3H9WA

Crystal structure of the n-terminal domain of diguanylate cyclase with pas/pac sensor (maqu_2914) from marinobacter aquaeolei, northeast structural genomics consortium target mqr66c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
KAIPWKINWQTMAFEYIGPQIEALLGWPQGSWKSVEDWATRMHPEDQEWVVNFCVKQSECGVDHEADYRALHRDGHYVWIRDVVHVVRDDSGEVEALIGFMFDISLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target MqR66C
rcsb
source organism Marinobacter aquaeolei
molecule tags Structural genomics, unknown function
molecule keywords Diguanylate cyclase with PAS/PAC sensor
total genus 30
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h9wA00
2V0UA 1D7EA 2Z6DA 1P97A 2OWHA 2WKRA 1LL8A 3EWKA 5DJTA 1XJ2A 1T1AA 1ODVA 1OTAA 4HNBA 4DJ3A 5TBMB 1LSWA 4EW7A 3CAXA 4HI4A 4MN6A 3CWFA 3EEHA 3NOPC 4WN5A 3ULFA 1XFQA 3F1NB 2W27A 3LI8A 2VV6A 4F3LB 1XJ6A 1Y28A 3UMDA 4HJ4A 3H7WB 1TS6A 3A0SA 2YKFA 2ZOIA 3E4QA 4NXGA 3F1OB 1OTDA 5F68A 2CMNA 2BASA 2A24A 2H28A 3K3CA 4HH2A 2L0WA 4XT2A 3UB8A 2L4RA 3RH8B 1DRMA 3VOLA 4PKYG 4R3AA 4NXBA 5HDCA 1S4SA 2HV1A 2QKPA 3C2WA 3LICA 3NOUC 2PYPA 4L9FA 3UB6A 3F1PB 5G4ZA 2M1CA 1TS8A 3PYPA 4PKYA 4GW9A 1LSVA 2VV7A 3HJIA 4HP4A 4I39A 5HWTA 3LYXA 5HWVA 4WUJA 4KUOA 4BBTA 1T1CA 1D06A 1JNUA 1OT9A 1S67L 3RTYA 2WKQA 1OTEA 3UMEA 5J4EA 4HJ6A 3B33A 4F3LA 4NXEA 4NXFA 5DKLA 5IU1A 1S1YA 2ZBBA 2D02A 4JGOA 5HSQA 3LIFA 3KX0X 5DJUA 2J80A 2R78A 4B9OA 3GDIA 2OWJA 5F6AA 3IS2A 1TS7A 1EW0A 5KIZA 2GJ3A 2B02A 1S1ZA 1G28A 1VB6A 2WKPA 4I3IA 5A8BA 2JN7A 2I9VA 4EQ1A 3NOTC 2V0WA 5HDDA 4LRYC 3C8CA 1OTIA 3F1PA 4H6JA 3T50A 3G6OA 4KQDA 3VE3A 5HD3A 4BBUA 2P7JA 4EETB 5IS1A 2INWA 4LLOB 4EERA 5HWWA 5HDSA 2PYRA 2OOLA 3H82B 5DKKA 3A0VA 3NHQA 2PR6A 5F5YA 3UB7A 5EFWA 1OJ5A 5F69A 1N9NA 1F9IA 1V9YA 3CLOA 3HJKA 2ZOHA 3LIEA 3MFXA 2KDKA 1XFNA 2W0NA 4YWZA 3LIBA 2VLGA 3LI9A 1XJ3A 4L9GA 3SW1A 3MQQA 4R70A 2QWSA 3A0RA 4HHDA 4GHIB 1WA9A 2K7SA 3E4OA 2JHEA 3BY9A 2PD8A 3ZQ5A 3LIAA 3PHYA 4GHIA 4R38A 2PD7A 1DP8A 1NWZA 1S66L 4H6JB 5TBMA 4EXOA 2L1MA 3UB9A 4WF0A 3H9WA 3VE4A 4LRXC 2V1BA 3NJAA 1UGUA 3FG8A 3K3DA 1DP9A 3H82A 5J3WA 1V9ZA 3D72A 2QJ5A 3ICYA 2V1AA 3H7WA 3IBRA 1LT0A 4I3AA 1GSXA 2EA9A 4L9EA 3OLOA 4GS9B 4RQ9A 1F98A 1T18A 3F1OA 4R6LA 1OT6A 2A24B 4XT2B 2VEAA 4I3JA 3BY8A 4HH3A 3UE6A 4EEPA 1TS0A 1LSXA 2YKHA 3GECA 4HIAA 4LRZE 1DP6A 4WLAA 2QHKA 1GSVA 3MR0A 1P0ZA 1OTBA 1BYWA 2VV8A 4I5SA 4JGRA 3BWLA 3FC7A 2PHYA 5AVEA 2Z6CA 3E4PA 1MZUA 1X0OA 2QJ7A 3LUQA 4M4XA 4WL9A 2PDRA 1N9LA 4GCZA 3F1NA 5HD5A 4EEUA 4LPZA 2D01A 2V9AA 1S4RA 1UWPX 4HQAA 4HOIA 4EESA 1OJGA 3P7NA 4HJ3A 1GSWA 4JGQA 1UWNX 1XJ4A 1T19A 3MXQA 5AVFA 2PR5A 1T1BA 5J7EA 4HY8A 5G4YA 3MJQA 4I38A 4JGPA 4GS9A 5I5LA 4BBVA 4HP9A 4DJ2A 5HZHA 3IS2B 1KOUA 4E04A 2KX6A 3MQOA 4KUKA 4K08A 3LIDA 4MN5A 1N9OA
chains in the Genus database with same CATH superfamily
1YPRA 1L2SA 4IUKA 4DMZA 2HDSA 5GLAA 2VV6A 1GA0A 2ZOIA 3WS4A 4NXGA 3AGFA 4PKYG 2Y79A 2MJ6A 2M1CA 1DY6A 1JWPA 2ACGA 1VHMA 3LEZA 2ZQCA 2IA2A 4OQGA 1W63M 1W8YA 4WZ4A 4QU3A 3LY4A 3IH8A 3CG5A 3G2ZA 1JTDA 2VGKA 4UQIM 5HD3A 3BFEA 3BFCA 4EERA 2V1ZA 4G3VA 3QP6A 3UB7A 1K54C 3KSHA 5F69A 4DE3A 5A92A 2ZOHA 4JKTA 5DF7A 4OVDA 1C3BA 1OPXA 5TFQA 1FR1A 4S2OA 4WYYA 2PD7A 5HAPA 4LV1A 1MXOA 2A49A 5AQAA 3H82A 5EM0A 4KZ8A 2WKIA 1GHMA 4FTXA 3OC2A 3GECA 4IJGA 1PZOA 4JGRA 4BL3A 3DW0A 5AVEA 4EEUA 3HBRA 3M6BA 3GMWA 3JVVA 3BRMA 1TDGA 3RXWA 4HP9A 4OOLA 4E04A 2WAFA 5CXWA 2O9BA 2J9PA 3B47A 3P01A 4Y0OA 3JPUA 3BFDA 4Q8IA 4HI4A 5TR7A 3NOPC 4P6BA 2RCXA 2PAVP 4PM9A 1TS6A 5EUAA 4HH2A 4DRTA 1PWCA 5DF9A 1SDNA 2Y8HA 1NZUA 2O99A 4OPRA 1SZVA 4PM5A 1Y54A 2JBFA 4D2OA 3DBAA 3IF6C 2Y4AA 4X56A 4YNRA 3M2JA 5I94A 4JGOA 5CEDA 2ZMFA 4JXWA 3Q7VB 1KGGA 3HUMA 2JC7A 2WKPA 3KSGA 4WM9A 4GNUA 3SH7A 1K56D 3LEQA 4H6JA 3VP1A 3KYZA 2ZQ7A 2VGLS 2XQZA 1D1JA 1A0KA 1OJ5A 4DKIA 2B18A 1K57A 1ONGA 3W4QA 4UQIS 4UHUA 1NJ4A 4ZJ1A 4GHIB 4KZ4A 3UPOA 2O9AA 1XA1A 1DP8A 4LCMA 2FH5A 1Q2QA 3IH9A 2XROA 1NY0A 5CGWA 3IBRA 2WKEA 1F98A 4FH4A 4R6LA 1OT6A 4EEPA 3IWQA 4II7A 3OPLA 5J8XA 4EQIA 3NY4A 2JKFA 2XSSA 1H8MA 1OJGA 4JGQA 2PR5A 3RXXA 1YSQA 3HLWA 3LCEA 3S7NA 5F83A 1K25A 3BYDA 1DJAA 3QP8A 4XUXA 5HFOA 4GZBA 2QMIA 1H8YA 1PW1A 2W3FA 5JYPA 2CMNA 2Y2KA 3T4LA 5L2FA 2HV1A 1K55C 4K0WA 3CMZA 4OQIA 4KG6A 4U0XA 2Q9MA 3VSLA 3HJIA 1BZAA 4BBTA 4X1LA 4RA7A 1OTEA 3CHWP 5EECA 5E2FA 5DJUA 5FI6A 4JF4A 2AVXA 1S1ZA 2XEPA 3IX8A 2P04A 2V0WA 3E2LA 1ES3A 2WK0A 1N9NA 1V9YA 2OLUA 5L8MA 2W0NA 1FCOA 1ZG6A 3IF6B 1RGZA 1ZC2A 2Y2IA 1S0WA 2JE5A 3PAEA 4R38A 2HJEA 1NWZA 4E3OA 1S66L 1PWGA 4CLCB 3ZG5A 1V9ZA 3EEAA 2V1AA 4E6WA 4ZJ2A 4RQ9A 1KDWA 3C7UA 1W79A 4I3JA 3NECA 4KQOA 4AFIA 1YLZA 1IELA 3PBRA 4S2NA 5HX9A 4OOYA 4WL9A 4MBFA 3IHBA 2PDRA 2HDUA 4LPZA 1J3WA 4P6ZS 1MY8A 4H8RA 5JYOA 5J7EA 1EWZA 5EM1A 2VK3A 4MN7A 1XKZA 2XF3A 1MC0A 3GV9A 3G4PA 1I5QA 1XJ2A 4OOMA 1ZHHB 1CEFA 5CHJA 3MZFA 3O5YA 3EQUA 4OP5A 3SZTA 5HWTA 3VP4A 5HPIA 5IU1A 2J80A 5F6AA 3IS2A 4UA6A 1VB6A 4I3IA 5KMWA 5DTKA 4LLOB 4KENB 1FIKA 2W1RA 2KDKA 4R4SA 2OAP1 1SKOB 4MBHA 3QNCA 3ZNTA 4S2KA 1PYYA 3VOZA 3G32A 3QP2A 3R7WA 4JF6A 3PHYA 4GHIA 3U4LP 3R7WB 1K55A 3FYZA 3MBZA 