3H9RB

Crystal structure of the kinase domain of type i activin receptor (acvr1) in complex with fkbp12 and dorsomorphin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activin receptor type-1
publication title Structure of the Bone Morphogenetic Protein Receptor ALK2 and Implications for Fibrodysplasia Ossificans Progressiva.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/protein kinase
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3h9rB00
3IKGA 3O5LA 2PBCA 5D75A 3WH0A 4J4NA 4BF8A 3JYMA 1FKBA 3KADA 1Q1CA 4DROA 1JNTA 2DG9A 3TC5A 1Y0OA 1T11A 3GPKA 1NMWA 3KAFA 4TW7A 4LAWA 2K8IA 4FAPA 2KI3A 1J4RA 3KAHA 2ZQUA 4JFMA 1D6OA 1FKGA 4ODOA 2ZQVA 4DRKA 2MLZA 3FAPA 4G50A 1ZK6A 2F4EA 1FKIA 4GGQA 1J4IA 1QPLA 2XP7A 4JFLA 4W9QA 3UQAA 2KE0A 3EY6A 4U86A 4QT2A 3H9RB 3RGCA 2LPVA 1BKFA 3KABA 2N87A 1BL4A 1FKHA 3B7XA 3NRKA 2D9FA 4JFKA 3NTPA 4DH0A 4JFIA 1FKJA 5GPGA 2LJ4A 1J4HA 2XPBA 1FKLA 3KACA 1KT1A 2Y78A 3O5JA 2F21A 5I98A 4N19A 3UQBA 2DG3A 4W9PA 1KT0A 1TCOC 3TDBA 5HW6A 3O5DA 3O5QA 2XP4A 2OFNA 2MLYA 1YATA 2M2AA 3O5RA 4QIBA 4TW8A 1PINA 4DRIA 2XP8A 4U85A 2MPHA 5BXJA 1F8AB 4DRJA 2XP5A 1P5QA 2ZR6A 2RSEA 1W26A 2PPOA 1B6CA 3KCEA 1NMVA 5HWCA 4O2TA 1EQ3A 4ODQA 4DRQA 3UI4A 4TNSA 2JZVA 5HWBA 5HTGA 2RURA 4DT4A 4MSPA 1ZCNA 1M5YA 1FKSA 1D7JA 4R0XA 4TW6A 3VAWA 2L2SA 3KZ7A 3PRDA 1FJDA 1Q6HA 4G2PA 1NSGA 1ROTA 2DG4A 2KFWA 4MGVA 4DRPA 1EYMA 2VN1A 1JNSA 1U79A 1QZ2A 3I6CA 3O5PA 2KO7A 4LAXA 4DRHA 4DRMA 4DRNA 3JXVA 5B8IC 2ZQTA 1R9HA 4ODMA 3NI6A 4U84A 1YW5A 1N1AA 1HXVA 4FN2A 2AWGA 3LUOA 3UF8A 4IQ2A 1QPFA 2RUQA 5DITA 2F2DA 1D7HA 1JVWA 2VCDA 3UI6A 1FKKA 3PRBA 4LAVA 4DZ2A 5HW8A 5HW7A 3TCZA 4ODKA 5HUAA 3RFWA 2PV3A 3IKDA 3KAIA 4ODPA 2PPPA 2PV1A 2XP9A 3PA7A 2M08A 2KR7A 3CGNA 3JYJA 3ODKA 2XPAA 4IPXA 4QT3A 2FKEA 2RQSA 1ROUA 2RUCA 1Q6UA 3IHZA 3O5OA 3O5GA 1L1PA 2ZR5A 2XP3A 3O5KA 3UQIA 3O5FA 5DIVA 2RUDA 4DZ3A 1PBKA 4JFJA 2LKNA 2Q5AA 2MLXA 4ODNA 4TX0A 3KAGA 3MDYB 4IQCA 4ODLA 2MF9A 3O5EA 2LGOA 1FKTA 4ITZA 1FKFA 5HKGA 1FKRA 5J6EA 2XP6A 2ZR4A 4W9OA 4JYSA 1F40A 1D7IA 2KGJA 2IF4A 2UZ5A 3O5IA 5DIUA 2MNTA 3OOBA 3O5MA 2ZQSA 4GIVA 2FAPA 2PV2A 1FD9A 4NNRA 4C02B 2PPNA 2M1IA 4ODRA 4TYOA 3CGMA 3IK8A 1J6YA 4LAYA 1C9HA 4J4OA 5HT1A 3UI5A 1Q6IA 1FAPA 4DIPA 1FKDA 2ITKA 1A7XA
chains in the Genus database with same CATH superfamily
