3H9RB

Crystal structure of the kinase domain of type i activin receptor (acvr1) in complex with fkbp12 and dorsomorphin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activin receptor type-1
publication title Structure of the Bone Morphogenetic Protein Receptor ALK2 and Implications for Fibrodysplasia Ossificans Progressiva.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/protein kinase
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3h9rB00
1YATA 5DITA 1PINA 2VCDA 1J6YA 5HW7A 4ITZA 1M5YA 3KAHA 2OFNA 4G2PA 1ROTA 4MGVA 4DRPA 5BXJA 4FN2A 2XPAA 4LAVA 1FKBA 2M08A 4TNSA 1J4IA 4DROA 5HKGA 2ZQSA 5HW8A 1D7IA 4C02B 5DIUA 1B6CA 2XP7A 2MLXA 3O5LA 3B7XA 2DG4A 3O5IA 5B8IC 1P5QA 2LPVA 4J4NA 2K8IA 2F2DA 3O5FA 5GPGA 1HXVA 1Y0OA 3KACA 1BL4A 2IF4A 3KAIA 2UZ5A 2FAPA 2MF9A 2XP8A 4JFJA 4FAPA 4IPXA 2ITKA 4G50A 1KT1A 3IKGA 1Q6UA 3TCZA 4DRHA 1PBKA 2RQSA 3UF8A 5J6EA 2L2SA 3O5KA 3UQIA 1NMVA 1JVWA 2KR7A 4MSPA 1JNSA 3PRDA 2Q5AA 4DT4A 1TCOC 4NNRA 1ROUA 4U84A 3IK8A 3O5QA 4IQ2A 4ODQA 1U79A 2ZR6A 3I6CA 1W26A 1F8AB 3O5JA 4W9OA 1FKTA 4DH0A 1J4RA 1FKJA 2M1IA 2RUCA 3O5RA 3LUOA 1T11A 4ODNA 1FKSA 4DRKA 3UQAA 3KAFA 4QIBA 3GPKA 1D7HA 4TYOA 1EQ3A 4ODLA 2Y78A 4JFLA 2MLZA 5D75A 1FKIA 1ZCNA 2XP6A 2ZR5A 2FKEA 3CGMA 3NI6A 3ODKA 4JYSA 1EYMA 4O2TA 3KAGA 2DG9A 4ODPA 4TW6A 2KGJA 3UI6A 3UI4A 3NTPA 3O5MA 2RUDA 4LAYA 3VAWA 3FAPA 3O5PA 4ODKA 1Q6IA 2F4EA 2XP4A 4U86A 1BKFA 1FKLA 3RGCA 5HWBA 5HW6A 2ZQTA 1JNTA 3MDYB 4DZ3A 3KADA 2XP5A 3IKDA 2MNTA 2VN1A 1KT0A 3JXVA 4ODRA 1A7XA 4JFIA 3TDBA 4R0XA 2DG3A 4DRMA 1D7JA 2ZQUA 4DZ2A 4JFMA 4TX0A 1FKRA 1NSGA 4GIVA 4J4OA 1F40A 2KE0A 3IHZA 2RUQA 2PBCA 1FJDA 3O5EA 1FKKA 4ODMA 2KO7A 3NRKA 2F21A 4TW7A 3UQBA 5I98A 3CGNA 4N19A 5DIVA 4BF8A 4U85A 2MLYA 4QT2A 2LGOA 3EY6A 2KI3A 4DRNA 3JYJA 4LAXA 1N1AA 2AWGA 1QZ2A 2MPHA 2ZR4A 4W9QA 3O5OA 5HTGA 2RSEA 2ZQVA 1ZK6A 5HT1A 4DRIA 2XP9A 2PPPA 1C9HA 2PV1A 2KFWA 2PV3A 5HWCA 3PA7A 4JFKA 5HUAA 1FD9A 3KCEA 3KZ7A 1D6OA 4TW8A 1FKGA 3TC5A 4QT3A 1QPFA 1YW5A 2M2AA 3O5GA 1J4HA 1QPLA 3RFWA 2RURA 4LAWA 3WH0A 3KABA 3OOBA 2PPNA 4GGQA 1FKHA 1NMWA 1Q6HA 3UI5A 2JZVA 4W9PA 3JYMA 1FKFA 2XPBA 4DRJA 2PPOA 1L1PA 4ODOA 2D9FA 1FKDA 1FAPA 2XP3A 3PRBA 2N87A 1R9HA 3O5DA 4IQCA 4DRQA 2LKNA 2PV2A 2LJ4A 3H9RB 4DIPA 1Q1CA
chains in the Genus database with same CATH superfamily
