3H9RB

Crystal structure of the kinase domain of type i activin receptor (acvr1) in complex with fkbp12 and dorsomorphin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Bone Morphogenetic Protein Receptor ALK2 and Implications for Fibrodysplasia Ossificans Progressiva.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/protein kinase
molecule keywords Activin receptor type-1
total genus 27
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3h9rB00
5DIUA 4IQ2A 2LGOA 2KR7A 1ZK6A 1YW5A 3GPKA 2MLXA 3O5IA 2XP5A 4N19A 4TX0A 4DROA 3TCZA 1HXVA 1W26A 4JFMA 2ZQSA 3PRDA 2ZR5A 4JYSA 2D9FA 1Q6UA 4MSPA 3WH0A 4IPXA 2OFNA 2LJ4A 3CGMA 2PV3A 1FKFA 1B6CA 1FKLA 4DRJA 4DRNA 1R9HA 3O5KA 4W9OA 1ROUA 2M08A 3LUOA 2RUCA 3KAFA 4DRMA 4J4OA 1FKBA 5DIVA 2F2DA 2KFWA 2N87A 2ZQVA 3O5RA 4JFLA 1FKJA 4QT3A 4U85A 4DIPA 4DRHA 1L1PA 1PINA 3OOBA 1T11A 5HWBA 1PBKA 3FAPA 3KAHA 3O5PA 1D7HA 4TNSA 3UI5A 4ITZA 2F4EA 4G50A 4DRQA 2RUDA 3IHZA 2DG4A 3IKDA 3KAIA 4TW7A 5I98A 3O5LA 3O5DA 2ZQTA 3CGNA 5DITA 4R0XA 2KI3A 4DZ3A 5J6EA 2MLYA 3JYMA 4U86A 3TC5A 3UQAA 1P5QA 1ROTA 2VCDA 1TCOC 5HUAA 4FAPA 4LAXA 1FKDA 1NSGA 2RQSA 5HW6A 2PPOA 4JFKA 3UF8A 1FKRA 2XP8A 1QZ2A 3PA7A 3RGCA 4ODNA 4G2PA 4GGQA 1FJDA 1QPFA 3MDYB 3KACA 2PBCA 4TW8A 4TW6A 4LAYA 4JFIA 1N1AA 3H9RB 4LAVA 1BKFA 3O5GA 2MLZA 3O5OA 2PPPA 4W9PA 2LKNA 4U84A 4DT4A 2M2AA 5BXJA 3JYJA 3PRBA 4J4NA 3O5QA 5D75A 2UZ5A 5HW8A 2DG3A 1Q6IA 2RSEA 2ZR6A 2M1IA 5B8IC 3ODKA 3O5FA 5HW7A 1JNSA 3UI6A 2RUQA 4MGVA 4ODPA 2MF9A 1D6OA 2XP4A 4FN2A 3RFWA 3B7XA 3UQIA 1EQ3A 2XP9A 3VAWA 1D7JA 1QPLA 2F21A 3NRKA 3KCEA 3O5JA 4IQCA 4LAWA 1ZCNA 1F40A 3KABA 5GPGA 1EYMA 2PV1A 4TYOA 1NMVA 4ODRA 1Q1CA 1Y0OA 2XP7A 4O2TA 3UQBA 4QT2A 1YATA 2LPVA 2ZQUA 1Q6HA 1FKHA 2RURA 2XP6A 2IF4A 3KAGA 3KZ7A 5HT1A 4ODOA 4C02B 4DRIA 1J4HA 2FKEA 1KT1A 2AWGA 2ITKA 3IK8A 1J4IA 3UI4A 1U79A 2PV2A 3I6CA 5HWCA 1NMWA 2PPNA 4ODLA 4DRKA 2KO7A 4ODKA 3O5EA 1D7IA 1C9HA 1FKSA 1FKGA 2K8IA 1M5YA 3EY6A 3JXVA 3NTPA 1J6YA 1BL4A 4W9QA 2DG9A 2MPHA 4ODMA 1FKIA 3NI6A 1KT0A 1FD9A 1FAPA 2XPBA 2ZR4A 1J4RA 2FAPA 2JZVA 4ODQA 3TDBA 4JFJA 1JNTA 3KADA 2XPAA 2Y78A 4QIBA 4DRPA 2KE0A 5HKGA 1FKTA 3O5MA 3IKGA 4GIVA 4DZ2A 1F8AB 1A7XA 1JVWA 1FKKA 2XP3A 2MNTA 4NNRA 2VN1A 5HTGA 2Q5AA 2L2SA 4BF8A 4DH0A 2KGJA
chains in the Genus database with same CATH superfamily
