3H9WA

Crystal structure of the n-terminal domain of diguanylate cyclase with pas/pac sensor (maqu_2914) from marinobacter aquaeolei, northeast structural genomics consortium target mqr66c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
KAIPWKINWQTMAFEYIGPQIEALLGWPQGSWKSVEDWATRMHPEDQEWVVNFCVKQSECGVDHEADYRALHRDGHYVWIRDVVHVVRDDSGEVEALIGFMFDISLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diguanylate cyclase with PAS/PAC sensor
publication title Northeast Structural Genomics Consortium Target MqR66C
rcsb
source organism Marinobacter aquaeolei
molecule tags Structural genomics, unknown function
total genus 30
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h9wA00
4HJ3A 2QJ7A 4NXFA 4LRXC 1S1ZA 2PD8A 4GHIA 2OOLA 1TS0A 1XJ6A 4PKYG 5HD5A 1TS6A 3D72A 3MQOA 3RH8B 2ZBBA 1DP9A 4HJ6A 3IS2B 4I39A 3E4QA 2VV8A 3NHQA 2BASA 3GECA 3UMDA 2V0UA 4BBVA 5G4ZA 4K08A 5IU1A 3MJQA 3F1OB 5DJTA 2QWSA 3H7WB 4WN5A 4L9EA 3F1PA 4WLAA 2INWA 1GSVA 1LSVA 3EWKA 4YWZA 2P7JA 5TBMA 4GS9B 4HNBA 2V0WA 4F3LB 2D01A 3ZQ5A 1T1AA 1XJ4A 3LIDA 2PD7A 3NJAA 1DP6A 2ZOHA 4HH3A 4MN5A 5F69A 4EESA 1T18A 3B33A 5G4YA 3SW1A 3EEHA 3UB8A 2PHYA 4EW7A 4HQAA 5F68A 1XJ2A 5IS1A 2M1CA 4H6JB 1LSWA 5F5YA 4RQ9A 3K3DA 1OT9A 2PYPA 3LIAA 3LIBA 4HP9A 3LUQA 1LT0A 3PYPA 2YKHA 3VE3A 2W27A 4LRYC 1OTDA 2Z6DA 4B9OA 3IS2A 2JN7A 1NWZA 3H82B 5HDSA 1S67L 1OT6A 2OWJA 1V9ZA 2ZOIA 2L1MA 2R78A 3LI9A 5J7EA 4R70A 4WL9A 2H28A 3UB6A 3BY8A 1X0OA 3BWLA 5HWTA 3H7WA 5A8BA 2VV6A 2I9VA 1G28A 4GS9A 4F3LA 5HWWA 4HH2A 1F98A 5HDDA 4L9GA 1UWNX 3G6OA 4BBUA 2EA9A 3H9WA 4KUKA 4KQDA 1TS8A 1N9OA 1N9LA 3VOLA 3NOUC 4I3JA 3IBRA 4BBTA 3LICA 1P97A 1XFQA 2W0NA 5HZHA 1F9IA 1D7EA 4H6JA 3T50A 5DJUA 3F1NB 2QKPA 1WA9A 3RTYA 5HDCA 4DJ3A 4LRZE 2Z6CA 5J4EA 1GSXA 4LPZA 1P0ZA 4JGRA 1LL8A 3LIFA 4EETB 2J80A 3H82A 4XT2B 2VLGA 1KOUA 3VE4A 3NOTC 4HY8A 2PR6A 1MZUA 3LI8A 4PKYA 2GJ3A 3C8CA 2QHKA 3NOPC 4MN6A 5AVEA 4HHDA 2CMNA 5KIZA 3E4OA 1TS7A 3ULFA 2V1AA 3P7NA 1D06A 3MQQA 1JNUA 1N9NA 5J3WA 4GCZA 1S1YA 4I38A 1T1CA 1EW0A 4DJ2A 1DRMA 3F1OA 1XFNA 3FG8A 4M4XA 