3H9WA

Crystal structure of the n-terminal domain of diguanylate cyclase with pas/pac sensor (maqu_2914) from marinobacter aquaeolei, northeast structural genomics consortium target mqr66c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
b'KAIPWKINWQTMAFEYIGPQIEALLGWPQGSWKSVEDWATRMHPEDQEWVVNFCVKQSECGVDHEADYRALHRDGHYVWIRDVVHVVRDDSGEVEALIGFMFDISLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diguanylate cyclase with PAS/PAC sensor
publication title Northeast Structural Genomics Consortium Target MqR66C
rcsb
source organism Marinobacter aquaeolei
molecule tags Structural genomics, unknown function
total genus 30
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h9wA00
4LLOB 2QWSA 4L9EA 4R38A 1TS0A 4GHIA 5AVFA 1LSXA 1V9YA 4YWZA 2Z6DA 2V9AA 4KUKA 2VV6A 3IBRA 3LIBA 2PD7A 3C2WA 4F3LA 2PYRA 4HJ4A 3SW1A 5TBMB 5HSQA 4HH3A 4B9OA 1N9LA 5HWTA 4LRZE 3C8CA 5HWWA 2V1AA 2D02A 3G6OA 3PHYA 4JGOA 3LI8A 2J80A 3E4PA 4WF0A 2K7SA 4R6LA 5HD3A 4LRYC 4BBTA 4XT2B 1DP6A 2D01A 5DKLA 4GS9B 2Z6CA 1T18A 3CWFA 4NXEA 4DJ3A 4PKYG 4WL9A 5HWVA 4EQ1A 3VE4A 4I3JA 3GECA 3F1NB 1GSVA 3NOTC 3D72A 3LIFA 4HH2A 1T1CA 5F6AA 3MR0A 2VEAA 3RTYA 1OT9A 5TBMA 1NWZA 2INWA 2JN7A 4L9GA 3MXQA 1TS7A 1XJ6A 3MFXA 2L0WA 1OTEA 1WA9A 2PHYA 1DP8A 1VB6A 5DJTA 2PR5A 4M4XA 4GS9A 3NJAA 4PKYA 2ZBBA 4HOIA 2V0UA 3UE6A 4WN5A 3UMDA 3VE3A 3HJKA 1LL8A 1KOUA 3F1NA 5F5YA 1XJ2A 4JGRA 5HZHA 3K3CA 5IS1A 3OLOA 3BY8A 5G4YA 5J3WA 4MN5A 1LSWA 5KIZA 3LIAA 3GDIA 3E4OA 4I5SA 4JGQA 3PYPA 4NXFA 3UB6A 4WLAA 1Y28A 2PYPA 4R70A 2QHKA 1G28A 3MJQA 4E04A 2L4RA 5G4ZA 3A0VA 1F9IA 1GSXA 1OTDA 1XJ3A 5J7EA 4K08A 1D7EA 3BY9A 4I3AA 4NXGA 1DP9A 1DRMA 3IS2B 2ZOHA 2GJ3A 3P7NA 4DJ2A 4GCZA 3H82A 4HQAA 3ICYA 4HP9A 2HV1A 3RH8B 2L1MA 4MN6A 4H6JB 3A0SA 4I39A 2OWHA 4L9FA 4HJ6A 5HDDA 2V1BA 4RQ9A 1ODVA 1OTIA 4EETB 2KDKA 4HHDA 4EEPA 5AVEA 1EW0A 2OWJA 1N9NA 2W27A 1S4SA 3MQQA 4HNBA 1OTAA 3NHQA 3A0RA 3IS2A 2OOLA 3H9WA 1F98A 4BBVA 1TS6A 3CLOA 2YKHA 1MZUA 5F68A 2JHEA 3LIDA 4HI4A 2H28A 3B33A 5EFWA 4I3IA 3H82B 4JGPA 4LPZA 1OJGA 5DKKA 4H6JA 2QJ7A 4EW7A 3LIEA 4KUOA 3FC7A 3NOPC 3UB8A 4HJ3A 3ULFA 5DJUA 2CMNA 4EXOA 1T19A 2R78A 2VV7A 2B02A 2A24A 5HD5A 1UWNX 4BBUA 3UB7A 3F1PB 2WKPA 3EWKA 1T1BA 4EERA 2PD8A 1JNUA 2VV8A 2KX6A 4NXBA 3F1OB 2ZOIA 4GW9A 1T1AA 1XJ4A 1P0ZA 1S66L 5F69A 1TS8A 2M1CA 2YKFA 3LYXA 3H7WB 1OT6A 2QJ5A 5A8BA 3LUQA 2I9VA 3FG8A 5I5LA 2WKRA 4LRXC 1GSWA 5HDSA 5IU1A 1LT0A 3LI9A 1S4RA 2PDRA 3BWLA 3F1PA 3LICA 2A24B 4GHIB 2PR6A 2V0WA 2BASA 4I38A 1XFNA 4EEUA 1D06A 1P97A 1BYWA 3K3DA 5J4EA 3EEHA 4KQDA 3F1OA 3HJIA 4F3LB 2EA9A 4WUJA 4HP4A 4HY8A 3UMEA 3ZQ5A 3H7WA 1N9OA 3NOUC 1S67L 1LSVA 1X0OA 1XFQA 1UWPX 3UB9A 3CAXA 2VLGA 1S1YA 3KX0X 2W0NA 1OTBA 1V9ZA 1UGUA 4XT2A 3MQOA 3VOLA 1OJ5A 4EESA 4HIAA 3T50A 2WKQA 4R3AA 2QKPA 2P7JA 1S1ZA 5HDCA 3E4QA
chains in the Genus database with same CATH superfamily
4L9EA 1YM1A 1ZG4A 3LEZA 1TS0A 5AVFA 3PBQA 4YFMA 4KZ8A 1DY6A 3QP2A 3LIBA 3BQAA 1K38A 4UQIS 5JYOA 3C2WA 4F3LA 3SW1A 5K5BA 1HLUP 2XA7S 1NRJA 3HVFA 5HL6A 3FYZA 4CJNA 1L0DA 4HH3A 5DTKA 3WWXA 4RX2A 3NC8A 2PAVP 3PAGA 3GV9A 5CGXA 2D02A 2WYXA 3QP1A 3LR5A 4D2OA 4LGWA 2A2LA 3E4PA 4NKPA 4WF0A 1CEGA 1K54A 2Y2NA 4P0MA 4Z9QA 4OP5A 3Q1FA 4OPQA 2IWDA 2Y91A 5GLBA 3ITAA 3GECA 4GB7A 4P87A 1NY0A 1BUEA 2P9VB 4X1MA 1GSVA 1PZPA 1TDGA 5EPHA 1PZOA 5FQMA 5I94A 4S2NA 4X56A 1PIOA 1E25A 1TD5A 3WS1A 1W5DA 3RTYA 3BQ8A 3WS2A 4L9GA 3MXQA 2VZWA 5HARA 5CEDA 4QB8A 4MNRA 4WBGA 4HBTA 3QP6A 2R9WA 2WK0A 5FQIA 3PR6A 1WA9A 2PHYA 2H0TA 5GLAA 5FQQA 3MZFA 1DP8A 1VB6A 5E2EA 1FSYA 3BECA 1CI8A 1E4DA 1O7EA 3M6BA 4WN5A 3UMDA 3V3RA 2Y2HA 2WAFA 3BLSA 2P9VA 2EWVA 3P01A 3QNBA 4WMCA 1XJ2A 1Q2QA 2Z2MB 2BG1A 2HPBA 4KQOA 3BY8A 5G4YA 4OQHA 5J3WA 4WEJA 4IUHA 3C38A 3GDIA 3GQZA 5IT5A 2O0YA 3T4TA 3M2KA 2XQZA 4BWIA 3UB6A 3SH9A 4R3BA 3PBNA 2VGLM 4R70A 2PYPA 4OLGA 3DTIA 5M19A 1BT5A 5FAQA 4E04A 4LV1A 1DJBA 4YOFA 4EU0A 4S2MA 2R9XA 4Y17A 2Y2QA 3M2JA 1ES3A 5J7EA 4K08A 2M7UA 1D7EA 3BY9A 4I3AA 1CEFA 1PI5A 5DFXA 5CHMA 1DRMA 3IS2B 5CX7A 4N1XA 2HDQA 5DTSA 1MPLA 3B3XA 5EECA 3BFFA 2A49A 3IWOA 2XEPA 4JPMA 3RH8B 2VKSA 4FH4A 4CPKA 4K0XA 3IWQA 1FCOA 4X69A 4QJGA 4JF5A 3LEQA 4EUVA 3L7HA 4R0QA 3V5MA 1G5UA 4DDSA 5HDDA 3S7QA 4B4XA 3WS4A 5C5KA 1XKZA 4R4SA 3HLCA 2I72A 3HUOA 3GMWA 3W8KA 2WAEA 4EEPA 1GHPA 5AVEA 3BM6A 4DKIA 1ALQA 1EW0A 2OWJA 3PTEA 1STZA 4H8RA 1WE4A 4OPZA 4DRTA 1SKFA 1S4SA 4X55A 4IVKA 1K57C 4OLDA 5L09A 1JTDA 3IS2A 3TSGA 2Q9NA 2HJEA 1F98A 1TS6A 2O9BA 1RP5A 4HI4A 2H0YA 2V2FF 4ZRRA 4RX3A 4WMCD 4I3IA 5HL1A 2J3TD 3JVUA 4JGPA 4Y0OA 1BLCA 1IOUA 4KUOA 3NOPC 3UB8A 3GSGA 1H3QA 1NZUA 2CMNA 5KMWA 2JKGA 2XROA 4FTXA 4WEKA 1P9WA 3T4LA 2R78A 2VV7A 3MFDA 4N92A 2FH5A 4WYYA 5CHJA 3ZGAB 2NUTC 5EVEA 2WGIA 1S0WA 3NDEA 3UB7A 2WKPA 3DTMA 3JYIA 2EFUA 4B88A 1FR6A 2V1ZA 2PD8A 3HUMA 3RFBA 5A90A 3KYQA 3C4OA 4LCMA 1EROA 3UO9A 4BLMA 3BFGA 2OSUA 1ONHA 2OAP1 4GNUA 3U2AA 4E3KA 2KX6A 4UA7A 4NXBA 3HBRA 2ZOIA 1GCEA 1T1AA 1LI0A 1KGFA 5F69A 3IF5A 4OVDA 4PM7A 4G3WA 3IXBA 3T4JA 1YLTA 3O3VA 1MXOA 1FR1A 1KDSA 5DF7A 1KGEA 3UPPA 5EVIB 4OOYA 3EOIA 4E3JA 3ISGA 4O0PA 1GSWA 1XXMA 1KDWA 