4ZPVR 4ZPWR 4TX0A 4DROA 2DT2A 4JYSA 2D9FA 1LL4A 1Q6UA 4MSPA 4Q7NA 2OFNA 1B6CA 4DRJA 5DO2A 1GOIA 2M08A 2RUCA 1EIBA 2F2DA 2KFWA 3O5RA 3ALFA 2WK2A 3OOBA 1PBKA 3ARPA 3BXWA 1LQ0A 2FDMA 4ITZA 1HKJA 2ESCA 3CHDA 3IKDA 3O5DA 2KI3A 4DZ3A 2MLYA 3JYMA 3PR9A 4FAPA 1FKDA 1TFVA 2RQSA 5HW6A 1NWTA 2P4VA 1QZ2A 2QF8A 2WLYA 2B31A 3MDYB 2PBCA 3O5GA 3CHEA 3O5OA 2LKNA 4MPKA 1UR8A 1JCHB 3O5QA 3AS0A 1HJXA 1EQ3A 4DWSA 3B7XA 1NWRA 2F21A 4IQCA 2O92A 1F40A 1OGBA 4ODRA 4UDMA 1Y0OA 4O2TA 4HARA 4QT2A 4QZVB 1Q6HA 2RURA 2XP6A 5GPRA 3G6LA 5HT1A 4WJXA 4IT4A 3AROA 1J4IA 3WD4A 1U79A 3I6CA 2ETNA 4DRKA 4LGXA 1C9HA 1FFRA 3NTPA 3ARWA 3EY6A 4W9QA 1E6RA 1FKIA 4W5UA 3WQWA 4Z2LA 3FXYA 5HBFA 3WD2A 2DSWA 4ML4A 4MTVA 4ZPTR 2XPAA 4Q22A 2Y78A 4QIBA 1IX5A 2KE0A 3RM9A 3ARYA 1ZL1A 2MNTA 3AS3A 2Q5AA 5DIUA 3FY1A 1ZK6A 3O5IA 4MNJA 2A3CA 3PRDA 3WL1A 1GPFA 3B9DA 1H0GA 4W9OA 3CHFA 3B8SA 1FKBA 2DSZA 4S3KA 5DIVA 1ZBCA 2N87A 2ZQVA 5I98A 1FKJA 4U85A 1PINA 5HWBA 3UI5A 3O5PA 1D7HA 4Z2KA 4DWSC 1WAWA 1HKMA 3BMBA 4DRQA 4P8UA 1LG2A 2ZQTA 1X6LA 3B9AA 1VF8A 4U86A 5HUAA 1TCOC 1NSGA 3WD0A 3ARSA 3PA7A 4ODNA 4GGQA 1QPFA 3AQUA 3G6MA 3KACA 4TW6A 1XRVA 4JFIA 4LAVA 1NWUA 1ZBVA 4XAKA 4U84A 4DT4A 2M2AA 5BXJA 1Q6IA 1FFQA 2RSEA 2ZR6A 2M1IA 3ARRA 2DPEA 4P8VA 2MF9A 2XP4A 4R5EA 1D7JA 3VAWA 4URIA 3KCEA 1W1TA 3KABA 5GPGA 2XP7A 2WLZA 3UQBA 1ITXA 1YATA 1FKHA 1J4HA 3ALGA 3WIJA 1EHNA 1W1VA 5HWCA 1D2KA 1NMWA 2PPNA 3AS2A 4WKFA 1D7IA 2PN0A 4L72B 1FKGA 2K8IA 1J6YA 2MPHA 4ODMA 3NI6A 1KT0A 3WD1A 3WD3A 1FAPA 1W1PA 2XPBA 4HBOA 2FAPA 4KR0B 1HKKA 1FKTA 1GUVA 1E6ZA 1JVWA 4NNRA 5HTGA 2L2SA 4BF8A 4DH0A 2LGOA 4P8XA 2DT1A 2XP5A 4JFMA 3WQVA 2ZR5A 1NH6A 4IPXA 2LJ4A 3CGMA 1FKFA 1HJVA 1LL6A 4DRNA 5GQBA 3LUOA 1OWQA 3GTYX 4DRMA 4J4OA 4DIPA 1L1PA 1ZBWA 4G50A 4WKAA 2RUDA 4TW7A 5DEZA 2A3BA 3O5LA 3ARUA 2AOSA 3UQAA 1ROTA 4Z2JA 4LAXA 1EDQA 2PPOA 1FKRA 2XP8A 2DT3A 4G2PA 1W9UA 3W4RA 4LAYA 3H9RB 2MLZA 4IT6A 2PPPA 3JYJA 3PRBA 5D75A 2UZ5A 5HW8A 3ODKA 5HW7A 1JNSA 1WB0A 4MGVA 5JH8A 3RFWA 1D6OA 3ARXA 1JNDA 2XP9A 4ZS6A 1O6IA 1QPLA 1RD6A 3B9EA 3NRKA 4KQZA 1NWSA 2B5UB 4TYOA 1ZB5A 4MNLA 2ZQUA 1W9PA 3KAGA 1X6NA 2IF4A 4C02B 4ODOA 4DRIA 1GRJA 2FKEA 4PTMA 1KT1A 2F23A 3IK8A 3UI4A 3CHCA 1HJWA 3RMEA 2EULA 3O5EA 4WK9A 3ARZA 1UR9A 3JXVA 2IUZA 1FD9A 1K9TA 1E15A 2ZR4A 1J4RA 3ARQA 4ODQA 3TDBA 4JFJA 1JNTA 3RM8A 5HKGA 3O5MA 4L3NA 3IKGA 1JNEA 4DZ2A 4P8WA 2DSVA 1FKKA 2A3AA 4IQ2A 2KR7A 1YW5A 3GPKA 3EIPA 2MLXA 4N19A 3TCZA 2YBTA 3PRAA 1HXVA 1W26A 2ZQSA 3ARTA 3WH0A 2PV3A 3ARVA 2A3EA 1FKLA 1SYTA 1R9HA 3O5KA 1ROUA 2DSUA 3KAFA 4JFLA 4QT3A 4DRHA 4WKHA 1T11A 3KAHA 3FAPA 4TNSA 4WIWA 3OA5A 2F4EA 1OGGA 2YBUA 4MNKA 3IHZA 2DG4A 2DT0A 3KAIA 3CGNA 5DITA 5J6EA 5DF0A 3TC5A 1P5QA 2VCDA 4NSBA 1E44A 3CH9A 4JFKA 2OLHA 3CZ8A 3UF8A 1W1YA 2G41A 3RGCA 1E9LA 1FJDA 4TW8A 4DWSD 4Z2GA 1N1AA 4W9PA 1BKFA 3GU0A 4NZCA 3WL0A 4J4NA 4AY1A 2DG3A 4MNMA 1LG1A 3WKZA 3RM4A 5B8IC 1XHGA 3O5FA 3UI6A 2RUQA 4ODPA 1W9VA 4FN2A 1CTNA 3UQIA 3O5JA 4LAWA 1ZCNA 1H0IA 3AS1A 1EYMA 2PV1A 1NMVA 1Q1CA 1E6PA 2LPVA 2O9OA 3KZ7A 1ZU8A 2WM0A 2AWGA 2ITKA 2PV2A 2G8ZA 4HBEA 4S3JA 4ODLA 2KO7A 4ODKA 1LL7A 1FKSA 1HKIA 1SR0A 1M5YA 1WNOA 1ZBKA 1BL4A 4Z2IA 2DG9A 2PI6A 2JZVA 3KADA 4DRPA 4Z2HA 3QOKA 4MAVA 4GIVA 1F8AB 1E6NA 1A7XA 2XP3A 4DWSB 2VN1A 1LJYA 4R0XA 1KFWA 2KGJA