5AVFA 4JGOA 3F1NA 2QJ5A 5DKLA 1UGUA 2YKFA 3UMEA 2V9AA 1OTIA 3MXQA 3FC7A 2D02A 3CLOA 2V1BA 4GW9A 2JHEA 1S4SA 1ODVA 1DP8A 4XT2A 3A0RA 2OWHA 3HJKA 4JGPA 3GDIA 3ICYA 4LLOB 1VB6A 2K7SA 4EQ1A 1UWPX 4JGQA 5HD3A 3UE6A 2A24B 2B02A 2L0WA 3E4PA 1S4RA 4HJ4A 1OTBA 1GSWA 3BY9A 2VV7A 3CAXA 5HWVA 4WUJA 3LIEA 4GHIB 3A0SA 3A0VA 2HV1A 1OTEA 1OJGA 1LSXA 4I3AA 5DKKA 4R6LA 1OJ5A 2PDRA 3C2WA 3HJIA 2PR5A 3LYXA 3CWFA 5F6AA 4HI4A 2VEAA 2L4RA 3UB7A 3PHYA 1XJ3A 3KX0X 4L9FA 4NXBA 1T19A 1S66L 3OLOA 2PYRA 1T1BA 2KX6A 5HSQA 3F1PB 3MR0A 4I3IA 4EERA 4HOIA 5EFWA 5I5LA 4EEPA 5TBMB 3UB9A 4HIAA 4R3AA 4EXOA 1OTAA 4E04A 4HP4A 1Y28A 2WKRA 4KUOA 4NXEA 4EEUA 2WKPA 1BYWA 4WF0A 2A24A 1V9YA 4I5SA 4R38A 2WKQA 3K3CA 2KDKA 3MFXA 4NXGA
chains in the Genus database with same CATH superfamily
4HJ3A 1MBLA 1Q2PA 4EBNA 4RX2A 4LRXC 3MKEA 1TDGA 2XF3A 3T4JA 2WKHA 3FPWA 3ZG8B 1XJ6A 2VA0A 4ETXA 4LGWA 5HD5A 5EVID 3MQOA 1HLUP 3C5AA 4CQHA 1CQAA 2FFYA 2VZWA 4KZ8A 3RH8B 5F1FA 3IWIA 1BLSA 3TJZC 3V67A 3IS2B 3E4QA 5TFQA 2ZM8A 1JWPA 2BASA 3FZCA 5FQIA 4R4SA 2ZQDA 1YLZA 4BLMA 4K08A 4OOMA 1FILA 2ACGA 2EX2A 2ZC3B 3F1OB 4BD1A 5DJTA 2QWSA 1BULA 1GA0A 3IX3A 5HAIA 4WN5A 1ERQA 1W63M 4PM8A 4QWOA 2INWA 3DTEA 4MMNA 4P87A 2V1ZA 1STZA 2P7JA 5TBMA 2V0WA 4UA6A 3MS6A 2JKRM 1XJ4A 2PD7A 1DP6A 2ZOHA 3G31A 2BG1A 4X55A 3T4OA 3IXBA 4WZ5A 3QP5A 1T18A 5CHUA 2HJEA 1I2SA 1PZOA 2OAQ1 4PPRA 5E2HA 3W4OA 3HLEA 1L0EA 5CECA 4H6JB 1LSWA 2XGNA 3EEAA 3M6HA 3DW0A 4ARZA 4EBPA 4IHQA 3PYPA 2YKHA 4EWFA 2W27A 1KGFA 3T1QB 5CGSA 4LRYC 3OCLA 2KOIA 2Y2NA 4UHUA 4Y5FA 2P08A 1S67L 1LL5A 4G3KA 4ZDXA 1V9ZA 1EWZA 2L1MA 4EU0A 1FR6A 4P85A 2R78A 3CITA 2G2UA 3A3EA 4L0LA 3VSLA 2HP6A 1NJ4A 1X0OA 3BWLA 4PM9A 5EVLA 2VV6A 4Q0HA 4WBGA 1S0WA 1YAXA 5KMWA 4C75A 4GS9A 2HDRA 3OCNA 5JYPA 3Q07A 3S7NA 5HDDA 2J9OA 4L9GA 4OONA 1E4DA 3LY4A 5DF9A 3H9WA 2H5SA 1TVFA 1L2SA 4KQDA 5FQKA 2H0TA 3OZHA 2A3UA 2ZM2A 3IF5A 1GHIA 4I3JA 2MJ6A 2M7UA 3LICA 2FH5A 1XPBA 1L3LA 1IYQA 4S2JA 1D7EA 4DDSA 5CX7A 2XQZA 5DTSA 4Q0JA 1PZPA 2ZLYA 1WA9A 1NY0A 1KDWA 5U47A 2VJWA 2Z6CA 4X1MA 4E3LA 4YFMA 4LV3A 1GSXA 