5HAQA 5E2HA 4RYEA 5FQKA 3IBJA 4Q0HA 3LI9A 1L0FA 3A3FA 3FWLA 2XD5A 4PM9A 5TJJA 1K57A 1I2SA 3HCYA 3OCNA 3OZHA 1NYYA 2JCHA 2JKRI 3S7NA 4BENA 4DXCA 1K55C 1N4OA 3W2ZA 2X01A 3HLFA 3OOVA 1KE0A 1VM1A 3EEHA 2WGVA 3S7OA 2EA9A 3PBSA 1NZOA 4HP4A 3UMEA 3UE0A 3Q7VB 3DAVA 5HX9A 1S67L 1LSVA 4C6YA 4GJ4A 2VGLS 5FDSA 2Y2LA 2HF6A 5EE8A 2P08A 3NULA 5EVIA 5HPIA 2ACGA 3HUNA 1I5QA 3KX0X 3VP2A 1QMFA 1UGUA 3MQOA 3VOLA 1DJCA 1W63M 2IWCA 3VOZA 2G7UA 1XA7A 2P7JA 2JE5A 5TR7A 3UE3A 1S1ZA 2BLSA 1ZHHB 3NIAA 2W1TB 3VP1A 3FPVA 4YINA 1LSXA 3A3JA 3SS4A 2V9AA 2VV6A 3IBRA 1HZOA 1MKIA 4EQIA 2Y2KA 1YLPA 1LLBA 2PU4A 1XA1A 1ONGA 3Q7VA 2XK1A 2LB5A 4P85A 5TBMB 4UEYA 1S6RA 4XXRA 4B9OA 4Q0JA 4B93A 5HWTA 1XGJA 3C8CA 3SZTA 3PBTA 1ACFA 5CECA 1YAXA 3G6OA 4GDBA 2DMWA 1W7FA 3PHYA 3LI8A 1MC0A 3RXXA 2WZXA 4X53A 4KG5A 3VFHA 3WRTA 4LRYC 5HD3A 4BBTA 3KSHA 2Z6CA 4DXBA 4IJGA 5L8MA 3W4OA 1W8YA 1KVMA 4I3JA 3WS5A 1YMXA 3P09A 3NOTC 3T1RA 3OBFA 3SH8A 4HH2A 4NETA 1FOFA 5F6AA 2WGWB 2BTFP 4OQ0A 3PXPA 1ESIA 3M6HA 2DCFA 1OT9A 3N4IA 5TBMA 1PNEA 2V8CA 3TOIA 1ERQA 2O9CA 1ZTUA 3ZDJA 5FI2A 4C75A 3A3IA 4Y5FA 4RA7A 4S2NC 2OLUA 3KO6A 2EFXA 5EVID 2HDRA 2Y2GA 3Q81A 5FI7A 2PR5A 3PBRA 4PKYA 4GD8A 2ZJ9A 2AVXA 5HFOA 5CEBA 4UHUA 3BYDA 3CI6A 5AJGA 3GRJA 4JGRA 3IQAA 2WGWA 1M40A 2ZQ8A 3Q82A 4FUWA 3ZG0A 2VGKA 4DE3A 1ERMA 4KZBA 4ME4A 3CG5A 3T12B 3CPTB 4X6TA 2C5WB 3G4PA 2J3TC 2GDNA 2ZQ9A 2QHKA 3OPRA 3C30A 4O7DA 5FSRA 3S22A 4PMAA 4BD1A 4ESPA 4OONA 2P74A 5EVLA 3ITBA 4P6ZS 4KZ9A 5L2FA 3MS6A 1BLPA 2W3GA 4Q8IA 1PYYA 4NXGA 4CLCE 1PFLA 1PI4A 4KENB 2GJ3A 3P7NA 4DJ2A 5FATA 3R4KA 4HQAA 3CITA 1K6RA 5F1GA 1VEUB 3ICYA 5GLDA 1H8MA 3D3OA 3T4OA 2HDUA 4O01A 5HAIA 3CUEA 1YSQA 4MN6A 5CHUA 2XD1A 4H6JB 3CPTA 1MY8A 4KQRA 4HJ6A 4ID4A 4RQ9A 4LCLA 4PM6A 5AQBA 3BEBA 1ODVA 3HREA 3HLBA 3LR0A 4EETB 4HHDA 3TJZC 3G30A 1AWIA 1N9NA 1FQGA 1YLZA 2Y2JA 3NHQA 3A0RA 2OOLA 4BBVA 3CLOA 2J9OA 3ZNTA 3N8SA 2YKHA 3QP8A 1VEUA 5F68A 2JHEA 1I2WA 2B95A 5L07A 2H28A 2ZMVA 2X71A 4E6XA 1PWCA 4LPZA 1OJGA 3BFDA 4H6JA 2QJ7A 4EW7A 3FC7A 4PM8A 3ULFA 1PWGA 4DE0A 4FCFA 4LV2A 2XDMA 4EXOA 3PAEA 3TW8A 1K4FA 1T19A 1KGGA 1F2KA 2PRFA 4XUZA 5FQ9A 1QMEA 4Q0IA 1W8QA 2V20A 5HW3A 3ZVWA 3EWKA 4KZ3A 4HBUA 4EERA 2ZC4B 4EBPA 1SHVA 1P9RA 1MWSA 2Y2PA 1YMSA 1JNUA 3Q07A 4S2KA 4G3KA 2VX8A 3G2YA 5GHZA 2J8YA 3L9KA 5EOEA 3PBOA 2ZC5B 2M1CA 3LYXA 3ZHHA 1F5MA 2O99A 4EV4A 3DTKA 1KE4A 5CRFA 4LRXC 4KQQA 1C3BA 3TG9A 2PBYA 3AGEA 3U4LP 5GL9A 3UE1A 4N9KA 2HGVA 2PDRA 2UV0E 5MC7A 2NUPC 4A5RA 3FKWA 4GHIB 2V0WA 2BASA 5J8XA 4I38A 1D06A 1EI5A 4S2PA 4WZ5C 4R3JA 3DWZA 2ZC3B 1FSWA 4FD8A 4KQDA 3ZYTA 4L0LA 4OOLA 3ZQ5A 4C3QA 1IKGA 4U0TA 3HLEA 1X0OA 4OQIA 3O86A 1ZC2A 1PWDA 4JXVA 2W0NA 4LFUA 1V9ZA 2ZM0A 4XT2A 3IX8A 5FA7A 1OJ5A 2GZAA 3T50A 2WKQA 3K2NA 4IBRA 4R3AA 2QKPA 1U60A 4GZBA 1JTGA 5HDCA 2W3DA 5EVIC 4LLOB 2QWSA 1BZAA 1YLYA 4KZ6A 1H8ZA 4R38A 4JF6A 2JBFA 4GKUA 4GHIA 5F1FA 5G18A 1K56A 1V9YA 4YWZA 1N9BA 2J3WA 4S2LA 5LBRA 5AQ9A 4ZBEA 5FEGA 4QHCA 3UPNA 5KZHA 2J9PA 3LR4A 2W3FA 3VSLA 1VETB 1BTLA 3IF6B 4DE1A 4MBHA 4E3OA 4K91A 1YLJA 4QD4A 2XSSA 4E3LA 4NK3A 4IEDA 2VK3A 3KYZA 4JGOA 3MZEA 2J80A 1TEMA 4MBFA 2K7SA 4R6LA 2XGNA 3LGOA 2EWWA 2XR0A 5AQAA 4WZ5A 3UDXA 3CWFA 5E43A 3T1SA 3EQVA 5HWVA 1RGZA 3IHBA 3F1NB 4ETXA 4E3IA 3ZFZA 1ZG6A 2K2NA 1T1CA 2JKRM 4OOMA 3W4QA 3OC2A 2VEAA 4P6ZM 1VETA 4N9LA 1NWZA 2INWA 3IF6A 2HP9A 3Q7ZA 2E8IA 2JN7A 3MZDA 1TS7A 1XJ6A 1JWPA 3MFXA 4UA9A 2CC1A 1OTEA 3ZG5A 1TF1A 2XFSA 4YNRA 4HESA 1RCJA 3IX4A 3T1XA 2EX6A 1G6OA 2ZQAA 4S2OA 1E3UA 2HZ5A 3LCEA 4M4XA 4ETZA 3HLGA 5EM0A 4HOIA 5JYPA 5L10A 3AGDA 3TE8A 1SZVA 3F1NA 2OLVA 5F5YA 3NY4A 2ZL1B 2E8JA 3JVVA 4KZ7A 4UA6A 1K56D 5HZHA 5FDHA 1YQSA 3N8LA 4Y2FA 3WS0A 3E2LA 3IH8A 1LSWA 1K6SA 3IWIA 5KIZA 4E3NA 4I5SA 2PBDP 3T4KA 4JGQA 5TGFA 3PYPA 2HP6A 2JKTI 4ZTKA 4R1GA 3MSHA 4WLAA 2Y2OA 1ESUA 3RJUA 5EV0A 5F82A 5GHYA 4N1HA 5M1AA 3MJQA 2VA0A 3NBLA 1ES2A 5G4ZA 2XFTA 3LO7A 3A0VA 1W63Q 4CLCC 1GSXA 1OTDA 1K25A 4JXGA 1XJ3A 4HEFA 1BSGA 4Y15A 3UNWA 3ZNYA 2FFYA 4E3MA 5A92A 1GA0A 1CI9A 1G6AA 2ZL1A 3H82A 4Y3IA 1HTZA 3BRMA 3E2KA 3OPPA 3V67A 2HV1A 2ZLYA 4BQMA 2L1MA 2ZQDA 2VJWA 4K0WA 3A0SA 2JKFA 4X25A 5EUAA 1IKIA 4I39A 3UDIA 4LV3A 4L9FA 3G35A 1H8YA 2WUQA 3E98A 4NG2A 4GDNA 2JC7A 4CLCB 3N7WA 1OTIA 3OCLA 2Y55A 2QMIA 3CUEC 3BJNA 2X02A 3ZVTA 3IXHA 3GTCA 1OPXA 4JBFA 4JF4A 3A3EA 1EWZA 1L2SA 1DJAA 1AXBA 1NRFA 3B47A 3N6IA 4JKTA 3MQQA 1FILA 4HNBA 1E3UD 4EWFA 1YLWA 2J7VA 2UWXA 1W79A 3H9WA 1NJ4A 1L0EA 5CXWA 2Y4AA 3LIDA 5EFWA 2H5SA 4G3VA 4S2JA 3BFEA 3AGFA 2HDSA 4HJ3A 5DJUA 3S4XA 3D9YA 1XPBA 4GN2A 4R4RA 3ZCZA 1BLHA 3SS3A 4CLCA 1NLYA 2B02A 3FKVA 2A24A 5KSCA 4OP8A 4BBUA 2ZMAA 1FCMA 3F1PB 3BLMA 4MDZA 3N8RA 1GA9A 5FI6A 2EX2A 1PW1A 2VGJA 5A93A 1WYBA 2QZ6A 1IELA 1IYSA 2VV8A 4BMWA 4LENA 3G34A 1ZKJA 2QPNA 3F1OB 1GHMA 2PT7A 1K0KA 4IHQA 1XJ4A 1P0ZA 2P04A 1TS8A 1CF0A 1JWZA 3BW6A 4DMZA 2ZQ7A 4DF6A 1OT6A 4FSFA 2QJ5A 5TFQA 5A8BA 3LUQA 3B42A 2I9VA 3O5YA 3T1QB 5DF9A 1CJFA 3VOYA 4GOGA 4PM5A 3SOIA 5HDSA 5IU1A 3MXSA 3IXGA 2KOIA 2OV5A 3V50A 1S4RA 4NEED 5GHXA 3DBAA 4MCWA 4AFIA 3F1PA 2Y79A 1MWUA 3QP4A 3O88A 1Z6FA 3LICA 3ZG8B 3MF0A 4OKPA 1XFNA 