3H9RB

Crystal structure of the kinase domain of type i activin receptor (acvr1) in complex with fkbp12 and dorsomorphin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Bone Morphogenetic Protein Receptor ALK2 and Implications for Fibrodysplasia Ossificans Progressiva.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/protein kinase
molecule keywords Activin receptor type-1
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3h9rB00
4IQ2A 3CGMA 4ODNA 5D75A 1U79A 4ODRA 1PBKA 3O5FA 4TW6A 2FKEA 4JFIA 3KAIA 1BKFA 2ZQSA 5J6EA 1FKJA 2PBCA 2KGJA 3KABA 4DH0A 2RURA 2M08A 1D7JA 3KAHA 3O5EA 4DRHA 1FKSA 4IPXA 4W9OA 2ZQTA 3O5OA 4ODOA 2MPHA 3MDYB 4DT4A 1FKHA 2DG3A 4R0XA 3UF8A 4LAWA 1W26A 3NTPA 2ZQVA 5GPGA 4BF8A 1TCOC 1JVWA 4G50A 3TCZA 5HWBA 4GIVA 1J4RA 2DG4A 1Y0OA 1B6CA 3O5JA 2VN1A 4JFJA 4TW8A 1PINA 2LPVA 3I6CA 4JFKA 4DRPA 2D9FA 3CGNA 4DZ2A 2KFWA 3O5IA 3PRDA 2DG9A 2KI3A 3TDBA 2ZR5A 5HTGA 5HUAA 2MF9A 2LJ4A 3O5PA 3O5RA 3UI4A 3KCEA 3IK8A 5HW7A 2KO7A 1NSGA 2VCDA 1KT0A 4DRQA 4N19A 4QIBA 1FKGA 3O5KA 4MSPA 1C9HA 2JZVA 5DIVA 3KACA 3PA7A 1NMWA 4U86A 3UQIA 1M5YA 3O5GA 1Q6HA 1A7XA 5HT1A 4QT2A 1J6YA 1FJDA 4W9PA 2FAPA 3B7XA 1FD9A 5HW8A 1P5QA 3TC5A 1FKFA 2KR7A 4TNSA 1NMVA 1QPFA 1YATA 2PPNA 3O5MA 2XP7A 3WH0A 2XP9A 1YW5A 4J4OA 4DRIA 1F40A 2RSEA 2PPPA 2XP4A 2UZ5A 3O5LA 2LKNA 3IKDA 3RFWA 2IF4A 4NNRA 2M1IA 2OFNA 1R9HA 1JNSA 1FKLA 3PRBA 2XPAA 2K8IA 3UI5A 4FN2A 4G2PA 1D6OA 4TYOA 5HWCA 3UQBA 4U84A 2RUQA 1J4HA 3ODKA 5DIUA 3VAWA 5HKGA 1EYMA 4DZ3A 4GGQA 1FKIA 2ZR4A 1J4IA 3JYJA 2MLXA 3GPKA 4ODKA 2ZR6A 1ZCNA 3JXVA 2MLZA 5DITA 2ITKA 4IQCA 2AWGA 2ZQUA 1Q1CA 2M2AA 2PV1A 4LAVA 4ODLA 3FAPA 1FKKA 1JNTA 2Y78A 4ODQA 1FKBA 4ODMA 1D7IA 4DRJA 2PV3A 1KT1A 2MLYA 3O5DA 3KAGA 5HW6A 4J4NA 4W9QA 1N1AA 4ITZA 2F2DA 2PPOA 1FKRA 1Q6IA 2RQSA 4MGVA 4DRNA 3JYMA 3UQAA 1FAPA 2N87A 3H9RB 3RGCA 1Q6UA 4DIPA 1T11A 4C02B 3IHZA 2XP8A 3NI6A 4O2TA 5BXJA 3EY6A 4QT3A 1ZK6A 4TX0A 3IKGA 2L2SA 2XP5A 2KE0A 2XP3A 3OOBA 4DRMA 1F8AB 1FKTA 2LGOA 2MNTA 4U85A 4TW7A 2F21A 2PV2A 1D7HA 4JFMA 1L1PA 1FKDA 3KADA 2RUDA 4JYSA 1BL4A 4LAYA 1ROUA 4FAPA 4JFLA 2F4EA 1HXVA 2RUCA 3KZ7A 5I98A 2Q5AA 3NRKA 4DRKA 5B8IC 3KAFA 1QPLA 4DROA 1ROTA 4ODPA 3UI6A 4LAXA 2XPBA 3LUOA 1EQ3A 3O5QA 1QZ2A 2XP6A
chains in the Genus database with same CATH superfamily