4ZPTR 2WLYA 2B5UB 5DITA 2VCDA 4MAVA 1OWQA 1M5YA 2DSUA 2OFNA 3GTYX 4FN2A 4TNSA 2ESCA 1E6PA 4DROA 4Z2GA 2XP7A 2MLXA 2G8ZA 3O5LA 2DG4A 2LPVA 4DWSB 5GPGA 2IF4A 2UZ5A 2XP8A 3CHFA 3CH9A 1EDQA 4UDMA 1PBKA 2Q5AA 1K9TA 4NNRA 3IK8A 3O5QA 4ODQA 1NWTA 2ZR6A 5DF0A 1RD6A 1F8AB 2DT3A 3UQAA 2M1IA 1ITXA 1T11A 1H0GA 1E9LA 3CHCA 3RM9A 2XP6A 4W9PA 3CGMA 2FKEA 3NI6A 3ODKA 4O2TA 4DRMA 4FAPA 4DRKA 1X6NA 3UI6A 3O5MA 1D2KA 1CTNA 4ODKA 3CHDA 2XP4A 1BKFA 2P4VA 5HW6A 2ZQTA 1JNEA 3CHEA 3KADA 2VN1A 1ZBVA 3RMEA 4IT4A 2DG3A 4DZ2A 1LQ0A 1ZBCA 1FKRA 2OLHA 3B9DA 2YBUA 1GPFA 2EULA 2PBCA 1FJDA 4ODMA 4TW7A 5I98A 4R5EA 2MLYA 1NH6A 3AROA 2LGOA 2O9OA 4WKAA 4DRNA 3AQUA 4IT6A 2MPHA 2ZR4A 3WD2A 3O5OA 2RSEA 4DRIA 1XRVA 5DO2A 2PV1A 2KFWA 3W4RA 4Z2HA 3KCEA 1FKGA 1HKIA 1YW5A 2M2AA 3BMBA 3WH0A 4P8UA 1FKHA 1NMWA 1Q6HA 1W9PA 1FFRA 3OA5A 2N87A 1R9HA 4Q7NA 1YATA 1PINA 5HW7A 4NSBA 3GU0A 4W5UA 4G2PA 4S3KA 3AS0A 1J4IA 2ZQSA 1E6RA 3ARWA 4P8XA 4C02B 3B8SA 1EIBA 4MNLA 5DIUA 2QF8A 3B7XA 1E44A 4ML4A 1HKJA 4HARA 1O6IA 2A3BA 3AS1A 3KAIA 4JFJA 4G50A 3RM8A 1HJWA 3UF8A 5J6EA 3O5KA 3UQIA 2KR7A 4P8VA 1TCOC 3B9EA 4U84A 4URIA 4MTVA 1J4RA 4ODNA 2RUCA 3LUOA 1GOIA 4QIBA 3G6LA 1W1PA 2ZR5A 2DSZA 1H0IA 3ARTA 4TW6A 4L72B 1LL6A 1NWRA 1W1YA 3O5PA 1Q6IA 1UR8A 2XP5A 4ODRA 4R0XA 2ZQUA 4JFMA 1HJVA 5JH8A 1EHNA 2RUQA 3UQBA 2B31A 3NRKA 4Z2IA 3CGNA 4N19A 4BF8A 3ARXA 4QT2A 4DWSC 3FY1A 3AS3A 3JYJA 3WL1A 5HTGA 2ZQVA 3WQWA 2PPPA 1E15A 1W9UA 3EIPA 1D6OA 4P8WA 2DSWA 1QPLA 4Z2JA 3KABA 1ZU8A 2XPBA 4DRJA 2D9FA 3RM4A 2DPEA 3O5DA 1ZB5A 2LKNA 2A3CA 3ARZA 3QOKA 4ZPWR 1LJYA 3KAHA 3WD3A 4DRPA 4LAVA 3ALFA 5HKGA 5HW8A 5HBFA 2WK2A 2YBTA 1UR9A 3WQVA 2WM0A 2FDMA 2DSVA 3O5IA 3CZ8A 1P5QA 1HXVA 1NWSA 2F2DA 2K8IA 3O5FA 3WD0A 2PI6A 1Y0OA 4MNKA 4WKFA 4KQZA 2MF9A 1KFWA 1LG2A 3IKGA 4Z2LA 2RQSA 1LL7A 4MSPA 1JNSA 1ROUA 2F23A 4IQ2A 3I6CA 1FKTA 1E6NA 1FKSA 3GPKA 1D7HA 4TYOA 1EQ3A 2Y78A 4JFLA 2MLZA 5D75A 1FKIA 1ZCNA 4ODPA 3UI4A 2DG9A 2RUDA 4MPKA 3VAWA 3ARVA 1GUVA 3FAPA 4U86A 4HBEA 1FKLA 2IUZA 3RGCA 5HWBA 1JNTA 3MDYB 4DZ3A 2DT0A 3ALGA 3JXVA 1GRJA 1A7XA 2O92A 4JFIA 3PR9A 4TX0A 1NSGA 1JNDA 1TFVA 4GIVA 4J4OA 1F40A 1SYTA 1XHGA 4U85A 2KI3A 4LAXA 1N1AA 1QZ2A 4WJXA 5HT1A 1E6ZA 4HBOA 2PV3A 5HWCA 3PA7A 4JFKA 3ARPA 4TW8A 3TC5A 3G6MA 1QPFA 4ZS6A 3O5GA 1HJXA 3RFWA 4LAWA 3OOBA 2PPNA 1ZBWA 1LG1A 4WKHA 3UI5A 2JZVA 4ZPVR 4ODOA 1VF8A 1FKDA 1NWUA 4LGXA 4DRQA 5DEZA 4ITZA 3H9RB 4DIPA 2G41A 1Q1CA 1J6YA 1HKKA 3WL0A 2A3AA 1ROTA 4MGVA 5BXJA 2XPAA 1SR0A 1FKBA 2M08A 3ARUA 2PN0A 1D7IA 1W9VA 4DWSA 4Q22A 1B6CA 1JCHB 5B8IC 4J4NA 1LL4A 1W1TA 3KACA 1BL4A 2FAPA 4IPXA 2ITKA 1KT1A 1Q6UA 3TCZA 4DRHA 4DWSD 2L2SA 1NMVA 1JVWA 1OGGA 3PRDA 4WK9A 3WD4A 4DT4A 1X6LA 3WD1A 3AS2A 4S3JA 1U79A 1W26A 4W9OA 3O5JA 3WKZA 1OGBA 4DH0A 1FKJA 3B9AA 3O5RA 5GPRA 5GQBA 3KAFA 1WNOA 4MNMA 4ODLA 4KR0B 4L3NA 2ETNA 4JYSA 1WB0A 1EYMA 3KAGA 2KGJA 1FFQA 3NTPA 4LAYA 2A3EA 1IX5A 2F4EA 3WIJA 1WAWA 3IKDA 2MNTA 1KT0A 2WLZA 3TDBA 1D7JA 3ARQA 4MNJA 2AOSA 3BXWA 4NZCA 2KE0A 1ZL1A 3IHZA 3O5EA 1FKKA 2KO7A 2F21A 5DIVA 3EY6A 3ARRA 1HKMA 2AWGA 4PTMA 4W9QA 1ZBKA 1ZK6A 2XP9A 1W1VA 2DT1A 1C9HA 4AY1A 4WIWA 5HUAA 1FD9A 3KZ7A 4Z2KA 3ARSA 4QT3A 1J4HA 4XAKA 2RURA 2DT2A 4GGQA 3ARYA 1FKFA 3FXYA 3JYMA 2PPOA 3PRAA 1L1PA 4QZVB 1FAPA 2XP3A 3PRBA 4IQCA 2PV2A 2LJ4A