2IWBA 3JPUA 5E2FA 4BL2A 2RL3A 2G2WA 3F1OA 4OH0A 4WUJA 4HY8A 1M6KA 3VSKA 2FFFB 2XF3A 2XH9A 1JWVA 2QYBA 3KYEA 3NOUC 1XFQA 3C4PA 1HD8A 3IHAA 5E2GA 4KZAA 3VFFA 3UB9A 4LV0A 4EBNA 3MQ0A 1S1YA 3IH9A 3G32A 1OTBA 3DWKA 3EGXC 4JXSA 3MBZA 2GNXA 3KSGA 1CQAA 4RVAA 3FZCA 1LL9A 1L0GA 1LI9A 5F83A 3VP0A 4PHTA 1SDNA 1CK3A 3E4QA 3NDGA 4CLCD 2B18A 5BOHA 2WKHA 5HPFA 2ZC6B 2Z6DA 4KUKA 1MWRA 4QU3A 3LY4A 3VV4A 2PD7A 1Y4OA 2PYRA 3VP3A 1LHYA 2ZM8A 1MKMA 4HJ4A 2W3EA 5EOOA 2ZM2A 2G2UA 5HSQA 2WKEA 1N9LA 4LRZE 1VHMA 5HWWA 4S2IA 2V1AA 3LY3A 4F94A 5DKLA 4XT2B 1DP6A 2D01A 4GS9B 3DW0A 3NCKA 1T18A 2LB9A 2A3UA 3SH7A 1OMEA 4NXEA 4DJ3A 2W3HA 4PKYG 4WL9A 1PRQA 4EQ1A 5FEFA 2EX8A 3VE4A 3GVBA 4UAAA 4CQHA 3C5AA 3S1YA 2WADA 3D72A 3GR2A 3LIFA 4GLQA 4KG2A 1VQQA 4DN0A 4MLLA 3HL9A 3MR0A 3UPOA 4JXWA 3QHYA 2KLIA 4DE2A 4BJPA 3TRCA 1YKDA 4R23A 3ZG7B 2L0WA 4PPRA 4WZ4A 1NLZA 5DVAA 4OPYA 3KSIA 1FCNA 4QY5A 3IF6C 5DJTA 2ZQCA 4GS9A 3CZDA 1IYQA 3NJAA 2ZBBA 2Q9MA 2V0UA 3UE6A 2FZ0A 1RGYA 3VMAA 3VE3A 2HP5A 3HJKA 1LL8A 1BULA 1KOUA 3KSFA 1XX2A 4ZJ2A 2ZD8A 3UDFA 3W4PA 3K3CA 2PU2A 3C7VA 5IS1A 3OLOA 3MMHA 3D4FA 4E6WA 4MN5A 5A91A 1SKOB 3CHWP 1L3LA 3LIAA 1YPRA 1ES5A 3E4OA 4OQGA 4ZJ3A 2GX5A 4GD6A 1H5XA 4NXFA 2IA2A 5HAPA 1JVJA 1Y28A 4U0XA 3CMZA 2EXBA 4QWOA 4M3KA 3NI9A 4KZ5A 1G28A 3QNCA 2L4RA 3T4QA 1O07A 5DFYA 1G68A 1PW8A 1F9IA 4WELA 4II7A 4Y0TA 5CTNA 3RXWA 1Z09A 1Y54A 3LR3A 3UY6A 3V3SA 3EEAA 1TVFA 3FPWA 1DP9A 4DDYA 3G2ZA 3S7PA 2ZOHA 1J3WA 3IT9A 4MBKA 4GCZA 1XP4A 2C6WB 1SDEA 1KE3A 4P6BA 1H0MA 4HP9A 2M7VA 4QPRA 1MBLA 3T4SA 5D3OA 5EM1A 4UQIM 3IX3A 1SKOA 2WZZA 3MKFA 1IYPA 4WM9A 2Z2LB 2OWHA 2XA7M 4EBLA 2K31A 2V1BA 4BD0A 3IXDA 3MKEA 2RCXA 4B4ZA 5FASA 2KDKA 1NYMA 4MMNA 1MWTA 1WYCA 3QP5A 4MN7A 4IVIA 1A0KA 2W27A 3CJMA 2EXAA 4ZAMA 4KZ4A 1D1JA 1KVLA 1OTAA 3OPLA 3VP4A 2OAQ1 3OPHA 5CERA 1XGIA 5CGWA 2XLNA 3O87A 3G31A 3WRZA 4FH2A 1HVBA 2WKIA 1MZUA 4Y13A 3FV7A 3B33A 4MEZA 1Q2PA 3H82B 4FOFA 5DF8A 3P98A 5CGSA 4IBXA 5DKKA 3LIEA 1LL5A 4PAUA 4Y7PA 3UB5P 5KSHA 3R7WB 1BLSA 5FAOA 4X68A 2EX9A 1NXYA 3C7UA 4ZJ1A 5HD5A 1UWNX 2Y8HA 5IHVA 2JKTM 2HJ9C 3BFCA 4KG6A 5DTTA 1IEMA 1T1BA 3EQUA 3HLWA 3ZG9B 4D60A 5AQ7A 2H10A 1YT4A 2Q0OA 4U3TA 4GW9A 2O9AA 3I7JA 1S66L 4X1LA 2YKFA 1IFQA 3H7WB 5CTMA 1IYOA 4ARZB 4Y0UA 5GLCA 4XUXA 3FG8A 5I5LA 2WKRA 1SCWA 3R7WA 2W1RA 2Y59A 1LT0A 1K55A 2ZMFA 2W1TA 3E0YA 5FAPA 2DRWA 4ZDXA 4EUZA 4QY6A 3BWLA 3NECA 2Y2MA 5FQJA 1TDLA 2V8FA 1K54C 2A24B 5U47A 3V39A 2PR6A 4O8GA 4EEUA 3EGDC 1P97A 1BYWA 4JLFA 3MXRA 3K3DA 5J4EA 3HJIA 4F3LB 1K4EA 2B5RA 3UN7A 4Z1WA 3H7WA 1N9OA 2Y2IA 4ARZA 2XRNA 5FL3A 4IUKA 3SS5A 1UWPX 2MJ6A 3HLDA 3CAXA 3A3DA 2VLGA 3DTEA 5M18A 4OPRA 1ES4A 4BL3A 4EESA 1FIKA 4HIAA 2ZC7A 1GHIA 1J9MA 2DNSA 1YSPA 3LFVA
chains in the Genus database with same CATH topology
2W1TB 4LLOB 2QWSA 4L9EA 4R38A 3FPVA 1TS0A 4GHIA 5AVFA 1LSXA 3PBQA 5HPFA 1V9YA 4YWZA 2Z6DA 2V9AA 4KUKA 2VV6A 3IBRA 3LIBA 2J3WA 3BQAA 5LBRA 4UQIS 3VV4A 2PD7A 3C2WA 4F3LA 2PYRA 1MKMA 4HJ4A 2W3EA 5K5BA 3SW1A 3LR4A 2W3FA 2XA7S 1NRJA 2LB5A 5HL6A 5TBMB 4UEYA 5HSQA 4HH3A 4B9OA 1N9LA 4Q0JA 4B93A 5HWTA 4LRZE 1VHMA 3C8CA 5HWWA 3PBTA 2XSSA 2V1AA 1YAXA 2D02A 3G6OA 2DMWA 3PHYA 3KYZA 3LR5A 4JGOA 3LI8A 1MC0A 2J80A 2A2LA 3E4PA 4NKPA 4WF0A 2K7SA 4R6LA 4LRYC 5HD3A 4BBTA 4XT2B 1DP6A 2D01A 3KSHA 4GS9B 5DKLA 2EWWA 2Z6CA 1T18A 2LB9A 3CWFA 4IJGA 4NXEA 5L8MA 4DJ3A 2W3HA 3EQVA 4PKYG 4WL9A 5HWVA 4EQ1A 3VE4A 4I3JA 3GECA 4CQHA 3F1NB 4ETXA 1GSVA 3NOTC 3OBFA 2K2NA 3D72A 3LIFA 4HH2A 1T1CA 4GLQA 5F6AA 2JKRM 4OOMA 4DN0A 3MR0A 3PXPA 3OC2A 1TD5A 2VEAA 4P6ZM 2KLIA 3RTYA 1OT9A 3BQ8A 5TBMA 1NWZA 2INWA 4BJPA 2JN7A 4L9GA 3TRCA 3MXQA 2VZWA 1YKDA 2O9CA 1ZTUA 1TS7A 1XJ6A 3MFXA 2L0WA 4Y5FA 1OTEA 1NLZA 1TF1A 3KO6A 4YNRA 3KSIA 3PR6A 1WA9A 1G6OA 2PHYA 1DP8A 1VB6A 5DJTA 2PR5A 3PBRA 4M4XA 4ETZA 4GS9A 3NJAA 4PKYA 2ZBBA 4HOIA 2V0UA 3UE6A 2FZ0A 4WN5A 3TE8A 3UMDA 3VE3A 3HJKA 1LL8A 1KOUA 3CI6A 3KSFA 5AJGA 3F1NA 5F5YA 2EWVA 3P01A 1XJ2A 3JVVA 4JGRA 5HZHA 3K3CA 5IS1A 4Y2FA 3OLOA 4KQOA 3BY8A 5G4YA 3MMHA 5J3WA 4MN5A 4WEJA 4IUHA 1LSWA 4ME4A 5KIZA 3LIAA 3C38A 3GDIA 3E4OA 4I5SA 3T4KA 4JGQA 5IT5A 2O0YA 3T4TA 2GX5A 2J3TC 3PYPA 4NXFA 2IA2A 2JKTI 4BWIA 3UB6A 3PBNA 2VGLM 4WLAA 1Y28A 2PYPA 4R70A 2QHKA 3C30A 1G28A 3MJQA 2VA0A 4E04A 2L4RA 3T4QA 5G4ZA 5DFYA 3A0VA 1W63Q 4CLCC 4YOFA 1F9IA 1GSXA 4WELA 4II7A 4EU0A 1OTDA 4P6ZS 3LR3A 1XJ3A 5J7EA 4K08A 2M7UA 1D7EA 2W3GA 3BY9A 3EEAA 4I3AA 4NXGA 3FPWA 4CLCE 1DP9A 5DFXA 1DRMA 3S7PA 3IS2B 5CX7A 2ZOHA 2GJ3A 3P7NA 4DJ2A 4GCZA 3R4KA 3H82A 4HQAA 3CITA 4Y3IA 3ICYA 4HP9A 2M7VA 1H8MA 3D3OA 4QPRA 3T4OA 3V67A 2HV1A 3RH8B 2VKSA 3T4SA 4O01A 4UQIM 3CUEA 2L1MA 2VJWA 1YSQA 4MN6A 4H6JB 3A0SA 4EUVA 4I39A 2OWHA 2XA7M 4L9FA 4HJ6A 5HDDA 3S7QA 2K31A 2V1BA 4RQ9A 3E98A 5C5KA 1ODVA 4CLCB 1OTIA 3LR0A 3OCLA 4EETB 2KDKA 4HHDA 3TJZC 3CUEC 4EEPA 3BJNA 5AVEA 4MMNA 1EW0A 2OWJA 1N9NA 1OPXA 1STZA 4MN7A 2W27A 3B47A 1S4SA 3MQQA 4HNBA 1OTAA 2OAQ1 3NHQA 3A0RA 3IS2A 2OOLA 3H9WA 2HJEA 1F98A 4BBVA 1TS6A 3CLOA 2YKHA 2O9BA 1MZUA 5F68A 2JHEA 3LIDA 4HI4A 2H28A 3B33A 4ZRRA 5EFWA 2ZMVA 4G3VA 4I3IA 3H82B 2J3TD 3JVUA 4FOFA 4JGPA 4LPZA 1OJGA 5DKKA 4H6JA 2QJ7A 1IOUA 4EW7A 3LIEA 4KUOA 3FC7A 3NOPC 3UB8A 4PAUA 4HJ3A 3ULFA 5DJUA 1H3QA 2CMNA 5KSHA 2XROA 3R7WB 4EXOA 3TW8A 4WEKA 1P9WA 1T19A 4CLCA 3T4LA 2R78A 2VV7A 1NLYA 2B02A 2FH5A 2A24A 5HD5A 1UWNX 2Y8HA 2NUTC 2JKTM 4BBUA 3UB7A 4Q0IA 2HJ9C 3F1PB 2WKPA 3EWKA 4MDZA 1T1BA 4EERA 2PD8A 3EQUA 3RFBA 1P9RA 1JNUA 3KYQA 4G3KA 2VV8A 4BMWA 2VX8A 2OAP1 3U2AA 2KX6A 4NXBA 3F1OB 2ZOIA 3PBOA 4GW9A 2O9AA 2PT7A 4IHQA 1T1AA 1XJ4A 1P0ZA 1S66L 5F69A 2P04A 1TS8A 2M1CA 2YKFA 4G3WA 1IFQA 3LYXA 3H7WB 3BW6A 3T4JA 4DMZA 4ARZB 1F5MA 2O99A 1OT6A 4FSFA 2QJ5A 5A8BA 3LUQA 3B42A 2I9VA 3O5YA 3EOIA 5DF9A 3FG8A 4O0PA 5I5LA 2WKRA 4LRXC 1GSWA 3R7WA 5HDSA 2W1RA 5IU1A 3IBJA 1LT0A 4Q0HA 3LI9A 2ZMFA 2W1TA 3E0YA 2KOIA 1S4RA 4NEED 2HGVA 3DBAA 2PDRA 3BWLA 4MCWA 5TJJA 4AFIA 5MC7A 3F1PA 2Y79A 2NUPC 3HCYA 3OCNA 3LICA 2A24B 4GHIB 2PR6A 2V0WA 3MF0A 2BASA 4I38A 1XFNA 2JKRI 4O8GA 3S7NA 4EEUA 3EGDC 1D06A 1P97A 3W2ZA 1BYWA 3OOVA 3K3DA 5J4EA 3EEHA 4KQDA 3F1OA 3HJIA 4F3LB 3S7OA 2EA9A 3ZYTA 4WUJA 3PBSA 4HP4A 4HY8A 4L0LA 4OOLA 3UMEA 4Z1WA 3ZQ5A 3H7WA 1N9OA 2QYBA 3NOUC 1S67L 4ARZA 1LSVA 1X0OA 2XRNA 4GJ4A 1XFQA 5FL3A 4IUKA 2VGLS 1UWPX 2MJ6A 2HF6A 2P08A 3UB9A 3CAXA 5HPIA 3MQ0A 2VLGA 1S1YA 3KX0X 2W0NA 1OTBA 1V9ZA 1UGUA 4XT2A 3MQOA 3VOLA 3EGXC 1W63M 2GNXA 3KSGA 1OJ5A 4EESA 4HIAA 2GZAA 3T50A 2G7UA 2WKQA 3K2NA 4R3AA 4PHTA 2QKPA 2P7JA 3UE3A 1S1ZA 5HDCA 3E4QA 1ZHHB 1YSPA 2W3DA 3LFVA 4CLCD 2B18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LLO B;  2QWS A;  4L9E A;  4R38 A;  1TS0 A;  4GHI A;  5AVF A;  1LSX A;  1V9Y A;  4YWZ A;  2Z6D A;  2V9A A;  4KUK A;  2VV6 A;  3IBR A;  3LIB A;  2PD7 A;  3C2W A;  4F3L A;  2PYR A;  4HJ4 A;  3SW1 A;  5TBM B;  5HSQ A;  4HH3 A;  4B9O A;  1N9L A;  5HWT A;  4LRZ E;  3C8C A;  5HWW A;  2V1A A;  2D02 A;  3G6O A;  3PHY A;  4JGO A;  3LI8 A;  2J80 A;  3E4P A;  4WF0 A;  2K7S A;  4R6L A;  5HD3 A;  4LRY C;  4BBT A;  4XT2 B;  1DP6 A;  2D01 A;  5DKL A;  4GS9 B;  2Z6C A;  1T18 A;  3CWF A;  4NXE A;  4DJ3 A;  4PKY G;  4WL9 A;  5HWV A;  4EQ1 A;  3VE4 A;  4I3J A;  3GEC A;  3F1N B;  1GSV A;  3NOT C;  3D72 A;  3LIF A;  4HH2 A;  1T1C A;  5F6A A;  3MR0 A;  2VEA A;  3RTY A;  1OT9 A;  5TBM A;  1NWZ A;  2INW A;  2JN7 A;  4L9G A;  3MXQ A;  1TS7 A;  1XJ6 A;  3MFX A;  2L0W A;  1OTE A;  1WA9 A;  2PHY A;  1DP8 A;  1VB6 A;  5DJT A;  2PR5 A;  4M4X A;  4GS9 A;  3NJA A;  4PKY A;  2ZBB A;  4HOI A;  2V0U A;  3UE6 A;  4WN5 A;  3UMD A;  3VE3 A;  3HJK A;  1LL8 A;  1KOU A;  3F1N A;  5F5Y A;  1XJ2 A;  4JGR A;  5HZH A;  3K3C A;  5IS1 A;  3OLO A;  3BY8 A;  5G4Y A;  5J3W A;  4MN5 A;  1LSW A;  5KIZ A;  3LIA A;  3GDI A;  3E4O A;  4I5S A;  4JGQ A;  3PYP A;  4NXF A;  3UB6 A;  4WLA A;  1Y28 A;  2PYP A;  4R70 A;  2QHK A;  1G28 A;  3MJQ A;  4E04 A;  2L4R A;  5G4Z A;  3A0V A;  1F9I A;  1GSX A;  1OTD A;  1XJ3 A;  5J7E A;  4K08 A;  1D7E A;  3BY9 A;  4I3A A;  4NXG A;  1DP9 A;  1DRM A;  3IS2 B;  2ZOH A;  2GJ3 A;  3P7N A;  4DJ2 A;  4GCZ A;  3H82 A;  4HQA A;  3ICY A;  4HP9 A;  2HV1 A;  3RH8 B;  2L1M A;  4MN6 A;  4H6J B;  3A0S A;  4I39 A;  2OWH A;  4L9F A;  4HJ6 A;  5HDD A;  2V1B A;  4RQ9 A;  1ODV A;  1OTI A;  4EET B;  2KDK A;  4HHD A;  4EEP A;  5AVE A;  1EW0 A;  2OWJ A;  1N9N A;  2W27 A;  1S4S A;  3MQQ A;  4HNB A;  1OTA A;  3NHQ A;  3A0R A;  3IS2 A;  2OOL A;  3H9W A;  1F98 A;  4BBV A;  1TS6 A;  3CLO A;  2YKH A;  1MZU A;  5F68 A;  2JHE A;  3LID A;  4HI4 A;  2H28 A;  3B33 A;  5EFW A;  4I3I A;  3H82 B;  4JGP A;  4LPZ A;  1OJG A;  5DKK A;  4H6J A;  2QJ7 A;  4EW7 A;  3LIE A;  4KUO A;  3FC7 A;  3NOP C;  3UB8 A;  4HJ3 A;  3ULF A;  5DJU A;  2CMN A;  4EXO A;  1T19 A;  2R78 A;  2VV7 A;  2B02 A;  2A24 A;  5HD5 A;  1UWN X;  4BBU A;  3UB7 A;  3F1P B;  2WKP A;  3EWK A;  1T1B A;  4EER A;  2PD8 A;  1JNU A;  2VV8 A;  2KX6 A;  4NXB A;  3F1O B;  2ZOI A;  4GW9 A;  1T1A A;  1XJ4 A;  1P0Z A;  1S66 L;  5F69 A;  1TS8 A;  2M1C A;  2YKF A;  3LYX A;  3H7W B;  1OT6 A;  2QJ5 A;  5A8B A;  3LUQ A;  2I9V A;  3FG8 A;  5I5L A;  2WKR A;  4LRX C;  1GSW A;  5HDS A;  5IU1 A;  1LT0 A;  3LI9 A;  1S4R A;  2PDR A;  3BWL A;  3F1P A;  3LIC A;  2A24 B;  4GHI B;  2PR6 A;  2V0W A;  2BAS A;  4I38 A;  1XFN A;  4EEU A;  1D06 A;  1P97 A;  1BYW A;  3K3D A;  5J4E A;  3EEH A;  4KQD A;  3F1O A;  3HJI A;  4F3L B;  2EA9 A;  4WUJ A;  4HP4 A;  4HY8 A;  3UME A;  3ZQ5 A;  3H7W A;  1N9O A;  3NOU C;  1S67 L;  1LSV A;  1X0O A;  1XFQ A;  1UWP X;  3UB9 A;  3CAX A;  2VLG A;  1S1Y A;  3KX0 X;  2W0N A;  1OTB A;  1V9Z A;  1UGU A;  4XT2 A;  3MQO A;  3VOL A;  1OJ5 A;  4EES A;  4HIA A;  3T50 A;  2WKQ A;  4R3A A;  2QKP A;  2P7J A;  1S1Z A;  5HDC A;  3E4Q A; 
#chains in the Genus database with same CATH topology