1MKIA 2ZMAA 5DF8A 2HPBA 2J80A 3ISGA 1RGZA 4ZTKA 3HLCA 3VE4A 4MNRA 3LI8A 4PKYA 3R4KA 2GJ3A 4FD8A 1NYMA 5AQ7A 4CLCE 1G6AA 5AQBA 3BFDA 4MN6A 2ZQ9A 5AVEA 2HDUA 3RJUA 1W63Q 3VP0A 3VV4A 4CPKA 4HBUA 2X71A 4IVKA 3ZVWA 3KSGA 3ULFA 4FTXA 3ZGAB 4IUKA 3VP3A 3P7NA 1N9NA 5EV0A 3E98A 4GCZA 3JVUA 1SDNA 3HUOA 4R3BA 1S1YA 4I38A 2XK1A 3C4OA 3MQ0A 1EW0A 4DJ2A 4OP8A 3P98A 4YOFA 3UE3A 1Z6FA 2RL3A 3FWLA 3UB5P 4CLCC 3F1NA 5KSHA 1RP5A 4WM9A 2OLUA 2EXAA 3FC7A 2D02A 4BWIA 4RVAA 3HREA 5EUAA 4LV0A 2Z2LB 1PWCA 2W3GA 4JKTA 3PBRA 5E2FA 3LGOA 1ZHHB 1DY6A 4FOFA 2IWDA 2OLVA 1P9RA 1K38A 4GLQA 4JF4A 1UWPX 3Q7VA 1MKMA 3OC2A 5KZHA 4Y2FA 1W5DA 2G2WA 1BT5A 1Y54A 2BTFP 3MXSA 1FCOA 3WS2A 1GSWA 3T1RA 2VV7A 1ACFA 2IWCA 2W3EA 3LIEA 4GHIB 1LHYA 2HV1A 2XH9A 1OTEA 3ZNYA 1K4EA 3IF6A 3O88A 1YLTA 4QY5A 4KZ3A 1PWGA 4I3AA 1PNEA 5DKKA 4S2KA 4N9KA 1OJ5A 3K2NA 4DE0A 3C2WA 3HJIA 1BLCA 3LYXA 2WK0A 5CTNA 2VEAA 1JWVA 2ZQCA 5DF7A 2J9PA 2ZQ7A 4PM5A 3TW8A 4PMAA 4NXBA 1T19A 2ZC6B 1T1BA 4Q8IA 4GDNA 3G32A 5EFWA 2Y2PA 5I5LA 5GL9A 4Y0OA 2PU4A 1NXYA 3OOVA 4UQIM 4EEPA 4YNRA 1YM1A 3HVFA 4EXOA 2HZ5A 1OTAA 5HW3A 4WELA 4S2MA 1Y28A 2WKRA 3G2ZA 1PFLA 2A49A 4NXEA 1BYWA 3OPRA 2J8YA 3EGXC 4BENA 2P04A 2Y2LA 3P09A 4NXFA 4AFIA 2PD8A 3VMAA 4Q0IA 4FH2A 4KZAA 3UE0A 4CLCA 1H8YA 2DNSA 4PKYG 1TS6A 3IH9A 2B18A 5HPIA 4I39A 1NRJA 4OVDA 5A92A 2V8FA 3MFDA 1OMEA 3VP1A 2VV8A 3UN7A 1ZKJA 1EI5A 4GN2A 5M1AA 1SKFA 2V0UA 4BBVA 3WS0A 1G68A 2EWWA 2Y59A 2AVXA 3VP2A 3GRJA 2C5WB 4DMZA 2WGWB 2FFFB 4MBFA 3WWXA 2B5RA 3CPTA 4WZ5C 1LSVA 1OPXA 5DTTA 1VEUB 4YWZA 1PI5A 4ZJ2A 5FSRA 1I5QA 4H8RA 4F3LB 2D01A 1T1AA 4E6XA 3NJAA 1S6RA 3HLBA 4PHTA 5HFOA 4X1LA 1NLYA 2JKTM 3QNCA 4MN5A 2VGLM 3W4QA 5G4YA 3HLFA 3UB8A 4Y17A 3PR6A 4UAAA 4E3JA 4R3JA 3BW6A 3BJNA 1K4FA 3GMWA 3BQAA 4EW7A 3HLGA 5F68A 4RQ9A 3R7WA 1ESIA 1MPLA 2IA2A 4XUXA 3G2YA 4GD8A 2OV5A 4WYYA 4GJ4A 1LT0A 5D3OA 2UV0E 4JBFA 1N9BA 1OTDA 4WMCA 1ZC2A 4E3OA 2OWJA 2E8JA 1FQGA 1IELA 4K91A 5DTKA 4S2LA 2ZOIA 4EBLA 2PRFA 2O9BA 4EUZA 4KZBA 3UPOA 3MZEA 3E2LA 2H28A 3UB6A 4BL3A 4IEDA 3H7WA 4D60A 5EE8A 5A8BA 1G28A 3A3FA 5HWWA 