4KQQA 1HLUP 3S7QA 4LRXC 3K3DA 2Y59A 1LT0A 3UPPA 2EA9A 3T4TA 5AQ7A 4DDSA 2VEAA 3ZCZA 1ERQA 3NDGA 3BLSA 1GSVA 1PIOA 5A91A 2J7VA 2IWBA 3ISGA 3PBSA 3F1NA 2BG1A 4QY5A 4HQAA 4OONA 4GLQA 3ZG0A 4JGPA 4LCLA 2Q0OA 2WKHA 1BSGA 1LL8A 3A3EA 1ZTUA 1PFLA 2WGWA 1LSWA 3DAVA 2XR0A 3O88A 4WELA 1JTGA 3UN7A 2Y55A 2JKTM 1NLZA 4GD8A 3UB8A 3G30A 2L4RA 1NZOA 3VOLA 4BD1A 3Q07A 3R4KA 3S22A 2ZLYA 3WS5A 4GJ4A 5EV0A 3VP0A 2WKQA 2ZL1A 4DXBA 3I7JA 3LIFA 5FQ9A 1TS7A 1I2WA 2B02A 2I9VA 3O87A 1JWVA 1P9WA 3F1PA 3QNBA 3G6OA 1F5MA 3UE0A 5AQ9A 5GHZA 4NK3A 3Q82A 4G3KA 5AQBA 1FSYA 3EGXC 3SS5A 2H0YA 1ZKJA 2Y2NA 3MXRA 3FV7A 3A0RA 1L0FA 3HREA 3G34A 4CPKA 4LV3A 3LIAA 4FOFA 1W63Q 3ITBA 4EXOA 4OLGA 1YT4A 3N4IA 2G2UA 1XP4A 4DE2A 2EFXA 2ZQ8A 1TDLA 4R3BA 1AWIA 1PI5A 1P0ZA 1OTBA 3A3FA 3CPTA 1FR6A 1PZPA 2XH9A 4L0LA 3MKFA 3T4OA 3HUNA 4KZAA 3A3JA 3VFHA 2X01A 1NYMA 4BBVA 2V2FF 3Q7VA 5M18A 1BUEA 4LV2A 1P97A 3UNWA 1CEGA 4E3JA 3N7WA 3BW6A 3IT9A 2Q9NA 3L7HA 2XA7M 1IOUA 4BMWA 3HVFA 4Y15A 4KZ7A 2XDMA 2B5RA 3HLDA 5DVAA 3C30A 4MDZA 2XA7S 3MZEA 2J8YA 5EVEA 4I39A 2OV5A 3MQ0A 1D06A 3CUEA 1GHPA 3T1SA 3SH8A 3PBQA 5CECA 1GCEA 5DKLA 2V20A 4R23A 2OWJA 5A8BA 2JN7A 3LFVA 1NRFA 5IS1A 1K6RA 1KGEA 1Q2PA 2PYRA 1STZA 4YINA 4S2MA 1XFNA 4LV0A 1DJBA 2ZMAA 2QWSA 3BFGA 3MMHA 3E4OA 5M1AA 3ZQ5A 4EV4A 5DFXA 3H9WA 4N1HA 4L9EA 3UO9A 1T18A 3TOIA 3UE6A 4HIAA 1XX2A 4ARZA 1DP6A 3G31A 1L3LA 1SCWA 3IXGA 1K6SA 4OQHA 2WGVA 4Y17A 3MS6A 4M4XA 1LI9A 1IEMA 1IFQA 1XGJA 4HOIA 2NUPC 2O0YA 5G4YA 5CTNA 4BENA 3S7OA 3C4PA 2HP6A 3IS2B 4Z1WA 5IHVA 4E3IA 2XD5A 2K31A 3E4QA 4HESA 3G35A 3BFFA 3ZDJA 1OTAA 2W3GA 4R0QA 4Q0IA 4LFUA 4MCWA 1SDEA 3Q7ZA 4CLCA 3W8KA 4ETZA 4OQ0A 2JKRM 1IYSA 2L0WA 5GLDA 1PNEA 4FD8A 4R3AA 3C2WA 4YOFA 3F1PB 1MWTA 5CX7A 4PKYA 3VP2A 3LYXA 5BOHA 5CEBA 1SKFA 3SOIA 3KX0X 2EXAA 2ZC6B 4CLCE 3P09A 1OTIA 5HWWA 1YLPA 1MWUA 3NHQA 3TW8A 3NDEA 3QP1A 4YWZA 3CITA 4IVKA 3SW1A 3C7VA 5FATA 3KSFA 3BY9A 5KSCA 1ESUA 5EE8A 2IWDA 4WF0A 2M7UA 4KZBA 3NJAA 1UGUA 2OLVA 3U2AA 2JKGA 2W1TA 2W1TB 2GDNA 3BM6A 3UDFA 4CJNA 1E3UA 1K54A 1M40A 1BYWA 3LUQA 4FH2A 2BTFP 1FCMA 4Y5FA 3ZGAB 4JXVA 2JCHA 4HJ3A 1W7FA 1XJ4A 3QP4A 4P87A 4KQRA 2KX6A 2ZM2A 5EVIA 3MQOA 4KUKA 3PXPA 1N9OA 4QWOA 4IBRA 5FQQA 4X25A 3NULA 5EVIB 1N9BA 3EWKA 2V8FA 3BJNA 5G18A 4ESPA 1KVMA 4HNBA 3CAXA 3VOYA 4S2PA 1G5UA 4M3KA 4OPQA 1VETB 2H28A 4DDYA 1CF0A 2NUTC 4NXBA 5HDCA 1S4SA 3NOUC 4IEDA 4S2JA 3HLBA 4XUZA 2PYPA 4CQHA 3PR6A 1XPBA 4GW9A 3HUOA 2Y91A 4Q0HA 1VM1A 2C5WB 3C38A 3IF5A 3TRCA 2XFTA 1SHVA 3PBOA 1HTZA 2IWCA 3CPTB 4Q0JA 4IVIA 1YM1A 1ES2A 3NCKA 4DE0A 2ZQ9A 4GKUA 2WZXA 1YMXA 5GLBA 1L0EA 3FZCA 4ZBEA 4QB8A 4UA9A 1XJ3A 2XGNA 3MQQA 2P9VB 4K0XA 4R70A 5FEGA 3E98A 2B95A 5TBMA 3MZDA 4BL2A 3PBTA 3Q81A 3T4KA 3ICYA 2XFSA 4E3KA 3CUEC 4LENA 4E6XA 4WEJA 1TS0A 3N8LA 4N1XA 4PM8A 4NG2A 2A2LA 4X55A 2A3UA 2HP5A 4A5RA 1Z6FA 4X53A 1CJFA 1ZG4A 2V9AA 3L9KA 2PBYA 3P7NA 2GNXA 4Y13A 2ZL1B 3VMAA 1RGYA 3S4XA 4OPZA 4K08A 2V0UA 2ZC5B 3IWIA 5DJTA 2X02A 3UPNA 1ODVA 4Y0UA 4DJ3A 4K91A 3CWFA 5L09A 1XFQA 2CC1A 3A0SA 3FWLA 3E0YA 5CERA 5IT5A 1BLPA 5EOOA 1PI4A 4GOGA 2ZC4B 4EUVA 3UDXA 1YSPA 2WAEA 3NIAA 4WUJA 1PRQA 1G6AA 3OPRA 3UY6A 4F3LA 5HSQA 5KSHA 2W3EA 1LI0A 2J9OA 3DTEA 1WE4A 3MSHA 3NOTC 3NC8A 1VEUB 2P7JA 2R9XA 4EETB 2INWA 4B4XA 5HDSA 3H82B 5F1GA 3N8RA 1K4EA 1FILA 2V8CA 3FKVA 5HL1A 4DXCA 5HAQA 3NBLA 2EXBA 2JHEA 1P9RA 3CZDA 1IYQA 2I72A 2Y2QA 4S2NC 1HVBA 5EVLA 5CTMA 3OPHA 2DNSA 1BT5A 3WWXA 3OLOA 4GS9B 5A93A 2E8JA 1S6RA 5L10A 4Z9QA 4R3JA 4I5SA 1E25A 3BLMA 1WYBA 1X0OA 1E3UD 4KG5A 4PM7A 3KO6A 5HD5A 2PU4A 1S4RA 3NI9A 4EESA 2EX6A 2VKSA 1G68A 3C5AA 2J3WA 1T1BA 5GHYA 3MJQA 2R9WA 3BQ8A 4UAAA 4HBUA 2RL3A 2FZ0A 2OWHA 2Y2MA 1T1AA 3T1RA 3PAGA 4IHQA 4P85A 3MXSA 4JXSA 3LI8A 1MKMA 1M6KA 1XJ6A 1Y28A 3EQVA 3S7PA 2ZM0A 2HF6A 3F1OB 3N8SA 2A24A 5DF8A 3RH8B 4QD4A 5HW3A 1LHYA 3SH9A 2JKTI 1TS8A 2G7UA 5FQKA 1T1CA 1F2KA 3T4JA 4HJ6A 1S1YA 1YMSA 2D02A 4JF5A 4PAUA 1EW0A 1MKIA 1YLWA 1FOFA 4BBUA 3FPWA 3B42A 2ZC7A 2XLNA 4JPMA 5HAIA 3CLOA 3LIEA 5HL6A 2DMWA 5FEFA 2E8IA 2Z2LB 4EBPA 2H5SA 4EU0A 4H6JB 5MC7A 4N9LA 4E3LA 4KZ9A 4RX2A 4FSFA 4C75A 4EBLA 2VA0A 1FSWA 3HLCA 4WLAA 4MNRA 3EOIA 2XRNA 5EVID 5HPFA 5AJGA 3WRTA 3E4PA 2Y2JA 4N92A 1AXBA 3IXBA 2D01A 5L07A 5I5LA 1L0GA 2Y2LA 5FQIA 4B93A 1D7EA 2Z6DA 3V67A 2J3TD 3ZG9B 4EBNA 3IXHA 4KG2A 4KZ6A 4F3LB 1O7EA 4QJGA 2BASA 4XT2A 2EFUA 1QMFA 3HLEA 5E2GA 1KE3A 3UB6A 3VV4A 3V3RA 1J9MA 3D4FA 4DE1A 4NXFA 2ZBBA 4PPRA 3IHAA 3GDIA 5FI7A 2JKRI 1MWRA 1ACFA 4LRYC 2K2NA 5EVIC 3VE3A 4X1MA 1VEUA 3LR5A 1Z09A 2LB5A 1IKGA 3V50A 2Y2GA 4Y7PA 2VLGA 2PBDP 2HP9A 1YKDA 2K7SA 2WYXA 1DP9A 4CLCD 4I3AA 3QP5A 4S2IA 3W4PA 1VETA 3F1OA 2A24B 5FDHA 3JVUA 3PBNA 2QJ7A 4S2LA 4X69A 3O3VA 1EI5A 2ZQAA 2C6WB 3GRJA 2KLIA 1FCNA 3OCLA 4WEKA 3LIDA 3V3SA 3ITAA 2WKRA 3O86A 4IUHA 1OMEA 1BLCA 3HL9A 4GD6A 2J3TC 3ZYTA 3GVBA 5CHMA 4HJ4A 3H7WB 3OOVA 2QPNA 1G6OA 3K3CA 3LR4A 2QKPA 3LICA 2VX8A 1YAXA 1YQSA 3PYPA 5U47A 1K38A 5DTSA 4PHTA 1QMEA 3P98A 4O7DA 3B33A 2WUQA 1IYPA 2XK1A 2VGLM 1O07A 2EX8A 5KIZA 1G28A 1E4DA 4EQ1A 1LL9A 3OPPA 3IQAA 3T50A 3MF0A 4ZRRA 3GTCA 3HCYA 2ZM8A 4U3TA 1Y4OA 2VJWA 3FPVA 