chains in the Genus database with same CATH topology
4ZPTR 2WLYA 5DITA 2VCDA 4MAVA 1OWQA 1M5YA 2DSUA 2OFNA 4FN2A 4TNSA 2ESCA 1E6PA 4DROA 4Z2GA 2XP7A 2MLXA 2G8ZA 3O5LA 2DG4A 2LPVA 4DWSB 5GPGA 2IF4A 2UZ5A 2XP8A 3CHFA 3CH9A 1EDQA 1PBKA 2Q5AA 1K9TA 4NNRA 3IK8A 3O5QA 4ODQA 1NWTA 2ZR6A 5DF0A 1RD6A 1F8AB 2DT3A 3UQAA 2M1IA 1ITXA 1T11A 1H0GA 1E9LA 3CHCA 3RM9A 2XP6A 4W9PA 3CGMA 2FKEA 3NI6A 3ODKA 4O2TA 4DRMA 4FAPA 4DRKA 1X6NA 3UI6A 3O5MA 1D2KA 1CTNA 4ODKA 3CHDA 2XP4A 1BKFA 5HW6A 2ZQTA 1JNEA 3CHEA 3KADA 2VN1A 1ZBVA 3RMEA 4IT4A 2DG3A 4DZ2A 1LQ0A 1ZBCA 1FKRA 2OLHA 3B9DA 2YBUA 1GPFA 2PBCA 1FJDA 4ODMA 4TW7A 5I98A 4R5EA 2MLYA 1NH6A 3AROA 2LGOA 2O9OA 4WKAA 4DRNA 3AQUA 4IT6A 2MPHA 2ZR4A 3WD2A 3O5OA 2RSEA 4DRIA 1XRVA 5DO2A 2PV1A 2KFWA 3W4RA 4Z2HA 3KCEA 1FKGA 1HKIA 1YW5A 2M2AA 3WH0A 4P8UA 1FKHA 1NMWA 1Q6HA 1W9PA 1FFRA 3OA5A 2N87A 1R9HA 4Q7NA 1YATA 1PINA 5HW7A 4NSBA 4W5UA 4G2PA 4S3KA 3AS0A 1J4IA 2ZQSA 1E6RA 3ARWA 4P8XA 4C02B 3B8SA 1EIBA 4MNLA 5DIUA 2QF8A 3B7XA 4ML4A 1HKJA 4HARA 1O6IA 2A3BA 3AS1A 3KAIA 4JFJA 4G50A 3RM8A 1HJWA 3UF8A 5J6EA 3O5KA 3UQIA 2KR7A 4P8VA 1TCOC 3B9EA 4U84A 4URIA 4MTVA 1J4RA 4ODNA 2RUCA 3LUOA 1GOIA 4QIBA 3G6LA 1W1PA 2ZR5A 2DSZA 1H0IA 3ARTA 4TW6A 4L72B 1LL6A 1NWRA 1W1YA 3O5PA 1Q6IA 1UR8A 2XP5A 4ODRA 4R0XA 2ZQUA 4JFMA 1HJVA 5JH8A 1EHNA 2RUQA 3UQBA 2B31A 3NRKA 4Z2IA 3CGNA 4N19A 4BF8A 3ARXA 4QT2A 4DWSC 3FY1A 3AS3A 3JYJA 3WL1A 5HTGA 2ZQVA 3WQWA 2PPPA 1E15A 1W9UA 1D6OA 4P8WA 2DSWA 1QPLA 4Z2JA 3KABA 1ZU8A 2XPBA 4DRJA 2D9FA 3RM4A 2DPEA 3O5DA 1ZB5A 2LKNA 2A3CA 3ARZA 3QOKA 4ZPWR 1LJYA 3KAHA 3WD3A 4DRPA 4LAVA 3ALFA 5HKGA 5HW8A 5HBFA 2WK2A 2YBTA 1UR9A 3WQVA 2WM0A 2FDMA 2DSVA 3O5IA 3CZ8A 1P5QA 1HXVA 1NWSA 2F2DA 2K8IA 3O5FA 3WD0A 2PI6A 1Y0OA 4MNKA 4WKFA 4KQZA 2MF9A 1KFWA 1LG2A 3IKGA 4Z2LA 2RQSA 1LL7A 4MSPA 1JNSA 1ROUA 4IQ2A 3I6CA 1FKTA 1E6NA 1FKSA 3GPKA 1D7HA 4TYOA 1EQ3A 2Y78A 4JFLA 2MLZA 5D75A 1FKIA 1ZCNA 4ODPA 3UI4A 2DG9A 2RUDA 4MPKA 3VAWA 3ARVA 1GUVA 3FAPA 4U86A 4HBEA 1FKLA 2IUZA 3RGCA 5HWBA 1JNTA 3MDYB 4DZ3A 2DT0A 3ALGA 3JXVA 1A7XA 2O92A 4JFIA 3PR9A 4TX0A 1NSGA 1JNDA 1TFVA 4GIVA 4J4OA 1F40A 1SYTA 1XHGA 4U85A 2KI3A 4LAXA 1N1AA 1QZ2A 4WJXA 5HT1A 1E6ZA 4HBOA 2PV3A 5HWCA 3PA7A 4JFKA 3ARPA 4TW8A 3TC5A 3G6MA 1QPFA 4ZS6A 3O5GA 1HJXA 3RFWA 4LAWA 3OOBA 2PPNA 1ZBWA 1LG1A 4WKHA 3UI5A 2JZVA 4ZPVR 4ODOA 1VF8A 1FKDA 1NWUA 4LGXA 4DRQA 5DEZA 4ITZA 3H9RB 4DIPA 2G41A 1Q1CA 1J6YA 1HKKA 3WL0A 2A3AA 