1UWNX 3T4SA 2EA9A 2W3DA 3A3IA 3UDFA 1XGJA 4GZBA 1N9OA 4GB7A 3IBRA 4JLFA 4RYEA 3DWZA 3WRZA 4P6ZS 3B42A 2W0NA 4K0WA 5CRFA 3T50A 4U3TA 2WADA 2ZM0A 3O86A 5FQQA 2QKPA 2QPNA 1NZOA 2EWVA 3Q7ZA 3RTYA 5HDCA 1Y4OA 3FPVA 4LRZE 5J4EA 3IHAA 4A5RA 2X02A 2HP9A 1IYPA 1PW8A 3SH7A 5EVIC 2ZMFA 3LIFA 4EETB 1YKDA 3H82A 4BJPA 2HP5A 1KOUA 3M2KA 2GNXA 3D9YA 2PR6A 4GOGA 3EQUA 2P74A 3C8CA 5GLAA 2CC1A 2WGIA 4LENA 2JC7A 5HAQA 5FA7A 2X01A 3UDXA 3E0YA 1KGGA 1JVJA 2ZL1B 3KSFA 1W8YA 3WRTA 3B47A 4OOLA 3ZDJA 1K57C 1E25A 3A3JA 1HZOA 5J3WA 1GCEA 4LFUA 4PAUA 5L07A 5CTMA 4ME4A 3D4FA 3FG8A 5L8MA 4JF6A 3N4IA 4S2NC 4M4XA 5E2EA 3MZFA 5AVFA 2QJ5A 5DKLA 1UGUA 4KZ9A 2YKFA 2V9AA 1OTIA 3N8LA 1XP4A 5EOEA 1F5MA 4MDZA 2ZC5B 1DJCA 2V1BA 2Q0OA 2XA7S 3G34A 4GW9A 4U0TA 5LBRA 1FSYA 2JHEA 4WZ4A 2XSSA 3G35A 5EM0A 1DP8A 1LLBA 3VSKA 4XT2A 2LB9A 3UO9A 2OWHA 1WYCA 2JKRI 3GDIA 3CZDA 1SKOB 1YLPA 5AQ9A 4LLOB 3MBZA 2K7SA 4OQHA 2M7VA 1L0DA 4JGQA 3UE6A 2ZC7A 2XFTA 2B02A 3E4PA 1AWIA 3IF6C 1XX2A 4HJ4A 2I72A 1OTBA 4X53A 1G5UA 3AGFA 5TGFA 1NLZA 1FR1A 1YSQA 4WUJA 1EROA 4IVIA 4OPRA 3A0SA 3A0VA 3ZCZA 5AQAA 1W7FA 5I94A 4OOYA 4X25A 3UE1A 3NDEA 2GDNA 1K55A 4ZJ1A 1J9MA 3CI6A 3BRMA 5EM1A 1RCJA 5F1GA 4S2OA 3V3SA 3IXGA 4R6LA 3BFGA 4N1HA 3SOIA 1H0MA 3T4TA 3T1XA 5EVIA 4S2IA 5FATA 2PR5A 2ZD8A 3VFFA 1FCMA 3BEBA 4LV1A 4FUWA 3MF0A 3U4LP 3GVBA 4ZRRA 2Y2MA 2L4RA 4KZ7A 3HCYA 3OPLA 2HF6A 3KX0X 4OP5A 3KSIA 2WZXA 4WEKA 1NRFA 2HJ9C 1S66L 3OLOA 2PYRA 3IQAA 3PAEA 3IXDA 1K0KA 4EERA 4HOIA 3N7WA 3PAGA 4EUVA 2WGVA 1PW1A 5FI6A 3MZDA 5TBMB 3G4PA 1ES5A 3BLSA 1WE4A 1O07A 2GZAA 3V50A 2QMIA 2OAP1 1MY8A 4E04A 1J3WA 1U60A 1K57A 4KQRA 4DN0A 3SS4A 4EV4A 2PU2A 4QD4A 2A24A 4I5SA 1IYSA 5HARA 3NDGA 4KENB 2KDKA 4NXGA 4N92A 1LI0A 2QJ7A 3W8KA 2V20A 5TJJA 2P9VA 3OPHA 4S2NA 4KQOA 2OOLA 4ARZB 1TS0A 1BUEA 3C38A 5GLDA 1ES2A 3C7VA 3FKWA 3D72A 2W1TA 1HTZA 2ZBBA 3FV7A 4HEFA 1H8ZA 1IOUA 3PXPA 1P9WA 4X68A 3GTCA 2K2NA 5M18A 2ZQ8A 1HVBA 3SS5A 2JKGA 3GECA 4MBHA 3UMDA 2EXBA 1GA9A 1ES4A 3C30A 5FI2A 5MC7A 2R9XA 1XKZA 3NCKA 1W79A 3ZG0A 4OPZA 5CXWA 3F1PA 4WLAA 5FI7A 4LV2A 