3TSGA 4DF6A 3N6IA 5FAPA 1SKOA 3IWOA 3BECA 5FAQA 5A90A 1TVFA 4R4RA 5GL9A 2P74A 5J3WA 1ESIA 2ZQDA 4GN2A 3IBJA 3T1QB 1W8QA 4HH3A 5TJJA 4P6ZM 2FFYA 2O9CA 1NYYA 2XD1A 1PW8A 2VV8A 4WMCD 1BLSA 3FC7A 2Z6CA 1HZOA 4JXGA 4U0TA 4RX3A 5D3OA 3DWZA 3S1YA 3K2NA 2QYBA 1GHIA 1GSWA 4HY8A 1JWZA 1BTLA 1XA7A 2M7VA 2P9VA 3SS3A 3CJMA 2DRWA 1LLBA 3W4OA 2DCFA 1WYCA 4MN6A 2PU2A 4OLDA 5F1FA 3F1NB 2W27A 4Y2FA 4OKPA 1K57C 1L0DA 3UMDA 2VGJA 3KYEA 2WZZA 1GA9A 2ZC3B 3W2ZA 4O01A 1K4FA 3BQAA 4MEZA 2HPBA 4BQMA 3FKWA 5HWVA 2VV7A 4HP4A 1OT9A 1JNUA 2EX2A 3RTYA 2GX5A 3UMEA 2EWVA 4NXEA 2W3HA 1N4OA 2GJ3A 4QPRA 2HJ9C 5FL3A 3TE8A 4LGWA 4E3MA 4KQDA 1MPLA 1BLHA 3BEBA 2KOIA 3RJUA 4NEED 3LR0A 1H8ZA 3VP3A 5FSRA 3LI9A 1XXMA 2ZJ9A 4JLFA 3OZHA 2L1MA 3UB9A 3VE4A 4Y0TA 2P08A 5HZHA 1GSXA 3JYIA 4MBKA 5C5KA 2HDRA 5FI2A 1LSXA 5DTTA 2X71A 4XXRA 2PHYA 5GLCA 2PT7A 2OSUA 1MBLA 4GCZA 5KZHA 3IXDA 4HEFA 4ID4A 2W3DA 1T19A 3UDIA 5AVFA 2Y2OA 1CI8A 4WZ5C 4ZTKA 1ES4A 2UV0E 4ZJ3A 3VSKA 2H10A 5FASA 2LB9A 4EWFA 3V39A 4NETA 3EGDC 5FAOA 3A3IA 3WS1A 2GZAA 5F68A 3ZG8B 3WS2A 4L9FA 5G4ZA 2EX9A 4NKPA 4OPYA 1IYOA 5J4EA 1YLTA 4C3QA 4FCFA 3OCNA 2QZ6A 2VZWA 1RCJA 4C6YA 2EWWA 1HD8A 3C8CA 4ETXA 3DTMA 4EUZA 1KVLA 1TEMA 2OOLA 5DKKA 1EROA 3A0VA 3C4OA 5EFWA 3LR3A 2H0TA 3HJKA 3LIBA 4ARZB 5E43A 4QHCA 1NRJA 1H5XA 1JVJA 4YFMA 3FG8A 2QJ5A 2HZ5A 5EOEA 1W5DA 1H3QA 3TG9A 4XT2B 3BY8A 2YKHA 1BULA 3ZG7B 4KZ5A 5TGFA 3D9YA 4HBTA 1MWSA 3HLGA 4PM6A 3B3XA 1ONHA 3MXQA 2FFFB 1ES5A 1DJCA 3DTKA 1U60A 4BWIA 5E2HA 4O0PA 5TBMB 4JBFA 2WGWB 1I2SA 1NLYA 3EEHA 3ULFA 5DFYA 3ZVTA 3M6HA 5CGSA 3LGOA 3Q1FA 5FQJA 4GB7A 1YLJA 5EPHA 1LSVA 3LO7A 4E3NA 5LBRA 3MKEA 4KUOA 4UA7A 4BD0A 1S67L 5HARA 2Z2MB 2Y2HA 3MFDA 5F82A 1IKIA 2R78A 2ZD8A 4B9OA 1RP5A 3ZHHA 3IX4A 4GDNA 1YLYA 1KE4A 3CI6A 2WADA 5F5YA 3DWKA 3V5MA 4ZAMA 3SS4A 1PWDA 4G3WA 2PD8A 3E2KA 2OAQ1 3T1XA 4B88A 4N9KA 1H0MA 3D72A 2ZMVA 5M19A 5CRFA 4CLCC 4RYEA 3M2KA 1VQQA 3WS0A 4OP8A 2Y2PA 3UE1A 3AGDA 1N9LA 2G2WA 3DTIA 4GS9A 4F94A 4DJ2A 2PRFA 5FDSA 3OBFA 4WZ5A 3T12B 4MN5A 4KZ3A 4IBXA 3IF6A 2HDQA 4GDBA 3UB5P 4WN5A 2BLSA 5E2EA 2UWXA 4P0MA 2YKFA 3QHYA 1OTDA 3GSGA 1K0KA 1DRMA 5CGXA 1NXYA 4B4ZA 3UE3A 3G2YA 4QY6A 1KDSA 3A3DA 4WBGA 4DN0A 1K56A 4O8GA 4Y3IA 1CI9A 1LL5A 3WRZA 5K5BA 4D60A 5HDDA 5CHUA 4ZDXA 1CQAA 1TD5A 4ME4A 4BLMA 3ZVWA 1ALQA 2PR6A 3GR2A 3KYQA 2HGVA 3T4SA 1F9IA 3PTEA 3ZFZA 1XGIA 3MFXA 5FA7A 4PMAA 4L9GA 4HHDA 4OH0A 1WA9A 4FUWA 3TJZC 3ZNYA 4X68A 4MMNA 3KSIA 3LY3A 2V1BA 1KE0A 1FQGA 4EW7A 3H7WA 5FQMA 1CK3A 4MLLA 1TF1A 4LRZE 1KGFA 4UEYA 3AGEA 2QHKA 4BJPA 3MR0A 3BWLA 3T4QA 1MZUA 5GHXA 4R1GA 3RFBA 1ERMA 3GQZA 3VFFA 1UWPX 4X6TA 1UWNX 3HLFA 3IX3A 4RVAA 4I38A 3D3OA 1KOUA 4WMCA 2WGIA
chains in the Genus database with same CATH topology
2V0UA 1LL8A 5DJTA 4IUKA 1ZTUA 1ODVA 4DMZA 4DJ3A 1LSWA 4MN6A 3CWFA 1XFQA 3F1NB 4WELA 2W27A 4Y2FA 2VV6A 3UMDA 2JKTM 3A0SA 2ZOIA 1NLZA 3E0YA 4NXGA 3UB8A 2L4RA 5IT5A 3VOLA 4PKYG 3W2ZA 2Y79A 3R4KA 4O01A 2MJ6A 3BQAA 4EUVA 2M1CA 1YSPA 4GJ4A 1VHMA 5HWVA 2VV7A 4HP4A 4WUJA 2IA2A 1OT9A 1JNUA 3RTYA 1W63M 2GX5A 2WKQA 3UMEA 2EWVA 4F3LA 4NXEA 5HSQA 5KSHA 3LIFA 2W3EA 1TS7A 2W3HA 2GJ3A 2B02A 4QPRA 2I9VA 3NOTC 2HJ9C 5FL3A 1P9WA 3F1PA 3TE8A 3G6OA 1F5MA 4KQDA 4UQIM 5HD3A 2P7JA 4EETB 2INWA 4EERA 5HDSA 3H82B 4G3VA 4G3KA 3UB7A 2KOIA 3KSHA 5F69A 4NEED 3EGXC 3LR0A 2ZOHA 3LI9A 1OPXA 3A0RA 2JHEA 1P9RA 3LIAA 2PD7A 1W63Q 4FOFA 4EXOA 2L1MA 3UB9A 3VE4A 2P08A 3H82A 5HZHA 1GSXA 3OLOA 4GS9B 5C5KA 3OC2A 1LSXA 3GECA 4IJGA 4I5SA 1P0ZA 1OTBA 4JGRA 2PHYA 5AVEA 2PT7A 1X0OA 4L0LA 3T4OA 4GCZA 3KO6A 5HD5A 4EEUA 1S4RA 4EESA 2VKSA 3JVVA 2W3DA 1T19A 2J3WA 5AVFA 1T1BA 3MJQA 4BBVA 4HP9A 3BQ8A 4OOLA 4E04A 2FZ0A 2O9BA 1P97A 2OWHA 3B47A 3P01A 2LB9A 1T1AA 3BW6A 4HI4A 4IHQA 3EGDC 3NOPC 2XA7M 3LI8A 1MKMA 1IOUA 1XJ6A 1Y28A 3EQVA 4BMWA 1TS6A 3S7PA 2HF6A 2GZAA 3F1OB 5F68A 2A24A 4HH2A 3RH8B 5DF9A 2JKTI 4L9FA 2Y8HA 3C30A 4MDZA 2XA7S 2O99A 5G4ZA 1TS8A 2G7UA 4I39A 3MQ0A 4NKPA 1T1CA 1D06A 3T4JA 3DBAA 5J4EA 3CUEA 4YNRA 4HJ6A 3PBQA 5DKLA 1S1YA 2D02A 4JGOA 3OCNA 2ZMFA 4PAUA 2OWJA 2VZWA 1EW0A 2WKPA 5A8BA 3KSGA 2JN7A 3LFVA 2EWWA 3C8CA 4ETXA 4H6JA 4BBUA 5IS1A 3FPWA 3B42A 3KYZA 2PYRA 2VGLS 2OOLA 5DKKA 1STZA 3A0VA 5EFWA 1OJ5A 3LR3A 3CLOA 3HJKA 3LIEA 1XFNA 2B18A 5HL6A 2DMWA 3LIBA 4UQIS 4ARZB 2QWSA 3MMHA 4GHIB 3E4OA 3ZQ5A 1NRJA 2O9AA 5DFXA 1DP8A 4EU0A 2FH5A 4H6JB 5MC7A 3H9WA 2XROA 3FG8A 2QJ5A 3IBRA 4L9EA 1F98A 1T18A 1H3QA 1OT6A 4R6LA 4XT2B 4FSFA 3UE6A 3BY8A 4EEPA 4II7A 4HIAA 2YKHA 2VA0A 4ARZA 1DP6A 4WLAA 3EOIA 2XRNA 5HPFA 5AJGA 3E4PA 4M4XA 2XSSA 1IFQA 2D01A 1H8MA 4HOIA 2NUPC 1OJGA 2O0YA 4JGQA 3MXQA 2PR5A 1YSQA 5G4YA 3S7OA 5I5LA 3IS2B 4Z1WA 3S7NA 4B93A 2K31A 3E4QA 1D7EA 2Z6DA 3V67A 4BWIA 2J3TD 4O0PA 1OTAA 2W3GA 5TBMB 4Q0IA 4MCWA 3EEHA 1NLYA 3ULFA 4CLCA 5DFYA 4F3LB 4ETZA 2W3FA 2CMNA 2BASA 2JKRM 4XT2A 2L0WA 4R3AA 3T4LA 3C2WA 2HV1A 3UB6A 4YOFA 3F1PB 3VV4A 5CX7A 4PKYA 1LSVA 3HJIA 3LYXA 5LBRA 4KUOA 4BBTA 1S67L 1OTEA 4NXFA 2ZBBA 3KX0X 5DJUA 2R78A 4B9OA 3GDIA 1S1ZA 2JKRI 4CLCE 2P04A 2V0WA 4LRYC 2K2NA 1OTIA 3VE3A 5HWWA 3CI6A 3NHQA 5F5YA 3LR5A 2LB5A 3TW8A 1N9NA 1V9YA 