4IQ2A 3CGMA 5D75A 3CHCA 4ODRA 4MNMA 5J6EA 2KGJA 4DH0A 1W9UA 2DT2A 1ZU8A 2EULA 4W9OA 3WL1A 2MPHA 3MDYB 1FKHA 3UF8A 4QZVB 1GOIA 1E6NA 4G50A 2DT0A 5DF0A 1HKMA 2VN1A 1HJVA 2G8ZA 2D9FA 3RMEA 2A3BA 3UI4A 2VCDA 4IT6A 4N19A 4QIBA 1E6RA 3AS1A 3O5KA 2JZVA 5DIVA 1H0GA 1NMWA 3WD0A 1ZL1A 4W9PA 3WD4A 5HW8A 1P5QA 1NWUA 3TC5A 1FKFA 1NMVA 3O5MA 2XP7A 4DRIA 5HBFA 2UZ5A 3O5LA 4UDMA 5DO2A 4NNRA 1OGGA 3PRBA 2K8IA 2PI6A 1D6OA 4TYOA 3WD3A 2RUQA 3VAWA 2YBTA 2P4VA 3CHDA 4GGQA 1ZBWA 4ODKA 1HKIA 1ZCNA 3JXVA 1Q1CA 5GQBA 3WKZA 4ODQA 1FKBA 1KT1A 2MLYA 5HW6A 3WQWA 4W9QA 4ITZA 4DWSB 1Q6IA 3H9RB 4C02B 2XP8A 1W1VA 2DSVA 4QT3A 4TX0A 3IKGA 2KE0A 2XP3A 4TW7A 2PV2A 2DPEA 3AROA 1LG2A 4LAYA 4FAPA 2DSWA 1ROUA 2QF8A 2B5UB 4XAKA 3WL0A 3KZ7A 3CZ8A 1QPLA 2O92A 1QZ2A 3O5QA 4ODNA 1JNEA 4S3JA 4HBEA 3B9AA 2YBUA 2ZQSA 3OA5A 4MPKA 1TFVA 3B9DA 3KAHA 4DRHA 1NH6A 1OWQA 3O5OA 2FDMA 1UR9A 3NTPA 5DEZA 2ZQVA 5GPGA 3TCZA 3WD2A 3O5JA 3I6CA 4JFKA 4MAVA 3ALFA 2KFWA 3TDBA 5HTGA 2MF9A 2LJ4A 3KCEA 3QOKA 5HW7A 4NSBA 1KT0A 2O9OA 3KACA 3UQIA 4U86A 3O5GA 1LJYA 1A7XA 1Q6HA 5HT1A 4QT2A 1J6YA 3EIPA 2FAPA 1VF8A 4W5UA 1NWSA 4Z2IA 1SR0A 1D2KA 2KR7A 2DSZA 3RM8A 4NZCA 3ARRA 4L72B 3RFWA 2M1IA 2OFNA 1R9HA 1JNSA 4WJXA 3FXYA 3CHEA 1HJWA 4G2PA 4URIA 2G41A 5HKGA 1O6IA 1EYMA 1HKJA 1J4IA 3JYJA 1E6PA 2MLXA 3ARPA 2MLZA 4IQCA 4LAVA 2ZQUA 3CH9A 2M2AA 3ARQA 1JCHB 4ZPVR 1FKKA 1LG1A 4ODMA 4DRJA 2B31A 2PV3A 3ARTA 4P8UA 4P8VA 3O5DA 3G6MA 3KAGA 1W1YA 1XRVA 2F2DA 2PPOA 3B8SA 3RM4A 4MGVA 4DRNA 3JYMA 2WLZA 3RGCA 3G6LA 1EDQA 1EHNA 1T11A 4DWSC 5BXJA 3NI6A 3EY6A 1ZK6A 1X6LA 2XP5A 4DRMA 4WKFA 2LGOA 3ARUA 1D7HA 1ZB5A 3RM9A 3ARVA 4WIWA 4ZPWR 2F4EA 2DSUA 3NRKA 4Q7NA 4DRKA 5B8IC 4ODPA 4Z2HA 4LAXA 1NWRA 1FFRA 1U79A 3O5FA 2FKEA 4ML4A 3AS3A 2RURA 1W1PA 1FKSA 2ZQTA 4ODOA 4DT4A 4WKAA 1J4RA 1KFWA 1B6CA 4JFJA 2LPVA 1E9LA 3CGNA 4AY1A 3O5IA 3PRDA 4DZ2A 2DG9A 2KI3A 4KQZA 2ZR5A 3O5PA 1SYTA 4KR0B 2KO7A 1FKGA 4MSPA 1X6NA 1C9HA 3FY1A 3PA7A 1M5YA 1FJDA 4Z2LA 1FD9A 1H0IA 3PRAA 2PPNA 3WH0A 2XP9A 4J4OA 2PPPA 2XP4A 4MNKA 5GPRA 3WQVA 4Z2GA 3IKDA 3BXWA 2PN0A 4P8WA 1FKLA 2XPAA 4HBOA 4WK9A 3UI5A 3ODKA 1FKIA 1ZBCA 5DITA 2ZR6A 2AWGA 4ODLA 2PV1A 1W9VA 1JNTA 2Y78A 4HARA 4ZPTR 1D7IA 4P8XA 4PTMA 1FKRA 2RQSA 1HJXA 2N87A 1XHGA 1Q6UA 4DIPA 4MNLA 3WD1A 2A3AA 1UR8A 2A3EA 2L2SA 3OOBA 1IX5A 1F8AB 1FKTA 1FFQA 3CHFA 4JFMA 4MTVA 1FKDA 3ALGA 3KADA 4Q22A 4ZS6A 1HXVA 1E6ZA 2DT1A 3ARYA 2Q5AA 3AS0A 2WM0A 3KAFA 1CTNA 4DROA 2XPBA 2XP6A 3BMBA 1OGBA 4TW6A 1PBKA 4JFIA 3ARWA 1BKFA 3KAIA 3AS2A 1FKJA 2PBCA 3KABA 1GRJA 2M08A 1HKKA 1D7JA 3O5EA 1EIBA 1GUVA 1E15A 4IPXA 1ZBVA 4IT4A 2DG3A 4R0XA 4LAWA 1W26A 4BF8A 1TCOC 1JVWA 5HWBA 4GIVA 2AOSA 2DG4A 1Y0OA 3AQUA 2IUZA 4R5EA 4TW8A 4DWSD 1PINA 4DRPA 1WNOA 3GTYX 3PR9A 4DWSA 5HUAA 3O5RA 2DT3A 3IK8A 1NSGA 4DRQA 2ETNA 1LL4A 4MNJA 4WKHA 4Z2JA 3B7XA 1LQ0A 4TNSA 3W4RA 1QPFA 1YATA 3B9EA 2A3CA 1YW5A 2WLYA 2WK2A 1F40A 1W9PA 2RSEA 1K9TA 4LGXA 2LKNA 1RD6A 1W1TA 1E44A 2IF4A 4FN2A 2ESCA 5HWCA 3UQBA 3WIJA 4U84A 1J4HA 5DIUA 3GU0A 4DZ3A 2ZR4A 3GPKA 1WB0A 2ITKA 4L3NA 1ITXA 3FAPA 1NWTA 2F23A 4J4NA 1N1AA 1LL6A 3UQAA 1FAPA 1JNDA 5JH8A 3ARSA 1LL7A 2OLHA 3IHZA 4O2TA 4S3KA 2MNTA 4U85A 2F21A 1WAWA 1ZBKA 1L1PA 2RUDA 4JYSA 1BL4A 4JFLA 4Z2KA 2RUCA 5I98A 3ARZA 3ARXA 1GPFA 1ROTA 3UI6A 3LUOA 1EQ3A