1ROTA 4MGVA 5BXJA 2XPAA 1SR0A 1FKBA 2M08A 3ARUA 1D7IA 1W9VA 4DWSA 4Q22A 1B6CA 5B8IC 4J4NA 1LL4A 1W1TA 3KACA 1BL4A 2FAPA 4IPXA 2ITKA 1KT1A 1Q6UA 3TCZA 4DRHA 4DWSD 2L2SA 1NMVA 1JVWA 1OGGA 3PRDA 4WK9A 3WD4A 4DT4A 1X6LA 3WD1A 3AS2A 4S3JA 1U79A 1W26A 4W9OA 3O5JA 3WKZA 1OGBA 4DH0A 1FKJA 3B9AA 3O5RA 5GPRA 5GQBA 3KAFA 1WNOA 4MNMA 4ODLA 4KR0B 4L3NA 4JYSA 1WB0A 1EYMA 3KAGA 2KGJA 1FFQA 3NTPA 4LAYA 2A3EA 1IX5A 2F4EA 3WIJA 1WAWA 3IKDA 2MNTA 1KT0A 2WLZA 3TDBA 1D7JA 3ARQA 4MNJA 2AOSA 3BXWA 4NZCA 2KE0A 1ZL1A 3IHZA 3O5EA 1FKKA 2KO7A 2F21A 5DIVA 3EY6A 3ARRA 1HKMA 2AWGA 4PTMA 4W9QA 1ZBKA 1ZK6A 2XP9A 1W1VA 2DT1A 1C9HA 4AY1A 4WIWA 5HUAA 1FD9A 3KZ7A 4Z2KA 3ARSA 4QT3A 1J4HA 4XAKA 2RURA 2DT2A 4GGQA 3ARYA 1FKFA 3FXYA 3JYMA 2PPOA 3PRAA 1L1PA 4QZVB 1FAPA 2XP3A 3PRBA 4IQCA 2PV2A 2LJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAT A;  5DIT A;  1PIN A;  2VCD A;  1J6Y A;  5HW7 A;  4ITZ A;  1M5Y A;  3KAH A;  2OFN A;  4G2P A;  1ROT A;  4MGV A;  4DRP A;  5BXJ A;  4FN2 A;  2XPA A;  4LAV A;  1FKB A;  2M08 A;  4TNS A;  1J4I A;  4DRO A;  5HKG A;  2ZQS A;  5HW8 A;  1D7I A;  4C02 B;  5DIU A;  1B6C A;  2XP7 A;  2MLX A;  3O5L A;  3B7X A;  2DG4 A;  3O5I A;  5B8I C;  1P5Q A;  2LPV A;  4J4N A;  2K8I A;  2F2D A;  3O5F A;  5GPG A;  1HXV A;  1Y0O A;  3KAC A;  1BL4 A;  2IF4 A;  3KAI A;  2UZ5 A;  2FAP A;  2MF9 A;  2XP8 A;  4JFJ A;  4FAP A;  4IPX A;  2ITK A;  4G50 A;  1KT1 A;  3IKG A;  1Q6U A;  3TCZ A;  4DRH A;  1PBK A;  2RQS A;  3UF8 A;  5J6E A;  2L2S A;  3O5K A;  3UQI A;  1NMV A;  1JVW A;  2KR7 A;  4MSP A;  1JNS A;  3PRD A;  2Q5A A;  4DT4 A;  1TCO C;  4NNR A;  1ROU A;  4U84 A;  3IK8 A;  3O5Q A;  4IQ2 A;  4ODQ A;  1U79 A;  2ZR6 A;  3I6C A;  1W26 A;  1F8A B;  3O5J A;  4W9O A;  1FKT A;  4DH0 A;  1J4R A;  1FKJ A;  2M1I A;  2RUC A;  3O5R A;  3LUO A;  1T11 A;  4ODN A;  1FKS A;  4DRK A;  3UQA A;  3KAF A;  4QIB A;  3GPK A;  1D7H A;  4TYO A;  1EQ3 A;  4ODL A;  2Y78 A;  4JFL A;  2MLZ A;  5D75 A;  1FKI A;  1ZCN A;  2XP6 A;  2ZR5 A;  2FKE A;  3CGM A;  3NI6 A;  3ODK A;  4JYS A;  1EYM A;  4O2T A;  3KAG A;  2DG9 A;  4ODP A;  4TW6 A;  2KGJ A;  3UI6 A;  3UI4 A;  3NTP A;  3O5M A;  2RUD A;  4LAY A;  3VAW A;  3FAP A;  3O5P A;  4ODK A;  1Q6I A;  2F4E A;  2XP4 A;  4U86 A;  1BKF A;  1FKL A;  3RGC A;  5HWB A;  5HW6 A;  2ZQT A;  1JNT A;  3MDY B;  4DZ3 A;  3KAD A;  2XP5 A;  3IKD A;  2MNT A;  2VN1 A;  1KT0 A;  3JXV A;  4ODR A;  1A7X A;  4JFI A;  3TDB A;  4R0X A;  2DG3 A;  4DRM A;  1D7J A;  2ZQU A;  4DZ2 A;  4JFM A;  4TX0 A;  1FKR A;  1NSG A;  4GIV A;  4J4O A;  1F40 A;  2KE0 A;  3IHZ A;  2RUQ A;  2PBC A;  1FJD A;  3O5E A;  1FKK A;  4ODM A;  2KO7 A;  3NRK A;  2F21 A;  