5L8MA 4YWZA 2W0NA 3CITA 2VLGA 3SW1A 3KSFA 4G3WA 1YKDA 2K7SA 3BY9A 2PD8A 4R38A 2OAQ1 2HJEA 1NWZA 1S66L 2M7UA 4WF0A 4CLCB 3NJAA 1UGUA 1DP9A 3U2AA 1V9ZA 3D72A 3EEAA 4CLCD 2V1AA 4I3AA 2ZMVA 4RQ9A 2W1TA 3F1OA 2A24B 2W1TB 4I3JA 4KQOA 4CLCC 4AFIA 3JVUA 3PBRA 3PBNA 1BYWA 2QJ7A 3LUQA 4WL9A 2PDRA 1N9LA 4Y5FA 4LPZA 4HJ3A 4P6ZS 1XJ4A 5J7EA 4GS9A 2KLIA 4DJ2A 2KX6A 3MQOA 3OBFA 3OCLA 4KUKA 4WEKA 3LIDA 3PXPA 1N9OA 4MN5A 4MN7A 3EWKA 3BJNA 2WKRA 1MC0A 4IUHA 1XJ2A 4HNBA 3CAXA 4OOMA 2J3TC 4WN5A 1ZHHB 3ZYTA 4HJ4A 3H7WB 3OOVA 2YKFA 1OTDA 2H28A 1G6OA 3K3CA 3LR4A 1DRMA 2NUTC 4NXBA 5HDCA 1S4SA 3O5YA 2QKPA 3LICA 3NOUC 2PYPA 4CQHA 2VX8A 3PR6A 1YAXA 3UE3A 3EQUA 3PYPA 4GW9A 5HWTA 4PHTA 4Q0HA 3B33A 3C38A 3TRCA 5HPIA 5IU1A 4DN0A 2J80A 2VGLM 3PBOA 4O8GA 4Y3IA 5F6AA 3IS2A 5KIZA 1G28A 1VB6A 4I3IA 4EQ1A 5K5BA 5HDDA 4Q0JA 3T50A 3MF0A 4ZRRA 3HCYA 1TD5A 4LLOB 4ME4A 2VJWA 2PR6A 3FPVA 3KYQA 2HGVA 3T4SA 1F9IA 2W1RA 3MFXA 2KDKA 2OAP1 1XJ3A 4L9GA 3MQQA 4R70A 4HHDA 1WA9A 3R7WA 3PHYA 4GHIA 3TJZC 3R7WB 3E98A 4MMNA 5TBMA 3KSIA 3S7QA 4LRXC 2V1BA 3PBTA 3K3DA 3T4KA 5J3WA 3ICYA 4EW7A 3H7WA 1LT0A 2EA9A 3T4TA 3CUEC 3IBJA 1TF1A 2VEAA 4HH3A 4WEJA 1TS0A 5TJJA 4P6ZM 4LRZE 4UEYA 2O9CA 2QHKA 1GSVA 4BJPA 3MR0A 2VV8A 3BWLA 3FC7A 2A2LA 2Z6CA 3T4QA 1MZUA 3PBSA 3F1NA 3RFBA 2V9AA 3K2NA 2QYBA 1UWPX 4HQAA 3P7NA 2GNXA 1GSWA 1UWNX 4GLQA 4HY8A 4I38A 4JGPA 3D3OA 1KOUA 4K08A 2M7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V0U A;  1D7E A;  2Z6D A;  1P97 A;  2OWH A;  2WKR A;  1LL8 A;  3EWK A;  5DJT A;  1XJ2 A;  1T1A A;  1ODV A;  1OTA A;  4HNB A;  4DJ3 A;  5TBM B;  1LSW A;  4EW7 A;  3CAX A;  4HI4 A;  4MN6 A;  3CWF A;  3EEH A;  3NOP C;  4WN5 A;  3ULF A;  1XFQ A;  3F1N B;  2W27 A;  3LI8 A;  2VV6 A;  4F3L B;  1XJ6 A;  1Y28 A;  3UMD A;  4HJ4 A;  3H7W B;  1TS6 A;  3A0S A;  2YKF A;  2ZOI A;  3E4Q A;  4NXG A;  3F1O B;  1OTD A;  5F68 A;  2CMN A;  2BAS A;  2A24 A;  2H28 A;  3K3C A;  4HH2 A;  2L0W A;  4XT2 A;  3UB8 A;  2L4R A;  3RH8 B;  1DRM A;  3VOL A;  4PKY G;  4R3A A;  4NXB A;  5HDC A;  1S4S A;  2HV1 A;  2QKP A;  3C2W A;  3LIC A;  3NOU C;  2PYP A;  4L9F A;  3UB6 A;  3F1P B;  5G4Z A;  2M1C A;  1TS8 A;  3PYP A;  4PKY A;  4GW9 A;  1LSV A;  2VV7 A;  3HJI A;  4HP4 A;  4I39 A;  5HWT A;  3LYX A;  5HWV A;  4WUJ A;  4KUO A;  4BBT A;  1T1C A;  1D06 A;  1JNU A;  1OT9 A;  1S67 L;  3RTY A;  2WKQ A;  1OTE A;  3UME A;  5J4E A;  4HJ6 A;  3B33 A;  4F3L A;  4NXE A;  4NXF A;  5DKL A;  5IU1 A;  1S1Y A;  2ZBB A;  2D02 A;  4JGO A;  5HSQ A;  3LIF A;  3KX0 X;  5DJU A;  2J80 A;  2R78 A;  4B9O A;  3GDI A;  2OWJ A;  5F6A A;  3IS2 A;  1TS7 A;  1EW0 A;  5KIZ A;  2GJ3 A;  2B02 A;  1S1Z A;  1G28 A;  1VB6 A;  2WKP A;  4I3I A;  5A8B A;  2JN7 A;  2I9V A;  4EQ1 A;  3NOT C;  2V0W A;  5HDD A;  4LRY C;  3C8C A;  1OTI A;  3F1P A;  4H6J A;  3T50 A;  3G6O A;  4KQD A;  3VE3 A;  5HD3 A;  4BBU A;  2P7J A;  4EET B;  5IS1 A;  2INW A;  4LLO B;  4EER A;  5HWW A;  5HDS A;  2PYR A;  2OOL A;  3H82 B;  5DKK A;  3A0V A;  3NHQ A;  2PR6 A;  5F5Y A;  3UB7 A;  5EFW A;  1OJ5 A;  5F69 A;  1N9N A;  1F9I A;  1V9Y A;  3CLO A;  3HJK A;  2ZOH A;  3LIE A;  3MFX A;  2KDK A;  1XFN A;  2W0N A;  4YWZ A;  3LIB A;  2VLG A;  3LI9 A;  1XJ3 A;  4L9G A;  3SW1 A;  3MQQ A;  4R70 A;  2QWS A;  3A0R A;  4HHD A;  4GHI B;  1WA9 A;  2K7S A;  3E4O A;  2JHE A;  3BY9 A;  2PD8 A;  3ZQ5 A;  3LIA A;  3PHY A;  4GHI A;  4R38 A;  2PD7 A;  1DP8 A;  1NWZ A;  1S66 L;  4H6J B;  5TBM A;  4EXO A;  2L1M A;  3UB9 A;  4WF0 A;  3H9W A;  3VE4 A;  4LRX C;  2V1B A;  3NJA A;  1UGU A;  3FG8 A;  3K3D A;  1DP9 A;  3H82 A;  5J3W A;  1V9Z A;  3D72 A;  2QJ5 A;  3ICY A;  2V1A A;  3H7W A;  3IBR A;  1LT0 A;  4I3A A;  1GSX A;  2EA9 A;  4L9E A;  3OLO A;  4GS9 B;  4RQ9 A;  1F98 A;  1T18 A;  3F1O A;  4R6L A;  1OT6 A;  2A24 B;  4XT2 B;  2VEA A;  4I3J A;  3BY8 A;  4HH3 A;  3UE6 A;  4EEP A;  1TS0 A;  1LSX A;  2YKH A;  3GEC A;  4HIA A;  4LRZ E;  1DP6 A;  4WLA A;  2QHK A;  1GSV A;  3MR0 A;  1P0Z A;  1OTB A;  1BYW A;  2VV8 A;  4I5S A;  4JGR A;  3BWL A;  3FC7 A;  2PHY A;  5AVE A;  2Z6C A;  3E4P A;  1MZU A;  1X0O A;  2QJ7 A;  3LUQ A;  4M4X A;  4WL9 A;  2PDR A;  1N9L A;  4GCZ A;  3F1N A;  5HD5 A;  4EEU A;  4LPZ A;  2D01 A;  2V9A A;  1S4R A;  1UWP X;  4HQA A;  4HOI A;  4EES A;  1OJG A;  3P7N A;  4HJ3 A;  1GSW A;  4JGQ A;  1UWN X;  1XJ4 A;  1T19 A;  3MXQ A;  5AVF A;  2PR5 A;  1T1B A;  5J7E A;  4HY8 A;  5G4Y A;  3MJQ A;  4I38 A;  4JGP A;  4GS9 A;  5I5L A;  4BBV A;  4HP9 A;  4DJ2 A;  5HZH A;  3IS2 B;  1KOU A;  4E04 A;  2KX6 A;  3MQO A;  4KUK A;  4K08 A;  3LID A;  4MN5 A;  1N9O A; 
#chains in the Genus database with same CATH topology