1L0GA 1ES3A 4GS9B 3NI9A 3BQ8A 1XA7A 2PAVP 4Y0UA 2PT7A 2PBDP 3QP2A 5CEDA 5F69A 3C7UA 3KSHA 4EESA 4Z9QA 2EX8A 3OPPA 1E3UD 5FQMA 2NUPC 3EEHA 3LEQA 4Y3IA 4DDYA 5FASA 3IHBA 2PHYA 4XXRA 1HD8A 1FIKA 3N8SA 1QMEA 1XJ2A 2M1CA 3ITAA 5F5YA 4FCFA 4OQGA 1OT9A 5CHJA 3LIAA 4MBKA 3S7OA 2HDSA 4HP9A 4IBXA 3LUQA 5DFXA 1KE4A 2B95A 1MC0A 3GSGA 1YLJA 3QHYA 4P6BA 4B9OA 2XROA 3IS2A 2EFUA 5HDSA 1OT6A 2Q9NA 1WYBA 2A2LA 2JKFA 2JCHA 3G30A 3LI9A 4R70A 1K54A 4N9LA 1BZAA 4WL9A 3QP4A 3S1YA 2K31A 1YSPA 1I2WA 2UWXA 4II7A 1LI9A 2E8IA 5HPFA 2O99A 3O5YA 4JPMA 4B4ZA 2I9VA 3UY6A 4OLGA 3E2KA 2W3HA 2Y91A 4BBUA 4KZ6A 2VKSA 5BOHA 4KG6A 4KUKA 5KSCA 4E3NA 3NOUC 1LL9A 2WYXA 2JBFA 5GLBA 1MWRA 1P97A 1XFQA 3JVVA 3RXWA 5HZHA 2W1RA 4H6JA 1TD5A 3F1NB 5GHZA 4DXBA 3BFFA 4MN7A 3KO6A 3WS5A 1PI4A 3KYEA 5CEBA 4LPZA 1P0ZA 4JGRA 1YT4A 1LL8A 2H10A 3EGDC 4QPRA 4QY6A 3IWOA 3UDIA 3TG9A 3TE8A 5EPHA 3NY4A 1MZUA 1YPRA 4DRTA 4ESPA 3NOPC 2XFSA 2Y2KA 3N8RA 2Y4AA 4QB8A 3Q7VB 3TSGA 1SCWA 4NG2A 1CI9A 5HL6A 4YINA 5A90A 3S7QA 5L2FA 3QP8A 3HL9A 4OLDA 3E4OA 1TS7A 1KGEA 1AXBA 3S7PA 1JNUA 1W8QA 4HESA 3HLDA 3IF6B 1T1CA 1K6SA 4EQIA 1IKGA 1D1JA 2J3TD 3ZG7B 4Z1WA 1Z09A 1SHVA 5FAPA 4S2PA 3AGDA 4GKUA 2Q9MA 4JXWA 3PTEA 4ZJ3A 1CEFA 2O9CA 3MXQA 4MLLA 1E3UA 2G7UA 3MSHA 4PM6A 3Q1FA 2J7VA 3CLOA 3A3DA 4QU3A 2Y8HA 5CERA 1CEGA 5GHXA 3LO7A 5E43A 3JPUA 4KZ4A 3HJKA 4JGPA 2ZC4B 2XRNA 4FH4A 4PM7A 1VB6A 4NETA 2JKTI 2J3TC 4NK3A 4KZ5A 4DE1A 2ZMVA 5HD3A 2XD1A 3BLMA 1PYYA 1JTDA 1K55C 3VP4A 3VFHA 4O0PA 3BY9A 4F94A 5GLCA 5FAOA 3NULA 3HUNA 5HWVA 2V8CA 3T4QA 4CLCB 3DBAA 1JTGA 4XUZA 3LR0A 1OJGA 1LSXA 5DVAA 3N6IA 1ZG4A 3V3RA 2RCXA 1L0FA 2PDRA 3BECA 3LR5A 3UPPA 1M6KA 1MWUA 1A0KA 3HBRA 3ZNTA 1BTLA 2JE5A 2NUTC 3V5MA 2IWBA 4R4RA 3IX4A 1IKIA 2DCFA 1XJ3A 3IT9A 2C6WB 3IWQA 2Z2MB 3BM6A 5EOOA 4ID4A 2KX6A 1CF0A 3CPTB 4G3WA 4LCLA 4KG5A 4X56A 4HIAA 2XEPA 1VETA 5FAQA 2Y2HA 4M3KA 4UQIS 5FDHA 1YLWA 1YLYA 3CMZA 4DKIA 2XD5A 3ITBA 4HP4A 4HBTA 1H5XA 2W3FA 4EEUA 4JF5A 2DMWA 4UA9A 2WKPA 3ZYTA 1V9YA 4R38A 2WKQA 3Q81A 4ZBEA 1XXMA 3B3XA 2KLIA 3MFXA 1PIOA 3PBSA 2BLSA 4BQMA 5TR7A 