3WQWA 1LG1A 1Q1CA 2DG9A 4HARA 4AY1A 3KAFA 2K8IA 4JFMA 3KAHA 1D6OA 3G6MA 2DSVA 3FAPA 4QZVB 4G50A 2F4EA 1FKIA 1NH6A 1ZBCA 3ARUA 1E6PA 3WD1A 3KABA 1BL4A 1FKHA 2FDMA 5HBFA 1UR8A 1W9PA 4UDMA 4S3KA 2O92A 1NWSA 1GUVA 4P8WA 2F21A 1E9LA 2DG3A 4ZS6A 1KT0A 1TCOC 3O5DA 1LQ0A 1WB0A 3O5RA 4TW8A 3BXWA 1NWTA 2OLHA 1P5QA 1H0IA 1W26A 1B6CA 2F23A 4Z2JA 4Z2KA 3AROA 4DRQA 2JZVA 4ZPVR 4MNJA 4XAKA 2PN0A 4TW6A 1W1YA 4PTMA 1E6RA 1D2KA 3PRDA 4Z2GA 1NSGA 1ROTA 4DRPA 5B8IC 2WK2A 4LAXA 1HJWA 1JCHB 3WQVA 2WLZA 4U84A 1NWRA 2AWGA 3LUOA 5DITA 5DEZA 3WD4A 2VCDA 3UI6A 1FKKA 3ARSA 1E15A 3CHFA 3RFWA 2PV1A 2XP9A 3ALFA 2KR7A 3ODKA 4TYOA 2FKEA 4WKFA 3IHZA 3WL1A 2ZR5A 2XP3A 3WD2A 2LKNA 3ALGA 4S3JA 1SYTA 2MF9A 1RD6A 2IUZA 3AS0A 4MAVA 1OWQA 3OA5A 1XRVA 5J6EA 2ZR4A 3B8SA 2KGJA 5DIUA 3OOBA 1OGBA 4MTVA 2FAPA 1FD9A 4NNRA 4C02B 2M1IA 2YBUA 3CGMA 1J6YA 4DIPA 5HT1A 1NWUA 1FAPA 1FKDA 3IKGA 1HKKA 5D75A 1K9TA 4J4NA 4WJXA 3JYMA 1W1VA 1JNDA 4BF8A 1FKBA 1W1TA 2A3AA 4DROA 4DWSC 1Y0OA 4TW7A 3GPKA 4DWSA 4LAWA 4FAPA 2KI3A 1J4RA 2DSZA 2MLZA 3CHDA 3RM4A 4JFLA 1QPLA 3RM8A 3EY6A 4U86A 4QT2A 3RGCA 2LPVA 1BKFA 3FXYA 2D9FA 4JFKA 1FKJA 2LJ4A 2XPBA 2WLYA 4MNMA 4N19A 3UQBA 4NZCA 1ZB5A 2XP4A 2MLYA 1YATA 3G6LA 4DRIA 4URIA 3ARPA 4U85A 5BXJA 4DRJA 2XP5A 2ZR6A 2DSUA 3BMBA 1NMVA 1FFRA 2DT1A 4HBEA 1EQ3A 4ODQA 1W9UA 3UI4A 3ARVA 5HTGA 1M5YA 4Q22A 1GPFA 1OGGA 1KFWA 1Q6HA 1JNSA 2KFWA 2VN1A 2KO7A 4DRMA 3CZ8A 1R9HA 1YW5A 1IX5A 3GTYX 1HXVA 4MNKA 4IQ2A 1QPFA 2RUQA 1JVWA 4IT4A 4Z2IA 3TCZA 5HUAA 4MNLA 3WKZA 2PPPA 4WKHA 4L72B 3AQUA 3JYJA 1ZL1A 4IPXA 4Q7NA 3O5OA 1L1PA 3O5KA 3EIPA 5DIVA 4DZ3A 4JFJA 2ETNA 2MLXA 3MDYB 1O6IA 4ODLA 4HBOA 3O5EA 4L3NA 1EHNA 2LGOA 3B9EA 1FKTA 3RMEA 1FKRA 2B5UB 2P4VA 2DPEA 1X6NA 4ML4A 1ZU8A 2PV2A 1LJYA 3IK8A 1ZBKA 2ITKA 1A7XA 3O5LA 3QOKA 1LG2A 2PBCA 3WH0A 1WAWA 3KADA 1JNTA 3WD0A 1T11A 1FFQA 1LL7A 4Z2HA 2DT0A 1HKMA 2ZQVA 4ZPWR 1ZK6A 1J4IA 1TFVA 1SR0A 2YBTA 5DO2A 2N87A 3B7XA 4DH0A 4DWSB 4JFIA 5GPGA 1LL6A 1J4HA 3KACA 1HKJA 2Y78A 3O5JA 4QIBA 3ARYA 3AS2A 2ESCA 4NSBA 2A3CA 2PPOA 5DF0A 1JNEA 4TNSA 5HWBA 2RURA 4DT4A 1ZCNA 3FY1A 4R0XA 3VAWA 3CHCA 2L2SA 3KZ7A 4LGXA 4G2PA 4MGVA 2A3EA 2DG4A 1EYMA 1U79A 3O5PA 3B9DA 1GOIA 3JXVA 2AOSA 2ZQTA 4WK9A 1W9VA 4FN2A 4R5EA 4KQZA 4LAVA 5HW8A 5HW7A 2PV3A 3IKDA 3KAIA 3WD3A 1X6LA 2M08A 4QT3A 1ROUA 3O5GA 3AS3A 3O5FA 3WL0A 2RUDA 2A3BA 1PBKA 3AS1A 3GU0A 3KAGA 4TX0A 4IQCA 4IT6A 4ITZA 1E44A 2XP6A 4JYSA 1F40A 1D7IA 3O5IA 1UR9A 5JH8A 2PPNA 4ODRA 4LAYA 4J4OA 4ODOA 2DSWA 4WKAA 1W1PA 3TC5A 2EULA 1NMWA 2B31A 4Z2LA 2ZQUA 1FKGA 1LL4A 4DRKA 3ARTA 4GGQA 4W9QA 2XP7A 3UQAA 2KE0A 1ZBWA 1HJVA 3H9RB 2DT3A 1HJXA 1EDQA 1CTNA 3NRKA 3NTPA 1FKLA 4KR0B 1KT1A 4ZPTR 5I98A 4W9PA 3PRAA 3TDBA 5HW6A 1H0GA 3O5QA 3WIJA 4P8VA 2OFNA 2M2AA 3CHEA 3W4RA 1PINA 2XP8A 5GPRA 3B9AA 2MPHA 2PI6A 1F8AB 3ARXA 4P8XA 2DT2A 2RSEA 3KCEA 5HWCA 4O2TA 1XHGA 2O9OA 3ARZA 4MPKA 4MSPA 1FKSA 1D7JA 1FJDA 4P8UA 3ARRA 3CH9A 1QZ2A 2QF8A 3ARQA 3I6CA 4DRNA 4DRHA 1WNOA 4ODMA 3NI6A 1N1AA 1EIBA 3UF8A 2F2DA 1D7HA 3PR9A 3PRBA 2WM0A 4DZ2A 4ODKA 1VF8A 5GQBA 4DWSD 1HKIA 4ODPA 3PA7A 3CGNA 3RM9A 2XPAA 4WIWA 2RQSA 2RUCA 3ARWA 1Q6UA 1GRJA 3UQIA 2Q5AA 1ITXA 2G41A 4ODNA 1E6NA 1E6ZA 4W5UA 5HKGA 1FKFA 4W9OA 2IF4A 2UZ5A 2MNTA 1ZBVA 3O5MA 2ZQSA 2G8ZA 4GIVA 1C9HA 3UI5A 1Q6IA
