B 4Q3DA 3KBOA 3FRJA 3G17A 3QWFA 4R9SA 5DNAA 3DOOA 3FTPA 2H5LA 1EK5A 3ST7A 4O59O 4XYEA 4S1VA 2OP0A 2FR8A 5CDYA 2HCTA 3GFBA 2QRJA 1KY4A 1KVRA 1YO6A 5IF3A 3VVCA 2JCYA 2FMUA 2CF5A 4FJ0A 2O50A 4CL3A 1DRVA 3SJ7A 4IGFA 1WMAA 3E1KA 4I9UA 2HUNA 2X6TA 1GDHA 1NPTO 1DAPA 1XQ6A 5CP8A 5DZSA 3GA0A 3V2GA 1YDEA 3I9OA 2I3AA 3DEYX 2BFMA 3O03A 1UZMA 3DR3A 2B4RO 2X0NA 5L7WA 3AI3A 3CEAA 3N74A 2NTJA 2NNLD 1FDWA 2H6EA 3MJSA 4Q9NA 4BO3A 3MJCA 5AXBA 4UEJA 2CZCA 2NADA 4J4BA 3RASA 4GX2A 4M8SA 1YB1A 3AUTA 5JSFA 4CQMA 4IDEA 1E6EA 1PGQA 3ZWBA 5CPFA 4XYMA 3VOSA 3QW2A 4WNCA 3H9JA 2OO5A 4R3NA 2HJSA 1LDBA 1KS9A 2FP4A 4CM1A 1VL6A 3L4SO 3PXXA 4AJNA 3ZWAA 3PLRA 2IEBA 1PZHA 3FTNA 2ZYGA 1KYQA 2VRCD 3NDRA 4PLPA 3GPDG 4IMPA 3TZQA 4CMIA 3CZRA 3DHYA 3W8DA 2PGDA 4F46A 1MB4A 2HK8A 3JD4A 3U5TA 1E92A 3MZ0A 4K6CA 3E03A 1YJ8A 1X1TA 3I6IA 4U0JA 2JD1A 2PGJA 2YDYA 5F1KA 3D3WB 4CUJA 3D4NA 4IINA 2UVDA 3GZNA 5IN5A 4XRGA 3F6YA 4Y8VA 2X1HA 4LN1A 3GUYA 2ZYDA 4BNUA 2DBRA 3ZU4A 2AEJA 4WLVA 2NQ8A 1LRJA 3L6DA 1SZJG 4PLZA 1CRWG 5T5QA 1NQAO 3VZRA 4D0RA 1QMGA 2VTDA 3H5AA 5F21A 2O7SA 3UCXA 3QWIA 5F3RA 3U62A 3NV9A 4IJUA 5KKAA 3VVBA 3WIDA 3ZWVA 5TT0A 1IY8A 5IDXA 4AVYA 3DOCA 1F17A 3JQAA 3PQFA 2C54A 3OIFA 2ZB4A 2O3UA 3GRKA 1JAYA 1I3LA 3JD0A 3DC2A 3I1JA 2H9IA 4TVOA 4L74A 4R1TA 1JDJA 1I33A 4K28A 4EUEA 1LU9A 1XDWA 2EF1A 4F45A 4BVAA 4JNKA 3SBOA 2P5YA 1D1TA 2HMVA 3W4KA 1R6DA 1UR5A 4ZQBA 3WXBA 3OJLA 4A7PA 5LC1A 1AN9A 4QT0A 3TZHA 4AJEA 1EVZA 1NX6A 1PEDA 3GGOA 3TOZA 4KWHA 1E7SA 2DLDA 4AJ2A 3EVTA 3KYDA 3QV1A 4YJGB 5JNLA 2CDBA 3RI3A 4EUHA 5IXYA 1LJ8A 4BO8A 4R3WA 1Y9EA 1LBEA 4YDRA 3KEOA 4QTZA 2EV9A 1PQPA 1GR0A 3AU8A 4GH5A 1ISFA 4GLOA 4QQRA 2I65A 3WOHA 4CR7A 1O94A 2Q49A 3S1LA 3OICA 5GZ3A 2QYTA 3GOHA 4IXTA 4Z3DA 4CM5A 1GD1O 2O3TA 3PPIA 1LXCA 1HWYA 4Z0TA 4YA6A 2PH3A 3FN4A 2DFVA 1H2BA 4ALIA 3GLQA 3PZBA 3WDSA 5HS6A 2DTDA 4XKJA 3VDQA 3PWZA 1E3WA 3FNGA 4Q3AA 1BGVA 4CQMD 4K9DA 1W6UA 3RUAA 5CEJA 4XYGA 5ENDA 1C14A 3LVFO 1LLDA 4XIJA 1UJMA 4IMRA 1NTOA 3S2IA 3UHAA 5CDTA 2VNSA 1DSSG 2Z95A 2G1UA 1RM3A 1TT5B 4Z0PA 3F5SA 1UXJA 1MG5A 5CDSA 5IDQA 5IG2A 2DBVO 4CM9D 5JE8A 3D0OA 3LYLA 1LQTA 1IOLA 2D8AA 2JCXA 2ILTA 1U2DA 3E8XA 2UV8A 3ZGYA 1JVBA 3LT0A 4WNIA 1ONNA 1V9LA 4EITA 3BAZA 2GNAA 1YS4A 3BMOA 1KVSA 4RL6A 2NU8A 5JW6A 4XQCA 5A9RA 4BB5A 2I99A 1QV7A 3GHYA 4FS3A 2IYPA 3JQ7B 1PZFA 3ZZNA 2UDPA 2JHFA 2JHGA 1O9BA 3FNEA 2NVUB 3JYLA 1ZZEA 2HK7A 1GYPA 5JDIA 3JQ8A 2GYYA 4XB2A 3WGQA 3WWZA 1YB5A 4FFLA 4CM7A 3WQQA 3RUFA 4RPGA 4QFCA 2F00A 1N9GB 1UZLA 3GNTA 4N5NA 4CLXA 4XYBA 5DN9A 2ZIZA 4ZVVA 1ZIDA 1MLDA 4YJHA 2P4QA 1WVGA 2IEDA 1PJ3A 3NUGA 5KTKA 3U09A 1JKFA 5TNXA 5G0WA 4WPGA 3VC7A 4BO7A 1PS0A 4CM9A 2V65A 1JWAB 3LDHA 5CHEA 2HQ1A 1DC6A 3CZMA 2GO1A 4HFRA 1B16A 4DC0A 1S6YA 1I24A 1D3AA 5C7IO 4CR8A 1I0ZA 1SMKA 4JBIA 1H6BA 1O6ZA 1ZFNA 3ZHBA 3IMFA 1MX3A 5AVOA 3RU9A 5I7SA 3IL2A 1YBAA 1ISGA 3WFIA 3CUKA 3SVTA 3ZDFA 5C5IA 2HRZA 4RLHA 3H2ZA 3AM4A 3H9EO 4I5FA 3W4JA 3RFTA 1XSEA 1Z7EA 2HDHA 2VNAA 3C7DB 3BMNA 1C3VA 1DO8A 1EE9A 1OC2A 1N2SA 2EWMA 2HMUA 3A1NA 5JLAA 5JS6A 2WJPA 1I36A 1LRKA 4ND4A 1GUZA 1NNUA 2OBYA 3OQ1A 4NZ9A 1HKUA 2HU2A 4ID9A 3EZYA 1NFQA 1X14A 3DL2A 2C82A 3RUDA 1ZJZA 4ND2A 4NU5A 3NKLA 2EP7A 1OC4A 2C5AA 1V0JA 5KNLA 4L76A 4BHTA 3ZWMA 4D3SA 2Z1MA 3ZH2A 3W4IA 4WLOA 3IKTA 5DBIA 3Q2KA 1T2AA 3MEQA 2DBQA 3B6ZA 2X9GA 3NTOA 3FCOA 1EUZA 4GBJA 3ROMA 5A9TA 1PJ4A 4NR0A 3GAFA 2R2GA 3ZWOA 4DGSA 2VHYA 3W6UA 3DFZA 2D59A 4IGEA 3ULKA 1IB6A 2AA3A 2ZJ1A 3RFVA 1JTVA 1Y8QB 1K3TA 2RAFA 2FWMX 4GMGA 1LLUA 3I3OA 1GYRA 3KLPX 2B0JA 2EHDA 4TROA 4F6LA 5A05A 4HADA 4ZQFA 3BTUA 4RLSA 4KDFA 4MO2A 1EZ4A 4KOAA 4NIMA 3WR5A 5BSFA 4O63O 1GZ6A 