 1YPR A;  1L2S A;  4IUK A;  4DMZ A;  2HDS A;  5GLA A;  2VV6 A;  1GA0 A;  2ZOI A;  3WS4 A;  4NXG A;  3AGF A;  4PKY G;  2Y79 A;  2MJ6 A;  2M1C A;  1DY6 A;  1JWP A;  2ACG A;  1VHM A;  3LEZ A;  2ZQC A;  2IA2 A;  4OQG A;  1W63 M;  1W8Y A;  4WZ4 A;  4QU3 A;  3LY4 A;  3IH8 A;  3CG5 A;  3G2Z A;  1JTD A;  2VGK A;  4UQI M;  5HD3 A;  3BFE A;  3BFC A;  4EER A;  2V1Z A;  4G3V A;  3QP6 A;  3UB7 A;  1K54 C;  3KSH A;  5F69 A;  4DE3 A;  5A92 A;  2ZOH A;  4JKT A;  5DF7 A;  4OVD A;  1C3B A;  1OPX A;  5TFQ A;  1FR1 A;  4S2O A;  4WYY A;  2PD7 A;  5HAP A;  4LV1 A;  1MXO A;  2A49 A;  5AQA A;  3H82 A;  5EM0 A;  4KZ8 A;  2WKI A;  1GHM A;  4FTX A;  3OC2 A;  3GEC A;  4IJG A;  1PZO A;  4JGR A;  4BL3 A;  3DW0 A;  5AVE A;  4EEU A;  3HBR A;  3M6B A;  3GMW A;  3JVV A;  3BRM A;  1TDG A;  3RXW A;  4HP9 A;  4OOL A;  4E04 A;  2WAF A;  5CXW A;  2O9B A;  2J9P A;  3B47 A;  3P01 A;  4Y0O A;  3JPU A;  3BFD A;  4Q8I A;  4HI4 A;  5TR7 A;  3NOP C;  4P6B A;  2RCX A;  2PAV P;  4PM9 A;  1TS6 A;  5EUA A;  4HH2 A;  4DRT A;  1PWC A;  5DF9 A;  1SDN A;  2Y8H A;  1NZU A;  2O99 A;  4OPR A;  1SZV A;  4PM5 A;  1Y54 A;  2JBF A;  4D2O A;  3DBA A;  3IF6 C;  2Y4A A;  4X56 A;  4YNR A;  3M2J A;  5I94 A;  4JGO A;  5CED A;  2ZMF A;  4JXW A;  3Q7V B;  1KGG A;  3HUM A;  2JC7 A;  2WKP A;  3KSG A;  4WM9 A;  4GNU A;  3SH7 A;  1K56 D;  3LEQ A;  4H6J A;  3VP1 A;  3KYZ A;  2ZQ7 A;  2VGL S;  2XQZ A;  1D1J A;  1A0K A;  1OJ5 A;  4DKI A;  2B18 A;  1K57 A;  1ONG A;  3W4Q A;  4UQI S;  4UHU A;  1NJ4 A;  4ZJ1 A;  4GHI B;  4KZ4 A;  3UPO A;  2O9A A;  1XA1 A;  1DP8 A;  4LCM A;  2FH5 A;  1Q2Q A;  3IH9 A;  2XRO A;  1NY0 A;  5CGW A;  3IBR A;  2WKE A;  1F98 A;  4FH4 A;  4R6L A;  1OT6 A;  4EEP A;  3IWQ A;  4II7 A;  3OPL A;  5J8X A;  4EQI A;  3NY4 A;  2JKF A;  2XSS A;  1H8M A;  1OJG A;  4JGQ A;  2PR5 A;  3RXX A;  1YSQ A;  3HLW A;  3LCE A;  3S7N A;  5F83 A;  1K25 A;  3BYD A;  1DJA A;  3QP8 A;  4XUX A;  5HFO A;  4GZB A;  2QMI A;  1H8Y A;  1PW1 A;  2W3F A;  5JYP A;  2CMN A;  2Y2K A;  3T4L A;  5L2F A;  2HV1 A;  1K55 C;  4K0W A;  3CMZ A;  4OQI A;  4KG6 A;  4U0X A;  2Q9M A;  3VSL A;  3HJI A;  1BZA A;  4BBT A;  4X1L A;  4RA7 A;  1OTE A;  3CHW P;  5EEC A;  5E2F A;  5DJU A;  5FI6 A;  4JF4 A;  2AVX A;  1S1Z A;  2XEP A;  3IX8 A;  2P04 A;  2V0W A;  3E2L A;  1ES3 A;  2WK0 A;  1N9N A;  1V9Y A;  2OLU A;  5L8M A;  2W0N A;  1FCO A;  1ZG6 A;  3IF6 B;  1RGZ A;  1ZC2 A;  2Y2I A;  1S0W A;  2JE5 A;  3PAE A;  4R38 A;  2HJE A;  1NWZ A;  4E3O A;  1S66 L;  1PWG A;  4CLC B;  3ZG5 A;  1V9Z A;  3EEA A;  2V1A A;  4E6W A;  4ZJ2 A;  4RQ9 A;  1KDW A;  3C7U A;  1W79 A;  4I3J A;  3NEC A;  4KQO A;  4AFI A;  1YLZ A;  1IEL A;  3PBR A;  4S2N A;  5HX9 A;  4OOY A;  4WL9 A;  4MBF A;  3IHB A;  2PDR A;  2HDU A;  4LPZ A;  1J3W A;  4P6Z S;  1MY8 A;  4H8R A;  5JYO A;  5J7E A;  1EWZ A;  5EM1 A;  2VK3 A;  4MN7 A;  1XKZ A;  2XF3 A;  1MC0 A;  3GV9 A;  3G4P A;  1I5Q A;  1XJ2 A;  4OOM A;  1ZHH B;  1CEF A;  5CHJ A;  3MZF A;  3O5Y A;  3EQU A;  4OP5 A;  3SZT A;  5HWT A;  3VP4 A;  5HPI A;  5IU1 A;  2J80 A;  5F6A A;  3IS2 A;  4UA6 A;  1VB6 A;  4I3I A;  5KMW A;  5DTK A;  4LLO B;  4KEN B;  1FIK A;  2W1R A;  2KDK A;  4R4S A;  2OAP 1;  1SKO B;  4MBH A;  3QNC A;  3ZNT A;  4S2K A;  1PYY A;  3VOZ A;  3G32 A;  3QP2 A;  3R7W A;  4JF6 A;  3PHY A;  4GHI A;  3U4L P;  3R7W B;  1K55 A;  3FYZ A;  3MBZ A;  4KQQ A;  1HLU P;  3S7Q A;  4LRX C;  3K3D A;  2Y59 A;  1LT0 A;  3UPP A;  2EA9 A;  3T4T A;  5AQ7 A;  4DDS A;  2VEA A;  3ZCZ A;  1ERQ A;  3NDG A;  3BLS A;  1GSV A;  1PIO A;  5A91 A;  2J7V A;  2IWB A;  3ISG A;  3PBS A;  3F1N A;  2BG1 A;  4QY5 A;  4HQA A;  4OON A;  4GLQ A;  3ZG0 A;  4JGP A;  4LCL A;  2Q0O A;  2WKH A;  1BSG A;  1LL8 A;  3A3E A;  1ZTU A;  1PFL A;  2WGW A;  1LSW A;  3DAV A;  2XR0 A;  3O88 A;  4WEL A;  1JTG A;  3UN7 A;  2Y55 A;  2JKT M;  1NLZ A;  4GD8 A;  3UB8 A;  3G30 A;  2L4R A;  1NZO A;  3VOL A;  4BD1 A;  3Q07 A;  3R4K A;  3S22 A;  2ZLY A;  3WS5 A;  4GJ4 A;  5EV0 A;  3VP0 A;  2WKQ A;  2ZL1 A;  4DXB A;  3I7J A;  3LIF A;  5FQ9 A;  1TS7 A;  1I2W A;  2B02 A;  2I9V A;  3O87 A;  1JWV A;  1P9W A;  3F1P A;  3QNB A;  3G6O A;  1F5M A;  3UE0 A;  5AQ9 A;  5GHZ A;  4NK3 A;  3Q82 A;  4G3K A;  5AQB A;  1FSY A;  3EGX C;  3SS5 A;  2H0Y A;  1ZKJ A;  2Y2N A;  3MXR A;  3FV7 A;  3A0R A;  1L0F A;  3HRE A;  3G34 A;  4CPK A;  4LV3 A;  3LIA A;  4FOF A;  1W63 Q;  3ITB A;  4EXO A;  4OLG A;  1YT4 A;  3N4I A;  2G2U A;  1XP4 A;  4DE2 A;  2EFX A;  2ZQ8 A;  1TDL A;  4R3B A;  1AWI A;  1PI5 A;  1P0Z A;  1OTB A;  3A3F A;  3CPT A;  1FR6 A;  1PZP A;  2XH9 A;  4L0L A;  3MKF A;  3T4O A;  3HUN A;  4KZA A;  3A3J A;  3VFH A;  2X01 A;  1NYM A;  4BBV A;  2V2F F;  3Q7V A;  5M18 A;  1BUE A;  4LV2 A;  1P97 A;  3UNW A;  1CEG A;  4E3J A;  3N7W A;  3BW6 A;  3IT9 A;  2Q9N A;  3L7H A;  2XA7 M;  1IOU A;  4BMW A;  3HVF A;  4Y15 A;  4KZ7 A;  2XDM A;  2B5R A;  3HLD A;  5DVA A;  3C30 A;  4MDZ A;  2XA7 S;  3MZE A;  2J8Y A;  5EVE A;  4I39 A;  2OV5 A;  3MQ0 A;  1D06 A;  3CUE A;  1GHP A;  3T1S A;  3SH8 A;  3PBQ A;  5CEC A;  1GCE A;  5DKL A;  2V20 A;  4R23 A;  2OWJ A;  5A8B A;  2JN7 A;  3LFV A;  1NRF A;  5IS1 A;  1K6R A;  1KGE A;  1Q2P A;  2PYR A;  1STZ A;  4YIN A;  4S2M A;  1XFN A;  4LV0 A;  1DJB A;  2ZMA A;  2QWS A;  3BFG A;  3MMH A;  3E4O A;  5M1A A;  3ZQ5 A;  4EV4 A;  5DFX A;  3H9W A;  4N1H A;  4L9E A;  3UO9 A;  1T18 A;  3TOI A;  3UE6 A;  4HIA A;  1XX2 A;  4ARZ A;  1DP6 A;  3G31 A;  1L3L A;  1SCW A;  3IXG A;  1K6S A;  4OQH A;  2WGV A;  4Y17 