chains in the Genus database with same CATH topology
3WQWA 1LG1A 1Q1CA 2DG9A 4HARA 4AY1A 3KAFA 2K8IA 4JFMA 3KAHA 1D6OA 3G6MA 2DSVA 3FAPA 4QZVB 4G50A 2F4EA 1FKIA 1NH6A 1ZBCA 3ARUA 1E6PA 3WD1A 3KABA 1BL4A 1FKHA 2FDMA 5HBFA 1UR8A 1W9PA 4S3KA 2O92A 1NWSA 1GUVA 4P8WA 2F21A 1E9LA 2DG3A 4ZS6A 1KT0A 1TCOC 3O5DA 1LQ0A 1WB0A 3O5RA 4TW8A 3BXWA 1NWTA 2OLHA 1P5QA 1H0IA 1W26A 1B6CA 4Z2JA 4Z2KA 3AROA 4DRQA 2JZVA 4ZPVR 4MNJA 4XAKA 4TW6A 1W1YA 4PTMA 1E6RA 1D2KA 3PRDA 4Z2GA 1NSGA 1ROTA 4DRPA 5B8IC 2WK2A 4LAXA 1HJWA 3WQVA 2WLZA 4U84A 1NWRA 2AWGA 3LUOA 5DITA 5DEZA 3WD4A 2VCDA 3UI6A 1FKKA 3ARSA 1E15A 3CHFA 3RFWA 2PV1A 2XP9A 3ALFA 2KR7A 3ODKA 4TYOA 2FKEA 4WKFA 3IHZA 3WL1A 2ZR5A 2XP3A 3WD2A 2LKNA 3ALGA 4S3JA 1SYTA 2MF9A 1RD6A 2IUZA 3AS0A 4MAVA 1OWQA 3OA5A 1XRVA 5J6EA 2ZR4A 3B8SA 2KGJA 5DIUA 3OOBA 1OGBA 4MTVA 2FAPA 1FD9A 4NNRA 4C02B 2M1IA 2YBUA 3CGMA 1J6YA 4DIPA 5HT1A 1NWUA 1FAPA 1FKDA 3IKGA 1HKKA 5D75A 1K9TA 4J4NA 4WJXA 3JYMA 1W1VA 1JNDA 4BF8A 1FKBA 1W1TA 2A3AA 4DROA 4DWSC 1Y0OA 4TW7A 3GPKA 4DWSA 4LAWA 4FAPA 2KI3A 1J4RA 2DSZA 2MLZA 3CHDA 3RM4A 4JFLA 1QPLA 3RM8A 3EY6A 4U86A 4QT2A 3RGCA 2LPVA 1BKFA 3FXYA 2D9FA 4JFKA 1FKJA 2LJ4A 2XPBA 2WLYA 4MNMA 4N19A 3UQBA 4NZCA 1ZB5A 2XP4A 2MLYA 1YATA 3G6LA 4DRIA 4URIA 3ARPA 4U85A 5BXJA 4DRJA 2XP5A 2ZR6A 2DSUA 1NMVA 1FFRA 2DT1A 4HBEA 1EQ3A 4ODQA 1W9UA 3UI4A 3ARVA 5HTGA 1M5YA 4Q22A 1GPFA 1OGGA 1KFWA 1Q6HA 1JNSA 2KFWA 2VN1A 2KO7A 4DRMA 3CZ8A 1R9HA 1YW5A 1IX5A 1HXVA 4MNKA 4IQ2A 1QPFA 2RUQA 1JVWA 4IT4A 4Z2IA 3TCZA 5HUAA 4MNLA 3WKZA 2PPPA 4WKHA 4L72B 3AQUA 3JYJA 1ZL1A 4IPXA 4Q7NA 3O5OA 1L1PA 3O5KA 5DIVA 4DZ3A 4JFJA 2MLXA 3MDYB 1O6IA 4ODLA 4HBOA 3O5EA 4L3NA 1EHNA 2LGOA 3B9EA 1FKTA 3RMEA 1FKRA 2DPEA 1X6NA 4ML4A 1ZU8A 2PV2A 1LJYA 3IK8A 1ZBKA 2ITKA 1A7XA 3O5LA 3QOKA 1LG2A 2PBCA 3WH0A 1WAWA 3KADA 1JNTA 3WD0A 1T11A 1FFQA 1LL7A 4Z2HA 2DT0A 1HKMA 2ZQVA 4ZPWR 1ZK6A 1J4IA 1TFVA 1SR0A 2YBTA 5DO2A 2N87A 3B7XA 4DH0A 4DWSB 4JFIA 5GPGA 1LL6A 1J4HA 3KACA 1HKJA 2Y78A 3O5JA 4QIBA 3ARYA 3AS2A 2ESCA 4NSBA 2A3CA 2PPOA 5DF0A 1JNEA 4TNSA 5HWBA 2RURA 4DT4A 1ZCNA 3FY1A 4R0XA 3VAWA 3CHCA 2L2SA 3KZ7A 4LGXA 4G2PA 4MGVA 2A3EA 2DG4A 1EYMA 3O5PA 1U79A 3B9DA 1GOIA 3JXVA 2AOSA 2ZQTA 4WK9A 1W9VA 4FN2A 4R5EA 4KQZA 4LAVA 5HW8A 5HW7A 2PV3A 3IKDA 3KAIA 3WD3A 1X6LA 2M08A 4QT3A 1ROUA 3O5GA 3AS3A 3O5FA 3WL0A 2RUDA 2A3BA 1PBKA 3AS1A 4TX0A 3KAGA 4IQCA 4IT6A 4ITZA 2XP6A 4JYSA 1F40A 1D7IA 3O5IA 1UR9A 5JH8A 