4JGBA 1LDGA 1Q7GA 2Q45A 3OH8A 3BA1A 2AE1A 4HFMA 2HAEA 4ZN6A 4BKOA 2P9CA 1I3MA 4Z6KA 2QQ5A 4R9RA 2X5KO 1GQQA 3DAFA 5THQA 5AOVA 4WJZA 3QQPA 5ES3A 1J4AA 2GD1O 4RQTA 5JC1A 4NK4A 2P2SA 1ML3A 1ULUA 4WCFB 4N7RA 3DBHB 3BMNB 3DDNA 4KTTE 5ILGA 2ZKLA 5KJ6A 1QORA 2YHUA 3AM3A 3QWAA 3BTOA 1T25A 2Q2VA 3EK2A 2V6MA 4E0BA 3GVIA 5J23A 5BQFA 3Q11A 4CV1A 4CJXA 2BGKA 4DREA 1WLYA 1PJLA 2JFGA 1A9ZA 1T1SA 2O3QA 4RPHA 5A03A 2JFFA 1M76A 2X8LA 3UOGA 4XYLA 2GN6A 2XF8A 1XYGA 3FR8A 4MVJF 5LCXA 1H6AA 3DFUA 2HJRA 3VPSA 2B37A 3VZSA 5KIAA 3Q9UA 3FNFA 1KBZA 3MJVA 4NHEA 2GZ2A 3DZKA 3K9QO 4TQGA 4B79A 2EJVA 1F12A 4MIEA 1E5LA 1NFFA 3JSAA 4KP7A 4XGKA 3L4BC 4L75A 5U1PA 5JPIA 4CLEA 1WXDA 4CMBA 3PDUA 1B0AA 5JY6A 2JL1A 4DXHA 3NJ8A 1KEVA 2AEMA 2ET6A 1H0KA 4Z9YA 2VHVA 3PJFA 2NM0A 4DVJA 3U9LA 5KVCA 2DFDA 3IOYA 3VH1A 1CJCA 1NWCA 2OUIA 4J1TA 3WIEA 4UUNA 4C7JA 4PLVA 1BHSA 4EEZA 3UKOA 2VHXA 4W6ZA 3F1LA 3ZV6A 4BNWA 3GG2A 1VKNA 1U3WA 2QZZA 1T1RA 4XGNA 3VTFA 2GN4A 2P68A 3BTSA 1D7OA 3ADPA 5GZ1A 1DBVO 2HMTA 1PJCA 4CMHA 3BHMA 5ER9A 4RPJA 3GNQA 1RM4A 4BKPA 2ZTLA 2A35A 1E7MA 1DRWA 1UZNA 4K1LA 4TWRA 5JCJD 3CMCO 4IZHA 5JYDA 4I9HA 4L4XA 3TJRA 5COBA 2GN8A 1WDMA 4TRNA 4OOEA 4D43A 4HP8A 4JBHA 4OO3A 1Z75A 3V8BA 3ANMA 1PQWA 3AY7A 2DTXA 4FJ1A 3AI1A 4ZRMA 3G49A 1PQUA 4KUGA 1J5PA 1U4SA 3DHEA 3UW3A 4D42A 2Y0CA 3GMDA 5ENVA 4A10A 3VPFA 5G4KA 3I4FA 2NU7A 2YV3A 3QE3A 5I9MA 3V1TC 4YT4A 4OOFA 5CG1A 2SCUA 3KUXA 2J6IA 5DF1A 1YXMA 3I9JA 4D41A 5JMWA 2OHXA 2FRDA 3MTGA 5CFZA 3BHIA 3ITKA 2I3GA 1LLQA 1NBOA 4U0KA 4DQXA 1T2EA 3H3JA 1PL6A 3LU1A 3ROPA 4E13A 1LSUA 3F3SA 4BKUA 5COAA 4EEXA 2XXBA 4BNGA 3IC5A 3OIGA 1NVMB 4H3VA 3B70A 3TQHA 4C4OA 1K2WA 4BO6A 3HQ4O 3F9IA 5C7LO 1HDYA 5L95A 1CDOA 4U5QA 4FN4A 1HDXA 2JCVA 2QZ9A 4DMMA 1DC5A 2VUSA 4Y6PA 4BNNA 3M6IA 3GEMA 4PLCA 4WLUA 4B3IA 4PG6A 3FI9A 1GU7A 3JQFC 4CM4A 3I23A 3WNQA 1EVYA 4OSPA 4CV2A 4PIVA 4R54A 2RCYA 5FYDA 4NI5A 2DAPA 4MP3A 1PX0A 4JBGA 3RJ9A 3WJAA 1W0CA 5EERA 1A4UA 3EVNA 3JV7A 3PJGA 3H6KA 3G0OA 1Z74A 5L51A 4MINA 2O4UX 3BMQB 3EMKA 3BMQA 1DIAA 4BNLA 2Y0DA 4ZHSA 3R3SA 4FFNA 4B7UA 3A14A 2ZCUA 1WNTA 3WYBA 4CQLB 1Z6ZA 1VI2A 2EJWA 1N8KA 2X4GA 3HE3A 1I8TA 2PA3A 3JYQA 3WBFA 3UF0A 1QRRA 4BNKA 3GR6A 2WEKA 2CF6A 4CQMB 3AWDA 2Y1FA 2YV1A 1FDVA 2NTNA 5T64A 2WYWA 3TL3A 5L9AA 1FF9A 4QO8A 4PLYA 1P1KA 2HSDA 1YDWA 3U4DA 2W4QA 1DB3A 3FR7A 4PZEA 5T57A 4D45A 1OOEA 4P22A 4Y9DA 3E5RA 1GCOA 4ZICA 4B4UA 1ZK3A 3KOUA 3K92A 2D5CA 3EDMA 4XJTA 4RF4A 4U8GA 1E1NA 3AUUA 3DQPA 3CMMA 1AE1A 4J3FA 4RVSA 3H3FA 4BNFA 3IS3A 1ADGA 3I9NA 2YV2A 3INGA 4BNTA 4QXMA 1D4FA 1PJBA 4LCEA 3CE6A 4E5PA 4TZTA 4M89A 2D0IA 4ZQHA 3BXXA 2FR1A 4OXNA 5CPBA 3LC7O 1MFZA 1SOWA 2CVZA 3VHRA 5BNTA 1YL6A 3PIIA 3LK7A 2OP1A 2VHZA 1Y5MA 1NQTA 4LMPA 3AUSA 1UP4A 2F1KA 4IQGA 1ISJA 1EQ2A 1ZMOA 2ZB7A 3BZUA 4DMLA 3MWEB 4BO2A 1TA4A 1MUUA 1YOVA 4MVJG 4CUZA 3WGGA 3MWDB 1IHYA 2J3IA 5L3ZA 3OJFA 4ND5A 4W7HA 1R4NB 4TZKA 5ILOA 3GK3A 3KYDB 4A2CA 2CVOA 4RVFA 4AJ1A 3DBRA 1GAEO 2W98A 3HWRA 2OGUA 1I3KA 1F06A 3GNSA 5BNIA 4FGSA 1GEEA 1YQGA 1QYCA 2VHWA 2FZWA 4J9UE 4RPKA 1P0FA 2RH8A 2H63A 3NJ4A 1HZJA 3GN1A 4DWVA 1AXGA 1GY8A 1VM6A 1HDOA 1IL0A 2C59A 3KM0A 4B8ZA 4RF3A 1GV0A 2AQIA 2NU6A 2AW5A 1G0OA 4IBOA 4Q3EA 4F3YA 5DT9A 1P1HA 3ETEA 3HUDA 4DA9A 4UREA 5EJ2A 3RC7A 2C07A 4Y6SA 3LLSA 2Q1UA 1RPNA 3TRIA 1DHTA 4O1MA 3JQAD 1PR3A 1P1FA 2J5RA 3ZNPA 1E3WB 2W90A 2VTEA 4UEKA 1RJWA 3S2FA 4J6FA 4W99A 2B36A 3GVPA 5A06A 3TL2A 3A06A 1X0VA 4XR4A 4NU6A 3GEGA 3H5RA 4DQUA 6ADHA 3WBBA 1XHLA 3U4CA 5FEUA 3VDRA 4WUVA 2IYOA 3S8MA 4YRDA 1KY5A 1NFRA 4JJGA 1ENPA 1HE3A 1ISMA 1ZO8A 4I08A 1I2CA 1K89A 4II3A 4MVJD 4E31A 1ADBA 5CEEA 3S2EA 2Q99A 4KTVE 