chains in the Genus database with same CATH topology
4ZPVR 4ZPWR 4TX0A 4DROA 2DT2A 4JYSA 2D9FA 1LL4A 1Q6UA 4MSPA 4Q7NA 2OFNA 1B6CA 4DRJA 5DO2A 1GOIA 2M08A 2RUCA 1EIBA 2F2DA 2KFWA 3O5RA 3ALFA 2WK2A 3OOBA 1PBKA 3ARPA 3BXWA 1LQ0A 2FDMA 4ITZA 1HKJA 2ESCA 3CHDA 3IKDA 3O5DA 2KI3A 4DZ3A 2MLYA 3JYMA 3PR9A 4FAPA 1FKDA 1TFVA 2RQSA 5HW6A 1NWTA 1QZ2A 2QF8A 2WLYA 2B31A 3MDYB 2PBCA 3O5GA 3CHEA 3O5OA 2LKNA 4MPKA 1UR8A 3O5QA 3AS0A 1HJXA 1EQ3A 4DWSA 3B7XA 1NWRA 4IQCA 2F21A 2O92A 1F40A 1OGBA 4ODRA 1Y0OA 4O2TA 4HARA 4QT2A 4QZVB 1Q6HA 2RURA 2XP6A 5GPRA 3G6LA 5HT1A 4WJXA 4IT4A 3AROA 1J4IA 3WD4A 1U79A 3I6CA 4DRKA 4LGXA 1C9HA 1FFRA 3NTPA 3ARWA 3EY6A 4W9QA 1E6RA 1FKIA 4W5UA 3WQWA 4Z2LA 3FXYA 5HBFA 3WD2A 2DSWA 4ML4A 4MTVA 4ZPTR 2XPAA 4Q22A 2Y78A 4QIBA 1IX5A 2KE0A 3RM9A 3ARYA 1ZL1A 2MNTA 3AS3A 2Q5AA 5DIUA 3FY1A 1ZK6A 3O5IA 4MNJA 2A3CA 3PRDA 3WL1A 1GPFA 3B9DA 1H0GA 4W9OA 3CHFA 3B8SA 1FKBA 2DSZA 4S3KA 5DIVA 1ZBCA 2N87A 2ZQVA 5I98A 1FKJA 4U85A 1PINA 5HWBA 3UI5A 3O5PA 1D7HA 4Z2KA 4DWSC 1WAWA 1HKMA 4DRQA 4P8UA 1LG2A 2ZQTA 1X6LA 3B9AA 1VF8A 4U86A 5HUAA 1TCOC 1NSGA 3WD0A 3ARSA 3PA7A 4ODNA 4GGQA 1QPFA 3AQUA 3G6MA 3KACA 4TW6A 1XRVA 4JFIA 4LAVA 1NWUA 1ZBVA 4XAKA 4U84A 4DT4A 2M2AA 5BXJA 1Q6IA 1FFQA 2RSEA 2ZR6A 2M1IA 3ARRA 2DPEA 4P8VA 2MF9A 2XP4A 4R5EA 1D7JA 3VAWA 4URIA 3KCEA 1W1TA 3KABA 5GPGA 2XP7A 2WLZA 3UQBA 1ITXA 1YATA 1FKHA 1J4HA 3ALGA 3WIJA 1EHNA 1W1VA 5HWCA 1D2KA 1NMWA 2PPNA 3AS2A 4WKFA 1D7IA 4L72B 1FKGA 2K8IA 1J6YA 2MPHA 4ODMA 3NI6A 1KT0A 3WD1A 3WD3A 1FAPA 1W1PA 2XPBA 4HBOA 2FAPA 4KR0B 1HKKA 1FKTA 1GUVA 1E6ZA 1JVWA 4NNRA 5HTGA 2L2SA 4BF8A 4DH0A 2LGOA 4P8XA 2DT1A 2XP5A 4JFMA 3WQVA 2ZR5A 1NH6A 4IPXA 2LJ4A 3CGMA 1FKFA 1HJVA 1LL6A 4DRNA 5GQBA 3LUOA 1OWQA 4DRMA 4J4OA 4DIPA 1L1PA 1ZBWA 4G50A 4WKAA 2RUDA 4TW7A 5DEZA 2A3BA 3O5LA 3ARUA 2AOSA 3UQAA 1ROTA 4Z2JA 4LAXA 1EDQA 2PPOA 1FKRA 2XP8A 2DT3A 4G2PA 1W9UA 3W4RA 4LAYA 3H9RB 2MLZA 4IT6A 2PPPA 3JYJA 3PRBA 5D75A 2UZ5A 5HW8A 3ODKA 5HW7A 1JNSA 1WB0A 4MGVA 5JH8A 3RFWA 1D6OA 3ARXA 1JNDA 2XP9A 4ZS6A 1O6IA 1QPLA 1RD6A 3B9EA 3NRKA 4KQZA 1NWSA 4TYOA 1ZB5A 4MNLA 2ZQUA 1W9PA 3KAGA 1X6NA 2IF4A 4C02B 4ODOA 4DRIA 2FKEA 4PTMA 1KT1A 3IK8A 3UI4A 3CHCA 1HJWA 3RMEA 3O5EA 4WK9A 3ARZA 1UR9A 3JXVA 2IUZA 1FD9A 1K9TA 1E15A 2ZR4A 1J4RA 3ARQA 4ODQA 3TDBA 4JFJA 1JNTA 3RM8A 5HKGA 3O5MA 4L3NA 3IKGA 1JNEA 4DZ2A 4P8WA 2DSVA 1FKKA 2A3AA 4IQ2A 2KR7A 1YW5A 3GPKA 2MLXA 4N19A 3TCZA 2YBTA 3PRAA 