chains in the Genus database with same CATH topology
4IQ2A 3CGMA 5D75A 3CHCA 4ODRA 4MNMA 5J6EA 2KGJA 4DH0A 1W9UA 2DT2A 1ZU8A 4W9OA 3WL1A 2MPHA 3MDYB 1FKHA 3UF8A 4QZVB 1GOIA 1E6NA 4G50A 2DT0A 5DF0A 1HKMA 2VN1A 1HJVA 2G8ZA 2D9FA 3RMEA 2A3BA 3UI4A 2VCDA 4IT6A 4N19A 4QIBA 1E6RA 3AS1A 3O5KA 2JZVA 5DIVA 1H0GA 1NMWA 3WD0A 1ZL1A 4W9PA 3WD4A 5HW8A 1P5QA 1NWUA 3TC5A 1FKFA 1NMVA 3O5MA 2XP7A 4DRIA 5HBFA 2UZ5A 3O5LA 5DO2A 4NNRA 1OGGA 3PRBA 2K8IA 2PI6A 1D6OA 4TYOA 3WD3A 2RUQA 3VAWA 2YBTA 3CHDA 4GGQA 1ZBWA 4ODKA 1HKIA 1ZCNA 3JXVA 1Q1CA 5GQBA 3WKZA 4ODQA 1FKBA 1KT1A 2MLYA 5HW6A 3WQWA 4W9QA 4ITZA 4DWSB 1Q6IA 3H9RB 4C02B 2XP8A 1W1VA 2DSVA 4QT3A 4TX0A 3IKGA 2KE0A 2XP3A 4TW7A 2PV2A 2DPEA 3AROA 1LG2A 4LAYA 4FAPA 2DSWA 1ROUA 2QF8A 4XAKA 3WL0A 3KZ7A 3CZ8A 1QPLA 2O92A 1QZ2A 3O5QA 4ODNA 1JNEA 4S3JA 4HBEA 3B9AA 2YBUA 2ZQSA 3OA5A 4MPKA 1TFVA 3B9DA 3KAHA 4DRHA 1NH6A 1OWQA 3O5OA 2FDMA 1UR9A 3NTPA 5DEZA 2ZQVA 5GPGA 3TCZA 3WD2A 3O5JA 3I6CA 4JFKA 4MAVA 3ALFA 2KFWA 3TDBA 5HTGA 2MF9A 2LJ4A 3KCEA 3QOKA 5HW7A 4NSBA 1KT0A 2O9OA 3KACA 3UQIA 4U86A 3O5GA 1LJYA 1A7XA 1Q6HA 5HT1A 4QT2A 1J6YA 2FAPA 1VF8A 4W5UA 1NWSA 4Z2IA 1SR0A 1D2KA 2KR7A 2DSZA 3RM8A 4NZCA 3ARRA 4L72B 3RFWA 2M1IA 2OFNA 1R9HA 1JNSA 4WJXA 3FXYA 3CHEA 1HJWA 4G2PA 4URIA 2G41A 5HKGA 1O6IA 1EYMA 1HKJA 1J4IA 3JYJA 1E6PA 2MLXA 3ARPA 2MLZA 4IQCA 4LAVA 2ZQUA 3CH9A 2M2AA 3ARQA 4ZPVR 1FKKA 1LG1A 4ODMA 4DRJA 2B31A 2PV3A 3ARTA 4P8UA 4P8VA 3O5DA 3G6MA 3KAGA 1W1YA 1XRVA 2F2DA 2PPOA 3B8SA 3RM4A 4MGVA 4DRNA 3JYMA 2WLZA 3RGCA 3G6LA 1EDQA 1EHNA 1T11A 4DWSC 5BXJA 3NI6A 3EY6A 1ZK6A 1X6LA 2XP5A 4DRMA 4WKFA 2LGOA 3ARUA 1D7HA 1ZB5A 3RM9A 3ARVA 4WIWA 4ZPWR 2F4EA 2DSUA 3NRKA 4Q7NA 4DRKA 5B8IC 4ODPA 4Z2HA 4LAXA 1NWRA 1FFRA 1U79A 3O5FA 2FKEA 4ML4A 3AS3A 2RURA 1W1PA 1FKSA 2ZQTA 4ODOA 4DT4A 4WKAA 1J4RA 1KFWA 1B6CA 4JFJA 2LPVA 1E9LA 3CGNA 4AY1A 3O5IA 3PRDA 4DZ2A 2DG9A 2KI3A 4KQZA 2ZR5A 3O5PA 1SYTA 4KR0B 2KO7A 1FKGA 4MSPA 1X6NA 1C9HA 3FY1A 3PA7A 1M5YA 1FJDA 4Z2LA 1FD9A 1H0IA 3PRAA 2PPNA 3WH0A 2XP9A 4J4OA 2PPPA 2XP4A 4MNKA 5GPRA 3WQVA 4Z2GA 3IKDA 3BXWA 4P8WA 1FKLA 2XPAA 4HBOA 4WK9A 3UI5A 3ODKA 1FKIA 1ZBCA 5DITA 2ZR6A 2AWGA 4ODLA 2PV1A 1W9VA 1JNTA 2Y78A 4HARA 4ZPTR 1D7IA 4P8XA 4PTMA 1FKRA 2RQSA 1HJXA 2N87A 1XHGA 1Q6UA 4DIPA 4MNLA 3WD1A 2A3AA 1UR8A 2A3EA 2L2SA 3OOBA 1IX5A 1F8AB 1FKTA 1FFQA 3CHFA 4JFMA 4MTVA 1FKDA 3ALGA 3KADA 4Q22A 4ZS6A 1HXVA 1E6ZA 2DT1A 3ARYA 2Q5AA 3AS0A 2WM0A 3KAFA 1CTNA 