4TW7 A;  3UQB A;  5I98 A;  3CGN A;  4N19 A;  5DIV A;  4BF8 A;  4U85 A;  2MLY A;  4QT2 A;  2LGO A;  3EY6 A;  2KI3 A;  4DRN A;  3JYJ A;  4LAX A;  1N1A A;  2AWG A;  1QZ2 A;  2MPH A;  2ZR4 A;  4W9Q A;  3O5O A;  5HTG A;  2RSE A;  2ZQV A;  1ZK6 A;  5HT1 A;  4DRI A;  2XP9 A;  2PPP A;  1C9H A;  2PV1 A;  2KFW A;  2PV3 A;  5HWC A;  3PA7 A;  4JFK A;  5HUA A;  1FD9 A;  3KCE A;  3KZ7 A;  1D6O A;  4TW8 A;  1FKG A;  3TC5 A;  4QT3 A;  1QPF A;  1YW5 A;  2M2A A;  3O5G A;  1J4H A;  1QPL A;  3RFW A;  2RUR A;  4LAW A;  3WH0 A;  3KAB A;  3OOB A;  2PPN A;  4GGQ A;  1FKH A;  1NMW A;  1Q6H A;  3UI5 A;  2JZV A;  4W9P A;  3JYM A;  1FKF A;  2XPB A;  4DRJ A;  2PPO A;  1L1P A;  4ODO A;  2D9F A;  1FKD A;  1FAP A;  2XP3 A;  3PRB A;  2N87 A;  1R9H A;  3O5D A;  4IQC A;  4DRQ A;  2LKN A;  2PV2 A;  2LJ4 A;  3H9R B;  4DIP A;  1Q1C A; 
#chains in the Genus database with same CATH topology
 4ZPT R;  2WLY A;  2B5U B;  5DIT A;  2VCD A;  4MAV A;  1OWQ A;  1M5Y A;  2DSU A;  2OFN A;  3GTY X;  4FN2 A;  4TNS A;  2ESC A;  1E6P A;  4DRO A;  4Z2G A;  2XP7 A;  2MLX A;  2G8Z A;  3O5L A;  2DG4 A;  2LPV A;  4DWS B;  5GPG A;  2IF4 A;  2UZ5 A;  2XP8 A;  3CHF A;  3CH9 A;  1EDQ A;  4UDM A;  1PBK A;  2Q5A A;  1K9T A;  4NNR A;  3IK8 A;  3O5Q A;  4ODQ A;  1NWT A;  2ZR6 A;  5DF0 A;  1RD6 A;  1F8A B;  2DT3 A;  3UQA A;  2M1I A;  1ITX A;  1T11 A;  1H0G A;  1E9L A;  3CHC A;  3RM9 A;  2XP6 A;  4W9P A;  3CGM A;  2FKE A;  3NI6 A;  3ODK A;  4O2T A;  4DRM A;  4FAP A;  4DRK A;  1X6N A;  3UI6 A;  3O5M A;  1D2K A;  1CTN A;  4ODK A;  3CHD A;  2XP4 A;  1BKF A;  2P4V A;  5HW6 A;  2ZQT A;  1JNE A;  3CHE A;  3KAD A;  2VN1 A;  1ZBV A;  3RME A;  4IT4 A;  2DG3 A;  4DZ2 A;  1LQ0 A;  1ZBC A;  1FKR A;  2OLH A;  3B9D A;  2YBU A;  1GPF A;  2EUL A;  2PBC A;  1FJD A;  4ODM A;  4TW7 A;  5I98 A;  4R5E A;  2MLY A;  1NH6 A;  3ARO A;  2LGO A;  2O9O A;  4WKA A;  4DRN A;  3AQU A;  4IT6 A;  2MPH A;  2ZR4 A;  3WD2 A;  3O5O A;  2RSE A;  4DRI A;  1XRV A;  5DO2 A;  2PV1 A;  2KFW A;  3W4R A;  4Z2H A;  3KCE A;  1FKG A;  1HKI A;  1YW5 A;  2M2A A;  3BMB A;  3WH0 A;  4P8U A;  1FKH A;  1NMW A;  1Q6H A;  1W9P A;  1FFR A;  3OA5 A;  2N87 A;  1R9H A;  4Q7N A;  1YAT A;  1PIN A;  5HW7 A;  4NSB A;  3GU0 A;  4W5U A;  4G2P A;  4S3K A;  3AS0 A;  1J4I A;  2ZQS A;  1E6R A;  3ARW A;  4P8X A;  4C02 B;  3B8S A;  1EIB A;  4MNL A;  5DIU A;  2QF8 A;  3B7X A;  1E44 A;  4ML4 A;  1HKJ A;  4HAR A;  1O6I A;  2A3B A;  3AS1 A;  3KAI A;  4JFJ A;  4G50 A;  3RM8 A;  1HJW A;  3UF8 A;  5J6E A;  3O5K A;  3UQI A;  2KR7 A;  4P8V A;  1TCO C;  3B9E A;  4U84 A;  4URI A;  4MTV A;  1J4R A;  4ODN A;  2RUC A;  3LUO A;  1GOI A;  4QIB A;  