1HXVA 1W26A 2ZQSA 3ARTA 3WH0A 2PV3A 3ARVA 2A3EA 1FKLA 1SYTA 1R9HA 3O5KA 1ROUA 2DSUA 3KAFA 4JFLA 4QT3A 4DRHA 4WKHA 1T11A 3KAHA 3FAPA 4TNSA 4WIWA 3OA5A 2F4EA 1OGGA 2YBUA 4MNKA 3IHZA 2DG4A 2DT0A 3KAIA 3CGNA 5DITA 5J6EA 5DF0A 3TC5A 1P5QA 2VCDA 4NSBA 3CH9A 4JFKA 2OLHA 3CZ8A 3UF8A 1W1YA 2G41A 3RGCA 1E9LA 1FJDA 4TW8A 4DWSD 4Z2GA 1N1AA 4W9PA 1BKFA 4NZCA 3WL0A 4J4NA 4AY1A 2DG3A 4MNMA 1LG1A 3WKZA 3RM4A 5B8IC 1XHGA 3O5FA 3UI6A 2RUQA 4ODPA 1W9VA 4FN2A 1CTNA 3UQIA 3O5JA 4LAWA 1ZCNA 1H0IA 3AS1A 1EYMA 2PV1A 1NMVA 1Q1CA 1E6PA 2LPVA 2O9OA 3KZ7A 1ZU8A 2WM0A 2AWGA 2ITKA 2PV2A 2G8ZA 4HBEA 4S3JA 4ODLA 2KO7A 4ODKA 1LL7A 1FKSA 1HKIA 1SR0A 1M5YA 1WNOA 1ZBKA 1BL4A 4Z2IA 2DG9A 2PI6A 2JZVA 3KADA 4DRPA 4Z2HA 3QOKA 4MAVA 4GIVA 1F8AB 1E6NA 1A7XA 2XP3A 4DWSB 2VN1A 1LJYA 4R0XA 1KFWA 2KGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DIU A;  4IQ2 A;  2LGO A;  2KR7 A;  1ZK6 A;  1YW5 A;  3GPK A;  2MLX A;  3O5I A;  2XP5 A;  4N19 A;  4TX0 A;  4DRO A;  3TCZ A;  1HXV A;  1W26 A;  4JFM A;  2ZQS A;  3PRD A;  2ZR5 A;  4JYS A;  2D9F A;  1Q6U A;  4MSP A;  3WH0 A;  4IPX A;  2OFN A;  2LJ4 A;  3CGM A;  2PV3 A;  1FKF A;  1B6C A;  1FKL A;  4DRJ A;  4DRN A;  1R9H A;  3O5K A;  4W9O A;  1ROU A;  2M08 A;  3LUO A;  2RUC A;  3KAF A;  4DRM A;  4J4O A;  1FKB A;  5DIV A;  2F2D A;  2KFW A;  2N87 A;  2ZQV A;  3O5R A;  4JFL A;  1FKJ A;  4QT3 A;  4U85 A;  4DIP A;  4DRH A;  1L1P A;  1PIN A;  3OOB A;  1T11 A;  5HWB A;  1PBK A;  3FAP A;  3KAH A;  3O5P A;  1D7H A;  4TNS A;  3UI5 A;  4ITZ A;  2F4E A;  4G50 A;  4DRQ A;  2RUD A;  3IHZ A;  2DG4 A;  3IKD A;  3KAI A;  4TW7 A;  5I98 A;  3O5L A;  3O5D A;  2ZQT A;  3CGN A;  5DIT A;  4R0X A;  2KI3 A;  4DZ3 A;  5J6E A;  2MLY A;  3JYM A;  4U86 A;  3TC5 A;  3UQA A;  1P5Q A;  1ROT A;  2VCD A;  1TCO C;  5HUA A;  4FAP A;  4LAX A;  1FKD A;  1NSG A;  2RQS A;  5HW6 A;  2PPO A;  4JFK A;  3UF8 A;  1FKR A;  2XP8 A;  1QZ2 A;  3PA7 A;  3RGC A;  4ODN A;  4G2P A;  4GGQ A;  1FJD A;  1QPF A;  3MDY B;  3KAC A;  2PBC A;  4TW8 A;  4TW6 A;  4LAY A;  4JFI A;  1N1A A;  3H9R B;  4LAV A;  1BKF A;  3O5G A;  2MLZ A;  3O5O A;  2PPP A;  4W9P A;  2LKN A;  4U84 A;  4DT4 A;  2M2A A;  5BXJ A;  3JYJ A;  3PRB A;  4J4N A;  3O5Q A;  5D75 A;  2UZ5 A;  5HW8 A;  2DG3 A;  1Q6I A;  2RSE A;  2ZR6 A;  2M1I A;  5B8I C;  3ODK A;  3O5F A;  5HW7 A;  1JNS A;  3UI6 A;  2RUQ A;  4MGV A;  4ODP A;  2MF9 A;  1D6O A;  2XP4 A;  4FN2 A;  3RFW A;  3B7X A;  3UQI A;  1EQ3 A;  2XP9 A;  3VAW A;  1D7J A;  1QPL A;  2F21 A;  3NRK A;  3KCE A;  3O5J A;  4IQC A;  4LAW A;  1ZCN A;  1F40 A;  3KAB A;  5GPG A;  1EYM A;  2PV1 A;  4TYO A;  1NMV A;  4ODR A;  1Q1C A;  1Y0O A;  2XP7 A;  4O2T A;  