4ZRNA 4KDEA 1A4IA 3JTMA 4KMSA 1E7WA 3SX2A 3ZWPA 4CMIB 1LI4A 2YW9A 5A1TA 3MCVA 3OMLA 3HFGA 1JN0A 3WGTA 1SPXA 2B5WA 5DBFA 3TFQA 4B4OA 4CMGA 4ALLA 3CXRA 3HDYA 3DZGA 4OXYA 3FSRA 3ZNQA 1EFKA 4IJKA 2EERA 5A4DA 2NU9A 3X2FA 4O0LA 1NVTA 3WYCA 3JQDA 4YQYA 4RF2A 1FDTA 2O3RA 4KWIA 3GH3A 3NT5A 4R5HA 5A02A 3FBTA 1H6DA 2AQ8A 1PJTA 1XG5A 1NR7A 1LSOA 3CIFA 2FZEA 5DOVA 4I1IA 2VWGA 4BNIA 1M6WA 3AOGA 3KXDA 3AOEC 2PTGA 3UGKA 1X0XA 1PGOA 4DUPA 3JQGA 1ONPA 3E9QA 4YCAA 3GPIA 4GWGA 3UFXA 1DFHA 2EW8A 5A3JA 1E3SA 3UCFA 3ZWWA 3L0DA 4JQCA 2O3SA 4YYZA 4ND1A 1C0KA 2QIOA 3N7UA 3HB5X 3QVTA 4GVXA 5IDYA 4GX1A 5G0UA 4P38A 2BFPA 1E3EA 1EE2A 4YWJA 1DC3A 1QXSA 3ZHXA 1E7QA 5KVQA 4Q39A 1HXHA 2E6UX 3E9NA 3WLEA 4DYVA 4ZGWA 1ADCA 1R0LA 1JU9A 1N7HA 4RV9A 5IZ4A 3WMXA 4J91A 4XA8A 5KJCA 4DL9A 2PLAA 3GUCA 4NNJA 4CLOA 3GVXA 4FQ8A 5BSHA 1AXEA 3TPCA 4HY3A 1ZXBA 2DT5A 4UUMA 3K5PA 2AG5A 1DJNA 1HETA 2PNFA 4AJIA 4JROA 1K6XA 4BNZA 3AM5A 5B4TA 3RUEA 3RU7A 4H15A 3DO5A 1E6UA 1NHWA 1DEHA 3RCBA 5B12A 3LF1A 1ZEMA 5KWEA 5ER6A 1I10A 1R16A 3AI2A 1ZSNA 3PZRA 5L53A 5B4UA 1KETA 2I66A 2OXIA 1LEHA 3GF4A 4OL9A 4UVHA 5JAZA 1RYEA 1B8VA 3L6EA 3T7EA 3RFXA 1IZ0A 1ZEJA 3KSDO 4XX0A 2P4HX 4E5KA 1ZK1A 2CMDA 4HWKA 1U7TA 4NBUA 3JQBC 3GZ4A 9LDBA 1PWXA 2Q4BA 2WD8A 4DPLA 1GUYA 3E18A 1O8CA 2GCGA 3IP3A 3L77A 4I8XA 4DIBA 2A9FA 4DPMA 5BSEA 5L4LA 1OAAA 2FPGA 3T4XA 4CODB 1H6CA 2RH4A 3GQVA 2HO5A 4PLTA 2G0TA 1DFIA 3OFSA 4BNMA 4WLNA 4N54A 1Y81A 1DIBA 2Q2QA 1EDZA 5FF9A 4YACA 4PG5A 1H9AA 4JIGA 1P3DA 2QRKA 4FGWA 4FC6A 3TZ6A 3PLNA 2O2YA 1KERA 3KZVA 4ILKA 4OYRA 1CF2O 4EBFA 3P2OA 4WCDA 4A27A 1U28A 1MA0A 2G82A 3GFGA 2NLOA 5EESA 2NACA 3H2SA 1Y5RA 2PKQO 2Q1WA 1BVUA 1OMOA 2CD9A 1LX6A 4KQXA 4LRTB 3OQ6A 4PG8A 1DLIA 1XQ1A 2VRBA 2X22A 3JD3A 3WWYA 1JWBB 1B8PA 1NWHA 1VL8A 4GL4A 3O26A 3U4IA 2FPIA 3RC9A 1J6UA 5KKCA 2D5AA 3TOXA 4YQZA 1MXFA 3RC1A 2AMFA 4Q3BA 1N92A 2VYVA 3H8VA 4FJ2A 3GT0A 4J1NA 3C8MA 1T24A 4OH1A 3MJEA 5DDIP 1T26A 3GVCA 3JQFA 5K0ZA 2I76A 2IE0A 2EXXA 3DMYA 3O4RA 1RM5A 4EZBA 1QYWA 4L8VA 5T67A 3ZV4A 2ZJ0A 2Y1DA 1XELA 3NTQA 4M87A 2H1SA 1KVUA 5TF4A 1Q1NA 1ZK4A 3RC2A 4E21A 2Q1SA 1BXZA 3OJEA 1VJTA 4Y6RA 4ESOA 2RHCA 1KC1A 3Q6IA 2PGLA 4PLHA 2C0CA 5L7TA 3TFOA 1Y8RA 1VRWA 2VT3A 2XPCA 3GGPA 2NV6A 1GQYA 1FJHA 1PGJA 3GDOA 3HDQA 3NDJA 4LSWA 5EL0A 2CVQA 3WFJA 4WCFC 4CMAA 2ZB3A 4GGOA 3WGZA 2X58A 3JQ8B 4LVUA 1HE2A 2IRWA 2E48A 4YT5A 2YHIA 5HM8A 5ICSA 2WDZA 3U4HA 2X0JA 1ORRA 3L9XA 5ITWA 1EUDA 1JVSA 2DKNA 3QVSA 3MJ4A 4OXKA 3LT1A 2HK9A 3UN1A 3FPLA 1X7GA 7MDHA 5JBIA 2UUPA 1MG0A 5IXSA
chains in the Genus database with same CATH superfamily
1TAHA 2G5TA 3MB8A 4ZAWA 5C3UA 4YY3B 1D8AA 1T3HA 3LY9A 1R5BA 1MVOA 5A9SA 2DY1A 4HAZA 2EKQA 3SLRA 5LLTA 1PP7U 5LA6A 2YKGA 4S0HB 3BCAA 5IVIA 2CXNA 3SQLA 3CR8A 3ITDA 1IM8A 4HDNB 3EAFA 4IXMA 3VR2D 3H3ZA 5C2JB 2AOXA 2JBHA 3ZLBA 1PDOA 1BJZA 4KIBA 1KQ8A 121PA 4KDRA 2PZEA 5EZYB 2X3YA 5FPYA 3MERA 5H82A 3C1OA 3T6KA 4D3DA 4DLYA 5IBCA 2WICA 4W1UA 3K31A 4HDSA 3R7BA 3EF3A 4PZPA 4ZO9A 4PK4A 3K8YA 1IAQA 3C6MA 4D9EA 1FDRA 3IV9A 4IIFA 4DS3A 1UZUA 1KONA 2YWBA 4JZYA 3QBEA 3EF1A 4O29A 5BYJA 1LRLA 2SNIE 2F5CA 4BWVA 2WWWA 1GQSA 3N2LA 1T91A 1R4MA 5KHOC 3FNRA 2AXLA 4PYNA 1MZVA 1UBUS 2Z2KA 2Q1ZB 2IVFA 3COWA 1GILA 1M34A 5HX7A 3JQ6A 1PDNC 1AHHA 2QGUA 5H6QA 2BFEB 3JQ9A 3NGXA 4DNFA 1CWUA 3LYHA 3P0FA 1PI3A 4IHJF 3RUIA 3CUOA 4I3HA 3T52A 3X43A 3QWHA 5IAOA 3AR4A 3R3WA 2G1AA 2OLKA 5ADWA 4CQNA 2F4NA 4HDRB 1LTQA 3AW8A 5EGOA 5DHUA 4R8VA 4EO9A 2FQQA 4BUCA 1WUIS 2TMKA 4D8YA 3PSHA 3A1TA 3H7IA 1K7CA 3WP0A 1PR4A 5L3QA 4UEQA 3N0VA 1W93A 1Z4PX 4FWIB 1YA4A 4IQ0A 2B69A 2QSHX 5ALYA 3ZOZA 4ZI7B 1WXIA 5FLKA 4BX2A 4YRSA 