3G6L A;  1W1P A;  2ZR5 A;  2DSZ A;  1H0I A;  3ART A;  4TW6 A;  4L72 B;  1LL6 A;  1NWR A;  1W1Y A;  3O5P A;  1Q6I A;  1UR8 A;  2XP5 A;  4ODR A;  4R0X A;  2ZQU A;  4JFM A;  1HJV A;  5JH8 A;  1EHN A;  2RUQ A;  3UQB A;  2B31 A;  3NRK A;  4Z2I A;  3CGN A;  4N19 A;  4BF8 A;  3ARX A;  4QT2 A;  4DWS C;  3FY1 A;  3AS3 A;  3JYJ A;  3WL1 A;  5HTG A;  2ZQV A;  3WQW A;  2PPP A;  1E15 A;  1W9U A;  3EIP A;  1D6O A;  4P8W A;  2DSW A;  1QPL A;  4Z2J A;  3KAB A;  1ZU8 A;  2XPB A;  4DRJ A;  2D9F A;  3RM4 A;  2DPE A;  3O5D A;  1ZB5 A;  2LKN A;  2A3C A;  3ARZ A;  3QOK A;  4ZPW R;  1LJY A;  3KAH A;  3WD3 A;  4DRP A;  4LAV A;  3ALF A;  5HKG A;  5HW8 A;  5HBF A;  2WK2 A;  2YBT A;  1UR9 A;  3WQV A;  2WM0 A;  2FDM A;  2DSV A;  3O5I A;  3CZ8 A;  1P5Q A;  1HXV A;  1NWS A;  2F2D A;  2K8I A;  3O5F A;  3WD0 A;  2PI6 A;  1Y0O A;  4MNK A;  4WKF A;  4KQZ A;  2MF9 A;  1KFW A;  1LG2 A;  3IKG A;  4Z2L A;  2RQS A;  1LL7 A;  4MSP A;  1JNS A;  1ROU A;  2F23 A;  4IQ2 A;  3I6C A;  1FKT A;  1E6N A;  1FKS A;  3GPK A;  1D7H A;  4TYO A;  1EQ3 A;  2Y78 A;  4JFL A;  2MLZ A;  5D75 A;  1FKI A;  1ZCN A;  4ODP A;  3UI4 A;  2DG9 A;  2RUD A;  4MPK A;  3VAW A;  3ARV A;  1GUV A;  3FAP A;  4U86 A;  4HBE A;  1FKL A;  2IUZ A;  3RGC A;  5HWB A;  1JNT A;  3MDY B;  4DZ3 A;  2DT0 A;  3ALG A;  3JXV A;  1GRJ A;  1A7X A;  2O92 A;  4JFI A;  3PR9 A;  4TX0 A;  1NSG A;  1JND A;  1TFV A;  4GIV A;  4J4O A;  1F40 A;  1SYT A;  1XHG A;  4U85 A;  2KI3 A;  4LAX A;  1N1A A;  1QZ2 A;  4WJX A;  5HT1 A;  1E6Z A;  4HBO A;  2PV3 A;  5HWC A;  3PA7 A;  4JFK A;  3ARP A;  4TW8 A;  3TC5 A;  3G6M A;  1QPF A;  4ZS6 A;  3O5G A;  1HJX A;  3RFW A;  4LAW A;  3OOB A;  2PPN A;  1ZBW A;  1LG1 A;  4WKH A;  3UI5 A;  2JZV A;  4ZPV R;  4ODO A;  1VF8 A;  1FKD A;  1NWU A;  4LGX A;  4DRQ A;  5DEZ A;  4ITZ A;  3H9R B;  4DIP A;  2G41 A;  1Q1C A;  1J6Y A;  1HKK A;  3WL0 A;  2A3A A;  1ROT A;  4MGV A;  5BXJ A;  2XPA A;  1SR0 A;  1FKB A;  2M08 A;  3ARU A;  2PN0 A;  1D7I A;  1W9V A;  4DWS A;  4Q22 A;  1B6C A;  1JCH B;  5B8I C;  4J4N A;  1LL4 A;  1W1T A;  3KAC A;  1BL4 A;  2FAP A;  4IPX A;  2ITK A;  1KT1 A;  1Q6U A;  3TCZ A;  4DRH A;  4DWS D;  2L2S A;  1NMV A;  1JVW A;  1OGG A;  3PRD A;  4WK9 A;  3WD4 A;  4DT4 A;  1X6L A;  3WD1 A;  3AS2 A;  4S3J A;  1U79 A;  1W26 A;  4W9O A;  3O5J A;  3WKZ A;  1OGB A;  4DH0 A;  1FKJ A;  3B9A A;  3O5R A;  5GPR A;  5GQB A;  3KAF A;  1WNO A;  4MNM A;  4ODL A;  4KR0 B;  4L3N A;  2ETN A;  4JYS A;  1WB0 A;  1EYM A;  3KAG A;  2KGJ A;  1FFQ A;  3NTP A;  4LAY A;  2A3E A;  1IX5 A;  2F4E A;  3WIJ A;  1WAW A;  3IKD A;  2MNT A;  1KT0 A;  2WLZ A;  3TDB A;  1D7J A;  3ARQ A;  4MNJ A;  2AOS