3UQB A;  4QT2 A;  1YAT A;  2LPV A;  2ZQU A;  1Q6H A;  1FKH A;  2RUR A;  2XP6 A;  2IF4 A;  3KAG A;  3KZ7 A;  5HT1 A;  4ODO A;  4C02 B;  4DRI A;  1J4H A;  2FKE A;  1KT1 A;  2AWG A;  2ITK A;  3IK8 A;  1J4I A;  3UI4 A;  1U79 A;  2PV2 A;  3I6C A;  5HWC A;  1NMW A;  2PPN A;  4ODL A;  4DRK A;  2KO7 A;  4ODK A;  3O5E A;  1D7I A;  1C9H A;  1FKS A;  1FKG A;  2K8I A;  1M5Y A;  3EY6 A;  3JXV A;  3NTP A;  1J6Y A;  1BL4 A;  4W9Q A;  2DG9 A;  2MPH A;  4ODM A;  1FKI A;  3NI6 A;  1KT0 A;  1FD9 A;  1FAP A;  2XPB A;  2ZR4 A;  1J4R A;  2FAP A;  2JZV A;  4ODQ A;  3TDB A;  4JFJ A;  1JNT A;  3KAD A;  2XPA A;  2Y78 A;  4QIB A;  4DRP A;  2KE0 A;  5HKG A;  1FKT A;  3O5M A;  3IKG A;  4GIV A;  4DZ2 A;  1F8A B;  1A7X A;  1JVW A;  1FKK A;  2XP3 A;  2MNT A;  4NNR A;  2VN1 A;  5HTG A;  2Q5A A;  2L2S A;  4BF8 A;  4DH0 A;  2KGJ A; 
#chains in the Genus database with same CATH topology
 4ZPV R;  4ZPW R;  4TX0 A;  4DRO A;  2DT2 A;  4JYS A;  2D9F A;  1LL4 A;  1Q6U A;  4MSP A;  4Q7N A;  2OFN A;  1B6C A;  4DRJ A;  5DO2 A;  1GOI A;  2M08 A;  2RUC A;  1EIB A;  2F2D A;  2KFW A;  3O5R A;  3ALF A;  2WK2 A;  3OOB A;  1PBK A;  3ARP A;  3BXW A;  1LQ0 A;  2FDM A;  4ITZ A;  1HKJ A;  2ESC A;  3CHD A;  3IKD A;  3O5D A;  2KI3 A;  4DZ3 A;  2MLY A;  3JYM A;  3PR9 A;  4FAP A;  1FKD A;  1TFV A;  2RQS A;  5HW6 A;  1NWT A;  2P4V A;  1QZ2 A;  2QF8 A;  2WLY A;  2B31 A;  3MDY B;  2PBC A;  3O5G A;  3CHE A;  3O5O A;  2LKN A;  4MPK A;  1UR8 A;  1JCH B;  3O5Q A;  3AS0 A;  1HJX A;  1EQ3 A;  4DWS A;  3B7X A;  1NWR A;  2F21 A;  4IQC A;  2O92 A;  1F40 A;  1OGB A;  4ODR A;  4UDM A;  1Y0O A;  4O2T A;  4HAR A;  4QT2 A;  4QZV B;  1Q6H A;  2RUR A;  2XP6 A;  5GPR A;  3G6L A;  5HT1 A;  4WJX A;  4IT4 A;  3ARO A;  1J4I A;  3WD4 A;  1U79 A;  3I6C A;  2ETN A;  4DRK A;  4LGX A;  1C9H A;  1FFR A;  3NTP A;  3ARW A;  3EY6 A;  4W9Q A;  1E6R A;  1FKI A;  4W5U A;  3WQW A;  4Z2L A;  3FXY A;  5HBF A;  3WD2 A;  2DSW A;  4ML4 A;  4MTV A;  4ZPT R;  2XPA A;  4Q22 A;  2Y78 A;  4QIB A;  1IX5 A;  2KE0 A;  3RM9 A;  3ARY A;  1ZL1 A;  2MNT A;  3AS3 A;  2Q5A A;  5DIU A;  3FY1 A;  1ZK6 A;  3O5I A;  4MNJ A;  2A3C A;  3PRD A;  3WL1 A;  1GPF A;  3B9D A;  1H0G A;  4W9O A;  3CHF A;  3B8S A;  1FKB A;  2DSZ A;  4S3K A;  5DIV A;  1ZBC A;  2N87 A;  2ZQV A;  5I98 A;  1FKJ A;  4U85 A;  1PIN A;  5HWB A;  3UI5 A;  3O5P A;  1D7H A;  4Z2K A;  4DWS C;  1WAW A;  1HKM A;  3BMB A;  4DRQ A;  4P8U A;  1LG2 A;  2ZQT A;  1X6L A;  3B9A A;  1VF8 A;  4U86 A;  5HUA A;  1TCO C;  1NSG A;  3WD0 A;  3ARS A;  3PA7 A;  4ODN A;  4GGQ A;  1QPF A;  3AQU A;  3G6M A;  3KAC A;  4TW6 A;  1XRV A;  4JFI A;  4LAV A;  1NWU A;  1ZBV A;  