 4L9E A;  1YM1 A;  1ZG4 A;  3LEZ A;  1TS0 A;  5AVF A;  3PBQ A;  4YFM A;  4KZ8 A;  1DY6 A;  3QP2 A;  3LIB A;  3BQA A;  1K38 A;  4UQI S;  5JYO A;  3C2W A;  4F3L A;  3SW1 A;  5K5B A;  1HLU P;  2XA7 S;  1NRJ A;  3HVF A;  5HL6 A;  3FYZ A;  4CJN A;  1L0D A;  4HH3 A;  5DTK A;  3WWX A;  4RX2 A;  3NC8 A;  2PAV P;  3PAG A;  3GV9 A;  5CGX A;  2D02 A;  2WYX A;  3QP1 A;  3LR5 A;  4D2O A;  4LGW A;  2A2L A;  3E4P A;  4NKP A;  4WF0 A;  1CEG A;  1K54 A;  2Y2N A;  4P0M A;  4Z9Q A;  4OP5 A;  3Q1F A;  4OPQ A;  2IWD A;  2Y91 A;  5GLB A;  3ITA A;  3GEC A;  4GB7 A;  4P87 A;  1NY0 A;  1BUE A;  2P9V B;  4X1M A;  1GSV A;  1PZP A;  1TDG A;  5EPH A;  1PZO A;  5FQM A;  5I94 A;  4S2N A;  4X56 A;  1PIO A;  1E25 A;  1TD5 A;  3WS1 A;  1W5D A;  3RTY A;  3BQ8 A;  3WS2 A;  4L9G A;  3MXQ A;  2VZW A;  5HAR A;  5CED A;  4QB8 A;  4MNR A;  4WBG A;  4HBT A;  3QP6 A;  2R9W A;  2WK0 A;  5FQI A;  3PR6 A;  1WA9 A;  2PHY A;  2H0T A;  5GLA A;  5FQQ A;  3MZF A;  1DP8 A;  1VB6 A;  5E2E A;  1FSY A;  3BEC A;  1CI8 A;  1E4D A;  1O7E A;  3M6B A;  4WN5 A;  3UMD A;  3V3R A;  2Y2H A;  2WAF A;  3BLS A;  2P9V A;  2EWV A;  3P01 A;  3QNB A;  4WMC A;  1XJ2 A;  1Q2Q A;  2Z2M B;  2BG1 A;  2HPB A;  4KQO A;  3BY8 A;  5G4Y A;  4OQH A;  5J3W A;  4WEJ A;  4IUH A;  3C38 A;  3GDI A;  3GQZ A;  5IT5 A;  2O0Y A;  3T4T A;  3M2K A;  2XQZ A;  4BWI A;  3UB6 A;  3SH9 A;  4R3B A;  3PBN A;  2VGL M;  4R70 A;  2PYP A;  4OLG A;  3DTI A;  5M19 A;  1BT5 A;  5FAQ A;  4E04 A;  4LV1 A;  1DJB A;  4YOF A;  4EU0 A;  4S2M A;  2R9X A;  4Y17 A;  2Y2Q A;  3M2J A;  1ES3 A;  5J7E A;  4K08 A;  2M7U A;  1D7E A;  3BY9 A;  4I3A A;  1CEF A;  1PI5 A;  5DFX A;  5CHM A;  1DRM A;  3IS2 B;  5CX7 A;  4N1X A;  2HDQ A;  5DTS A;  1MPL A;  3B3X A;  5EEC A;  3BFF A;  2A49 A;  3IWO A;  2XEP A;  4JPM A;  3RH8 B;  2VKS A;  4FH4 A;  4CPK A;  4K0X A;  3IWQ A;  1FCO A;  4X69 A;  4QJG A;  4JF5 A;  3LEQ A;  4EUV A;  3L7H A;  4R0Q A;  3V5M A;  1G5U A;  4DDS A;  5HDD A;  3S7Q A;  4B4X A;  3WS4 A;  5C5K A;  1XKZ A;  4R4S A;  3HLC A;  2I72 A;  3HUO A;  3GMW A;  3W8K A;  2WAE A;  4EEP A;  1GHP A;  5AVE A;  3BM6 A;  4DKI A;  1ALQ A;  1EW0 A;  2OWJ A;  3PTE A;  1STZ A;  4H8R A;  1WE4 A;  4OPZ A;  4DRT A;  1SKF A;  1S4S A;  4X55 A;  4IVK A;  1K57 C;  4OLD A;  5L09 A;  1JTD A;  3IS2 A;  3TSG A;  2Q9N A;  2HJE A;  1F98 A;  1TS6 A;  2O9B A;  1RP5 A;  4HI4 A;  2H0Y A;  2V2F F;  4ZRR A;  4RX3 A;  4WMC D;  4I3I A;  5HL1 A;  2J3T D;  3JVU A;  4JGP A;  4Y0O A;  1BLC A;  1IOU A;  4KUO A;  3NOP C;  3UB8 A;  3GSG A;  1H3Q A;  1NZU A;  2CMN A;  5KMW A;  2JKG A;  2XRO A;  4FTX A;  4WEK A;  1P9W A;  3T4L A;  2R78 A;  2VV7 A;  3MFD A;  4N92 A;  2FH5 A;  4WYY A;  5CHJ A;  3ZGA B;  2NUT C;  5EVE A;  2WGI A;  1S0W A;  3NDE A;  3UB7 A;  2WKP A;  3DTM A;  3JYI A;  2EFU A;  4B88 A;  1FR6 A;  2V1Z A;  2PD8 A;  3HUM A;  3RFB A;  5A90 A;  3KYQ A;  3C4O A;  4LCM A;  1ERO A;  3UO9 A;  4BLM A;  3BFG A;  2OSU A;  1ONH A;  2OAP 1;  4GNU A;  3U2A A;  4E3K A;  2KX6 A;  4UA7 A;  4NXB A;  3HBR A;  2ZOI A;  1GCE A;  1T1A A;  1LI0 A;  1KGF A;  5F69 A;  3IF5 A;  4OVD A;  4PM7 A;  4G3W A;  3IXB A;  3T4J A;  1YLT A;  3O3V A;  1MXO A;  1FR1 A;  1KDS A;  5DF7 A;  1KGE A;  3UPP A;  5EVI B;  4OOY A;  3EOI A;  4E3J A;  3ISG A;  4O0P A;  1GSW A;  1XXM A;  1KDW A;  5HAQ A;  5E2H A;  4RYE A;  5FQK A;  3IBJ A;  4Q0H A;  3LI9 A;  1L0F A;  3A3F A;  3FWL A;  2XD5 A;  4PM9 A;  5TJJ A;  1K57 A;  1I2S A;  3HCY A;  3OCN A;  3OZH A;  1NYY A;  2JCH A;  2JKR I;  3S7N A;  4BEN A;  4DXC A;  1K55 C;  1N4O A;  3W2Z A;  2X01 A;  3HLF A;  3OOV A;  1KE0 A;  1VM1 A;  3EEH A;  2WGV A;  3S7O A;  2EA9 A;  3PBS A;  1NZO A;  4HP4 A;  3UME A;  3UE0 A;  3Q7V B;  3DAV A;  5HX9 A;  1S67 L;  1LSV A;  4C6Y A;  4GJ4 A;  2VGL S;  5FDS A;  2Y2L A;  2HF6 A;  5EE8 A;  2P08 A;  3NUL A;  5EVI A;  5HPI A;  2ACG A;  3HUN A;  1I5Q A;  3KX0 X;  3VP2 A;  1QMF A;  1UGU A;  3MQO A;  3VOL A;  1DJC A;  1W63 M;  2IWC A;  3VOZ A;  2G7U A;  1XA7 A;  2P7J A;  2JE5 A;  5TR7 A;  3UE3 A;  1S1Z A;  2BLS A;  1ZHH B;  3NIA A;  2W1T B;  3VP1 A;  3FPV A;  4YIN A;  1LSX A;  3A3J A;  3SS4 A;  2V9A A;  2VV6 A;  3IBR A;  1HZO A;  1MKI A;  4EQI A;  2Y2K A;  1YLP A;  1LLB A;  2PU4 A;  1XA1 A;  1ONG A;  3Q7V A;  2XK1 A;  2LB5 A;  4P85 A;  5TBM B;  4UEY A;  1S6R A;  4XXR A;  4B9O A;  4Q0J A;  4B93 A;  5HWT A;  1XGJ A;  3C8C A;  3SZT A;  3PBT A;  1ACF A;  5CEC A;  1YAX A;  3G6O A;  4GDB A;  2DMW A;  1W7F A;  3PHY A;  3LI8 A;  1MC0 A;  3RXX A;  2WZX A;  4X53 A;  4KG5 A;  3VFH A;  3WRT A;  4LRY C;  5HD3 A;  4BBT A;  3KSH A;  2Z6C A;  4DXB A;  4IJG A;  5L8M A;  3W4O A;  1W8Y A;  1KVM A;  4I3J A;  3WS5 A;  1YMX A;  3P09 A;  3NOT C;  3T1R A;  3OBF A;  3SH8 A;  4HH2 A;  4NET A;  1FOF A;  5F6A A;  2WGW B;  2BTF P;  4OQ0 A;  3PXP A;  1ESI A;  3M6H A;  2DCF A;  1OT9 A;  3N4I A;  5TBM A;  1PNE A;  2V8C A;  3TOI A;  1ERQ A;  2O9C A;  1ZTU A;  3ZDJ A;  5FI2 A;  4C75 A;  3A3I A;  4Y5F A;  4RA7 A;  4S2N C;  2OLU A;  3KO6 A;  2EFX A;  5EVI D;  2HDR A;  2Y2G A;  3Q81 A;  5FI7 A;  2PR5 A;  3PBR A;  4PKY A;  4GD8 A;  2ZJ9 A;  2AVX A;  5HFO A;  5CEB A;  4UHU A;  3BYD A;  3CI6 A;  5AJG A;  3GRJ A;  4JGR A;  3IQA A;  2WGW A;  1M40 A;  2ZQ8 A;  3Q82 A;  4FUW A;  3ZG0 A;  2VGK A;  4DE3 A;  1ERM A;  4KZB A;  4ME4 A;  3CG5 A;  3T12 B;  3CPT B;  4X6T A;  2C5W B;  3G4P A;  2J3T C;  2GDN A;  2ZQ9 A;  2QHK A;  3OPR A;  3C30 A;  4O7D A;  5FSR A;  3S22 A;  4PMA A;  4BD1 A;  4ESP A;  4OON