2PPNA 4ODRA 4LAYA 4J4OA 4ODOA 2DSWA 4WKAA 1W1PA 3TC5A 1NMWA 2B31A 4Z2LA 2ZQUA 1FKGA 1LL4A 4DRKA 3ARTA 4GGQA 4W9QA 2XP7A 3UQAA 2KE0A 1ZBWA 1HJVA 3H9RB 2DT3A 1HJXA 1EDQA 1CTNA 3NRKA 3NTPA 1FKLA 4KR0B 1KT1A 4ZPTR 5I98A 4W9PA 3PRAA 3TDBA 5HW6A 1H0GA 3O5QA 3WIJA 4P8VA 2OFNA 2M2AA 3CHEA 3W4RA 1PINA 2XP8A 5GPRA 3B9AA 2MPHA 2PI6A 1F8AB 3ARXA 4P8XA 2DT2A 2RSEA 3KCEA 5HWCA 4O2TA 1XHGA 2O9OA 3ARZA 4MPKA 4MSPA 1FKSA 1D7JA 1FJDA 4P8UA 3ARRA 3I6CA 1QZ2A 2QF8A 3ARQA 3CH9A 4DRNA 4DRHA 1WNOA 4ODMA 3NI6A 1N1AA 1EIBA 3UF8A 2F2DA 1D7HA 3PR9A 3PRBA 2WM0A 4DZ2A 4ODKA 1VF8A 5GQBA 4DWSD 1HKIA 4ODPA 3PA7A 3CGNA 3RM9A 2XPAA 4WIWA 2RQSA 2RUCA 3ARWA 1Q6UA 3UQIA 2Q5AA 1ITXA 2G41A 4ODNA 1E6NA 1E6ZA 4W5UA 5HKGA 1FKFA 4W9OA 2IF4A 2UZ5A 2MNTA 1ZBVA 3O5MA 2ZQSA 2G8ZA 4GIVA 1C9HA 3UI5A 1Q6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKG A;  3O5L A;  2PBC A;  5D75 A;  3WH0 A;  4J4N A;  4BF8 A;  3JYM A;  1FKB A;  3KAD A;  1Q1C A;  4DRO A;  1JNT A;  2DG9 A;  3TC5 A;  1Y0O A;  1T11 A;  3GPK A;  1NMW A;  3KAF A;  4TW7 A;  4LAW A;  2K8I A;  4FAP A;  2KI3 A;  1J4R A;  3KAH A;  2ZQU A;  4JFM A;  1D6O A;  1FKG A;  4ODO A;  2ZQV A;  4DRK A;  2MLZ A;  3FAP A;  4G50 A;  1ZK6 A;  2F4E A;  1FKI A;  4GGQ A;  1J4I A;  1QPL A;  2XP7 A;  4JFL A;  4W9Q A;  3UQA A;  2KE0 A;  3EY6 A;  4U86 A;  4QT2 A;  3H9R B;  3RGC A;  2LPV A;  1BKF A;  3KAB A;  2N87 A;  1BL4 A;  1FKH A;  3B7X A;  3NRK A;  2D9F A;  4JFK A;  3NTP A;  4DH0 A;  4JFI A;  1FKJ A;  5GPG A;  2LJ4 A;  1J4H A;  2XPB A;  1FKL A;  3KAC A;  1KT1 A;  2Y78 A;  3O5J A;  2F21 A;  5I98 A;  4N19 A;  3UQB A;  2DG3 A;  4W9P A;  1KT0 A;  1TCO C;  3TDB A;  5HW6 A;  3O5D A;  3O5Q A;  2XP4 A;  2OFN A;  2MLY A;  1YAT A;  2M2A A;  3O5R A;  4QIB A;  4TW8 A;  1PIN A;  4DRI A;  2XP8 A;  4U85 A;  2MPH A;  5BXJ A;  1F8A B;  4DRJ A;  2XP5 A;  1P5Q A;  2ZR6 A;  2RSE A;  1W26 A;  2PPO A;  1B6C A;  3KCE A;  1NMV A;  5HWC A;  4O2T A;  1EQ3 A;  4ODQ A;  4DRQ A;  3UI4 A;  4TNS A;  2JZV A;  5HWB A;  5HTG A;  2RUR A;  4DT4 A;  4MSP A;  1ZCN A;  1M5Y A;  1FKS A;  1D7J A;  4R0X A;  4TW6 A;  3VAW A;  2L2S A;  3KZ7 A;  3PRD A;  1FJD A;  1Q6H A;  4G2P A;  1NSG A;  1ROT A;  2DG4 A;  2KFW A;  4MGV A;  4DRP A;  1EYM A;  2VN1 A;  1JNS A;  1U79 A;  1QZ2 A;  3I6C A;  3O5P A;  2KO7 A;  4LAX A;  4DRH A;  4DRM A;  4DRN A;  3JXV A;  5B8I C;  2ZQT A;  1R9H A;  4ODM A;  3NI6 A;  4U84 A;  1YW5 A;  1N1A A;  1HXV A;  4FN2 A;  2AWG A;  3LUO A;  3UF8 A;  4IQ2 A;  1QPF A;  2RUQ A;  5DIT A;  2F2D A;  1D7H A;  1JVW A;  2VCD A;  3UI6 A;  1FKK A;  3PRB A;  4LAV A;  4DZ2 A;  5HW8 A;  5HW7 A;  3TCZ A;  4ODK A;  5HUA A;  3RFW A;  2PV3 A;  3IKD A;  