4FFOA 4QDXA 1JPUA 1K9SA 1P1CA 4KO1S 4IIJA 2FDCA 4OINF 1G6NA 2FMKA 1KAHA 2ZB2A 1Q0HA 2PXHA 3IDQA 1JJIA 3VM6A 1MRZA 2BD0A 3OTHA 1ZICA 1PFQA 2UZ0A 1HKQA 3A02A 4MPRA 3HSEA 1B2LA 4Q19A 4FHEA 4KFTA 2ISYA 4QXQA 5B4VA 3JAMK 2OCAA 2PXAA 1KAQA 2VQHA 1L4MA 3OYNA 1U1EA 3ABOB 3DVAA 3QE0A 4MDHA 4HYTA 2FXAA 2AC2A 3C3YA 4QVKA 1EVKA 4I09A 2IXAA 4RYLA 6PFKA 1BS1A 1UKZA 1LDMA 3C3BA 3Q8WA 2EATA 1IV6A 2HWVA 2VBGA 3E7PA 1P2TA 3PPVA 4IRMA 1N9ZA 3BK2A 2X6OA 4CZZA 1BJTA 2CFTA 1JKIA 1OAOA 2V7TA 3FKSA 3HB0A 3VPAA 1BS9A 2K9MA 2GPJA 2K87A 2R00A 1UM9A 2C3PA 3A6FA 1EGMB 1C9KA 1TQ8A 2I7CA 3IDFA 3NRCA 4CMCA 2JFHA 3IO3A 4R1PA 3JRCA 2R6FA 2KZGA 1C4XA 1HZZC 1P2VA 1JJ8C 1P91A 2BEVB 3HUTA 5FR2A 2D2XA 5C7YA 4I4TB 1O3QA 1E8DA 2X77A 4RZXA 1JFLA 3DTYA 5DGIA 1Q1ZA 2VZEA 3WTWC 3KV1A 5JYBA 2FKAA 2BKAA 4LY3A 1V4VA 4YJDA 1LPPA 4OMUA 4F06A 2FF5A 1EGAA 3BG7A 3F6RA 4WLFA 1T33A 2UVPB 4E03A 4LJZF 4Z54A 3IGFA 3OURA 3T8TA 4NH4A 2Z6VA 2J3MA 1HDRA 2WJWA 3MGKA 4CM3A 2GAAA 2Q6VA 1X1PA 3OOPA 1G2QA 2FX3A 2XRNA 3C8ZA 3SF8B 2FFAA 4JKIA 2VE8A 1TKBA 2BPOA 2W4IA 5HIIA 2FP3A 4OHYA 1RQNA 2VWHA 2VPZA 4LQ4A 4RY8A 1OQYA 1L5WA 3JZIA 3U7RA 4M49A 3BB4A 1TTHA 2M34A 3FFWA 3HVUA 3QW4B 4Z99A 5G02A 2AS5F 2B9EA 1I3OA 3E5HA 1TUBB 3ZE2B 2A1UB 3HSYA 5ECWA 3NDIA 1RKQA 4GNKA 3MRXA 2RBKA 1CW2B 1UDAA 4RKWA 4G8BA 1IBKB 2VLBA 2BHSA 2RKHA 1ZCJA 3C6ZA 3DPSA 4LQLA 3N4MA 2I71A 4JP0A 1T4DA 2V6CA 1GZ4A 2PUJA 2Z1NA 2MCFA 3VYSB 5I7RA 1SA0A 2MINA 4LJSA 1WZIA 1B14A 3CJNA 1MH9A 2DWCA 2OMEA 1XDUA 2X0IA 1M1YE 2ENWA 2R8BA 3GFTA 1YC2A 3H5VA 3P9RA 1YKSA 1FK8A 4L50A 1TEHA 2Y77A 4DY4A 5HRAA 3LX6A 2VJBA 5IKXA 1E5VA 3COYA 1EVLA 5SY4A 2C5EA 2Q5HA 3CVYA 2WAFA 1NVEA 2O4CA 5AK6A 4BV3A 4L15A 4BQIA 2I8AA 2OXFA 3DV8A 3DNPA 3PUKA 4QUEA 4B0PA 2FU4A 2B8EA 1UPTA 2BEUA 4JLKA 4S2EA 5I7FA 3T5MA 3LG2A 3O95A 2RHLA 1EDBA 3LUPA 3MN1A 1GPAA 4XARA 5K0SA 3ZGZA 5ALKA 1FRVA 2XUZA 1ZCZA 4N0BA 5F5LA 4FMDF 5F1PA 1CR4A 1I1HA 2B6NA 2LDXA 2QVXX 4R69A 1WXGA 3SIWA 2HW8A 3V4GA 4RIGA 1UADA 3AP3A 4TLMB 1IH8A 5JMPA 1U2DC 5TB5A 4IDDA 3W8EA 4E88A 5A5VA 4NCXA 2PMUA 4P31A 1TM4E 2G70A 3PTLA 2VJ4A 2FPMA 4HW0A 2PVPA 4GAEA 4UVGA 1L5FA 1NAHA 5H80A 4DBVO 4UHTA 1MJHA 2X7HA 1DQYA 1E2KA 2ZOSA 3EZLA 4L5JA 2QTMA 3E6CC 2BBTA 4OYHA 4YT2A 3G73A 1NRIA 3SQXA 5T8KA 1NNLA 4PGMA 1VQLI 2KJQA 4JCOA 1HDZA 3HL2A 1NX9A 4QIWN 4IILA 2DUWA 4C5AA 2QJTA 3VMMA 2XOKA 4H4EA 1ZRDA 1W73A 1TVKB 4PONA 1WUKS 3IA7A 1F14A 2BTOA 2IOFA 4U7WA 4L78A 1OXVA 2AOTA 3DNMA 3DOIA 3KJHA 3HVRA 4DR7B 2XUOA 1Y82A 2KLOA 3NX4A 4TT8A 4E5NA 1GDTA 2SKEA 5J1TB 3RPUA 1C8LA 1C9MA 1K5PA 1T3SA 3BX1A 1I14A 5SICE 2PFKA 3ZIUA 4FGLA 2XXAB 4JBAA 2B83A 2GBGA 4LXUA 2YX1A 2ZI7A 5H81A 2NUPB 3QG1A 1D5VA 2XV1A 4IRXA 4NBVA 4ESHA 3FUVA 1FMTA 2QRNA 1E6WA 1L1QA 4QIHA 3W04A 4K8OA 3KP4A 4KIGA 1JKJB 1Y7PA 1X80B 4AIKA 2K5UA 1LCIA 4GI2A 4NU0A 5C37A 2YSRA 3KQNA 3AK4A 5TR9A 4AM3A 4Q37A 4LB6B 2B78A 3K6JA 2JH9A 2ZRNA 3PP8A 1ZI9A 4MW7A 2JLSA 4DRZA 4ZGGA 8GPBA 1OIVA 2ZRKA 3FGOA 1N6IA 1T8PA 2IP2A 4A3BJ 2OCPA 1DGRM 3QELB 3I0MA 4IJ5A 1CC1S 4RGBA 2IYZA 3ZWDA 3VR6A 2EKLA 5KYNA 4D2IA 3OEYA 3R9XB 2H4XA 2KWIA 5KYXA 1OLOA 3ZG6A 1I30A 1N5DA 1Z2CA 2CXPA 4C4ZA 3GP5A 2P6RA 2AR7A 1Y0UA 5FWNA 2FUCA 2CC2A 2JC3A 1A5TA 3AEXA 2TDXA 2ZXWH 4WKNA 4F56A 3HBJA 4J0KA 4LFCB 4MW0A 1VPDA 1XP8A 3K05A 3NHRA 4KN8A 3L43A 1VLMA 2IDMA 4PBRA 1CUWA 4I19A 1IBLB 2LLKA 4FDTA 4BX3A 1URPA 1UXIA 4FASD 1BFKA 3EQ9A 3M1LA 4ZYTA 2JDID 1U3UA 4MFEA 2B7LA 4KR9A 1AXRA 3PDIA 3GMSA 2H16A 2JHPA 3QLVA 4P8RA 4UNRA 1O7LA 2BAGA 2P4UA 3T5PA 4BKRA 4D82A 3QVKA 2N0SA 4J94A 3T8YA 3T3HA 1S7OA 2O8XA 3E7DA 3OZAA 2ZJZA 2H08A 1YOVB 2CL0X 3MPOA 3NKFA 1K83J 3BD6A 2I2CA 3G5UA 5H70A 3HUGB 