4DROA 2XPBA 2XP6A 1OGBA 4TW6A 1PBKA 4JFIA 3ARWA 1BKFA 3KAIA 3AS2A 1FKJA 2PBCA 3KABA 2M08A 1HKKA 1D7JA 3O5EA 1EIBA 1GUVA 1E15A 4IPXA 1ZBVA 4IT4A 2DG3A 4R0XA 4LAWA 1W26A 4BF8A 1TCOC 1JVWA 5HWBA 4GIVA 2AOSA 2DG4A 1Y0OA 3AQUA 2IUZA 4R5EA 4TW8A 4DWSD 1PINA 4DRPA 1WNOA 3PR9A 4DWSA 5HUAA 3O5RA 2DT3A 3IK8A 1NSGA 4DRQA 1LL4A 4MNJA 4WKHA 4Z2JA 3B7XA 1LQ0A 4TNSA 3W4RA 1QPFA 1YATA 3B9EA 2A3CA 1YW5A 2WLYA 2WK2A 1F40A 1W9PA 2RSEA 1K9TA 4LGXA 2LKNA 1RD6A 1W1TA 2IF4A 4FN2A 2ESCA 5HWCA 3UQBA 3WIJA 4U84A 1J4HA 5DIUA 4DZ3A 2ZR4A 3GPKA 1WB0A 2ITKA 4L3NA 1ITXA 3FAPA 1NWTA 4J4NA 1N1AA 1LL6A 3UQAA 1FAPA 1JNDA 5JH8A 3ARSA 1LL7A 2OLHA 3IHZA 4O2TA 4S3KA 2MNTA 4U85A 2F21A 1WAWA 1ZBKA 1L1PA 4JYSA 2RUDA 1BL4A 4JFLA 4Z2KA 2RUCA 5I98A 3ARZA 3ARXA 1GPFA 1ROTA 3UI6A 3LUOA 1EQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQ2 A;  3CGM A;  4ODN A;  5D75 A;  1U79 A;  4ODR A;  1PBK A;  3O5F A;  4TW6 A;  2FKE A;  4JFI A;  3KAI A;  1BKF A;  2ZQS A;  5J6E A;  1FKJ A;  2PBC A;  2KGJ A;  3KAB A;  4DH0 A;  2RUR A;  2M08 A;  1D7J A;  3KAH A;  3O5E A;  4DRH A;  1FKS A;  4IPX A;  4W9O A;  2ZQT A;  3O5O A;  4ODO A;  2MPH A;  3MDY B;  4DT4 A;  1FKH A;  2DG3 A;  4R0X A;  3UF8 A;  4LAW A;  1W26 A;  3NTP A;  2ZQV A;  5GPG A;  4BF8 A;  1TCO C;  1JVW A;  4G50 A;  3TCZ A;  5HWB A;  4GIV A;  1J4R A;  2DG4 A;  1Y0O A;  1B6C A;  3O5J A;  2VN1 A;  4JFJ A;  4TW8 A;  1PIN A;  2LPV A;  3I6C A;  4JFK A;  4DRP A;  2D9F A;  3CGN A;  4DZ2 A;  2KFW A;  3O5I A;  3PRD A;  2DG9 A;  2KI3 A;  3TDB A;  2ZR5 A;  5HTG A;  5HUA A;  2MF9 A;  2LJ4 A;  3O5P A;  3O5R A;  3UI4 A;  3KCE A;  3IK8 A;  5HW7 A;  2KO7 A;  1NSG A;  2VCD A;  1KT0 A;  4DRQ A;  4N19 A;  4QIB A;  1FKG A;  3O5K A;  4MSP A;  1C9H A;  2JZV A;  5DIV A;  3KAC A;  3PA7 A;  1NMW A;  4U86 A;  3UQI A;  1M5Y A;  3O5G A;  1Q6H A;  1A7X A;  5HT1 A;  4QT2 A;  1J6Y A;  1FJD A;  4W9P A;  2FAP A;  3B7X A;  1FD9 A;  5HW8 A;  1P5Q A;  3TC5 A;  1FKF A;  2KR7 A;  4TNS A;  1NMV A;  1QPF A;  1YAT A;  2PPN A;  3O5M A;  2XP7 A;  3WH0 A;  2XP9 A;  1YW5 A;  4J4O A;  4DRI A;  1F40 A;  2RSE A;  2PPP A;  2XP4 A;  2UZ5 A;  3O5L A;  2LKN A;  3IKD A;  3RFW A;  2IF4 A;  4NNR A;  2M1I A;  2OFN A;  1R9H A;  1JNS A;  1FKL A;  3PRB A;  2XPA A;  2K8I A;  3UI5 A;  4FN2 A;  4G2P A;  1D6O A;  4TYO A;  5HWC A;  3UQB A;  4U84 A;  2RUQ A;  1J4H A;  3ODK A;  5DIU A;  3VAW A;  5HKG A;  1EYM A;  4DZ3 A;  4GGQ A;  1FKI A;  2ZR4 A;  1J4I A;  3JYJ A;  2MLX A;  3GPK A;  4ODK A;  2ZR6 A;  1ZCN A;  3JXV A;  2MLZ A;  5DIT A;  2ITK A;  4IQC A;  2AWG A;  2ZQU A;  1Q1C A;  2M2A A;  2PV1 A;  4LAV A;  4ODL A;  3FAP A;  1FKK A;  1JNT A;  2Y78 A;  4ODQ A;  1FKB A;  4ODM A;  1D7I A;  4DRJ A;  2PV3 A;  1KT1 A;  2MLY A;  3O5D A;  3KAG A;  5HW6 A;  4J4N A;  4W9Q A;  1N1A A;  4ITZ A;  2F2D A;  2PPO A;  1FKR A;  1Q6I A;  2RQS A;  4MGV A;  4DRN A;  3JYM A;  3UQA A;  1FAP A;  2N87 A;  3H9R B;  3RGC A;  1Q6U A;  4DIP A;  1T11 A;  4C02 B;  3IHZ A;  2XP8 A;  3NI6 A;  4O2T A;  5BXJ A;  3EY6 A;  4QT3 A;  1ZK6 A;  4TX0 A;  3IKG A;  2L2S A;  2XP5 A;  2KE0 A;  2XP3 A;  3OOB A;  4DRM A;  1F8A B;  1FKT A;  2LGO A;  2MNT A;  4U85 A;  4TW7 A;  2F21 A;  2PV2 A;  1D7H A;  4JFM A;  1L1P A;  1FKD A;  3KAD A;  2RUD A;  4JYS A;  1BL4 A;  4LAY A;  1ROU A;  4FAP A;  4JFL A;  2F4E A;  1HXV A;  2RUC A;  3KZ7 A;  5I98 A;  2Q5A A;  3NRK A;  4DRK A;  5B8I C;  3KAF A;  1QPL A;  4DRO A;  1ROT A;  4ODP A;  3UI6 A;  4LAX A;  2XPB A;  3LUO A;  1EQ3 A;  3O5Q A;  1QZ2 A;  2XP6 A; 
#chains in the Genus database with same CATH topology
 4IQ2 A;  3CGM A;  5D75 A;  3CHC A;  4ODR A;  4MNM A;  5J6E A;  2KGJ A;  4DH0 A;  1W9U A;  2DT2 A;  1ZU8 A;  2EUL A;  4W9O A;  3WL1 A;  2MPH A;  3MDY B;  1FKH A;  3UF8 A;  4QZV B;  1GOI A;  1E6N A;  4G50 A;  2DT0 A;  5DF0 A;  1HKM A;  2VN1 A;  1HJV A;  2G8Z A;  2D9F A;  3RME A;  2A3B A;  3UI4 A;  2VCD A;  4IT6 A;  4N19 A;  4QIB A;  1E6R A;  3AS1 A;  3O5K A;  2JZV A;  5DIV A;  1H0G A;  1NMW A;  3WD0 A;  1ZL1 A;  4W9P A;  3WD4 A;  5HW8 A;  1P5Q A;  1NWU A;  3TC5 A;  1FKF A;  1NMV A;  3O5M A;  2XP7 A;  4DRI A;  5HBF A;  2UZ5 A;  3O5L A;  4UDM A;  5DO2 A;  4NNR A;  1OGG A;  3PRB A;  2K8I A;  2PI6 A;  1D6O A;  4TYO A;  3WD3 A;  2RUQ A;  3VAW A;  2YBT A;  2P4V A;  3CHD A;  4GGQ A;  1ZBW A;  4ODK A;  1HKI A;  1ZCN A;  3JXV A;  1Q1C A;  5GQB A;  3WKZ A;  4ODQ A;  1FKB A;  1KT1 A;  2MLY A;  5HW6 A;  3WQW A;  4W9Q A;  4ITZ A;  4DWS B;  1Q6I A;  3H9R B;  4C02 B;  2XP8 A;  1W1V A;  2DSV A;  4QT3 A;  4TX0 A;  3IKG A;  2KE0 A;  2XP3 A;  4TW7 A;  2PV2 A;  2DPE A;  3ARO A;  1LG2 A;  4LAY A;  4FAP A;  2DSW A;  1ROU A;  2QF8 A;  2B5U B;  4XAK A;  3WL0 A;  3KZ7 A;  3CZ8 A;  1QPL A;  2O92 A;  1QZ2 A;  3O5Q A;  4ODN A;  1JNE A;  4S3J A;  4HBE A;  3B9A A;  2YBU A;  2ZQS A;  3OA5 A;  4MPK A;  1TFV A;  3B9D A;  3KAH A;  4DRH A;  1NH6 A;  1OWQ A;  3O5O A;  2FDM A;  1UR9 A;  3NTP A;  5DEZ A;  2ZQV A;  5GPG A;  3TCZ A;  3WD2 A;  3O5J A;  3I6C A;  4JFK A;  4MAV A;  3ALF A;  2KFW A;  3TDB A;  5HTG A;  2MF9 A;  2LJ4 A;  3KCE A;  3QOK A;  5HW7 A;  4NSB A;  1KT0 A;  2O9O A;  3KAC A;  3UQI A;  4U86 A;  3O5G A;  1LJY A;  1A7X A;  1Q6H A;  5HT1 A;  4QT2 A;  1J6Y A;  3EIP A;  2FAP A;  1VF8 A;  4W5U A;  1NWS A;  4Z2I A;  1SR0 A;  1D2K A;  2KR7 A;  2DSZ A;  3RM8 A;  4NZC A;  3ARR A;  4L72 B;  