A;  3MS6 A;  4M4X A;  1LI9 A;  1IEM A;  1IFQ A;  1XGJ A;  4HOI A;  2NUP C;  2O0Y A;  5G4Y A;  5CTN A;  4BEN A;  3S7O A;  3C4P A;  2HP6 A;  3IS2 B;  4Z1W A;  5IHV A;  4E3I A;  2XD5 A;  2K31 A;  3E4Q A;  4HES A;  3G35 A;  3BFF A;  3ZDJ A;  1OTA A;  2W3G A;  4R0Q A;  4Q0I A;  4LFU A;  4MCW A;  1SDE A;  3Q7Z A;  4CLC A;  3W8K A;  4ETZ A;  4OQ0 A;  2JKR M;  1IYS A;  2L0W A;  5GLD A;  1PNE A;  4FD8 A;  4R3A A;  3C2W A;  4YOF A;  3F1P B;  1MWT A;  5CX7 A;  4PKY A;  3VP2 A;  3LYX A;  5BOH A;  5CEB A;  1SKF A;  3SOI A;  3KX0 X;  2EXA A;  2ZC6 B;  4CLC E;  3P09 A;  1OTI A;  5HWW A;  1YLP A;  1MWU A;  3NHQ A;  3TW8 A;  3NDE A;  3QP1 A;  4YWZ A;  3CIT A;  4IVK A;  3SW1 A;  3C7V A;  5FAT A;  3KSF A;  3BY9 A;  5KSC A;  1ESU A;  5EE8 A;  2IWD A;  4WF0 A;  2M7U A;  4KZB A;  3NJA A;  1UGU A;  2OLV A;  3U2A A;  2JKG A;  2W1T A;  2W1T B;  2GDN A;  3BM6 A;  3UDF A;  4CJN A;  1E3U A;  1K54 A;  1M40 A;  1BYW A;  3LUQ A;  4FH2 A;  2BTF P;  1FCM A;  4Y5F A;  3ZGA B;  4JXV A;  2JCH A;  4HJ3 A;  1W7F A;  1XJ4 A;  3QP4 A;  4P87 A;  4KQR A;  2KX6 A;  2ZM2 A;  5EVI A;  3MQO A;  4KUK A;  3PXP A;  1N9O A;  4QWO A;  4IBR A;  5FQQ A;  4X25 A;  3NUL A;  5EVI B;  1N9B A;  3EWK A;  2V8F A;  3BJN A;  5G18 A;  4ESP A;  1KVM A;  4HNB A;  3CAX A;  3VOY A;  4S2P A;  1G5U A;  4M3K A;  4OPQ A;  1VET B;  2H28 A;  4DDY A;  1CF0 A;  2NUT C;  4NXB A;  5HDC A;  1S4S A;  3NOU C;  4IED A;  4S2J A;  3HLB A;  4XUZ A;  2PYP A;  4CQH A;  3PR6 A;  1XPB A;  4GW9 A;  3HUO A;  2Y91 A;  4Q0H A;  1VM1 A;  2C5W B;  3C38 A;  3IF5 A;  3TRC A;  2XFT A;  1SHV A;  3PBO A;  1HTZ A;  2IWC A;  3CPT B;  4Q0J A;  4IVI A;  1YM1 A;  1ES2 A;  3NCK A;  4DE0 A;  2ZQ9 A;  4GKU A;  2WZX A;  1YMX A;  5GLB A;  1L0E A;  3FZC A;  4ZBE A;  4QB8 A;  4UA9 A;  1XJ3 A;  2XGN A;  3MQQ A;  2P9V B;  4K0X A;  4R70 A;  5FEG A;  3E98 A;  2B95 A;  5TBM A;  3MZD A;  4BL2 A;  3PBT A;  3Q81 A;  3T4K A;  3ICY A;  2XFS A;  4E3K A;  3CUE C;  4LEN A;  4E6X A;  4WEJ A;  1TS0 A;  3N8L A;  4N1X A;  4PM8 A;  4NG2 A;  2A2L A;  4X55 A;  2A3U A;  2HP5 A;  4A5R A;  1Z6F A;  4X53 A;  1CJF A;  1ZG4 A;  2V9A A;  3L9K A;  2PBY A;  3P7N A;  2GNX A;  4Y13 A;  2ZL1 B;  3VMA A;  1RGY A;  3S4X A;  4OPZ A;  4K08 A;  2V0U A;  2ZC5 B;  3IWI A;  5DJT A;  2X02 A;  3UPN A;  1ODV A;  4Y0U A;  4DJ3 A;  4K91 A;  3CWF A;  5L09 A;  1XFQ A;  2CC1 A;  3A0S A;  3FWL A;  3E0Y A;  5CER A;  5IT5 A;  1BLP A;  5EOO A;  1PI4 A;  4GOG A;  2ZC4 B;  4EUV A;  3UDX A;  1YSP A;  2WAE A;  3NIA A;  4WUJ A;  1PRQ A;  1G6A A;  3OPR A;  3UY6 A;  4F3L A;  5HSQ A;  5KSH A;  2W3E A;  1LI0 A;  2J9O A;  3DTE A;  1WE4 A;  3MSH A;  3NOT C;  3NC8 A;  1VEU B;  2P7J A;  2R9X A;  4EET B;  2INW A;  4B4X A;  5HDS A;  3H82 B;  5F1G A;  3N8R A;  1K4E A;  1FIL A;  2V8C A;  3FKV A;  5HL1 A;  4DXC A;  5HAQ A;  3NBL A;  2EXB A;  2JHE A;  1P9R A;  3CZD A;  1IYQ A;  2I72 A;  2Y2Q A;  4S2N C;  1HVB A;  5EVL A;  5CTM A;  3OPH A;  2DNS A;  1BT5 A;  3WWX A;  3OLO A;  4GS9 B;  5A93 A;  2E8J A;  1S6R A;  5L10 A;  4Z9Q A;  4R3J A;  4I5S A;  1E25 A;  3BLM A;  1WYB A;  1X0O A;  1E3U D;  4KG5 A;  4PM7 A;  3KO6 A;  5HD5 A;  2PU4 A;  1S4R A;  3NI9 A;  4EES A;  2EX6 A;  2VKS A;  1G68 A;  3C5A A;  2J3W A;  1T1B A;  5GHY A;  3MJQ A;  2R9W A;  3BQ8 A;  4UAA A;  4HBU A;  2RL3 A;  2FZ0 A;  2OWH A;  2Y2M A;  1T1A A;  3T1R A;  3PAG A;  4IHQ A;  4P85 A;  3MXS A;  4JXS A;  3LI8 A;  1MKM A;  1M6K A;  1XJ6 A;  1Y28 A;  3EQV A;  3S7P A;  2ZM0 A;  2HF6 A;  3F1O B;  3N8S A;  2A24 A;  5DF8 A;  3RH8 B;  4QD4 A;  5HW3 A;  1LHY A;  3SH9 A;  2JKT I;  1TS8 A;  2G7U A;  5FQK A;  1T1C A;  1F2K A;  3T4J A;  4HJ6 A;  1S1Y A;  1YMS A;  2D02 A;  4JF5 A;  4PAU A;  1EW0 A;  1MKI A;  1YLW A;  1FOF A;  4BBU A;  3FPW A;  3B42 A;  2ZC7 A;  2XLN A;  4JPM A;  5HAI A;  3CLO A;  3LIE A;  5HL6 A;  2DMW A;  5FEF A;  2E8I A;  2Z2L B;  4EBP A;  2H5S A;  4EU0 A;  4H6J B;  5MC7 A;  4N9L A;  4E3L A;  4KZ9 A;  4RX2 A;  4FSF A;  4C75 A;  4EBL A;  2VA0 A;  1FSW A;  3HLC A;  4WLA A;  4MNR A;  3EOI A;  2XRN A;  5EVI D;  5HPF A;  5AJG A;  3WRT A;  3E4P A;  2Y2J A;  4N92 A;  1AXB A;  3IXB A;  2D01 A;  5L07 A;  5I5L A;  1L0G A;  2Y2L A;  5FQI A;  4B93 A;  1D7E A;  2Z6D A;  3V67 A;  2J3T D;  3ZG9 B;  4EBN A;  3IXH A;  4KG2 A;  4KZ6 A;  4F3L B;  1O7E A;  4QJG A;  2BAS A;  4XT2 A;  2EFU A;  1QMF A;  3HLE A;  5E2G A;  1KE3 A;  3UB6 A;  3VV4 A;  3V3R A;  1J9M A;  3D4F A;  4DE1 A;  4NXF A;  2ZBB A;  4PPR A;  3IHA A;  3GDI A;  5FI7 A;  2JKR I;  1MWR A;  1ACF A;  4LRY C;  2K2N A;  5EVI C;  3VE3 A;  4X1M A;  1VEU A;  3LR5 A;  1Z09 A;  2LB5 A;  1IKG A;  3V50 A;  2Y2G A;  4Y7P A;  2VLG A;  2PBD P;  2HP9 A;  1YKD A;  2K7S A;  2WYX A;  1DP9 A;  4CLC D;  4I3A A;  3QP5 A;  4S2I A;  3W4P A;  1VET A;  3F1O A;  2A24 B;  5FDH A;  3JVU A;  3PBN A;  2QJ7 A;  4S2L A;  4X69 A;  3O3V A;  1EI5 A;  2ZQA A;  2C6W B;  3GRJ A;  2KLI A;  1FCN A;  3OCL A;  4WEK A;  3LID A;  3V3S A;  3ITA A;  2WKR A;  3O86 A;  4IUH A;  1OME A;  1BLC A;  3HL9 A;  4GD6 A;  2J3T C;  3ZYT A;  3GVB A;  5CHM A;  4HJ4 