5FUMA 2PJDA 5JMTA 5L3QB 4AQ7A 4UM9D 1L4BA 3QX7A 1U7OA 1I1NA 2OTCA 2QYHA 2C3UA 3RCOA 1EUCB 2WPNA 4L6AA 3L8YA 2EFHB 1XYVA 1SCNE 4KDPA 2R7LA 5DWVA 1ZHOA 1ZDMA 3WNVA 1BWQA 5AFSA 5JSZA 2E6KA 1SURA 4YJHB 2DDAA 4P9UA 1NM5A 3Q0IA 2A61A 3KJXA 4KYWA 1YL5A 1OX4B 1E89A 1XBTA 3FWNA 3PYMA 2E2HJ 4N5DA 3W05A 4BMNA 3PUFA 4EHJA 1F36A 1T6XA 1W5CC 2R00C 3BS4A 4CM6A 5KYYB 2XCSB 2Y69H 4JN6B 1M72A 1MMFB 4Q4HB 5HHTA 1ODJA 3NAQA 4R4JA 1BTOA 2ZE8A 5EQJB 3RHSA 2R6AA 3TIXB 3WOVA 1KPGA 5E9WA 2LDBA 3NQOA 2BH9A 2ASVA 4P0TA 4XVHA 2VEDA 2Z3VA 3G88A 2W4SA 3WY9A 4ER7A 2OM6A 3ELYA 1TKRA 1DRUA 2AG6A 4CSWA 2O5VA 2P2GA 2P7IA 2VH1A 3AG5A 3AP2A 3Q1LA 4G01B 3RAFC 1V8FA 3L7JA 2F90A 2XVZA 3GEDA 4Q4AA 4LG3A 2QDKA 1MQ8B 2N1MA 1ADFA 3DEEA 1G9SA 5DCWA 3PFNA 4OLAA 1P44A 6ABPA 3UGJA 1QDUA 3V5NA 1TB4A 3RYFB 4CV3A 1LD3A 3RHZA 2XDQA 2LY1A 4BLRA 1UFMA 2H1OA 2EEZA 2IIBA 3N39C 4DG9A 1MMGA 3KSBC 5F1JA 2XIGA 2QNIA 3TSAA 2XKKA 1ISRA 1GKYA 1HE5A 3QMVA 3AEUB 4YR7A 5AXAA 2W43A 3UWOA 1VLLA 3DZJA 2WK1A 4UXIA 5ALWA 1JUMA 2YQZA 2JAPA 2WT9A 3OM1A 4RTPA 2RIRA 4Q1CA 5A04A 2O5CA 4E6PA 4ZTZB 3EZ9A 1T4BA 4B40A 4EL0A 1LTHR 2GNOA 3QM1A 1BEUB 3WTZA 5LBQA 1XN1A 2V7GA 3WV4A 4BXOB 2CUZA 5BSMA 1ETXA 3SJMA 2VUMJ 2P0YA 1AHIA 3SI7A 4TL8A 5P8WA 3CINA 3LLVA 2ZYAA 2Q3MA 5L3SB 1ESMA 2E4UA 3HUFA 4J0GA 1XV5A 5IH3A 2JGLA 3I4NJ 5IHXA 1PJ2A 3FCAA 4MQEA 4MW1A 1MGOA 4KMMA 2YJNA 4MWZA 4AKHA 1JNYA 3V8PA 3GJYA 4H0CA 2CXQA 2BSQA 1DIGA 5AVKA 3GJ5A 3S2GA 4EELA 1CKEA 1A72A 2WHXA 3VISA 3GFFA 1JGGA 2IOYA 5AVYA 1PUXA 1HLPA 2I80A 5BN3A 5IBQA 2VLAA 1W30A 2OBLA 3RS0A 2XAAA 1WETA 4Z53A 5EVCA 4ISCA 2GERA 3VV2A 3B6CA 1JPJA 3HUUA 3V8NA 4E2XA 5K6AA 2DMNA 1N5JA 3BZKA 4RLQA 2R6R1 4Q15A 4RW0A 4XASA 5CA1A 4X24A 1E96A 4C6RA 5EMNA 2Q4EA 1GT0C 1UPFA 1X7DA 2KHMA 3JARA 1OX6A 4YJGA 2FQ3A 2I4RA 1JPVA 4P82A 5JCZA 1YUNA 5LNK6 4D0PA 3C16C 3U4QA 2DTRA 5KJFA 1YF3A 3VC1A 4JYKA 1HI9A 3HYLA 2FDXA 4HUTA 3U13A 2DT7B 1PSWA 4Z9FA 4DILA 1M5UA 3A31A 4YTEA 4K86A 4Q9LA 3JD2A 1LFBA 3CRZA 4TUYB 4CPDA 3U44B 3BWEA 3CIOA 1XRPA 2VDWB 2RQPA 3GTPJ 1RXSA 2Z2XA 3NOOA 2LF7A 3W8FA 1T56A 3ZDQA 4BMOB 1ZMTA 3E84A 1ODTC 1TU4A 4QNNA 4WGFA 5H4HA 4DIDA 2JJMA 2ZDGA 3PD7A 4KACA 4WCFA 3CLRC 1HNNA 3AR2A 1GXPA 3KPHA 1VHTA 3WE3A 3IR6A 5THXA 4AK9A 3J81k 2PUAA 1ZC4A 5JCOA 2QUIA 3IP7A 4KXYA 3UXMA 4M1YA 4ZYAA 1KIFA 1DAEA 3IVAA 1SHUX 2LVSA 1D1AA 4D5FA 5L3EA 1OY1A 2QTTA 3H42B 3JAKB 4MGYR 1UMQA 3T9EA 5HA5A 1A2KC 1Y6JA 3TKLA 4B35A 3HWSA 3ZJYA 3H19A 2I1LA 2K9QA 1D0IA 1TF5A 2IT1A 4RX1A 5CDHA 1C3JA 1VOTA 4LHXA 1E61A 2QMZA 5L3CA 3EXHB 3A10A 1L7DA 4O2BA 2JLVA 1PWEA 2ZJ8A 2BVMA 4LTDA 5AW9A 4JI1B 3TIGA 5JAUA 5GPAA 1VZ0A 3W90A 3CVUA 2KLHA 2CB9A 2PWZA 3HB7A 3PFFA 4RK0A 4LRWA 1OXMA 3UIEA 3JQQA 1F6DA 5HKKD 4CKCA 5I3CA 3T5XA 4R16A 4AXBA 1VL1A 2ISQA 1E9BA 3L07A 4JLNA 1ZU5A 2DUNA 1UJ4A 5D5WB 4IHKA 3ZMTA 4UCFA 5CJJA 4CEIA 2X8WA 1GA4A 3WLRA 4QEKA 3CVVA 2MSYA 5M3FJ 2FRVA 2IZOA 4EG3A 1V26A 5I5EA 2W9XA 1Q7CA 4NBTA 1SY7A 2STTA 2ZSBA 5B3SH 3QELA 4G9BA 4KAXA 5LKAA 2B92A 3AFNA 1Q0PA 1YHZA 1YX3A 2CD7A 1I6HJ 2EKPA 2ODQA 2V4ZA 5KSWB 1GZDA 2JKVA 3KYIB 1TM7E 4CN8A 4QLAA 1LF5A 2W6CX 4PR3A 3M4NA 4CG3A 3DE0X 1JXSA 3MCZA 1C2TA 1O0SA 1R71A 1NBMD 1OR7A 2C5HA 5EXSA 5EUCA 3T4EA 3HSSA 3IP1A 4HSGA 1FY2A 2JSPA 3L02A 4ZI5A 4AJKA 1OWMA 3CW2A 2MIIA 5AVTA 3R0VA 4FCTA 4JVLA 1R5OA 2QG4A 5KVAA 1YAJA 2NSHA 3A4LA 3H8WA 4MV6A 1MA3A 2OBBA 3B9QA 1SOMA 2F3QA 3DKVA 3H6HA 4MW5A 3CDIA 3WQBA 2ZRDA 3CPJB 3J80Z 1RWKA 2HA4A 1ZJ6A 4P5OA 1PEAA 3CPHA 3E8SA 4G5HA 3VZQA 4ZYYA 1SM4A 4RJIA 4EGJA 5B2FA 2V6EA 4ZU6X 1YFLA 4WZ6A 3R5XA 1Y7IA 4UUVA 4FE4A 3PO3J 1U04A 2F17A 4M3EA 2VF5X 2X7XA 2WU1A 3KZKA 5DHAA 3ZU5A 4EYOA 