A;  2P74 A;  5EVL A;  3ITB A;  4P6Z S;  4KZ9 A;  5L2F A;  3MS6 A;  1BLP A;  2W3G A;  4Q8I A;  1PYY A;  4NXG A;  4CLC E;  1PFL A;  1PI4 A;  4KEN B;  2GJ3 A;  3P7N A;  4DJ2 A;  5FAT A;  3R4K A;  4HQA A;  3CIT A;  1K6R A;  5F1G A;  1VEU B;  3ICY A;  5GLD A;  1H8M A;  3D3O A;  3T4O A;  2HDU A;  4O01 A;  5HAI A;  3CUE A;  1YSQ A;  4MN6 A;  5CHU A;  2XD1 A;  4H6J B;  3CPT A;  1MY8 A;  4KQR A;  4HJ6 A;  4ID4 A;  4RQ9 A;  4LCL A;  4PM6 A;  5AQB A;  3BEB A;  1ODV A;  3HRE A;  3HLB A;  3LR0 A;  4EET B;  4HHD A;  3TJZ C;  3G30 A;  1AWI A;  1N9N A;  1FQG A;  1YLZ A;  2Y2J A;  3NHQ A;  3A0R A;  2OOL A;  4BBV A;  3CLO A;  2J9O A;  3ZNT A;  3N8S A;  2YKH A;  3QP8 A;  1VEU A;  5F68 A;  2JHE A;  1I2W A;  2B95 A;  5L07 A;  2H28 A;  2ZMV A;  2X71 A;  4E6X A;  1PWC A;  4LPZ A;  1OJG A;  3BFD A;  4H6J A;  2QJ7 A;  4EW7 A;  3FC7 A;  4PM8 A;  3ULF A;  1PWG A;  4DE0 A;  4FCF A;  4LV2 A;  2XDM A;  4EXO A;  3PAE A;  3TW8 A;  1K4F A;  1T19 A;  1KGG A;  1F2K A;  2PRF A;  4XUZ A;  5FQ9 A;  1QME A;  4Q0I A;  1W8Q A;  2V20 A;  5HW3 A;  3ZVW A;  3EWK A;  4KZ3 A;  4HBU A;  4EER A;  2ZC4 B;  4EBP A;  1SHV A;  1P9R A;  1MWS A;  2Y2P A;  1YMS A;  1JNU A;  3Q07 A;  4S2K A;  4G3K A;  2VX8 A;  3G2Y A;  5GHZ A;  2J8Y A;  3L9K A;  5EOE A;  3PBO A;  2ZC5 B;  2M1C A;  3LYX A;  3ZHH A;  1F5M A;  2O99 A;  4EV4 A;  3DTK A;  1KE4 A;  5CRF A;  4LRX C;  4KQQ A;  1C3B A;  3TG9 A;  2PBY A;  3AGE A;  3U4L P;  5GL9 A;  3UE1 A;  4N9K A;  2HGV A;  2PDR A;  2UV0 E;  5MC7 A;  2NUP C;  4A5R A;  3FKW A;  4GHI B;  2V0W A;  2BAS A;  5J8X A;  4I38 A;  1D06 A;  1EI5 A;  4S2P A;  4WZ5 C;  4R3J A;  3DWZ A;  2ZC3 B;  1FSW A;  4FD8 A;  4KQD A;  3ZYT A;  4L0L A;  4OOL A;  3ZQ5 A;  4C3Q A;  1IKG A;  4U0T A;  3HLE A;  1X0O A;  4OQI A;  3O86 A;  1ZC2 A;  1PWD A;  4JXV A;  2W0N A;  4LFU A;  1V9Z A;  2ZM0 A;  4XT2 A;  3IX8 A;  5FA7 A;  1OJ5 A;  2GZA A;  3T50 A;  2WKQ A;  3K2N A;  4IBR A;  4R3A A;  2QKP A;  1U60 A;  4GZB A;  1JTG A;  5HDC A;  2W3D A;  5EVI C;  4LLO B;  2QWS A;  1BZA A;  1YLY A;  4KZ6 A;  1H8Z A;  4R38 A;  4JF6 A;  2JBF A;  4GKU A;  4GHI A;  5F1F A;  5G18 A;  1K56 A;  1V9Y A;  4YWZ A;  1N9B A;  2J3W A;  4S2L A;  5LBR A;  5AQ9 A;  4ZBE A;  5FEG A;  4QHC A;  3UPN A;  5KZH A;  2J9P A;  3LR4 A;  2W3F A;  3VSL A;  1VET B;  1BTL A;  3IF6 B;  4DE1 A;  4MBH A;  4E3O A;  4K91 A;  1YLJ A;  4QD4 A;  2XSS A;  4E3L A;  4NK3 A;  4IED A;  2VK3 A;  3KYZ A;  4JGO A;  3MZE A;  2J80 A;  1TEM A;  4MBF A;  2K7S A;  4R6L A;  2XGN A;  3LGO A;  2EWW A;  2XR0 A;  5AQA A;  4WZ5 A;  3UDX A;  3CWF A;  5E43 A;  3T1S A;  3EQV A;  5HWV A;  1RGZ A;  3IHB A;  3F1N B;  4ETX A;  4E3I A;  3ZFZ A;  1ZG6 A;  2K2N A;  1T1C A;  2JKR M;  4OOM A;  3W4Q A;  3OC2 A;  2VEA A;  4P6Z M;  1VET A;  4N9L A;  1NWZ A;  2INW A;  3IF6 A;  2HP9 A;  3Q7Z A;  2E8I A;  2JN7 A;  3MZD A;  1TS7 A;  1XJ6 A;  1JWP A;  3MFX A;  4UA9 A;  2CC1 A;  1OTE A;  3ZG5 A;  1TF1 A;  2XFS A;  4YNR A;  4HES A;  1RCJ A;  3IX4 A;  3T1X A;  2EX6 A;  1G6O A;  2ZQA A;  4S2O A;  1E3U A;  2HZ5 A;  3LCE A;  4M4X A;  4ETZ A;  3HLG A;  5EM0 A;  4HOI A;  5JYP A;  5L10 A;  3AGD A;  3TE8 A;  1SZV A;  3F1N A;  2OLV A;  5F5Y A;  3NY4 A;  2ZL1 B;  2E8J A;  3JVV A;  4KZ7 A;  4UA6 A;  1K56 D;  5HZH A;  5FDH A;  1YQS A;  3N8L A;  4Y2F A;  3WS0 A;  3E2L A;  3IH8 A;  1LSW A;  1K6S A;  3IWI A;  5KIZ A;  4E3N A;  4I5S A;  2PBD P;  3T4K A;  4JGQ A;  5TGF A;  3PYP A;  2HP6 A;  2JKT I;  4ZTK A;  4R1G A;  3MSH A;  4WLA A;  2Y2O A;  1ESU A;  3RJU A;  5EV0 A;  5F82 A;  5GHY A;  4N1H A;  5M1A A;  3MJQ A;  2VA0 A;  3NBL A;  1ES2 A;  5G4Z A;  2XFT A;  3LO7 A;  3A0V A;  1W63 Q;  4CLC C;  1GSX A;  1OTD A;  1K25 A;  4JXG A;  1XJ3 A;  4HEF A;  1BSG A;  4Y15 A;  3UNW A;  3ZNY A;  2FFY A;  4E3M A;  5A92 A;  1GA0 A;  1CI9 A;  1G6A A;  2ZL1 A;  3H82 A;  4Y3I A;  1HTZ A;  3BRM A;  3E2K A;  3OPP A;  3V67 A;  2HV1 A;  2ZLY A;  4BQM A;  2L1M A;  2ZQD A;  2VJW A;  4K0W A;  3A0S A;  2JKF A;  4X25 A;  5EUA A;  1IKI A;  4I39 A;  3UDI A;  4LV3 A;  4L9F A;  3G35 A;  1H8Y A;  2WUQ A;  3E98 A;  4NG2 A;  4GDN A;  2JC7 A;  4CLC B;  3N7W A;  1OTI A;  3OCL A;  2Y55 A;  2QMI A;  3CUE C;  3BJN A;  2X02 A;  3ZVT A;  3IXH A;  3GTC A;  1OPX A;  4JBF A;  4JF4 A;  3A3E A;  1EWZ A;  1L2S A;  1DJA A;  1AXB A;  1NRF A;  3B47 A;  3N6I A;  4JKT A;  3MQQ A;  1FIL A;  4HNB A;  1E3U D;  4EWF A;  1YLW A;  2J7V A;  2UWX A;  1W79 A;  3H9W A;  1NJ4 A;  1L0E A;  5CXW A;  2Y4A A;  3LID A;  5EFW A;  2H5S A;  4G3V A;  4S2J A;  3BFE A;  3AGF A;  2HDS A;  4HJ3 A;  5DJU A;  3S4X A;  3D9Y A;  1XPB A;  4GN2 A;  4R4R A;  3ZCZ A;  1BLH A;  3SS3 A;  4CLC A;  1NLY A;  2B02 A;  3FKV A;  2A24 A;  5KSC A;  4OP8 A;  4BBU A;  2ZMA A;  1FCM A;  3F1P B;  3BLM A;  4MDZ A;  3N8R A;  1GA9 A;  5FI6 A;  2EX2 A;  1PW1 A;  2VGJ A;  5A93 A;  1WYB A;  2QZ6 A;  1IEL A;  1IYS A;  2VV8 A;  4BMW A;  4LEN A;  3G34 A;  1ZKJ A;  2QPN A;  3F1O B;  1GHM A;  2PT7 A;  1K0K A;  4IHQ A;  1XJ4 A;  1P0Z A;  2P04 A;  1TS8 A;  1CF0 A;  1JWZ A;  3BW6 A;  4DMZ A;  2ZQ7 A;  4DF6 A;  1OT6 A;  4FSF