A;  3BXW A;  4NZC A;  2KE0 A;  1ZL1 A;  3IHZ A;  3O5E A;  1FKK A;  2KO7 A;  2F21 A;  5DIV A;  3EY6 A;  3ARR A;  1HKM A;  2AWG A;  4PTM A;  4W9Q A;  1ZBK A;  1ZK6 A;  2XP9 A;  1W1V A;  2DT1 A;  1C9H A;  4AY1 A;  4WIW A;  5HUA A;  1FD9 A;  3KZ7 A;  4Z2K A;  3ARS A;  4QT3 A;  1J4H A;  4XAK A;  2RUR A;  2DT2 A;  4GGQ A;  3ARY A;  1FKF A;  3FXY A;  3JYM A;  2PPO A;  3PRA A;  1L1P A;  4QZV B;  1FAP A;  2XP3 A;  3PRB A;  4IQC A;  2PV2 A;  2LJ4 A; 
#chains in the Genus database with same CATH homology
 4ZPT R;  2WLY A;  5DIT A;  2VCD A;  4MAV A;  1OWQ A;  1M5Y A;  2DSU A;  2OFN A;  4FN2 A;  4TNS A;  2ESC A;  1E6P A;  4DRO A;  4Z2G A;  2XP7 A;  2MLX A;  2G8Z A;  3O5L A;  2DG4 A;  2LPV A;  4DWS B;  5GPG A;  2IF4 A;  2UZ5 A;  2XP8 A;  3CHF A;  3CH9 A;  1EDQ A;  1PBK A;  2Q5A A;  1K9T A;  4NNR A;  3IK8 A;  3O5Q A;  4ODQ A;  1NWT A;  2ZR6 A;  5DF0 A;  1RD6 A;  1F8A B;  2DT3 A;  3UQA A;  2M1I A;  1ITX A;  1T11 A;  1H0G A;  1E9L A;  3CHC A;  3RM9 A;  2XP6 A;  4W9P A;  3CGM A;  2FKE A;  3NI6 A;  3ODK A;  4O2T A;  4DRM A;  4FAP A;  4DRK A;  1X6N A;  3UI6 A;  3O5M A;  1D2K A;  1CTN A;  4ODK A;  3CHD A;  2XP4 A;  1BKF A;  5HW6 A;  2ZQT A;  1JNE A;  3CHE A;  3KAD A;  2VN1 A;  1ZBV A;  3RME A;  4IT4 A;  2DG3 A;  4DZ2 A;  1LQ0 A;  1ZBC A;  1FKR A;  2OLH A;  3B9D A;  2YBU A;  1GPF A;  2PBC A;  1FJD A;  4ODM A;  4TW7 A;  5I98 A;  4R5E A;  2MLY A;  1NH6 A;  3ARO A;  2LGO A;  2O9O A;  4WKA A;  4DRN A;  3AQU A;  4IT6 A;  2MPH A;  2ZR4 A;  3WD2 A;  3O5O A;  2RSE A;  4DRI A;  1XRV A;  5DO2 A;  2PV1 A;  2KFW A;  3W4R A;  4Z2H A;  3KCE A;  1FKG A;  1HKI A;  1YW5 A;  2M2A A;  3WH0 A;  4P8U A;  1FKH A;  1NMW A;  1Q6H A;  1W9P A;  1FFR A;  3OA5 A;  2N87 A;  1R9H A;  4Q7N A;  1YAT A;  1PIN A;  5HW7 A;  4NSB A;  4W5U A;  4G2P A;  4S3K A;  3AS0 A;  1J4I A;  2ZQS A;  1E6R A;  3ARW A;  4P8X A;  4C02 B;  3B8S A;  1EIB A;  4MNL A;  5DIU A;  2QF8 A;  3B7X A;  4ML4 A;  1HKJ A;  4HAR A;  1O6I A;  2A3B A;  3AS1 A;  3KAI A;  4JFJ A;  4G50 A;  3RM8 A;  1HJW A;  3UF8 A;  5J6E A;  3O5K A;  3UQI A;  2KR7 A;  4P8V A;  1TCO C;  3B9E A;  4U84 A;  4URI A;  4MTV A;  1J4R A;  4ODN A;  2RUC A;  3LUO A;  1GOI A;  4QIB A;  3G6L A;  1W1P A;  2ZR5 A;  2DSZ A;  1H0I A;  3ART A;  4TW6 A;  4L72 B;  1LL6 A;  1NWR A;  1W1Y A;  3O5P A;  1Q6I A;  1UR8 A;  2XP5 A;  4ODR A;  4R0X A;  2ZQU A;  4JFM A;  1HJV A;  5JH8 A;  1EHN A;  2RUQ A;  3UQB A;  2B31 A;  3NRK A;  4Z2I A;  3CGN A;  4N19 A;  4BF8 A;  3ARX A;  4QT2 A;  4DWS C;  3FY1 A;  3AS3 A;  3JYJ A;  3WL1 A;  5HTG A;  2ZQV A;  3WQW A;  2PPP A;  1E15 A;  1W9U A;  1D6O A;  4P8W A;  2DSW A;  1QPL A;  4Z2J A;  3KAB A;  