1W4CA 2L18A 4EAQA 1KOGA 2ZQ5A 1NGSA 1ZGZA 4P58A 2AQEA 1LI7A 3Q87B 4IM7A 2FPPA 3IJ5A 4MKFA 3KKKA 4OG2A 4DM3A 3ONNA 1T9DA 3QIVA 3K0SA 3QODA 4WLEA 3ZDBA 2D1SA 3NNNA 1U1IA 4CTNA 3BMOB 1AV6A 1KIMA 2ATCA 3V3KA 1WDKA 3JQBA 4BP3A 3LVRE 1TLHB 4RGRA 2IEGA 4MB0A 4YYEA 4OQ4A 1DPGA 2PSJA 4XVCA 5CX4A 4HV4A 1R1DA 1JQLB 2OLJA 4LV5B 4A26A 2HJ9A 3V1TC 3HJEA 1HF3A 3LFUA 3KYCA 3V00A 5D7NA 5CXUA 1FLNA 5J6XA 2WINI 3RVPA 5JAPA 4ZK2A 3PEFA 5BQXA 2YXLA 4MQ5A 4EUKA 2EZHA 1QE0A 4IDAA 2YOFA 4KLCA 3LI2A 1YDMA 2VYND 3I52A 1RZRA 1RR8C 4Y2PA 3H0EA 2JIDA 1U8RA 3TKAA 5JV5A 3ZVRA 1QO7A 5GAEJ 1WCIA 3OOJA 4U39A 1CUZA 2WP0A 4LYGA 3MHTA 3PL8A 4MI6A 5DM0A 5TT1A 1R27A 4E3ZA 1R22A 3CJQB 1HL3A 1YKGA 2FCRA 3J7AO 2JLXA 3QPLA 1W8DA 4YCSA 4XLEA 4BNCA 1WVIA 2GILA 1RR7A 3EXG2 4BIIA 1FXSA 3VR3A 4ARZB 3FPCA 3VO8A 5EE3A 4DEYA 4HWTA 2X9LA 1JHMA 2JFXA 2QTGA 5TIIA 1D9XA 2FW9A 4I14A 4M3BA 3GARA 4JUCA 4CRWB 4MLZA 4YRIA 5JI6A 1KEZA 3CUYA 4RDCA 1C2YA 5EKXA 2XQFA 3VWBA 5HUQA 4A3DJ 1XZCA 1SCUA 3LO8A 4W5WA 2XOKD 4HX8A 1EI9A 1HFWA 2HPHA 1GQ2A 2WMDA 4LXIA 3ZHVA 1VE6A 3BMCA 1XTAA 3EDQA 2F4MB 3GU3A 3QVOA 1DOAA 3G7NA 3NIGB 1S7AA 2MBFA 1VC2A 2RAPA 4MVJM 3L79A 3C8DA 4PYIA 4WEQA 3FFBA 3I4CA 3TTVA 1ICEA 2DLNA 4IDNA 4X6LA 4BWYA 2V5VA 3TDKA 4UHKA 4GOKA 2CJJA 4K6OA 1NIPA 1XMXA 1CG6A 1VP9A 2XYVA 4RXMA 5HYVA 2VP5A 2IXBA 5EJ8A 2DU9A 2CXOA 2ZIGA 1QWSA 2MT9A 1N5LA 3V4OA 1UC5B 2NZVG 2YZ7A 4FMDB 3COJA 1CUCA 2J45A 1R4NA 1B4DA 3KVNA 3J7AY 4BEHA 5ELMA 5AIQA 2CNWD 5G41A 2EG5A 2B8NA 4YJFA 3QWBA 1BGWA 5K2MA 5H68A 3C4QA 3UG6A 2HVSA 4KMRA 5G0VA 3SS7X 1K4MA 1U0GA 3INRA 1X94A 2FEMA 1WB9A 2R0QC 1K6OA 2YJ3A 3ROQA 5KYTA 1G5PA 3WWOA 2F8MA 2FA9A 3J81K 3VR6D 1CE8B 3CDLA 1JQBA 1XALA 2ODNA 3VTZA 3ZE6A 3PF9A 1KEUA 1VMAA 2FSSA 1KDOA 2G1KA 3UMCA 1RXWA 2QVCA 3B1FA 4G67A 1ETWA 3JRAA 3LWZA 5T6MA 2D00A 2I2WA 2W83A 4Y2JA 2YMPA 4GVLA 4AKTA 3V48A 2FUG1 2NXWA 5CBKA 2O7OA 1KEPA 3ZD6A 4MW9A 4JBWA 2IIPA 3MAJA 2M6LA 1XZFA 2OGTA 1U7XA 3RRBA 4PCQA 3H5OA 1C81A 4X85A 4XVRA 3QYPA 3VHQA 4D44A 4ZREA 1YBMA 2F1HA 3DLIA 1V54H 1WH5A 3P5SA 5GY7A 3VH2A 2XT0A 1HSZA 2EBUA 3C3AA 3M9AA 5F64A 4PBTA 3M5CA 2OYCA 4AUXA 2HDNB 3D9QX 3FZNA 4KZPA 2VOOA 2QTAA 4AS1A 4A0RA 4KUHA 4ITUA 3BFVA 3HBNA 2QNBA 3HKEB 4G1BA 1BXRA 1WS6A 4CUKA 3HMKA 2HOAA 2JNWA 2ZRGA 4A8TA 4OXXA 3HTUA 3E3LA 3HA7A 1ATZA 2J85A 4N5LA 4OK6A 4E51A 4Z1MD 2WQ6A 2HIMA 2VTVA 1RNLA 1YKFA 5KPDA 1KMCA 4RPIA 2IZ1A 2YQ4A 1PV4A 3IJRA 1XPUA 3NGLA 2BIFA 2A0KA 2LPMA 3SBEA 1APLC 2NYVA 4F96A 4HSTA 3UAZA 2II6A 4U7HA 2PMZN 1TZCA 3ESAA 3MOGA 2FG7C 4RQUA 1U3FA 5E20A 3X0DA 1T1GA 5DCLA 2OZEA 1IWBB 3UJPA 2SHKA 3EQZA 1OMIA 4TL9A 4JJFA 4B3CA 1E20A 4O2AA 1KU6A 1N5MA 2VRCA 1OCEA 4QYMA 3ICWA 4J2HA 1HKSA 3RADC 4QUKA 3STUA 1GUAA 2O9JA 4KCGA 2X6WA 2IA0A 1N0WA 5B3JA 3THXB 4R8RA 3G2HA 1EGHA 4TX1A 3KE2A 4AAYA 2HDWA 1A04A 4RBOA 2ODWA 1PWZA 1T8TA 4FPXA 2UXDB 2NV2B 3CH6A 5GTIC 4JXXA 2D2WA 1CPYA 1P5ZB 2VNJA 3B6JA 3FZQA 3JW8A 2KMUA 1W1UA 1GL6A 5INTA 1YCFA 2XUBA 1X42A 4IKPA 1XDDA 5D01A 4JLAA 4PIPA 1MNQA 4KQWA 4JWTA 4R84A 4WK2B 3JAMZ 2QSGX 2Q8KA 2VYVD 1A4XA 3DFMA 1DIRA 1WQ1R 2WYIA 4MW2A 2ZW9A 4MKXA 1QOQB 4XB1A 4IHYA 4P96A 2BKVA 3NWBA 4RGQA 4K6HA 4DDTA 4F4HA 2JBAB 2DFFA 3EAGA 2O57A 3DFFA 4XN0A 4IX1A 4IL6C 3NTVA 5A0TA 1YZQA 3EJ6A 5DW3A 5CKTA 1XWWA 2ZWMA 1CEQA 3JRGA 4QTRA 1A98A 3E9MA 1DAMA 2Z09A 1ISSA 5T6BA 2GBYA 4D0GA 1G8YA 5IJ0B 1XZPA 1YR6A 3C6KA 2JJ2A 4PFOA 1FNMA 1OJLA 4PVCA 3I01A 1J06A 5BN4B 2P6NA 5AOCA 1L5SA 2ESHA 2ESNA 2QK4A 2HNBA 3CVOA 3P2JA 4HGNA 4QM6A 4GDMA 4RZHA 1ZK0A 2FJPA 4L8LA 3VMFA 1PGPA 4KLZA 3L93A 3KT0A 4UCWA 3ZEAA 2ZSIB 2C78A 3IVCA 4IUCS 4MWGA 5DI3A 1C7ZA 3LHFA 4UULA 4LDAA 3O4GA 