3KAI A;  4ODP A;  2PPP A;  2PV1 A;  2XP9 A;  3PA7 A;  2M08 A;  2KR7 A;  3CGN A;  3JYJ A;  3ODK A;  2XPA A;  4IPX A;  4QT3 A;  2FKE A;  2RQS A;  1ROU A;  2RUC A;  1Q6U A;  3IHZ A;  3O5O A;  3O5G A;  1L1P A;  2ZR5 A;  2XP3 A;  3O5K A;  3UQI A;  3O5F A;  5DIV A;  2RUD A;  4DZ3 A;  1PBK A;  4JFJ A;  2LKN A;  2Q5A A;  2MLX A;  4ODN A;  4TX0 A;  3KAG A;  3MDY B;  4IQC A;  4ODL A;  2MF9 A;  3O5E A;  2LGO A;  1FKT A;  4ITZ A;  1FKF A;  5HKG A;  1FKR A;  5J6E A;  2XP6 A;  2ZR4 A;  4W9O A;  4JYS A;  1F40 A;  1D7I A;  2KGJ A;  2IF4 A;  2UZ5 A;  3O5I A;  5DIU A;  2MNT A;  3OOB A;  3O5M A;  2ZQS A;  4GIV A;  2FAP A;  2PV2 A;  1FD9 A;  4NNR A;  4C02 B;  2PPN A;  2M1I A;  4ODR A;  4TYO A;  3CGM A;  3IK8 A;  1J6Y A;  4LAY A;  1C9H A;  4J4O A;  5HT1 A;  3UI5 A;  1Q6I A;  1FAP A;  4DIP A;  1FKD A;  2ITK A;  1A7X A; 
#chains in the Genus database with same CATH topology
 3WQW A;  1LG1 A;  1Q1C A;  2DG9 A;  4HAR A;  4AY1 A;  3KAF A;  2K8I A;  4JFM A;  3KAH A;  1D6O A;  3G6M A;  2DSV A;  3FAP A;  4QZV B;  4G50 A;  2F4E A;  1FKI A;  1NH6 A;  1ZBC A;  3ARU A;  1E6P A;  3WD1 A;  3KAB A;  1BL4 A;  1FKH A;  2FDM A;  5HBF A;  1UR8 A;  1W9P A;  4UDM A;  4S3K A;  2O92 A;  1NWS A;  1GUV A;  4P8W A;  2F21 A;  1E9L A;  2DG3 A;  4ZS6 A;  1KT0 A;  1TCO C;  3O5D A;  1LQ0 A;  1WB0 A;  3O5R A;  4TW8 A;  3BXW A;  1NWT A;  2OLH A;  1P5Q A;  1H0I A;  1W26 A;  1B6C A;  2F23 A;  4Z2J A;  4Z2K A;  3ARO A;  4DRQ A;  2JZV A;  4ZPV R;  4MNJ A;  4XAK A;  2PN0 A;  4TW6 A;  1W1Y A;  4PTM A;  1E6R A;  1D2K A;  3PRD A;  4Z2G A;  1NSG A;  1ROT A;  4DRP A;  5B8I C;  2WK2 A;  4LAX A;  1HJW A;  1JCH B;  3WQV A;  2WLZ A;  4U84 A;  1NWR A;  2AWG A;  3LUO A;  5DIT A;  5DEZ A;  3WD4 A;  2VCD A;  3UI6 A;  1FKK A;  3ARS A;  1E15 A;  3CHF A;  3RFW A;  2PV1 A;  2XP9 A;  3ALF A;  2KR7 A;  3ODK A;  4TYO A;  2FKE A;  4WKF A;  3IHZ A;  3WL1 A;  2ZR5 A;  2XP3 A;  3WD2 A;  2LKN A;  3ALG A;  4S3J A;  1SYT A;  2MF9 A;  1RD6 A;  2IUZ A;  3AS0 A;  4MAV A;  1OWQ A;  3OA5 A;  1XRV A;  5J6E A;  2ZR4 A;  3B8S A;  2KGJ A;  5DIU A;  3OOB A;  1OGB A;  4MTV A;  2FAP A;  1FD9 A;  4NNR A;  4C02 B;  2M1I A;  2YBU A;  3CGM A;  1J6Y A;  4DIP A;  5HT1 A;  1NWU A;  1FAP A;  1FKD A;  3IKG A;  1HKK A;  5D75 A;  1K9T A;  4J4N A;  4WJX A;  3JYM A;  1W1V A;  1JND A;  4BF8 A;  1FKB A;  1W1T A;  2A3A A;  4DRO A;  4DWS C;  1Y0O A;  4TW7 A;  3GPK A;  4DWS A;  4LAW A;  4FAP A;  2KI3 A;  1J4R A;  2DSZ A;  2MLZ A;  3CHD A;  3RM4 A;  4JFL A;  1QPL A;  3RM8 A;  3EY6 A;  4U86 A;  4QT2 A;  3RGC A;  2LPV A;  1BKF A;  3FXY A;  2D9F A;  4JFK A;  1FKJ A;  2LJ4 A;  2XPB A;  2WLY A;  4MNM A;  4N19 A;  