4XAK A;  4U84 A;  4DT4 A;  2M2A A;  5BXJ A;  1Q6I A;  1FFQ A;  2RSE A;  2ZR6 A;  2M1I A;  3ARR A;  2DPE A;  4P8V A;  2MF9 A;  2XP4 A;  4R5E A;  1D7J A;  3VAW A;  4URI A;  3KCE A;  1W1T A;  3KAB A;  5GPG A;  2XP7 A;  2WLZ A;  3UQB A;  1ITX A;  1YAT A;  1FKH A;  1J4H A;  3ALG A;  3WIJ A;  1EHN A;  1W1V A;  5HWC A;  1D2K A;  1NMW A;  2PPN A;  3AS2 A;  4WKF A;  1D7I A;  2PN0 A;  4L72 B;  1FKG A;  2K8I A;  1J6Y A;  2MPH A;  4ODM A;  3NI6 A;  1KT0 A;  3WD1 A;  3WD3 A;  1FAP A;  1W1P A;  2XPB A;  4HBO A;  2FAP A;  4KR0 B;  1HKK A;  1FKT A;  1GUV A;  1E6Z A;  1JVW A;  4NNR A;  5HTG A;  2L2S A;  4BF8 A;  4DH0 A;  2LGO A;  4P8X A;  2DT1 A;  2XP5 A;  4JFM A;  3WQV A;  2ZR5 A;  1NH6 A;  4IPX A;  2LJ4 A;  3CGM A;  1FKF A;  1HJV A;  1LL6 A;  4DRN A;  5GQB A;  3LUO A;  1OWQ A;  3GTY X;  4DRM A;  4J4O A;  4DIP A;  1L1P A;  1ZBW A;  4G50 A;  4WKA A;  2RUD A;  4TW7 A;  5DEZ A;  2A3B A;  3O5L A;  3ARU A;  2AOS A;  3UQA A;  1ROT A;  4Z2J A;  4LAX A;  1EDQ A;  2PPO A;  1FKR A;  2XP8 A;  2DT3 A;  4G2P A;  1W9U A;  3W4R A;  4LAY A;  3H9R B;  2MLZ A;  4IT6 A;  2PPP A;  3JYJ A;  3PRB A;  5D75 A;  2UZ5 A;  5HW8 A;  3ODK A;  5HW7 A;  1JNS A;  1WB0 A;  4MGV A;  5JH8 A;  3RFW A;  1D6O A;  3ARX A;  1JND A;  2XP9 A;  4ZS6 A;  1O6I A;  1QPL A;  1RD6 A;  3B9E A;  3NRK A;  4KQZ A;  1NWS A;  2B5U B;  4TYO A;  1ZB5 A;  4MNL A;  2ZQU A;  1W9P A;  3KAG A;  1X6N A;  2IF4 A;  4C02 B;  4ODO A;  4DRI A;  1GRJ A;  2FKE A;  4PTM A;  1KT1 A;  2F23 A;  3IK8 A;  3UI4 A;  3CHC A;  1HJW A;  3RME A;  2EUL A;  3O5E A;  4WK9 A;  3ARZ A;  1UR9 A;  3JXV A;  2IUZ A;  1FD9 A;  1K9T A;  1E15 A;  2ZR4 A;  1J4R A;  3ARQ A;  4ODQ A;  3TDB A;  4JFJ A;  1JNT A;  3RM8 A;  5HKG A;  3O5M A;  4L3N A;  3IKG A;  1JNE A;  4DZ2 A;  4P8W A;  2DSV A;  1FKK A;  2A3A A;  4IQ2 A;  2KR7 A;  1YW5 A;  3GPK A;  3EIP A;  2MLX A;  4N19 A;  3TCZ A;  2YBT A;  3PRA A;  1HXV A;  1W26 A;  2ZQS A;  3ART A;  3WH0 A;  2PV3 A;  3ARV A;  2A3E A;  1FKL A;  1SYT A;  1R9H A;  3O5K A;  1ROU A;  2DSU A;  3KAF A;  4JFL A;  4QT3 A;  4DRH A;  4WKH A;  1T11 A;  3KAH A;  3FAP A;  4TNS A;  4WIW A;  3OA5 A;  2F4E A;  1OGG A;  2YBU A;  4MNK A;  3IHZ A;  2DG4 A;  2DT0 A;  3KAI A;  3CGN A;  5DIT A;  5J6E A;  5DF0 A;  3TC5 A;  1P5Q A;  2VCD A;  4NSB A;  1E44 A;  3CH9 A;  4JFK A;  2OLH A;  3CZ8 A;  3UF8 A;  1W1Y A;  2G41 A;  3RGC A;  1E9L A;  1FJD A;  4TW8 A;  4DWS D;  4Z2G A;  1N1A A;  4W9P A;  1BKF A;  3GU0 A;  4NZC A;  3WL0 A;  4J4N A;  4AY1 A;  2DG3 A;  4MNM A;  1LG1 A;  3WKZ A;  3RM4 A;  5B8I C;  1XHG A;  3O5F A;  3UI6 A;  2RUQ A;  4ODP A;  1W9V A;  4FN2 A;  1CTN A;  3UQI A;  3O5J A;  4LAW A;  1ZCN