4JXKA 2CDAA 1K86A 3K0AB 3BYZA 2OZ6A 2JGNA 1J9IA 3ACCA 3WDMA 3KSUA 4CKWB 2ID4A 5CA0F 1OT3A 4B6RA 1BI3A 5FBQB 5J58A 2W2LA 2VC1A 2EW1A 1CUEA 1IBRA 1IUNA 1GNVA 1JIXA 4K9RA 3UQYS 3WZMA 4N41A 4HG2A 2JH8A 2D1QA 2OC9A 3L2RA 1LNZA 1MPXA 4LYDA 2DK5A 3PC7A 2WHQA 2O1SA 5AVJA 3ROKA 1M2NA 2CWWA 4I1VA 4MIMA 5SZHB 4CIVA 2C7OA 1XC5A 1BX0A 1YW8A 3QP6A 3BJRA 3OU6A 2Y1XA 2Q3JA 1VG0B 2FPXA 4MYCA 4EW6A 2D5LA 2J7PD 4C3ZA 1GLNA 3AU9A 1PP8F 4IFEA 1POXA 4MAAA 5EA2A 4HQMA 4PS0A 4ZMBA 1U0HC 3IBSA 5BORA 5TSDA 4UUPA 4QXRA 3F4BA 1SAUA 3GDFA 3OLQA 1RJ9A 1C0WA 1UBRS 3ICVA 4R79A 5DKFA 3TYXA 2HH9A 1NI5A 5BN4A 2CXHA 2VZ9A 2EKZA 3M3HA 5KOIA 5IM4A 3ILXA 2EGHA 2Q3BA 4B34A 3L8HA 5FOUA 3A3KA 3OYFA 2FFBA 1VKJA 1XD2B 2GEJA 1ATIA 2J8ZA 4Q3NA 4ZVQA 1XSDA 3EUHC 1ST2A 4J7UA 4LOCA 1L5OA 1LZKA 3KZIC 2WF7A 3R74A 2NTVA 3KS9A 4JIMA 1WPQA 2ZUUA 4CHTA 2WE8A 4HPQA 2GCPA 5K7HA 4OOIA 1OI7A 1BL0A 1NLMA 4HN2A 1IDOA 1QZTA 4X1EA 1TO1E 3TLCA 1JQ3A 2ERYA 4F3KA 1UKVY 3EW7A 2W2PA 5EHXA 3HXLA 3FDZB 3H1AA 3ZN0A 1M7BA 4PGFA 3W3AH 3SFZA 5LR6A 5THKA 2CQQA 2GA8A 2R4TA 3QE4A 5I8WA 4BY1J 4BFYA 3SJUA 2H7VA 3MD0A 4RAQA 2FGJA 3ZOKA 1IXCA 4Z9AA 4PZDA 5TQVA 3WMFA 2BBSA 4DCTA 1JH9A 1QYXA 3WTUC 1I4DD 3ED5A 4QTTB 4M72A 3NYQA 3N7AA 4XIGS 3VJLA 4YRLA 1H4VB 1ZK8A 2NZUG 1J0XO 4GWLA 4RD1A 4BBSJ 3RVKA 2VK1A 3W5BA 4UHJA 2X5JO 1PR2A 4EYKA 4QATA 4D4MA 4EM2A 4QBTA 3WK7A 4YV7A 2VPIA 3FIWA 1WH7A 1W4BA 4UNSA 4M74A 1OI3A 1YVRA 1V3TA 3KT8A 4EDHA 4ZGWA 4REQA 2ENUA 5BR7A 5HJ2A 2HCFA 2G88A 1U8EA 3U61B 2J0UB 1YQDA 8ADHA 1ENZA 2GH1A 3KUUA 1DPRA 2PWBA 4MRAA 3UA3A 3I59B 1XX5A 2LMDA 1UFQA 1KDRA 3DOHA 1JB9A 3T7JA 3LC1O 4NAUA 4BRSA 2BLLA 1W4LA 2HSJA 3NRVA 3I3SR 3GZ6A 2YASA 4L9AA 4NLLA 4RSHA 4F6RA 4LV8B 5CBPB 1Z0KA 3F74A 5E6UB 4ZARA 1BRMA 1YB4A 2X8BA 4RVUA 3GDGA 2I7DA 2L7FP 3KWMA 3Q6MA 3HOUJ 1GCUA 1G1AA 1KZ9A 2CCGA 3GLIE 3B1JA 4MW4A 4BMVA 2ZJ2A 1TC2A 2XZOA 2R7MA 4NBQA 3EVGA 3R09A 1DKQA 3KKQA 4KHPB 4I6GA 2ZJRF 1M54A 2IU3A 2LIPA 3DGFC 4JP2A 4QUHA 2BFOA 3CG0A 2JGRA 4OQQA 3IPLA 1GGHA 1YFKA 2EJUA 4UUAA 3DZBA 3LSKA 1P17A 4EGAA 3KD3A 4FSDA 3N2ZB 4JJ6A 1Z45A 2IE8A 3W3AA 5AW4A 2XYPA 2YUTA 2V7FA 3FVTA 3CG4A 3L6OO 3LLUA 4KN9S 4Q4HA 4RTKA 1H2YA 4FYPA 4ACBA 1PIWA 2G7UA 2W2KB 4JQSA 4LRXA 1N3LA 4BO1A 2DI3A 4PAGA 2E5ZA 4UTOA 5J8FA 4HZIA 1GPJA 1U8XX 2XR1A 4TYNA 2HIHA 4RJLA 4ALKA 5K0EA 3ZHSA 3OOYA 1XKQA 3FMQA 4GLLA 2FSHA 1ILEA 2IY7A 3IR5A 3F8TA 2E7WA 1KVQA 4ZVOA 2ZRPA 4E2YA 1X7HA 3GB9A 5HWSA 1V7PC 1CULC 1H93A 1V3FA 3CCRI 5CLQA 3ZGKA 1ZMBA 3FHLA 5AI5A 1W5TA 4L18B 2FX2A 2FWRA 1UBHS 1YGYA 3KCNA 3KJFA 4MHSA 2XBLA 3O9VA 1RWNA 2C5LA 3MW8A 2OV4A 2I1WA 2HRRA 1YD7A 4GQAA 3L06A 4TTIA 5EIOA 4EUNA 4GYWA 2P90A 5EHGA 2HZBA 4B76A 4P5PA 3D6AA 4EJOA 1RTKA 1BJRE 1CP3A 1WHSA 2DVMA 3LSPA 2VT7A 2AL7A 2PZ8A 3EZ2A 4TV9F 13PKA 1YO5C 3RKXA 4LKOA 2X86A 4JUAA 3OYDA 3IUPA 3LSHA 1VBMA 3M8KA 4MVJA 2FETA 2CSXA 2FLWA 5B7PA 1ZGBA 5HE8A 3HYTA 5M5BA 2WG0A 4LE1A 4NFSA 1EX6A 3F3YA 3N6VA 2XDQB 4HYEA 1INLA 1JA1A 1OTXA 1FEZA 3FXUA 2RJOA 1PL8A 2XB6A 1Q92A 3NM5A 4CUGA 5AR1A 3K0CC 3HP1A 1TADA 1L4FA 2EJTA 4EAAA 4KBGA 5C1OA 1TQPA 1VNDA 3IDZA 2X5NA 4NQZA 3L0PA 4Q1AA 4MS1A 1RWQA 1QCZA 2IHUA 2XCTB 2PZAA 5ALTA 1KKMA 4UE2A 1MC4A 2R1ZA 3O3NB 2AJ8A 4FD3A 4ZVKA 4LSGA 3PFBA 1JQJC 2H5JA 1BE1A 4ZZIA 4CIYA 3PS9A 3QP5A 1A35A 1B59A 1XA4A 3EMVA 1O3RA 1L1RA 3BRQA 2ZREA 4MRMA 5F1OA 3SXUA 3E7WA 4FOLA 1U8CB 2HYDA 4BQOA 1MBZA 1P81A 1QK4A 2QL5A 2ZQYA 5B66C 1X7YA 5DP1A 5GZ6A 1R15A 1DBRA 2H1WA 3UJHA 3QH4A 4PPNA 3Q3CA 4R2XA 1GQRA 3PEWA 2JLZA 3K6KA 1P4HA 3UYLA 2HJGA 1QGYA 1KJIA 1U9JA 2VUTA 4A92A 2UKDA 3KU1A 3G8CA 3IP5A 2B7CA 1HBXG 2Z9DA 1L4KA 5HFJA 5D6EA 3AFMA 3D6NB 5CU7A 1YZKA 