3UQB A;  4NZC A;  1ZB5 A;  2XP4 A;  2MLY A;  1YAT A;  3G6L A;  4DRI A;  4URI A;  3ARP A;  4U85 A;  5BXJ A;  4DRJ A;  2XP5 A;  2ZR6 A;  2DSU A;  3BMB A;  1NMV A;  1FFR A;  2DT1 A;  4HBE A;  1EQ3 A;  4ODQ A;  1W9U A;  3UI4 A;  3ARV A;  5HTG A;  1M5Y A;  4Q22 A;  1GPF A;  1OGG A;  1KFW A;  1Q6H A;  1JNS A;  2KFW A;  2VN1 A;  2KO7 A;  4DRM A;  3CZ8 A;  1R9H A;  1YW5 A;  1IX5 A;  3GTY X;  1HXV A;  4MNK A;  4IQ2 A;  1QPF A;  2RUQ A;  1JVW A;  4IT4 A;  4Z2I A;  3TCZ A;  5HUA A;  4MNL A;  3WKZ A;  2PPP A;  4WKH A;  4L72 B;  3AQU A;  3JYJ A;  1ZL1 A;  4IPX A;  4Q7N A;  3O5O A;  1L1P A;  3O5K A;  3EIP A;  5DIV A;  4DZ3 A;  4JFJ A;  2ETN A;  2MLX A;  3MDY B;  1O6I A;  4ODL A;  4HBO A;  3O5E A;  4L3N A;  1EHN A;  2LGO A;  3B9E A;  1FKT A;  3RME A;  1FKR A;  2B5U B;  2P4V A;  2DPE A;  1X6N A;  4ML4 A;  1ZU8 A;  2PV2 A;  1LJY A;  3IK8 A;  1ZBK A;  2ITK A;  1A7X A;  3O5L A;  3QOK A;  1LG2 A;  2PBC A;  3WH0 A;  1WAW A;  3KAD A;  1JNT A;  3WD0 A;  1T11 A;  1FFQ A;  1LL7 A;  4Z2H A;  2DT0 A;  1HKM A;  2ZQV A;  4ZPW R;  1ZK6 A;  1J4I A;  1TFV A;  1SR0 A;  2YBT A;  5DO2 A;  2N87 A;  3B7X A;  4DH0 A;  4DWS B;  4JFI A;  5GPG A;  1LL6 A;  1J4H A;  3KAC A;  1HKJ A;  2Y78 A;  3O5J A;  4QIB A;  3ARY A;  3AS2 A;  2ESC A;  4NSB A;  2A3C A;  2PPO A;  5DF0 A;  1JNE A;  4TNS A;  5HWB A;  2RUR A;  4DT4 A;  1ZCN A;  3FY1 A;  4R0X A;  3VAW A;  3CHC A;  2L2S A;  3KZ7 A;  4LGX A;  4G2P A;  4MGV A;  2A3E A;  2DG4 A;  1EYM A;  1U79 A;  3O5P A;  3B9D A;  1GOI A;  3JXV A;  2AOS A;  2ZQT A;  4WK9 A;  1W9V A;  4FN2 A;  4R5E A;  4KQZ A;  4LAV A;  5HW8 A;  5HW7 A;  2PV3 A;  3IKD A;  3KAI A;  3WD3 A;  1X6L A;  2M08 A;  4QT3 A;  1ROU A;  3O5G A;  3AS3 A;  3O5F A;  3WL0 A;  2RUD A;  2A3B A;  1PBK A;  3AS1 A;  3GU0 A;  3KAG A;  4TX0 A;  4IQC A;  4IT6 A;  4ITZ A;  1E44 A;  2XP6 A;  4JYS A;  1F40 A;  1D7I A;  3O5I A;  1UR9 A;  5JH8 A;  2PPN A;  4ODR A;  4LAY A;  4J4O A;  4ODO A;  2DSW A;  4WKA A;  1W1P A;  3TC5 A;  2EUL A;  1NMW A;  2B31 A;  4Z2L A;  2ZQU A;  1FKG A;  1LL4 A;  4DRK A;  3ART A;  4GGQ A;  4W9Q A;  2XP7 A;  3UQA A;  2KE0 A;  1ZBW A;  1HJV A;  3H9R B;  2DT3 A;  1HJX A;  1EDQ A;  1CTN A;  3NRK A;  3NTP A;  1FKL A;  4KR0 B;  1KT1 A;  4ZPT R;  5I98 A;  4W9P A;  3PRA A;  3TDB A;  5HW6 A;  1H0G A;  3O5Q A;  3WIJ A;  4P8V A;  2OFN A;  2M2A A;  3CHE A;  3W4R A;  1PIN A;  2XP8 A;  5GPR A;  3B9A A;  2MPH A;  2PI6 A;  1F8A B;  3ARX A;  4P8X A;  2DT2 A;  2RSE A;  3KCE A;  5HWC A;  4O2T A;  1XHG A;  2O9O A;  3ARZ A;  4MPK A;  4MSP A;  1FKS A;  1D7J A;  1FJD A;  4P8U A;  3ARR A;  3CH9 A;  1QZ2 A;  2QF8 A;  3ARQ A;  3I6C A;  4DRN A;  4DRH A;  1WNO