A;  1H0I A;  3AS1 A;  1EYM A;  2PV1 A;  1NMV A;  1Q1C A;  1E6P A;  2LPV A;  2O9O A;  3KZ7 A;  1ZU8 A;  2WM0 A;  2AWG A;  2ITK A;  2PV2 A;  2G8Z A;  4HBE A;  4S3J A;  4ODL A;  2KO7 A;  4ODK A;  1LL7 A;  1FKS A;  1HKI A;  1SR0 A;  1M5Y A;  1WNO A;  1ZBK A;  1BL4 A;  4Z2I A;  2DG9 A;  2PI6 A;  2JZV A;  3KAD A;  4DRP A;  4Z2H A;  3QOK A;  4MAV A;  4GIV A;  1F8A B;  1E6N A;  1A7X A;  2XP3 A;  4DWS B;  2VN1 A;  1LJY A;  4R0X A;  1KFW A;  2KGJ A; 
#chains in the Genus database with same CATH homology
 4ZPV R;  4ZPW R;  4TX0 A;  4DRO A;  2DT2 A;  4JYS A;  2D9F A;  1LL4 A;  1Q6U A;  4MSP A;  4Q7N A;  2OFN A;  1B6C A;  4DRJ A;  5DO2 A;  1GOI A;  2M08 A;  2RUC A;  1EIB A;  2F2D A;  2KFW A;  3O5R A;  3ALF A;  2WK2 A;  3OOB A;  1PBK A;  3ARP A;  3BXW A;  1LQ0 A;  2FDM A;  4ITZ A;  1HKJ A;  2ESC A;  3CHD A;  3IKD A;  3O5D A;  2KI3 A;  4DZ3 A;  2MLY A;  3JYM A;  3PR9 A;  4FAP A;  1FKD A;  1TFV A;  2RQS A;  5HW6 A;  1NWT A;  1QZ2 A;  2QF8 A;  2WLY A;  2B31 A;  3MDY B;  2PBC A;  3O5G A;  3CHE A;  3O5O A;  2LKN A;  4MPK A;  1UR8 A;  3O5Q A;  3AS0 A;  1HJX A;  1EQ3 A;  4DWS A;  3B7X A;  1NWR A;  4IQC A;  2F21 A;  2O92 A;  1F40 A;  1OGB A;  4ODR A;  1Y0O A;  4O2T A;  4HAR A;  4QT2 A;  4QZV B;  1Q6H A;  2RUR A;  2XP6 A;  5GPR A;  3G6L A;  5HT1 A;  4WJX A;  4IT4 A;  3ARO A;  1J4I A;  3WD4 A;  1U79 A;  3I6C A;  4DRK A;  4LGX A;  1C9H A;  1FFR A;  3NTP A;  3ARW A;  3EY6 A;  4W9Q A;  1E6R A;  1FKI A;  4W5U A;  3WQW A;  4Z2L A;  3FXY A;  5HBF A;  3WD2 A;  2DSW A;  4ML4 A;  4MTV A;  4ZPT R;  2XPA A;  4Q22 A;  2Y78 A;  4QIB A;  1IX5 A;  2KE0 A;  3RM9 A;  3ARY A;  1ZL1 A;  2MNT A;  3AS3 A;  2Q5A A;  5DIU A;  3FY1 A;  1ZK6 A;  3O5I A;  4MNJ A;  2A3C A;  3PRD A;  3WL1 A;  1GPF A;  3B9D A;  1H0G A;  4W9O A;  3CHF A;  3B8S A;  1FKB A;  2DSZ A;  4S3K A;  5DIV A;  1ZBC A;  2N87 A;  2ZQV A;  5I98 A;  1FKJ A;  4U85 A;  1PIN A;  5HWB A;  3UI5 A;  3O5P A;  1D7H A;  4Z2K A;  4DWS C;  1WAW A;  1HKM A;  4DRQ A;  4P8U A;  1LG2 A;  2ZQT A;  1X6L A;  3B9A A;  1VF8 A;  4U86 A;  5HUA A;  1TCO C;  1NSG A;  3WD0 A;  3ARS A;  3PA7 A;  4ODN A;  4GGQ A;  1QPF A;  3AQU A;  3G6M A;  3KAC A;  4TW6 A;  1XRV A;  4JFI A;  4LAV A;  1NWU A;  1ZBV A;  4XAK A;  4U84 A;  4DT4 A;  2M2A A;  5BXJ A;  1Q6I A;  1FFQ A;  2RSE A;  2ZR6 A;  2M1I A;  3ARR A;  2DPE A;  4P8V A;  2MF9 A;  2XP4 A;  4R5E A;  1D7J A;  3VAW A;  4URI A;  3KCE A;  1W1T A;  3KAB A;  5GPG A;  2XP7 A;  2WLZ A;  3UQB A;  1ITX A;  1YAT A;  1FKH A;  1J4H A;  3ALG A;  3WIJ A;  1EHN A;  1W1V A;  5HWC A;  1D2K A;  1NMW A;  2PPN A;  3AS2 A;  4WKF A;  1D7I A;  4L72 B;  1FKG A;  2K8I A;  1J6Y A;  2MPH A;  