1TF1A 3LCEA 1KDSA 5IT5A 3FKVA 3QNBA 1S1ZA 3SH8A 3R7WB 2VGJA 4GHIA 1DJAA 3QP1A 1CJFA 3PBTA 3LR3A 3IXHA 3RXXA 4GDBA 5GHYA 4BD0A 1DP9A 4HJ6A 3NECA 1TDLA 3NHQA 1KVLA 3M2JA 4IUHA 5G4ZA 3L9KA 4BL2A 4OH0A 1C3BA 4LCMA 5IU1A 3CUEC 5FL3A 3MJQA 3L7HA 5A93A 3H7WB 4BMWA 4L9EA 2O9AA 4X6TA 3D3OA 5CHMA 3V39A 3ZFZA 1GSVA 3NC8A 3BYDA 2QZ6A 4DXCA 3EWKA 4E6WA 5JYOA 4HNBA 5HL1A 2XDMA 3ZQ5A 3LIDA 2EX9A 5DFYA 1ONGA 2Y2GA 2FZ0A 4HH3A 4OQ0A 1VHMA 3KYZA 3B33A 3DTIA 3SW1A 1ONHA 4WEJA 3KYQA 4R0QA 5HAPA 2Y79A 5IHVA 3ZVTA 3IH8A 3BFEA 1PWDA 2VGLS 3IX8A 4Y15A 1Q2QA 4NKPA 5K5BA 4HQAA 4CLCD 1KVMA 3MMHA 5L09A 4JXSA 1IYOA 5IS1A 2R9WA 5E2GA 3GR2A 3K3DA 4C6YA 4RX3A 4DE3A 2PYPA 3T4KA 1FSWA 3LIBA 3P01A 1CI8A 3CG5A 2QYBA 3VE3A 3DAVA 4O01A 1NYYA 1K54C 1GHPA 2Y2IA 2PBYA 2Z6DA 5A91A 1N4OA 2VX8A 2WAFA 2JN7A 1NWZA 3H82B 4NEED 4B4XA 3PBOA 3IBJA 5AJGA 4Y13A 3W2ZA 4O7DA 4B88A 3ZG9B 3HLWA 5J7EA 4OPYA 1NZUA 3U2AA 2EFXA 3BY8A 1K6RA 4IJGA 5HWTA 2ZQAA 4JXGA 2WGWA 3T1SA 3ZHHA 4GD6A 1KE0A 1VEUA 5F83A 3LR4A 4F3LA 1BLPA 1IEMA 3PBNA 4HH2A 1F98A 3T4LA 3G6OA 4Y7PA 1H8MA 4E3MA 1TS8A 4P6ZM 1N9LA 1K56D 3VOLA 2DRWA 4BBTA 1VETB 1F9IA 4Y0TA 2HGVA 3BFCA 5FDSA 5DJUA 3S4XA 1G6OA 3OBFA 4UEYA 3TOIA 3O3VA 4DJ3A 4WMCD 3CUEA 3WS4A 1ESUA 5J8XA 1YQSA 1SDEA 3WS1A 4O8GA 5EECA 4OQIA 2WKIA 1VQQA 1KE3A 4P0MA 3MXRA 4XT2B 2VLGA 4JXVA 1SZVA 3NOTC 4HY8A 3UNWA 2VGKA 3CJMA 2WZZA 3W4PA 2QHKA 3GV9A 4ETZA 3AGEA 2WKEA 1TEMA 4MEZA 5C5KA 4D2OA 4R23A 2XLNA 4HHDA 1MXOA 3DWKA 3LEZA 3RFBA 3T12B 4ZAMA 2CMNA 5KIZA 3CHWP 2V1AA 4FSFA 5FEGA 3PBQA 3QP6A 1D06A 5F82A 3MQQA 5G18A 3VOZA 4KG2A 4MCWA 5FQ9A 4CJNA 4QJGA 4R1GA 1DRMA 5FEFA 5EVIB 3F1OA 1XFNA 3UPNA 3HUMA 1ALQA 2OSUA 2GX5A 3DTKA 4JGOA 1H3QA 1ERMA 2XA7M 3UMEA 3MKFA 1ZTUA 3NBLA 1S4SA 3M6BA 3DTMA 1JWZA 4C3QA 1ODVA 4K0XA 1IFQA 1K25A 1YMXA 4E3KA 1MWSA 2LB5A 2XR0A 3A0RA 3TRCA 3EOIA 4X69A 5EVEA 3S22A 1YMSA 3I7JA 4OKPA 4IBRA 1RGYA 2Y2OA 5HX9A 2VK3A 3ICYA 1DJBA 2O0YA 2V2FF 4EQ1A 4RA7A 2A24B 2ZL1A 2L0WA 4OPQA 3GQZA 1S4RA 5M19A 3NIAA 2Y2QA 4UA7A 1BLHA 1MWTA 3CAXA 2P9VB 4U0XA 4KQQA 1ZG6A 5L10A 3SS3A 