A;  4ODM A;  3NI6 A;  1N1A A;  1EIB A;  3UF8 A;  2F2D A;  1D7H A;  3PR9 A;  3PRB A;  2WM0 A;  4DZ2 A;  4ODK A;  1VF8 A;  5GQB A;  4DWS D;  1HKI A;  4ODP A;  3PA7 A;  3CGN A;  3RM9 A;  2XPA A;  4WIW A;  2RQS A;  2RUC A;  3ARW A;  1Q6U A;  1GRJ A;  3UQI A;  2Q5A A;  1ITX A;  2G41 A;  4ODN A;  1E6N A;  1E6Z A;  4W5U A;  5HKG A;  1FKF A;  4W9O A;  2IF4 A;  2UZ5 A;  2MNT A;  1ZBV A;  3O5M A;  2ZQS A;  2G8Z A;  4GIV A;  1C9H A;  3UI5 A;  1Q6I A; 
#chains in the Genus database with same CATH homology
 3WQW A;  1LG1 A;  1Q1C A;  2DG9 A;  4HAR A;  4AY1 A;  3KAF A;  2K8I A;  4JFM A;  3KAH A;  1D6O A;  3G6M A;  2DSV A;  3FAP A;  4QZV B;  4G50 A;  2F4E A;  1FKI A;  1NH6 A;  1ZBC A;  3ARU A;  1E6P A;  3WD1 A;  3KAB A;  1BL4 A;  1FKH A;  2FDM A;  5HBF A;  1UR8 A;  1W9P A;  4S3K A;  2O92 A;  1NWS A;  1GUV A;  4P8W A;  2F21 A;  1E9L A;  2DG3 A;  4ZS6 A;  1KT0 A;  1TCO C;  3O5D A;  1LQ0 A;  1WB0 A;  3O5R A;  4TW8 A;  3BXW A;  1NWT A;  2OLH A;  1P5Q A;  1H0I A;  1W26 A;  1B6C A;  4Z2J A;  4Z2K A;  3ARO A;  4DRQ A;  2JZV A;  4ZPV R;  4MNJ A;  4XAK A;  4TW6 A;  1W1Y A;  4PTM A;  1E6R A;  1D2K A;  3PRD A;  4Z2G A;  1NSG A;  1ROT A;  4DRP A;  5B8I C;  2WK2 A;  4LAX A;  1HJW A;  3WQV A;  2WLZ A;  4U84 A;  1NWR A;  2AWG A;  3LUO A;  5DIT A;  5DEZ A;  3WD4 A;  2VCD A;  3UI6 A;  1FKK A;  3ARS A;  1E15 A;  3CHF A;  3RFW A;  2PV1 A;  2XP9 A;  3ALF A;  2KR7 A;  3ODK A;  4TYO A;  2FKE A;  4WKF A;  3IHZ A;  3WL1 A;  2ZR5 A;  2XP3 A;  3WD2 A;  2LKN A;  3ALG A;  4S3J A;  1SYT A;  2MF9 A;  1RD6 A;  2IUZ A;  3AS0 A;  4MAV A;  1OWQ A;  3OA5 A;  1XRV A;  5J6E A;  2ZR4 A;  3B8S A;  2KGJ A;  5DIU A;  3OOB A;  1OGB A;  4MTV A;  2FAP A;  1FD9 A;  4NNR A;  4C02 B;  2M1I A;  2YBU A;  3CGM A;  1J6Y A;  4DIP A;  5HT1 A;  1NWU A;  1FAP A;  1FKD A;  3IKG A;  1HKK A;  5D75 A;  1K9T A;  4J4N A;  4WJX A;  3JYM A;  1W1V A;  1JND A;  4BF8 A;  1FKB A;  1W1T A;  2A3A A;  4DRO A;  4DWS C;  1Y0O A;  4TW7 A;  3GPK A;  4DWS A;  4LAW A;  4FAP A;  2KI3 A;  1J4R A;  2DSZ A;  2MLZ A;  3CHD A;  3RM4 A;  4JFL A;  1QPL A;  3RM8 A;  3EY6 A;  4U86 A;  4QT2 A;  3RGC A;  2LPV A;  1BKF A;  3FXY A;  2D9F A;  4JFK A;  1FKJ A;  2LJ4 A;  2XPB A;  2WLY A;  4MNM A;  4N19 A;  3UQB A;  4NZC A;  1ZB5 A;  2XP4 A;  2MLY A;  1YAT A;  3G6L A;  4DRI A;  4URI A;  3ARP A;  4U85 A;  5BXJ A;  4DRJ A;  2XP5 A;  2ZR6 A;  2DSU A;  1NMV A;  1FFR A;  2DT1 A;  4HBE A;  1EQ3 A;  4ODQ A;  1W9U A;  3UI4 A;  3ARV A;  5HTG A;  1M5Y A;  4Q22 A;  1GPF A;  1OGG A;  1KFW A;  1Q6H A;  1JNS A;  2KFW A;  2VN1 A;  2KO7 A;  4DRM A;  3CZ8 A;  1R9H A;  1YW5 A;  1IX5 A;  1HXV A;  4MNK A;  4IQ2 A;  1QPF A;  