A;  3H7W B;  3OOV A;  2QPN A;  1G6O A;  3K3C A;  3LR4 A;  2QKP A;  3LIC A;  2VX8 A;  1YAX A;  1YQS A;  3PYP A;  5U47 A;  1K38 A;  5DTS A;  4PHT A;  1QME A;  3P98 A;  4O7D A;  3B33 A;  2WUQ A;  1IYP A;  2XK1 A;  2VGL M;  1O07 A;  2EX8 A;  5KIZ A;  1G28 A;  1E4D A;  4EQ1 A;  1LL9 A;  3OPP A;  3IQA A;  3T50 A;  3MF0 A;  4ZRR A;  3GTC A;  3HCY A;  2ZM8 A;  4U3T A;  1Y4O A;  2VJW A;  3FPV A;  3TSG A;  4DF6 A;  3N6I A;  5FAP A;  1SKO A;  3IWO A;  3BEC A;  5FAQ A;  5A90 A;  1TVF A;  4R4R A;  5GL9 A;  2P74 A;  5J3W A;  1ESI A;  2ZQD A;  4GN2 A;  3IBJ A;  3T1Q B;  1W8Q A;  4HH3 A;  5TJJ A;  4P6Z M;  2FFY A;  2O9C A;  1NYY A;  2XD1 A;  1PW8 A;  2VV8 A;  4WMC D;  1BLS A;  3FC7 A;  2Z6C A;  1HZO A;  4JXG A;  4U0T A;  4RX3 A;  5D3O A;  3DWZ A;  3S1Y A;  3K2N A;  2QYB A;  1GHI A;  1GSW A;  4HY8 A;  1JWZ A;  1BTL A;  1XA7 A;  2M7V A;  2P9V A;  3SS3 A;  3CJM A;  2DRW A;  1LLB A;  3W4O A;  2DCF A;  1WYC A;  4MN6 A;  2PU2 A;  4OLD A;  5F1F A;  3F1N B;  2W27 A;  4Y2F A;  4OKP A;  1K57 C;  1L0D A;  3UMD A;  2VGJ A;  3KYE A;  2WZZ A;  1GA9 A;  2ZC3 B;  3W2Z A;  4O01 A;  1K4F A;  3BQA A;  4MEZ A;  2HPB A;  4BQM A;  3FKW A;  5HWV A;  2VV7 A;  4HP4 A;  1OT9 A;  1JNU A;  2EX2 A;  3RTY A;  2GX5 A;  3UME A;  2EWV A;  4NXE A;  2W3H A;  1N4O A;  2GJ3 A;  4QPR A;  2HJ9 C;  5FL3 A;  3TE8 A;  4LGW A;  4E3M A;  4KQD A;  1MPL A;  1BLH A;  3BEB A;  2KOI A;  3RJU A;  4NEE D;  3LR0 A;  1H8Z A;  3VP3 A;  5FSR A;  3LI9 A;  1XXM A;  2ZJ9 A;  4JLF A;  3OZH A;  2L1M A;  3UB9 A;  3VE4 A;  4Y0T A;  2P08 A;  5HZH A;  1GSX A;  3JYI A;  4MBK A;  5C5K A;  2HDR A;  5FI2 A;  1LSX A;  5DTT A;  2X71 A;  4XXR A;  2PHY A;  5GLC A;  2PT7 A;  2OSU A;  1MBL A;  4GCZ A;  5KZH A;  3IXD A;  4HEF A;  4ID4 A;  2W3D A;  1T19 A;  3UDI A;  5AVF A;  2Y2O A;  1CI8 A;  4WZ5 C;  4ZTK A;  1ES4 A;  2UV0 E;  4ZJ3 A;  3VSK A;  2H10 A;  5FAS A;  2LB9 A;  4EWF A;  3V39 A;  4NET A;  3EGD C;  5FAO A;  3A3I A;  3WS1 A;  2GZA A;  5F68 A;  3ZG8 B;  3WS2 A;  4L9F A;  5G4Z A;  2EX9 A;  4NKP A;  4OPY A;  1IYO A;  5J4E A;  1YLT A;  4C3Q A;  4FCF A;  3OCN A;  2QZ6 A;  2VZW A;  1RCJ A;  4C6Y A;  2EWW A;  1HD8 A;  3C8C A;  4ETX A;  3DTM A;  4EUZ A;  1KVL A;  1TEM A;  2OOL A;  5DKK A;  1ERO A;  3A0V A;  3C4O A;  5EFW A;  3LR3 A;  2H0T A;  3HJK A;  3LIB A;  4ARZ B;  5E43 A;  4QHC A;  1NRJ A;  1H5X A;  1JVJ A;  4YFM A;  3FG8 A;  2QJ5 A;  2HZ5 A;  5EOE A;  1W5D A;  1H3Q A;  3TG9 A;  4XT2 B;  3BY8 A;  2YKH A;  1BUL A;  3ZG7 B;  4KZ5 A;  5TGF A;  3D9Y A;  4HBT A;  1MWS A;  3HLG A;  4PM6 A;  3B3X A;  1ONH A;  3MXQ A;  2FFF B;  1ES5 A;  1DJC A;  3DTK A;  1U60 A;  4BWI A;  5E2H A;  4O0P A;  5TBM B;  4JBF A;  2WGW B;  1I2S A;  1NLY A;  3EEH A;  3ULF A;  5DFY A;  3ZVT A;  3M6H A;  5CGS A;  3LGO A;  3Q1F A;  5FQJ A;  4GB7 A;  1YLJ A;  5EPH A;  1LSV A;  3LO7 A;  4E3N A;  5LBR A;  3MKE A;  4KUO A;  4UA7 A;  4BD0 A;  1S67 L;  5HAR A;  2Z2M B;  2Y2H A;  3MFD A;  5F82 A;  1IKI A;  2R78 A;  2ZD8 A;  4B9O A;  1RP5 A;  3ZHH A;  3IX4 A;  4GDN A;  1YLY A;  1KE4 A;  3CI6 A;  2WAD A;  5F5Y A;  3DWK A;  3V5M A;  4ZAM A;  3SS4 A;  1PWD A;  4G3W A;  2PD8 A;  3E2K A;  2OAQ 1;  3T1X A;  4B88 A;  4N9K A;  1H0M A;  3D72 A;  2ZMV A;  5M19 A;  5CRF A;  4CLC C;  4RYE A;  3M2K A;  1VQQ A;  3WS0 A;  4OP8 A;  2Y2P A;  3UE1 A;  3AGD A;  1N9L A;  2G2W A;  3DTI A;  4GS9 A;  4F94 A;  4DJ2 A;  2PRF A;  5FDS A;  3OBF A;  4WZ5 A;  3T12 B;  4MN5 A;  4KZ3 A;  4IBX A;  3IF6 A;  2HDQ A;  4GDB A;  3UB5 P;  4WN5 A;  2BLS A;  5E2E A;  2UWX A;  4P0M A;  2YKF A;  3QHY A;  1OTD A;  3GSG A;  1K0K A;  1DRM A;  5CGX A;  1NXY A;  4B4Z A;  3UE3 A;  3G2Y A;  4QY6 A;  1KDS A;  3A3D A;  4WBG A;  4DN0 A;  1K56 A;  4O8G A;  4Y3I A;  1CI9 A;  1LL5 A;  3WRZ A;  5K5B A;  4D60 A;  5HDD A;  5CHU A;  4ZDX A;  1CQA A;  1TD5 A;  4ME4 A;  4BLM A;  3ZVW A;  1ALQ A;  2PR6 A;  3GR2 A;  3KYQ A;  2HGV A;  3T4S A;  1F9I A;  3PTE A;  3ZFZ A;  1XGI A;  3MFX A;  5FA7 A;  4PMA A;  4L9G A;  4HHD A;  4OH0 A;  1WA9 A;  4FUW A;  3TJZ C;  3ZNY A;  4X68 A;  4MMN A;  3KSI A;  3LY3 A;  2V1B A;  1KE0 A;  1FQG A;  4EW7 A;  3H7W A;  5FQM A;  1CK3 A;  4MLL A;  1TF1 A;  4LRZ E;  1KGF A;  4UEY A;  3AGE A;  2QHK A;  4BJP A;  3MR0 A;  3BWL A;  3T4Q A;  1MZU A;  5GHX A;  4R1G A;  3RFB A;  1ERM A;  3GQZ A;  3VFF A;  1UWP X;  4X6T A;  1UWN X;  3HLF A;  3IX3 A;  4RVA A;  4I38 A;  3D3O A;  1KOU A;  4WMC A;  2WGI A; 
#chains in the Genus database with same CATH homology