3RFW A;  2M1I A;  2OFN A;  1R9H A;  1JNS A;  4WJX A;  3FXY A;  3CHE A;  1HJW A;  4G2P A;  4URI A;  2G41 A;  5HKG A;  1O6I A;  1EYM A;  1HKJ A;  1J4I A;  3JYJ A;  1E6P A;  2MLX A;  3ARP A;  2MLZ A;  4IQC A;  4LAV A;  2ZQU A;  3CH9 A;  2M2A A;  3ARQ A;  1JCH B;  4ZPV R;  1FKK A;  1LG1 A;  4ODM A;  4DRJ A;  2B31 A;  2PV3 A;  3ART A;  4P8U A;  4P8V A;  3O5D A;  3G6M A;  3KAG A;  1W1Y A;  1XRV A;  2F2D A;  2PPO A;  3B8S A;  3RM4 A;  4MGV A;  4DRN A;  3JYM A;  2WLZ A;  3RGC A;  3G6L A;  1EDQ A;  1EHN A;  1T11 A;  4DWS C;  5BXJ A;  3NI6 A;  3EY6 A;  1ZK6 A;  1X6L A;  2XP5 A;  4DRM A;  4WKF A;  2LGO A;  3ARU A;  1D7H A;  1ZB5 A;  3RM9 A;  3ARV A;  4WIW A;  4ZPW R;  2F4E A;  2DSU A;  3NRK A;  4Q7N A;  4DRK A;  5B8I C;  4ODP A;  4Z2H A;  4LAX A;  1NWR A;  1FFR A;  1U79 A;  3O5F A;  2FKE A;  4ML4 A;  3AS3 A;  2RUR A;  1W1P A;  1FKS A;  2ZQT A;  4ODO A;  4DT4 A;  4WKA A;  1J4R A;  1KFW A;  1B6C A;  4JFJ A;  2LPV A;  1E9L A;  3CGN A;  4AY1 A;  3O5I A;  3PRD A;  4DZ2 A;  2DG9 A;  2KI3 A;  4KQZ A;  2ZR5 A;  3O5P A;  1SYT A;  4KR0 B;  2KO7 A;  1FKG A;  4MSP A;  1X6N A;  1C9H A;  3FY1 A;  3PA7 A;  1M5Y A;  1FJD A;  4Z2L A;  1FD9 A;  1H0I A;  3PRA A;  2PPN A;  3WH0 A;  2XP9 A;  4J4O A;  2PPP A;  2XP4 A;  4MNK A;  5GPR A;  3WQV A;  4Z2G A;  3IKD A;  3BXW A;  2PN0 A;  4P8W A;  1FKL A;  2XPA A;  4HBO A;  4WK9 A;  3UI5 A;  3ODK A;  1FKI A;  1ZBC A;  5DIT A;  2ZR6 A;  2AWG A;  4ODL A;  2PV1 A;  1W9V A;  1JNT A;  2Y78 A;  4HAR A;  4ZPT R;  1D7I A;  4P8X A;  4PTM A;  1FKR A;  2RQS A;  1HJX A;  2N87 A;  1XHG A;  1Q6U A;  4DIP A;  4MNL A;  3WD1 A;  2A3A A;  1UR8 A;  2A3E A;  2L2S A;  3OOB A;  1IX5 A;  1F8A B;  1FKT A;  1FFQ A;  3CHF A;  4JFM A;  4MTV A;  1FKD A;  3ALG A;  3KAD A;  4Q22 A;  4ZS6 A;  1HXV A;  1E6Z A;  2DT1 A;  3ARY A;  2Q5A A;  3AS0 A;  2WM0 A;  3KAF A;  1CTN A;  4DRO A;  2XPB A;  2XP6 A;  3BMB A;  1OGB A;  4TW6 A;  1PBK A;  4JFI A;  3ARW A;  1BKF A;  3KAI A;  3AS2 A;  1FKJ A;  2PBC A;  3KAB A;  1GRJ A;  2M08 A;  1HKK A;  1D7J A;  3O5E A;  1EIB A;  1GUV A;  1E15 A;  4IPX A;  1ZBV A;  4IT4 A;  2DG3 A;  4R0X A;  4LAW A;  1W26 A;  4BF8 A;  1TCO C;  1JVW A;  5HWB A;  4GIV A;  2AOS A;  2DG4 A;  1Y0O A;  3AQU A;  2IUZ A;  4R5E A;  4TW8 A;  4DWS D;  1PIN A;  4DRP A;  1WNO A;  3GTY X;  3PR9 A;  4DWS A;  5HUA A;  3O5R A;  2DT3 A;  3IK8 A;  1NSG A;  4DRQ A;  2ETN A;  1LL4 A;  4MNJ A;  4WKH A;  4Z2J A;  3B7X A;  1LQ0 A;  4TNS A;  3W4R A;  1QPF A;  1YAT A;  3B9E A;  2A3C A;  1YW5 A;  2WLY A;  2WK2 A;  1F40 A;  1W9P A;  2RSE A;  1K9T A;  4LGX A;  2LKN A;  1RD6 A;  1W1T A;  1E44 A;  2IF4 A;  4FN2 A;  2ESC A;  5HWC A;  