2RUQ A;  1JVW A;  4IT4 A;  4Z2I A;  3TCZ A;  5HUA A;  4MNL A;  3WKZ A;  2PPP A;  4WKH A;  4L72 B;  3AQU A;  3JYJ A;  1ZL1 A;  4IPX A;  4Q7N A;  3O5O A;  1L1P A;  3O5K A;  5DIV A;  4DZ3 A;  4JFJ A;  2MLX A;  3MDY B;  1O6I A;  4ODL A;  4HBO A;  3O5E A;  4L3N A;  1EHN A;  2LGO A;  3B9E A;  1FKT A;  3RME A;  1FKR A;  2DPE A;  1X6N A;  4ML4 A;  1ZU8 A;  2PV2 A;  1LJY A;  3IK8 A;  1ZBK A;  2ITK A;  1A7X A;  3O5L A;  3QOK A;  1LG2 A;  2PBC A;  3WH0 A;  1WAW A;  3KAD A;  1JNT A;  3WD0 A;  1T11 A;  1FFQ A;  1LL7 A;  4Z2H A;  2DT0 A;  1HKM A;  2ZQV A;  4ZPW R;  1ZK6 A;  1J4I A;  1TFV A;  1SR0 A;  2YBT A;  5DO2 A;  2N87 A;  3B7X A;  4DH0 A;  4DWS B;  4JFI A;  5GPG A;  1LL6 A;  1J4H A;  3KAC A;  1HKJ A;  2Y78 A;  3O5J A;  4QIB A;  3ARY A;  3AS2 A;  2ESC A;  4NSB A;  2A3C A;  2PPO A;  5DF0 A;  1JNE A;  4TNS A;  5HWB A;  2RUR A;  4DT4 A;  1ZCN A;  3FY1 A;  4R0X A;  3VAW A;  3CHC A;  2L2S A;  3KZ7 A;  4LGX A;  4G2P A;  4MGV A;  2A3E A;  2DG4 A;  1EYM A;  3O5P A;  1U79 A;  3B9D A;  1GOI A;  3JXV A;  2AOS A;  2ZQT A;  4WK9 A;  1W9V A;  4FN2 A;  4R5E A;  4KQZ A;  4LAV A;  5HW8 A;  5HW7 A;  2PV3 A;  3IKD A;  3KAI A;  3WD3 A;  1X6L A;  2M08 A;  4QT3 A;  1ROU A;  3O5G A;  3AS3 A;  3O5F A;  3WL0 A;  2RUD A;  2A3B A;  1PBK A;  3AS1 A;  4TX0 A;  3KAG A;  4IQC A;  4IT6 A;  4ITZ A;  2XP6 A;  4JYS A;  1F40 A;  1D7I A;  3O5I A;  1UR9 A;  5JH8 A;  2PPN A;  4ODR A;  4LAY A;  4J4O A;  4ODO A;  2DSW A;  4WKA A;  1W1P A;  3TC5 A;  1NMW A;  2B31 A;  4Z2L A;  2ZQU A;  1FKG A;  1LL4 A;  4DRK A;  3ART A;  4GGQ A;  4W9Q A;  2XP7 A;  3UQA A;  2KE0 A;  1ZBW A;  1HJV A;  3H9R B;  2DT3 A;  1HJX A;  1EDQ A;  1CTN A;  3NRK A;  3NTP A;  1FKL A;  4KR0 B;  1KT1 A;  4ZPT R;  5I98 A;  4W9P A;  3PRA A;  3TDB A;  5HW6 A;  1H0G A;  3O5Q A;  3WIJ A;  4P8V A;  2OFN A;  2M2A A;  3CHE A;  3W4R A;  1PIN A;  2XP8 A;  5GPR A;  3B9A A;  2MPH A;  2PI6 A;  1F8A B;  3ARX A;  4P8X A;  2DT2 A;  2RSE A;  3KCE A;  5HWC A;  4O2T A;  1XHG A;  2O9O A;  3ARZ A;  4MPK A;  4MSP A;  1FKS A;  1D7J A;  1FJD A;  4P8U A;  3ARR A;  3I6C A;  1QZ2 A;  2QF8 A;  3ARQ A;  3CH9 A;  4DRN A;  4DRH A;  1WNO A;  4ODM A;  3NI6 A;  1N1A A;  1EIB A;  3UF8 A;  2F2D A;  1D7H A;  3PR9 A;  3PRB A;  2WM0 A;  4DZ2 A;  4ODK A;  1VF8 A;  5GQB A;  4DWS D;  1HKI A;  4ODP A;  3PA7 A;  3CGN A;  3RM9 A;  2XPA A;  4WIW A;  2RQS A;  2RUC A;  3ARW A;  1Q6U A;  3UQI A;  2Q5A A;  1ITX A;  2G41 A;  4ODN A;  1E6N A;  1E6Z A;  4W5U A;  5HKG A;  1FKF A;  4W9O A;  2IF4 A;  2UZ5 A;  2MNT A;  1ZBV A;  3O5M A;  2ZQS A;  2G8Z A;  4GIV A;  1C9H A;  3UI5 A;  1Q6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...