 2V0U A;  1LL8 A;  5DJT A;  4IUK A;  1ZTU A;  1ODV A;  4DMZ A;  4DJ3 A;  1LSW A;  4MN6 A;  3CWF A;  1XFQ A;  3F1N B;  4WEL A;  2W27 A;  4Y2F A;  2VV6 A;  3UMD A;  2JKT M;  3A0S A;  2ZOI A;  1NLZ A;  3E0Y A;  4NXG A;  3UB8 A;  2L4R A;  5IT5 A;  3VOL A;  4PKY G;  3W2Z A;  2Y79 A;  3R4K A;  4O01 A;  2MJ6 A;  3BQA A;  4EUV A;  2M1C A;  1YSP A;  4GJ4 A;  1VHM A;  5HWV A;  2VV7 A;  4HP4 A;  4WUJ A;  2IA2 A;  1OT9 A;  1JNU A;  3RTY A;  1W63 M;  2GX5 A;  2WKQ A;  3UME A;  2EWV A;  4F3L A;  4NXE A;  5HSQ A;  5KSH A;  3LIF A;  2W3E A;  1TS7 A;  2W3H A;  2GJ3 A;  2B02 A;  4QPR A;  2I9V A;  3NOT C;  2HJ9 C;  5FL3 A;  1P9W A;  3F1P A;  3TE8 A;  3G6O A;  1F5M A;  4KQD A;  4UQI M;  5HD3 A;  2P7J A;  4EET B;  2INW A;  4EER A;  5HDS A;  3H82 B;  4G3V A;  4G3K A;  3UB7 A;  2KOI A;  3KSH A;  5F69 A;  4NEE D;  3EGX C;  3LR0 A;  2ZOH A;  3LI9 A;  1OPX A;  3A0R A;  2JHE A;  1P9R A;  3LIA A;  2PD7 A;  1W63 Q;  4FOF A;  4EXO A;  2L1M A;  3UB9 A;  3VE4 A;  2P08 A;  3H82 A;  5HZH A;  1GSX A;  3OLO A;  4GS9 B;  5C5K A;  3OC2 A;  1LSX A;  3GEC A;  4IJG A;  4I5S A;  1P0Z A;  1OTB A;  4JGR A;  2PHY A;  5AVE A;  2PT7 A;  1X0O A;  4L0L A;  3T4O A;  4GCZ A;  3KO6 A;  5HD5 A;  4EEU A;  1S4R A;  4EES A;  2VKS A;  3JVV A;  2W3D A;  1T19 A;  2J3W A;  5AVF A;  1T1B A;  3MJQ A;  4BBV A;  4HP9 A;  3BQ8 A;  4OOL A;  4E04 A;  2FZ0 A;  2O9B A;  1P97 A;  2OWH A;  3B47 A;  3P01 A;  2LB9 A;  1T1A A;  3BW6 A;  4HI4 A;  4IHQ A;  3EGD C;  3NOP C;  2XA7 M;  3LI8 A;  1MKM A;  1IOU A;  1XJ6 A;  1Y28 A;  3EQV A;  4BMW A;  1TS6 A;  3S7P A;  2HF6 A;  2GZA A;  3F1O B;  5F68 A;  2A24 A;  4HH2 A;  3RH8 B;  5DF9 A;  2JKT I;  4L9F A;  2Y8H A;  3C30 A;  4MDZ A;  2XA7 S;  2O99 A;  5G4Z A;  1TS8 A;  2G7U A;  4I39 A;  3MQ0 A;  4NKP A;  1T1C A;  1D06 A;  3T4J A;  3DBA A;  5J4E A;  3CUE A;  4YNR A;  4HJ6 A;  3PBQ A;  5DKL A;  1S1Y A;  2D02 A;  4JGO A;  3OCN A;  2ZMF A;  4PAU A;  2OWJ A;  2VZW A;  1EW0 A;  2WKP A;  5A8B A;  3KSG A;  2JN7 A;  3LFV A;  2EWW A;  3C8C A;  4ETX A;  4H6J A;  4BBU A;  5IS1 A;  3FPW A;  3B42 A;  3KYZ A;  2PYR A;  2VGL S;  2OOL A;  5DKK A;  1STZ A;  3A0V A;  5EFW A;  1OJ5 A;  3LR3 A;  3CLO A;  3HJK A;  3LIE A;  1XFN A;  2B18 A;  5HL6 A;  2DMW A;  3LIB A;  4UQI S;  4ARZ B;  2QWS A;  3MMH A;  4GHI B;  3E4O A;  3ZQ5 A;  1NRJ A;  2O9A A;  5DFX A;  1DP8 A;  4EU0 A;  2FH5 A;  4H6J B;  5MC7 A;  3H9W A;  2XRO A;  3FG8 A;  2QJ5 A;  3IBR A;  4L9E A;  1F98 A;  1T18 A;  1H3Q A;  1OT6 A;  4R6L A;  4XT2 B;  4FSF A;  3UE6 A;  3BY8 A;  4EEP A;  4II7 A;  4HIA A;  2YKH A;  2VA0 A;  4ARZ A;  1DP6 A;  4WLA A;  3EOI A;  2XRN A;  5HPF A;  5AJG A;  3E4P A;  4M4X A;  2XSS A;  1IFQ A;  2D01 A;  1H8M A;  4HOI A;  2NUP C;  1OJG A;  2O0Y A;  4JGQ A;  3MXQ A;  2PR5 A;  1YSQ A;  5G4Y A;  3S7O A;  5I5L A;  3IS2 B;  4Z1W A;  3S7N A;  4B93 A;  2K31 A;  3E4Q A;  1D7E A;  2Z6D A;  3V67 A;  4BWI A;  2J3T D;  4O0P A;  1OTA A;  2W3G A;  5TBM B;  4Q0I A;  4MCW A;  3EEH A;  1NLY A;  3ULF A;  4CLC A;  5DFY A;  4F3L B;  4ETZ A;  2W3F A;  2CMN A;  2BAS A;  2JKR M;  4XT2 A;  2L0W A;  4R3A A;  3T4L A;  3C2W A;  2HV1 A;  3UB6 A;  4YOF A;  3F1P B;  3VV4 A;  5CX7 A;  4PKY A;  1LSV A;  3HJI A;  3LYX A;  5LBR A;  4KUO A;  4BBT A;  1S67 L;  1OTE A;  4NXF A;  2ZBB A;  3KX0 X;  5DJU A;  2R78 A;  4B9O A;  3GDI A;  1S1Z A;  2JKR I;  4CLC E;  2P04 A;  2V0W A;  4LRY C;  2K2N A;  1OTI A;  3VE3 A;  5HWW A;  3CI6 A;  3NHQ A;  5F5Y A;  3LR5 A;  2LB5 A;  3TW8 A;  1N9N A;  1V9Y A;  5L8M A;  4YWZ A;  2W0N A;  3CIT A;  2VLG A;  3SW1 A;  3KSF A;  4G3W A;  1YKD A;  2K7S A;  3BY9 A;  2PD8 A;  4R38 A;  2OAQ 1;  2HJE A;  1NWZ A;  1S66 L;  2M7U A;  4WF0 A;  4CLC B;  3NJA A;  1UGU A;  1DP9 A;  3U2A A;  1V9Z A;  3D72 A;  3EEA A;  4CLC D;  2V1A A;  4I3A A;  2ZMV A;  4RQ9 A;  2W1T A;  3F1O A;  2A24 B;  2W1T B;  4I3J A;  4KQO A;  4CLC C;  4AFI A;  3JVU A;  3PBR A;  3PBN A;  1BYW A;  2QJ7 A;  3LUQ A;  4WL9 A;  2PDR A;  1N9L A;  4Y5F A;  4LPZ A;  4HJ3 A;  4P6Z S;  1XJ4 A;  5J7E A;  4GS9 A;  2KLI A;  4DJ2 A;  2KX6 A;  3MQO A;  3OBF A;  3OCL A;  4KUK A;  4WEK A;  3LID A;  3PXP A;  1N9O A;  4MN5 A;  4MN7 A;  3EWK A;  3BJN A;  2WKR A;  1MC0 A;  4IUH A;  1XJ2 A;  4HNB A;  3CAX A;  4OOM A;  2J3T C;  4WN5 A;  1ZHH B;  3ZYT A;  4HJ4 A;  3H7W B;  3OOV A;  2YKF A;  1OTD A;  2H28 A;  1G6O A;  3K3C A;  3LR4 A;  1DRM A;  2NUT C;  4NXB A;  5HDC A;  1S4S A;  3O5Y A;  2QKP A;  3LIC A;  3NOU C;  2PYP A;  4CQH A;  2VX8 A;  3PR6 A;  1YAX A;  3UE3 A;  3EQU A;  3PYP A;  4GW9 A;  5HWT A;  4PHT A;  4Q0H A;  3B33 A;  3C38 A;  3TRC A;  5HPI A;  5IU1 A;  4DN0 A;  2J80 A;  2VGL M;  3PBO A;  4O8G A;  4Y3I A;  5F6A A;  3IS2 A;  5KIZ A;  1G28 A;  1VB6 A;  4I3I A;  4EQ1 A;  5K5B A;  5HDD A;  4Q0J A;  3T50 A;  3MF0 A;  4ZRR A;  3HCY A;  1TD5 A;  4LLO B;  4ME4 A;  2VJW A;  2PR6 A;  3FPV A;  3KYQ A;  2HGV A;  3T4S A;  1F9I A;  2W1R A;  3MFX A;  2KDK A;  2OAP 1;  1XJ3 A;  4L9G A;  3MQQ A;  4R70 A;  4HHD A;  1WA9 A;  3R7W A;  3PHY A;  4GHI A;  3TJZ C;  3R7W B;  3E98 A;  4MMN A;  5TBM A;  3KSI A;  3S7Q A;  4LRX C;  2V1B A;  3PBT A;  3K3D A;  3T4K A;  5J3W A;  3ICY A;  4EW7 A;  3H7W A;  1LT0 A;  2EA9 A;  3T4T A;  3CUE C;  3IBJ A;  1TF1 A;  2VEA A;  4HH3 A;  4WEJ A;  1TS0 A;  5TJJ A;  4P6Z M;  4LRZ E;  4UEY A;  2O9C A;  2QHK A;  1GSV A;  4BJP A;  3MR0 A;  2VV8 A;  3BWL A;  3FC7 A;  2A2L A;  2Z6C A;  3T4Q A;  1MZU A;  3PBS A;  3F1N A;  3RFB A;  2V9A A;  3K2N A;  2QYB A;  1UWP X;  4HQA A;  3P7N A;  2GNX A;  1GSW A;  1UWN X;  4GLQ A;  4HY8 A;  4I38 A;  4JGP A;  3D3O A;  1KOU A;  4K08 A;  2M7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...