1ZU8 A;  2XPB A;  4DRJ A;  2D9F A;  3RM4 A;  2DPE A;  3O5D A;  1ZB5 A;  2LKN A;  2A3C A;  3ARZ A;  3QOK A;  4ZPW R;  1LJY A;  3KAH A;  3WD3 A;  4DRP A;  4LAV A;  3ALF A;  5HKG A;  5HW8 A;  5HBF A;  2WK2 A;  2YBT A;  1UR9 A;  3WQV A;  2WM0 A;  2FDM A;  2DSV A;  3O5I A;  3CZ8 A;  1P5Q A;  1HXV A;  1NWS A;  2F2D A;  2K8I A;  3O5F A;  3WD0 A;  2PI6 A;  1Y0O A;  4MNK A;  4WKF A;  4KQZ A;  2MF9 A;  1KFW A;  1LG2 A;  3IKG A;  4Z2L A;  2RQS A;  1LL7 A;  4MSP A;  1JNS A;  1ROU A;  4IQ2 A;  3I6C A;  1FKT A;  1E6N A;  1FKS A;  3GPK A;  1D7H A;  4TYO A;  1EQ3 A;  2Y78 A;  4JFL A;  2MLZ A;  5D75 A;  1FKI A;  1ZCN A;  4ODP A;  3UI4 A;  2DG9 A;  2RUD A;  4MPK A;  3VAW A;  3ARV A;  1GUV A;  3FAP A;  4U86 A;  4HBE A;  1FKL A;  2IUZ A;  3RGC A;  5HWB A;  1JNT A;  3MDY B;  4DZ3 A;  2DT0 A;  3ALG A;  3JXV A;  1A7X A;  2O92 A;  4JFI A;  3PR9 A;  4TX0 A;  1NSG A;  1JND A;  1TFV A;  4GIV A;  4J4O A;  1F40 A;  1SYT A;  1XHG A;  4U85 A;  2KI3 A;  4LAX A;  1N1A A;  1QZ2 A;  4WJX A;  5HT1 A;  1E6Z A;  4HBO A;  2PV3 A;  5HWC A;  3PA7 A;  4JFK A;  3ARP A;  4TW8 A;  3TC5 A;  3G6M A;  1QPF A;  4ZS6 A;  3O5G A;  1HJX A;  3RFW A;  4LAW A;  3OOB A;  2PPN A;  1ZBW A;  1LG1 A;  4WKH A;  3UI5 A;  2JZV A;  4ZPV R;  4ODO A;  1VF8 A;  1FKD A;  1NWU A;  4LGX A;  4DRQ A;  5DEZ A;  4ITZ A;  3H9R B;  4DIP A;  2G41 A;  1Q1C A;  1J6Y A;  1HKK A;  3WL0 A;  2A3A A;  1ROT A;  4MGV A;  5BXJ A;  2XPA A;  1SR0 A;  1FKB A;  2M08 A;  3ARU A;  1D7I A;  1W9V A;  4DWS A;  4Q22 A;  1B6C A;  5B8I C;  4J4N A;  1LL4 A;  1W1T A;  3KAC A;  1BL4 A;  2FAP A;  4IPX A;  2ITK A;  1KT1 A;  1Q6U A;  3TCZ A;  4DRH A;  4DWS D;  2L2S A;  1NMV A;  1JVW A;  1OGG A;  3PRD A;  4WK9 A;  3WD4 A;  4DT4 A;  1X6L A;  3WD1 A;  3AS2 A;  4S3J A;  1U79 A;  1W26 A;  4W9O A;  3O5J A;  3WKZ A;  1OGB A;  4DH0 A;  1FKJ A;  3B9A A;  3O5R A;  5GPR A;  5GQB A;  3KAF A;  1WNO A;  4MNM A;  4ODL A;  4KR0 B;  4L3N A;  4JYS A;  1WB0 A;  1EYM A;  3KAG A;  2KGJ A;  1FFQ A;  3NTP A;  4LAY A;  2A3E A;  1IX5 A;  2F4E A;  3WIJ A;  1WAW A;  3IKD A;  2MNT A;  1KT0 A;  2WLZ A;  3TDB A;  1D7J A;  3ARQ A;  4MNJ A;  2AOS A;  3BXW A;  4NZC A;  2KE0 A;  1ZL1 A;  3IHZ A;  3O5E A;  1FKK A;  2KO7 A;  2F21 A;  5DIV A;  3EY6 A;  3ARR A;  1HKM A;  2AWG A;  4PTM A;  4W9Q A;  1ZBK A;  1ZK6 A;  2XP9 A;  1W1V A;  2DT1 A;  1C9H A;  4AY1 A;  4WIW A;  5HUA A;  1FD9 A;  3KZ7 A;  4Z2K A;  3ARS A;  4QT3 A;  1J4H A;  4XAK A;  2RUR A;  2DT2 A;  4GGQ A;  3ARY A;  1FKF A;  3FXY A;  3JYM A;  2PPO A;  3PRA A;  1L1P A;  4QZV B;  1FAP A;  2XP3 A;  3PRB A;  4IQC A;  2PV2 A;  2LJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...