4OM8A 4U2GA 3S5UA 2J5OA 2O07A 3L9WA 2FPKA 3F8NA 4HV5A 2QVBA 2RG1A 2BGWA 3NHAA 1HG0A 2ODBA 3FGNA 4B4KA 1JLMA 5EP4A 1LLFA 4R8KA 4KZKA 4WKOA 3TGLA 1E0DA 1UBTS 2CJWA 1CIVA 3MTBA 4JGGA 3KCCA 5KSPA 1UELB 1Z6TA 3DU5A 2QBYA 3BGOS 2SKCA 2VQEB 3RVOA 4DCJA 3H9GA 5P21A 4A3MJ 4L1KA 5A2GA 5LXTA 2P9YA 2XVMA 3UHOA 1GNSA 4ZO4A 2QKMB 2BGIA 3GLSA 2NVBA 4V0RA 2K3PA 2P40A 3SOZA 2HU7A 3LWDA 2MR6A 1WGXA 3HY3A 3T35A 1N0IA 1VMEA 1Z5VA 1GYQA 2E2IJ 1N0UA 4LK3A 1NR1A 4RIEA 1DC4A 3A7DA 3QVWA 5HBRA 4PSAA 3R7SA 1DCKA 4DG5A 5DUKA 2QTCA 4HDUA 2NW6A 4KA4A 4E7LA 5K4HA 2UXCB 4U6SA 3NOXA 1RWOA 2Z33A 5BWCA 2XF5A 3N6RA 1R4MB 2GPAA 2AQHA 1ZH6A 2WUEA 3ICPA 1YZGA 2IYQA 4BFUA 1QF7A 3LVQE 1P7IA 2P3LA 4BEWA 3WHBA 3S14J 1U4OA 4W4TA 1X1QA 3CLUC 1AO3A 1Z4IA 3WJ7A 1RJDA 4HX5A 4BO4A 3LDUA 1NE2A 4P4LA 3I56I 4Q4JA 3GFVA 5WRFA 1I50J 3PFGA 3TTSA 1DO2A 4XDZA 4GU5A 3DZDA 1AGPA 1YFJA 3FOWA 2VDRB 1E9FA 2Q3FA 4WXMA 4NYIQ 2QZ8A 1L6IA 2GFHA 4G86A 5K7FA 1JDUA 3C1AA 4IFIA 4CL2A 3NXSA 1AQYA 2AN3A 3CNHA 3KB8A 3BDVA 1NBME 1YI2I 1OZAA 3OL4A 2OEPA 2B8JA 1QONA 1HMYA 3GUUA 3M34A 4FP9A 2CMGA 1XTBA 3KDAA 3IPCA 2R5NA 3I8OA 5DHTA 3TDNA 5TJJA 4AFNA 1Y8QA 4H7KA 4Y0VA 2YFYA 1ZSVA 4C6TB 3L6RA 3R6SA 1QHFA 3RARA 4JI3B 3W7AA 5FR1A 5CFPA 1YHNA 3GNLA 5EINA 1YJ5A 4MWOA 1SXJB 4KQCA 1K7YA 4MV1A 1Z6YA 4OP1A 3SXJA 5C3MA 2J9RA 2M5WA 1TJPB 3OY9A 4JD5A 3A0HC 2QR5A 3FGZA 1E5DA 1QVRA 2ZG6A 3F7NA 1QH8B 1SZPA 4I0WB 1N2XA 1FDSA 1QH1B 2XVAA 3AX6A 3WRXC 4F5ZA 4QFDA 1HLDA 4PZ9A 3FOZA 4TTTS 3I9KA 2DERA 4WAUA 5D85A 1O03A 2CLOB 3BE5A 3LZ6A 4A8HA 3VKHA 2FY8A 2FNAA 1ZNWA 3IPRA 3INYA 1SVMA 1P5RA 1FSSA 3IE2A 1BVRA 2VJKA 3I5UA 3CCVI 3E0QA 3GFQA 3S8PA 3LQRA 2QP4A 1QP4A 2RHGB 2PD3A 3JASB 3N6XA 2AOVA 3NTUA 5G0SA 3SGLA 4Z4CA 1A2OA 5AVZA 1X38A 4BFWA 5J2UA 5A2QA 1P9OA 4HLNA 3FCYA 2BW3A 2H5EA 3PNLA 2GZSA 1GJRA 1HL7A 1SKBA 3TW4A 1K6JA 4I55B 4UB8C 4PX3A 4L3WA 2IYLD 3ZDXB 2BFCB 3B85A 3JSXA 3ZIAD 1L1EA 1SVIA 2WIBA 5EYPA 3DU6A 2Z4SA 2QW0X 4RVGA 1NQUA 3TLGB 4ZCRA 1O7JA 1UP7A 3K1TA 3KPWA 4DNCA 3R5HA 3GLXA 2C7GA 2IEZA 2B34A 2O14A 3P9QA 4GPBA 3D4IA 2I2AA 1TQ2A 2BMAA 2C95A 4ZRDA 3ZVMA 1W7PA 1S7CA 2ATIA 2NIPA 1FWZA 2ZXIA 3GUZA 2X9QA 2HOSA 2B6HA 4ZHQF 1UAGA 1MIOA 1RHJA 4UDXX 2MGQA 3AY6A 4J0EA 4BV9A 1RYHA 4DT1A 5JXJA 4MX8A 1Z4KA 2NO1A 3NFYA 3QUAA 4CN9A 2XGMA 4DLBA 1LJ9A 4BU1A 3G1LA 1NVFA 1PNRA 1FPMA 3CUEF 3GT4A 3WJ1A 1I2MA 2J5XA 2AN4A 2YN2A 5F78A 2RGRA 3GEZA 2E85A 3I83A 3RW9A 2DHQA 4ZHQA 4EQ6B 3DWLE 3OQIA 1N1MA 4TMZA 1DP7P 1LW7A 2QENA 4B82A 1GVNB 1L4EA 4JI8B 1BJAA 3W6NA 3K2BA 4NDNE 4JP1A 3ESWB 1DX4A 4EYSA 1X3UA 3IURA 2HKIA 1SAYA 2G67A 2GPTA 5IP7J 1SU7A 3G7UA 4FFPA 4OYLA 2OFPA 4RABA 3ND9A 4MVJE 4EH1A 4QUJA 5JHHB 1NF8A 1D0SA 1J33A 4B3TB 3V1YA 4NBRA 1ZAKA 3FOBA 5A3RA 3C7JA 1F0YA 2PXXA 4WA7A 1X1EA 3NWJA 3HJCA 4NX2A 5AVVA 4A36A 3D1JA 3KEYA 4GP6A 1P7JA 1EWRA 4DJEC 1P4JA 3TB6A 3ZIAA 3HY6A 3CUQC 1WSDA 2A6EF 1G17A 1IO2A 3LA6A 4A0QA 4DLNA 2FV8A 1RYZA 1Q2UA 2QRJA 4ILEA 2HEGA 1P9RA 2RDMA 4L9JA 1W49A 4G63A 5DV9A 3VVCA 3ZQUA 3ZI4A 2Y75A 1FRFS 4P53A 4HNVA 1G6Q1 2L0XA 2I10A 3QXGA 2NNNA 3DV0A 1K7EB 4AO7A 1DRVA 4CL3A 3KNZA 3OUZA 3T7IA 3UOWA 2VL7A 3FWKA 3ZMZA 4TM7A 1GDHA 4DM7A 2CN1A 3B82A 1GUDA 1B42A 1GPYA 3LZCA 1DAPA 3WRYC 2AS0A 4FVTA 1P62B 4O1HA 1SHZA 3MF4A 3PT5A 4RJJA 1YJ9I 1WF3A 3CX8A 3LOQA 3IUNA 3V2GA 4DMRA 4ZOQI 1MB0A 3UV7A 4OMCA 4LG1A 4R1MA 1R3UA 3CNEA 2P1ZA 2FMXA 5ALHA 3O03A 5GWXA 3HDTA 3FBWA 2HY7A 3L8ZA 4DMGA 2NYXA 2IX9A 4LYEA 4EJFA 2ZIVB 2NO4A 4LX0A 2R4QA 4PQGA 5L7WA 4ZCIA 4WOPA 2ZSJA 1R0WA 4AZTA 2NNLD 3UJ6A 2KT0A 2FEWB 5FB3A 5FUBA 5BXYA 1M1ZA 4Q9NA 3O4JA 1TYBE 1U9IA 5FTWA 4RVNA 3KZNA 3ZIDA 4MKIA 4UEJA 4MV3A 2CZCA