3UQB A;  3WIJ A;  4U84 A;  1J4H A;  5DIU A;  3GU0 A;  4DZ3 A;  2ZR4 A;  3GPK A;  1WB0 A;  2ITK A;  4L3N A;  1ITX A;  3FAP A;  1NWT A;  2F23 A;  4J4N A;  1N1A A;  1LL6 A;  3UQA A;  1FAP A;  1JND A;  5JH8 A;  3ARS A;  1LL7 A;  2OLH A;  3IHZ A;  4O2T A;  4S3K A;  2MNT A;  4U85 A;  2F21 A;  1WAW A;  1ZBK A;  1L1P A;  2RUD A;  4JYS A;  1BL4 A;  4JFL A;  4Z2K A;  2RUC A;  5I98 A;  3ARZ A;  3ARX A;  1GPF A;  1ROT A;  3UI6 A;  3LUO A;  1EQ3 A; 
#chains in the Genus database with same CATH homology
 4IQ2 A;  3CGM A;  5D75 A;  3CHC A;  4ODR A;  4MNM A;  5J6E A;  2KGJ A;  4DH0 A;  1W9U A;  2DT2 A;  1ZU8 A;  4W9O A;  3WL1 A;  2MPH A;  3MDY B;  1FKH A;  3UF8 A;  4QZV B;  1GOI A;  1E6N A;  4G50 A;  2DT0 A;  5DF0 A;  1HKM A;  2VN1 A;  1HJV A;  2G8Z A;  2D9F A;  3RME A;  2A3B A;  3UI4 A;  2VCD A;  4IT6 A;  4N19 A;  4QIB A;  1E6R A;  3AS1 A;  3O5K A;  2JZV A;  5DIV A;  1H0G A;  1NMW A;  3WD0 A;  1ZL1 A;  4W9P A;  3WD4 A;  5HW8 A;  1P5Q A;  1NWU A;  3TC5 A;  1FKF A;  1NMV A;  3O5M A;  2XP7 A;  4DRI A;  5HBF A;  2UZ5 A;  3O5L A;  5DO2 A;  4NNR A;  1OGG A;  3PRB A;  2K8I A;  2PI6 A;  1D6O A;  4TYO A;  3WD3 A;  2RUQ A;  3VAW A;  2YBT A;  3CHD A;  4GGQ A;  1ZBW A;  4ODK A;  1HKI A;  1ZCN A;  3JXV A;  1Q1C A;  5GQB A;  3WKZ A;  4ODQ A;  1FKB A;  1KT1 A;  2MLY A;  5HW6 A;  3WQW A;  4W9Q A;  4ITZ A;  4DWS B;  1Q6I A;  3H9R B;  4C02 B;  2XP8 A;  1W1V A;  2DSV A;  4QT3 A;  4TX0 A;  3IKG A;  2KE0 A;  2XP3 A;  4TW7 A;  2PV2 A;  2DPE A;  3ARO A;  1LG2 A;  4LAY A;  4FAP A;  2DSW A;  1ROU A;  2QF8 A;  4XAK A;  3WL0 A;  3KZ7 A;  3CZ8 A;  1QPL A;  2O92 A;  1QZ2 A;  3O5Q A;  4ODN A;  1JNE A;  4S3J A;  4HBE A;  3B9A A;  2YBU A;  2ZQS A;  3OA5 A;  4MPK A;  1TFV A;  3B9D A;  3KAH A;  4DRH A;  1NH6 A;  1OWQ A;  3O5O A;  2FDM A;  1UR9 A;  3NTP A;  5DEZ A;  2ZQV A;  5GPG A;  3TCZ A;  3WD2 A;  3O5J A;  3I6C A;  4JFK A;  4MAV A;  3ALF A;  2KFW A;  3TDB A;  5HTG A;  2MF9 A;  2LJ4 A;  3KCE A;  3QOK A;  5HW7 A;  4NSB A;  1KT0 A;  2O9O A;  3KAC A;  3UQI A;  4U86 A;  3O5G A;  1LJY A;  1A7X A;  1Q6H A;  5HT1 A;  4QT2 A;  1J6Y A;  2FAP A;  1VF8 A;  4W5U A;  1NWS A;  4Z2I A;  1SR0 A;  1D2K A;  2KR7 A;  2DSZ A;  3RM8 A;  4NZC A;  3ARR A;  4L72 B;  3RFW A;  2M1I A;  2OFN A;  1R9H A;  1JNS A;  4WJX A;  3FXY A;  3CHE A;  1HJW A;  4G2P A;  4URI A;  2G41 A;  5HKG A;  1O6I A;  1EYM A;  1HKJ A;  1J4I A;  3JYJ A;  1E6P A;  2MLX A;  3ARP A;  2MLZ A;  4IQC A;  4LAV A;  2ZQU A;  3CH9 A;  2M2A A;  3ARQ A;  4ZPV R;  1FKK A;  1LG1 A;  4ODM A;  4DRJ A;  2B31 A;  2PV3 A;  3ART A;  4P8U A;  4P8V A;  3O5D A;  3G6M A;  3KAG A;  1W1Y A;  1XRV A;  2F2D A;  2PPO A;  3B8S