4ODM A;  3NI6 A;  1KT0 A;  3WD1 A;  3WD3 A;  1FAP A;  1W1P A;  2XPB A;  4HBO A;  2FAP A;  4KR0 B;  1HKK A;  1FKT A;  1GUV A;  1E6Z A;  1JVW A;  4NNR A;  5HTG A;  2L2S A;  4BF8 A;  4DH0 A;  2LGO A;  4P8X A;  2DT1 A;  2XP5 A;  4JFM A;  3WQV A;  2ZR5 A;  1NH6 A;  4IPX A;  2LJ4 A;  3CGM A;  1FKF A;  1HJV A;  1LL6 A;  4DRN A;  5GQB A;  3LUO A;  1OWQ A;  4DRM A;  4J4O A;  4DIP A;  1L1P A;  1ZBW A;  4G50 A;  4WKA A;  2RUD A;  4TW7 A;  5DEZ A;  2A3B A;  3O5L A;  3ARU A;  2AOS A;  3UQA A;  1ROT A;  4Z2J A;  4LAX A;  1EDQ A;  2PPO A;  1FKR A;  2XP8 A;  2DT3 A;  4G2P A;  1W9U A;  3W4R A;  4LAY A;  3H9R B;  2MLZ A;  4IT6 A;  2PPP A;  3JYJ A;  3PRB A;  5D75 A;  2UZ5 A;  5HW8 A;  3ODK A;  5HW7 A;  1JNS A;  1WB0 A;  4MGV A;  5JH8 A;  3RFW A;  1D6O A;  3ARX A;  1JND A;  2XP9 A;  4ZS6 A;  1O6I A;  1QPL A;  1RD6 A;  3B9E A;  3NRK A;  4KQZ A;  1NWS A;  4TYO A;  1ZB5 A;  4MNL A;  2ZQU A;  1W9P A;  3KAG A;  1X6N A;  2IF4 A;  4C02 B;  4ODO A;  4DRI A;  2FKE A;  4PTM A;  1KT1 A;  3IK8 A;  3UI4 A;  3CHC A;  1HJW A;  3RME A;  3O5E A;  4WK9 A;  3ARZ A;  1UR9 A;  3JXV A;  2IUZ A;  1FD9 A;  1K9T A;  1E15 A;  2ZR4 A;  1J4R A;  3ARQ A;  4ODQ A;  3TDB A;  4JFJ A;  1JNT A;  3RM8 A;  5HKG A;  3O5M A;  4L3N A;  3IKG A;  1JNE A;  4DZ2 A;  4P8W A;  2DSV A;  1FKK A;  2A3A A;  4IQ2 A;  2KR7 A;  1YW5 A;  3GPK A;  2MLX A;  4N19 A;  3TCZ A;  2YBT A;  3PRA A;  1HXV A;  1W26 A;  2ZQS A;  3ART A;  3WH0 A;  2PV3 A;  3ARV A;  2A3E A;  1FKL A;  1SYT A;  1R9H A;  3O5K A;  1ROU A;  2DSU A;  3KAF A;  4JFL A;  4QT3 A;  4DRH A;  4WKH A;  1T11 A;  3KAH A;  3FAP A;  4TNS A;  4WIW A;  3OA5 A;  2F4E A;  1OGG A;  2YBU A;  4MNK A;  3IHZ A;  2DG4 A;  2DT0 A;  3KAI A;  3CGN A;  5DIT A;  5J6E A;  5DF0 A;  3TC5 A;  1P5Q A;  2VCD A;  4NSB A;  3CH9 A;  4JFK A;  2OLH A;  3CZ8 A;  3UF8 A;  1W1Y A;  2G41 A;  3RGC A;  1E9L A;  1FJD A;  4TW8 A;  4DWS D;  4Z2G A;  1N1A A;  4W9P A;  1BKF A;  4NZC A;  3WL0 A;  4J4N A;  4AY1 A;  2DG3 A;  4MNM A;  1LG1 A;  3WKZ A;  3RM4 A;  5B8I C;  1XHG A;  3O5F A;  3UI6 A;  2RUQ A;  4ODP A;  1W9V A;  4FN2 A;  1CTN A;  3UQI A;  3O5J A;  4LAW A;  1ZCN A;  1H0I A;  3AS1 A;  1EYM A;  2PV1 A;  1NMV A;  1Q1C A;  1E6P A;  2LPV A;  2O9O A;  3KZ7 A;  1ZU8 A;  2WM0 A;  2AWG A;  2ITK A;  2PV2 A;  2G8Z A;  4HBE A;  4S3J A;  4ODL A;  2KO7 A;  4ODK A;  1LL7 A;  1FKS A;  1HKI A;  1SR0 A;  1M5Y A;  1WNO A;  1ZBK A;  1BL4 A;  4Z2I A;  2DG9 A;  2PI6 A;  2JZV A;  3KAD A;  4DRP A;  4Z2H A;  3QOK A;  4MAV A;  4GIV A;  1F8A B;  1E6N A;  1A7X A;  2XP3 A;  4DWS B;  2VN1 A;  1LJY A;  4R0X A;  1KFW A;  2KGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...