A;  2QJ5 A;  5TFQ A;  5A8B A;  3LUQ A;  3B42 A;  2I9V A;  3O5Y A;  3T1Q B;  5DF9 A;  1CJF A;  3VOY A;  4GOG A;  4PM5 A;  3SOI A;  5HDS A;  5IU1 A;  3MXS A;  3IXG A;  2KOI A;  2OV5 A;  3V50 A;  1S4R A;  4NEE D;  5GHX A;  3DBA A;  4MCW A;  4AFI A;  3F1P A;  2Y79 A;  1MWU A;  3QP4 A;  3O88 A;  1Z6F A;  3LIC A;  3ZG8 B;  3MF0 A;  4OKP A;  1XFN A;  2IWB A;  3JPU A;  5E2F A;  4BL2 A;  2RL3 A;  2G2W A;  3F1O A;  4OH0 A;  4WUJ A;  4HY8 A;  1M6K A;  3VSK A;  2FFF B;  2XF3 A;  2XH9 A;  1JWV A;  2QYB A;  3KYE A;  3NOU C;  1XFQ A;  3C4P A;  1HD8 A;  3IHA A;  5E2G A;  4KZA A;  3VFF A;  3UB9 A;  4LV0 A;  4EBN A;  3MQ0 A;  1S1Y A;  3IH9 A;  3G32 A;  1OTB A;  3DWK A;  3EGX C;  4JXS A;  3MBZ A;  2GNX A;  3KSG A;  1CQA A;  4RVA A;  3FZC A;  1LL9 A;  1L0G A;  1LI9 A;  5F83 A;  3VP0 A;  4PHT A;  1SDN A;  1CK3 A;  3E4Q A;  3NDG A;  4CLC D;  2B18 A;  5BOH A;  2WKH A;  5HPF A;  2ZC6 B;  2Z6D A;  4KUK A;  1MWR A;  4QU3 A;  3LY4 A;  3VV4 A;  2PD7 A;  1Y4O A;  2PYR A;  3VP3 A;  1LHY A;  2ZM8 A;  1MKM A;  4HJ4 A;  2W3E A;  5EOO A;  2ZM2 A;  2G2U A;  5HSQ A;  2WKE A;  1N9L A;  4LRZ E;  1VHM A;  5HWW A;  4S2I A;  2V1A A;  3LY3 A;  4F94 A;  5DKL A;  4XT2 B;  1DP6 A;  2D01 A;  4GS9 B;  3DW0 A;  3NCK A;  1T18 A;  2LB9 A;  2A3U A;  3SH7 A;  1OME A;  4NXE A;  4DJ3 A;  2W3H A;  4PKY G;  4WL9 A;  1PRQ A;  4EQ1 A;  5FEF A;  2EX8 A;  3VE4 A;  3GVB A;  4UAA A;  4CQH A;  3C5A A;  3S1Y A;  2WAD A;  3D72 A;  3GR2 A;  3LIF A;  4GLQ A;  4KG2 A;  1VQQ A;  4DN0 A;  4MLL A;  3HL9 A;  3MR0 A;  3UPO A;  4JXW A;  3QHY A;  2KLI A;  4DE2 A;  4BJP A;  3TRC A;  1YKD A;  4R23 A;  3ZG7 B;  2L0W A;  4PPR A;  4WZ4 A;  1NLZ A;  5DVA A;  4OPY A;  3KSI A;  1FCN A;  4QY5 A;  3IF6 C;  5DJT A;  2ZQC A;  4GS9 A;  3CZD A;  1IYQ A;  3NJA A;  2ZBB A;  2Q9M A;  2V0U A;  3UE6 A;  2FZ0 A;  1RGY A;  3VMA A;  3VE3 A;  2HP5 A;  3HJK A;  1LL8 A;  1BUL A;  1KOU A;  3KSF A;  1XX2 A;  4ZJ2 A;  2ZD8 A;  3UDF A;  3W4P A;  3K3C A;  2PU2 A;  3C7V A;  5IS1 A;  3OLO A;  3MMH A;  3D4F A;  4E6W A;  4MN5 A;  5A91 A;  1SKO B;  3CHW P;  1L3L A;  3LIA A;  1YPR A;  1ES5 A;  3E4O A;  4OQG A;  4ZJ3 A;  2GX5 A;  4GD6 A;  1H5X A;  4NXF A;  2IA2 A;  5HAP A;  1JVJ A;  1Y28 A;  4U0X A;  3CMZ A;  2EXB A;  4QWO A;  4M3K A;  3NI9 A;  4KZ5 A;  1G28 A;  3QNC A;  2L4R A;  3T4Q A;  1O07 A;  5DFY A;  1G68 A;  1PW8 A;  1F9I A;  4WEL A;  4II7 A;  4Y0T A;  5CTN A;  3RXW A;  1Z09 A;  1Y54 A;  3LR3 A;  3UY6 A;  3V3S A;  3EEA A;  1TVF A;  3FPW A;  1DP9 A;  4DDY A;  3G2Z A;  3S7P A;  2ZOH A;  1J3W A;  3IT9 A;  4MBK A;  4GCZ A;  1XP4 A;  2C6W B;  1SDE A;  1KE3 A;  4P6B A;  1H0M A;  4HP9 A;  2M7V A;  4QPR A;  1MBL A;  3T4S A;  5D3O A;  5EM1 A;  4UQI M;  3IX3 A;  1SKO A;  2WZZ A;  3MKF A;  1IYP A;  4WM9 A;  2Z2L B;  2OWH A;  2XA7 M;  4EBL A;  2K31 A;  2V1B A;  4BD0 A;  3IXD A;  3MKE A;  2RCX A;  4B4Z A;  5FAS A;  2KDK A;  1NYM A;  4MMN A;  1MWT A;  1WYC A;  3QP5 A;  4MN7 A;  4IVI A;  1A0K A;  2W27 A;  3CJM A;  2EXA A;  4ZAM A;  4KZ4 A;  1D1J A;  1KVL A;  1OTA A;  3OPL A;  3VP4 A;  2OAQ 1;  3OPH A;  5CER A;  1XGI A;  5CGW A;  2XLN A;  3O87 A;  3G31 A;  3WRZ A;  4FH2 A;  1HVB A;  2WKI A;  1MZU A;  4Y13 A;  3FV7 A;  3B33 A;  4MEZ A;  1Q2P A;  3H82 B;  4FOF A;  5DF8 A;  3P98 A;  5CGS A;  4IBX A;  5DKK A;  3LIE A;  1LL5 A;  4PAU A;  4Y7P A;  3UB5 P;  5KSH A;  3R7W B;  1BLS A;  5FAO A;  4X68 A;  2EX9 A;  1NXY A;  3C7U A;  4ZJ1 A;  5HD5 A;  1UWN X;  2Y8H A;  5IHV A;  2JKT M;  2HJ9 C;  3BFC A;  4KG6 A;  5DTT A;  1IEM A;  1T1B A;  3EQU A;  3HLW A;  3ZG9 B;  4D60 A;  5AQ7 A;  2H10 A;  1YT4 A;  2Q0O A;  4U3T A;  4GW9 A;  2O9A A;  3I7J A;  1S66 L;  4X1L A;  2YKF A;  1IFQ A;  3H7W B;  5CTM A;  1IYO A;  4ARZ B;  4Y0U A;  5GLC A;  4XUX A;  3FG8 A;  5I5L A;  2WKR A;  1SCW A;  3R7W A;  2W1R A;  2Y59 A;  1LT0 A;  1K55 A;  2ZMF A;  2W1T A;  3E0Y A;  5FAP A;  2DRW A;  4ZDX A;  4EUZ A;  4QY6 A;  3BWL A;  3NEC A;  2Y2M A;  5FQJ A;  1TDL A;  2V8F A;  1K54 C;  2A24 B;  5U47 A;  3V39 A;  2PR6 A;  4O8G A;  4EEU A;  3EGD C;  1P97 A;  1BYW A;  4JLF A;  3MXR A;  3K3D A;  5J4E A;  3HJI A;  4F3L B;  1K4E A;  2B5R A;  3UN7 A;  4Z1W A;  3H7W A;  1N9O A;  2Y2I A;  4ARZ A;  2XRN A;  5FL3 A;  4IUK A;  3SS5 A;  1UWP X;  2MJ6 A;  3HLD A;  3CAX A;  3A3D A;  2VLG A;  3DTE A;  5M18 A;  4OPR A;  1ES4 A;  4BL3 A;  4EES A;  1FIK A;  4HIA A;  2ZC7 A;  1GHI A;  1J9M A;  2DNS A;  1YSP A;  3LFV A; 
#chains in the Genus database with same CATH homology