A;  3RM4 A;  4MGV A;  4DRN A;  3JYM A;  2WLZ A;  3RGC A;  3G6L A;  1EDQ A;  1EHN A;  1T11 A;  4DWS C;  5BXJ A;  3NI6 A;  3EY6 A;  1ZK6 A;  1X6L A;  2XP5 A;  4DRM A;  4WKF A;  2LGO A;  3ARU A;  1D7H A;  1ZB5 A;  3RM9 A;  3ARV A;  4WIW A;  4ZPW R;  2F4E A;  2DSU A;  3NRK A;  4Q7N A;  4DRK A;  5B8I C;  4ODP A;  4Z2H A;  4LAX A;  1NWR A;  1FFR A;  1U79 A;  3O5F A;  2FKE A;  4ML4 A;  3AS3 A;  2RUR A;  1W1P A;  1FKS A;  2ZQT A;  4ODO A;  4DT4 A;  4WKA A;  1J4R A;  1KFW A;  1B6C A;  4JFJ A;  2LPV A;  1E9L A;  3CGN A;  4AY1 A;  3O5I A;  3PRD A;  4DZ2 A;  2DG9 A;  2KI3 A;  4KQZ A;  2ZR5 A;  3O5P A;  1SYT A;  4KR0 B;  2KO7 A;  1FKG A;  4MSP A;  1X6N A;  1C9H A;  3FY1 A;  3PA7 A;  1M5Y A;  1FJD A;  4Z2L A;  1FD9 A;  1H0I A;  3PRA A;  2PPN A;  3WH0 A;  2XP9 A;  4J4O A;  2PPP A;  2XP4 A;  4MNK A;  5GPR A;  3WQV A;  4Z2G A;  3IKD A;  3BXW A;  4P8W A;  1FKL A;  2XPA A;  4HBO A;  4WK9 A;  3UI5 A;  3ODK A;  1FKI A;  1ZBC A;  5DIT A;  2ZR6 A;  2AWG A;  4ODL A;  2PV1 A;  1W9V A;  1JNT A;  2Y78 A;  4HAR A;  4ZPT R;  1D7I A;  4P8X A;  4PTM A;  1FKR A;  2RQS A;  1HJX A;  2N87 A;  1XHG A;  1Q6U A;  4DIP A;  4MNL A;  3WD1 A;  2A3A A;  1UR8 A;  2A3E A;  2L2S A;  3OOB A;  1IX5 A;  1F8A B;  1FKT A;  1FFQ A;  3CHF A;  4JFM A;  4MTV A;  1FKD A;  3ALG A;  3KAD A;  4Q22 A;  4ZS6 A;  1HXV A;  1E6Z A;  2DT1 A;  3ARY A;  2Q5A A;  3AS0 A;  2WM0 A;  3KAF A;  1CTN A;  4DRO A;  2XPB A;  2XP6 A;  1OGB A;  4TW6 A;  1PBK A;  4JFI A;  3ARW A;  1BKF A;  3KAI A;  3AS2 A;  1FKJ A;  2PBC A;  3KAB A;  2M08 A;  1HKK A;  1D7J A;  3O5E A;  1EIB A;  1GUV A;  1E15 A;  4IPX A;  1ZBV A;  4IT4 A;  2DG3 A;  4R0X A;  4LAW A;  1W26 A;  4BF8 A;  1TCO C;  1JVW A;  5HWB A;  4GIV A;  2AOS A;  2DG4 A;  1Y0O A;  3AQU A;  2IUZ A;  4R5E A;  4TW8 A;  4DWS D;  1PIN A;  4DRP A;  1WNO A;  3PR9 A;  4DWS A;  5HUA A;  3O5R A;  2DT3 A;  3IK8 A;  1NSG A;  4DRQ A;  1LL4 A;  4MNJ A;  4WKH A;  4Z2J A;  3B7X A;  1LQ0 A;  4TNS A;  3W4R A;  1QPF A;  1YAT A;  3B9E A;  2A3C A;  1YW5 A;  2WLY A;  2WK2 A;  1F40 A;  1W9P A;  2RSE A;  1K9T A;  4LGX A;  2LKN A;  1RD6 A;  1W1T A;  2IF4 A;  4FN2 A;  2ESC A;  5HWC A;  3UQB A;  3WIJ A;  4U84 A;  1J4H A;  5DIU A;  4DZ3 A;  2ZR4 A;  3GPK A;  1WB0 A;  2ITK A;  4L3N A;  1ITX A;  3FAP A;  1NWT A;  4J4N A;  1N1A A;  1LL6 A;  3UQA A;  1FAP A;  1JND A;  5JH8 A;  3ARS A;  1LL7 A;  2OLH A;  3IHZ A;  4O2T A;  4S3K A;  2MNT A;  4U85 A;  2F21 A;  1WAW A;  1ZBK A;  1L1P A;  4JYS A;  2RUD A;  1BL4 A;  4JFL A;  4Z2K A;  2RUC A;  5I98 A;  3ARZ A;  3ARX A;  1GPF A;  1ROT A;  3UI6 A;  3LUO A;  1EQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...