3LFVA 4B93A 4QHCA 1M40A 4G3VA 3ZG5A 4E3IA 4GNUA 1BSGA 2W1TB 1F2KA 1CK3A 1FOFA 1FCNA 1PRQA 2WAEA 2Y55A 3CWFA 4HI4A 5F6AA 3O87A 2ZJ9A 3VOYA 3UB7A 3EQVA 3PHYA 5FQJA 4L9FA 1VM1A 1K56A 5HSQA 3F1PB 3MR0A 4I3IA 3Q82A 4DF6A 4N1XA 1XGIA 2WUQA 3LY3A 5CGWA 4DE2A 2Y2JA 2J3WA 3UB9A 3SH9A 3FYZA 3SZTA 4R3AA 1QMFA 1SKOA 1XA1A 3JYIA 4KUOA 1GHMA 2HDQA 2H0YA 5CGXA 4WF0A 3K3CA 1O7EA 3C4PA 2EX6A
chains in the Genus database with same CATH topology
3PBSA 2P04A 4HJ3A 2QJ7A 1TF1A 4NXFA 5IT5A 4AFIA 5TJJA 4LRXC 1S1ZA 2PD8A 4Q0IA 3R7WB 4GHIA 4KQOA 2OOLA 3T4JA 4ARZB 3FPWA 4CLCA 3PBTA 1TS0A 3LR3A 1XJ6A 3C38A 2VA0A 4PKYG 4ETXA 5HD5A 1TS6A 3D72A 3MQOA 4CQHA 2VZWA 3RH8B 2W1TA 2ZBBA 1DP9A 2B18A 4HJ6A 5HPIA 3TJZC 3V67A 3IS2B 1IOUA 3PXPA 1NRJA 3E4QA 4I39A 1P9WA 2K2NA 2VV8A 3NHQA 2BASA 3GECA 4IUHA 3UMDA 2V0UA 4BBVA 5G4ZA 4K08A 4OOMA 5IU1A 3C30A 2EWWA 3CUEC 5FL3A 5MC7A 3MJQA 3F1OB 5DJTA 2QWSA 3H7WB 4DMZA 4WN5A 4BMWA 1W63M 4L9EA 2O9AA 3F1PA 4WLAA 3D3OA 2INWA 1GSVA 4MMNA 1LSVA 1OPXA 3EWKA 4YWZA 1STZA 2P7JA 5TBMA 4GS9B 4HNBA 2V0WA 4F3LB 2D01A 3ZQ5A 1T1AA 2JKRM 3BQ8A 1XJ4A 3LIDA 2PD7A 3NJAA 1DP6A 2ZOHA 5DFYA 4PHTA 2FZ0A 2PT7A 2KDKA 4HH3A 3T4OA 1NLYA 1VHMA 2JKTM 4MN5A 5F69A 4EESA 3KSHA 2VGLM 1T18A 3B33A 3KYZA 5G4YA 2HJEA 3SW1A 4WEJA 3KYQA 2NUPC 3EEHA 3UB8A 2Y79A 3PR6A 4Y3IA 2OAQ1 2VGLS 2PHYA 3BW6A 3BJNA 4NKPA 5K5BA 3BQAA 4EW7A 4HQAA 5F68A 4CLCD 3MMHA 1XJ2A 5IS1A 2M1CA 4H6JB 1LSWA 5F5YA 3EEAA 4RQ9A 3K3DA 3R7WA 1OT9A 2PYPA 3T4KA 3LIAA 4ARZA 3S7OA 3LIBA 2IA2A 3P01A 4IHQA 4HP9A 3LUQA 4GJ4A 1LT0A 2QYBA 2YKHA 3PYPA 5DFXA 3VE3A 2W27A 4O01A 1MC0A 4LRYC 3OCLA 2KOIA 1OTDA 2Z6DA 4B9OA 2VX8A 2XROA 3IS2A 2JN7A 1NWZA 3H82B 4NEED 4Y5FA 2P08A 5HDSA 1S67L 3PBOA 3IBJA 1OT6A 4G3KA 2OWJA 5AJGA 1V9ZA 3W2ZA 2ZOIA 2A2LA 2L1MA 4EU0A 2O9BA 2R78A 3LI9A 5J7EA 3CITA 4R70A 3U2AA 4WL9A 2H28A 3UB6A 3BY8A 4L0LA 4IJGA 1X0OA 3BWLA 5HWTA 3H7WA 2K31A 1YSPA 5A8BA 2VV6A 4Q0HA 4II7A 5HPFA 1YAXA 2O99A 3O5YA 2I9VA 3LR4A 1G28A 4GS9A 3OCNA 4F3LA 5HWWA 3PBNA 2W3HA 4HH2A 3S7NA 1F98A 5HDDA 4L9GA 1UWNX 3T4LA 3T4SA 3G6OA 4BBUA 2VKSA 