 2W1T B;  4LLO B;  2QWS A;  4L9E A;  4R38 A;  3FPV A;  1TS0 A;  4GHI A;  5AVF A;  1LSX A;  3PBQ A;  5HPF A;  1V9Y A;  4YWZ A;  2Z6D A;  2V9A A;  4KUK A;  2VV6 A;  3IBR A;  3LIB A;  2J3W A;  3BQA A;  5LBR A;  4UQI S;  3VV4 A;  2PD7 A;  3C2W A;  4F3L A;  2PYR A;  1MKM A;  4HJ4 A;  2W3E A;  5K5B A;  3SW1 A;  3LR4 A;  2W3F A;  2XA7 S;  1NRJ A;  2LB5 A;  5HL6 A;  5TBM B;  4UEY A;  5HSQ A;  4HH3 A;  4B9O A;  1N9L A;  4Q0J A;  4B93 A;  5HWT A;  4LRZ E;  1VHM A;  3C8C A;  5HWW A;  3PBT A;  2XSS A;  2V1A A;  1YAX A;  2D02 A;  3G6O A;  2DMW A;  3PHY A;  3KYZ A;  3LR5 A;  4JGO A;  3LI8 A;  1MC0 A;  2J80 A;  2A2L A;  3E4P A;  4NKP A;  4WF0 A;  2K7S A;  4R6L A;  4LRY C;  5HD3 A;  4BBT A;  4XT2 B;  1DP6 A;  2D01 A;  3KSH A;  4GS9 B;  5DKL A;  2EWW A;  2Z6C A;  1T18 A;  2LB9 A;  3CWF A;  4IJG A;  4NXE A;  5L8M A;  4DJ3 A;  2W3H A;  3EQV A;  4PKY G;  4WL9 A;  5HWV A;  4EQ1 A;  3VE4 A;  4I3J A;  3GEC A;  4CQH A;  3F1N B;  4ETX A;  1GSV A;  3NOT C;  3OBF A;  2K2N A;  3D72 A;  3LIF A;  4HH2 A;  1T1C A;  4GLQ A;  5F6A A;  2JKR M;  4OOM A;  4DN0 A;  3MR0 A;  3PXP A;  3OC2 A;  1TD5 A;  2VEA A;  4P6Z M;  2KLI A;  3RTY A;  1OT9 A;  3BQ8 A;  5TBM A;  1NWZ A;  2INW A;  4BJP A;  2JN7 A;  4L9G A;  3TRC A;  3MXQ A;  2VZW A;  1YKD A;  2O9C A;  1ZTU A;  1TS7 A;  1XJ6 A;  3MFX A;  2L0W A;  4Y5F A;  1OTE A;  1NLZ A;  1TF1 A;  3KO6 A;  4YNR A;  3KSI A;  3PR6 A;  1WA9 A;  1G6O A;  2PHY A;  1DP8 A;  1VB6 A;  5DJT A;  2PR5 A;  3PBR A;  4M4X A;  4ETZ A;  4GS9 A;  3NJA A;  4PKY A;  2ZBB A;  4HOI A;  2V0U A;  3UE6 A;  2FZ0 A;  4WN5 A;  3TE8 A;  3UMD A;  3VE3 A;  3HJK A;  1LL8 A;  1KOU A;  3CI6 A;  3KSF A;  5AJG A;  3F1N A;  5F5Y A;  2EWV A;  3P01 A;  1XJ2 A;  3JVV A;  4JGR A;  5HZH A;  3K3C A;  5IS1 A;  4Y2F A;  3OLO A;  4KQO A;  3BY8 A;  5G4Y A;  3MMH A;  5J3W A;  4MN5 A;  4WEJ A;  4IUH A;  1LSW A;  4ME4 A;  5KIZ A;  3LIA A;  3C38 A;  3GDI A;  3E4O A;  4I5S A;  3T4K A;  4JGQ A;  5IT5 A;  2O0Y A;  3T4T A;  2GX5 A;  2J3T C;  3PYP A;  4NXF A;  2IA2 A;  2JKT I;  4BWI A;  3UB6 A;  3PBN A;  2VGL M;  4WLA A;  1Y28 A;  2PYP A;  4R70 A;  2QHK A;  3C30 A;  1G28 A;  3MJQ A;  2VA0 A;  4E04 A;  2L4R A;  3T4Q A;  5G4Z A;  5DFY A;  3A0V A;  1W63 Q;  4CLC C;  4YOF A;  1F9I A;  1GSX A;  4WEL A;  4II7 A;  4EU0 A;  1OTD A;  4P6Z S;  3LR3 A;  1XJ3 A;  5J7E A;  4K08 A;  2M7U A;  1D7E A;  2W3G A;  3BY9 A;  3EEA A;  4I3A A;  4NXG A;  3FPW A;  4CLC E;  1DP9 A;  5DFX A;  1DRM A;  3S7P A;  3IS2 B;  5CX7 A;  2ZOH A;  2GJ3 A;  3P7N A;  4DJ2 A;  4GCZ A;  3R4K A;  3H82 A;  4HQA A;  3CIT A;  4Y3I A;  3ICY A;  4HP9 A;  2M7V A;  1H8M A;  3D3O A;  4QPR A;  3T4O A;  3V67 A;  2HV1 A;  3RH8 B;  2VKS A;  3T4S A;  4O01 A;  4UQI M;  3CUE A;  2L1M A;  2VJW A;  1YSQ A;  4MN6 A;  4H6J B;  3A0S A;  4EUV A;  4I39 A;  2OWH A;  2XA7 M;  4L9F A;  4HJ6 A;  5HDD A;  3S7Q A;  2K31 A;  2V1B A;  4RQ9 A;  3E98 A;  5C5K A;  1ODV A;  4CLC B;  1OTI A;  3LR0 A;  3OCL A;  4EET B;  2KDK A;  4HHD A;  3TJZ C;  3CUE C;  4EEP A;  3BJN A;  5AVE A;  4MMN A;  1EW0 A;  2OWJ A;  1N9N A;  1OPX A;  1STZ A;  4MN7 A;  2W27 A;  3B47 A;  1S4S A;  3MQQ A;  4HNB A;  1OTA A;  2OAQ 1;  3NHQ A;  3A0R A;  3IS2 A;  2OOL A;  3H9W A;  2HJE A;  1F98 A;  4BBV A;  1TS6 A;  3CLO A;  2YKH A;  2O9B A;  1MZU A;  5F68 A;  2JHE A;  3LID A;  4HI4 A;  2H28 A;  3B33 A;  4ZRR A;  5EFW A;  2ZMV A;  4G3V A;  4I3I A;  3H82 B;  2J3T D;  3JVU A;  4FOF A;  4JGP A;  4LPZ A;  1OJG A;  5DKK A;  4H6J A;  2QJ7 A;  1IOU A;  4EW7 A;  3LIE A;  4KUO A;  3FC7 A;  3NOP C;  3UB8 A;  4PAU A;  4HJ3 A;  3ULF A;  5DJU A;  1H3Q A;  2CMN A;  5KSH A;  2XRO A;  3R7W B;  4EXO A;  3TW8 A;  4WEK A;  1P9W A;  1T19 A;  4CLC A;  3T4L A;  2R78 A;  2VV7 A;  1NLY A;  2B02 A;  2FH5 A;  2A24 A;  5HD5 A;  1UWN X;  2Y8H A;  2NUT C;  2JKT M;  4BBU A;  3UB7 A;  4Q0I A;  2HJ9 C;  3F1P B;  2WKP A;  3EWK A;  4MDZ A;  1T1B A;  4EER A;  2PD8 A;  3EQU A;  3RFB A;  1P9R A;  1JNU A;  3KYQ A;  4G3K A;  2VV8 A;  4BMW A;  2VX8 A;  2OAP 1;  3U2A A;  2KX6 A;  4NXB A;  3F1O B;  2ZOI A;  3PBO A;  4GW9 A;  2O9A A;  2PT7 A;  4IHQ A;  1T1A A;  1XJ4 A;  1P0Z A;  1S66 L;  5F69 A;  2P04 A;  1TS8 A;  2M1C A;  2YKF A;  4G3W A;  1IFQ A;  3LYX A;  3H7W B;  3BW6 A;  3T4J A;  4DMZ A;  4ARZ B;  1F5M A;  2O99 A;  1OT6 A;  4FSF A;  2QJ5 A;  5A8B A;  3LUQ A;  3B42 A;  2I9V A;  3O5Y A;  3EOI A;  5DF9 A;  3FG8 A;  4O0P A;  5I5L A;  2WKR A;  4LRX C;  1GSW A;  3R7W A;  5HDS A;  2W1R A;  5IU1 A;  3IBJ A;  1LT0 A;  4Q0H A;  3LI9 A;  2ZMF A;  2W1T A;  3E0Y A;  2KOI A;  1S4R A;  4NEE D;  2HGV A;  3DBA A;  2PDR A;  3BWL A;  4MCW A;  5TJJ A;  4AFI A;  5MC7 A;  3F1P A;  2Y79 A;  2NUP C;  3HCY A;  3OCN A;  3LIC A;  2A24 B;  4GHI B;  2PR6 A;  2V0W A;  3MF0 A;  2BAS A;  4I38 A;  1XFN A;  2JKR I;  4O8G A;  3S7N A;  4EEU A;  3EGD C;  1D06 A;  1P97 A;  3W2Z A;  1BYW A;  3OOV A;  3K3D A;  5J4E A;  3EEH A;  4KQD A;  3F1O A;  3HJI A;  4F3L B;  3S7O A;  2EA9 A;  3ZYT A;  4WUJ A;  3PBS A;  4HP4 A;  4HY8 A;  4L0L A;  4OOL A;  3UME A;  4Z1W A;  3ZQ5 A;  3H7W A;  1N9O A;  2QYB A;  3NOU C;  1S67 L;  4ARZ A;  1LSV A;  1X0O A;  2XRN A;  4GJ4 A;  1XFQ A;  5FL3 A;  4IUK A;  2VGL S;  1UWP X;  2MJ6 A;  2HF6 A;  2P08 A;  3UB9 A;  3CAX A;  5HPI A;  3MQ0 A;  2VLG A;  1S1Y A;  3KX0 X;  2W0N A;  1OTB A;  1V9Z A;  1UGU A;  4XT2 A;  3MQO A;  3VOL A;  3EGX C;  1W63 M;  2GNX A;  3KSG A;  1OJ5 A;  4EES A;  4HIA A;  2GZA A;  3T50 A;  2G7U A;  2WKQ A;  3K2N A;  4R3A A;  4PHT A;  2QKP A;  2P7J A;  3UE3 A;  1S1Z A;  5HDC A;  3E4Q A;  1ZHH B;  1YSP A;  2W3D A;  3LFV A;  4CLC D;  2B18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...