2EA9A 5DF9A 1H8MA 3H9WA 2W3DA 4KUKA 4KQDA 1TS8A 1N9OA 4P6ZM 1N9LA 3VOLA 3NOUC 4I3JA 3IBRA 2MJ6A 2M7UA 4BBTA 3LICA 4P6ZS 3B42A 1P97A 1XFQA 2FH5A 2W0NA 3JVVA 5HZHA 1F9IA 2W1RA 2HGVA 1D7EA 4H6JA 3T50A 5DJUA 5CX7A 1TD5A 3F1NB 1G6OA 3OBFA 2QKPA 4MN7A 4UEYA 4Q0JA 2EWVA 3KO6A 1WA9A 3RTYA 5HDCA 4DJ3A 3FPVA 4LRZE 2VJWA 2Z6CA 3CUEA 5J4EA 1GSXA 4LPZA 1P0ZA 4JGRA 4O8GA 1LL8A 2ZMFA 3EGDC 4QPRA 3LIFA 4EETB 2J80A 1YKDA 3H82A 4XT2B 2VLGA 4BJPA 1KOUA 2GNXA 3VE4A 3NOTC 4HY8A 2PR6A 3TE8A 3EQUA 1MZUA 3LI8A 3R4KA 2GJ3A 4PKYA 3C8CA 2QHKA 4CLCE 3NOPC 4ETZA 4MN6A 5AVEA 5C5KA 3E0YA 3KSFA 1W63Q 4HHDA 3VV4A 5HL6A 3B47A 3RFBA 4OOLA 3S7QA 2CMNA 5KIZA 3E4OA 3KSGA 1TS7A 3ULFA 2V1AA 4IUKA 4FSFA 3PBQA 3S7PA 3P7NA 1D06A 3MQQA 1JNUA 1N9NA 3E98A 5J3WA 4GCZA 3JVUA 4MCWA 1S1YA 4I38A 3MQ0A 1T1CA 4PAUA 1EW0A 4DJ2A 4ME4A 2J3TD 4YOFA 1DRMA 3UE3A 4Z1WA 3F1OA 1XFNA 3FG8A 5L8MA 4M4XA 5AVFA 2GX5A 4CLCC 4JGOA 3F1NA 2QJ5A 5KSHA 5DKLA 1UGUA 1H3QA 2XA7M 2YKFA 3UMEA 2V9AA 1OTIA 2O9CA 3MXQA 1F5MA 2G7UA 4MDZA 3FC7A 2D02A 1ZTUA 4BWIA 3CLOA 2V1BA 2XA7S 4GW9A 5LBRA 2JHEA 1S4SA 2XSSA 1ODVA 1DP8A 2Y8HA 2W3GA 1IFQA 4XT2A 2LB5A 3PBRA 3A0RA 2LB9A 3TRCA 3EOIA 2OWHA 2JKRI 3HJKA 4JGPA 3GDIA 1ZHHB 2XRNA 4FOFA 3ICYA 4LLOB 2O0YA 1VB6A 2JKTI 2K7SA 1P9RA 2J3TC 4EQ1A 4GLQA 2M7VA 1UWPX 2ZMVA 4JGQA 5HD3A 3UE6A 1MKMA 2A24B 2B02A 2L0WA 3OC2A 3E4PA 4Y2FA 1S4RA 4HJ4A 1OTBA 4O0PA 1GSWA 3BY9A 2VV7A 1NLZA 3CAXA 1YSQA 5HWVA 4WUJA 2W3EA 3LIEA 3T4QA 4GHIB 3A0SA 3A0VA 3LFVA 4B93A 4CLCB 2HV1A 3DBAA 1OTEA 3LR0A 1OJGA 3CI6A 4G3VA 1LSXA 2W1TB 4I3AA 5DKKA 4R6LA 1OJ5A 3K2NA 2PDRA 3LR5A 3T4TA 3C2WA 3HJIA 2PR5A 2NUTC 3LYXA 3MF0A 4ZRRA 3CWFA 5F6AA 4HI4A 2VEAA 2L4RA 3HCYA 3UB7A 2HF6A 3EQVA 3PHYA 1XJ3A 3KX0X 3TW8A 3KSIA 4L9FA 4NXBA 4WEKA 1T19A 2HJ9C 1S66L 3OLOA 2PYRA 1T1BA 2KX6A 5HSQA 3F1PB 3MR0A 4I3IA 4EERA 4HOIA 4G3WA 5EFWA 5I5LA 4EUVA 3OOVA 4UQIM 2J3WA 4EEPA 5TBMB 3UB9A 4HIAA 4YNRA 2GZAA 4R3AA 2OAP1 4UQIS 4EXOA 1OTAA 4E04A 4WELA 4HP4A 1Y28A 2WKRA 4KUOA 4DN0A 2W3FA 4NXEA 4EEUA 2DMWA 2WKPA 1BYWA 3ZYTA 4WF0A 2A24A 1V9YA 4I5SA 3EGXC 2WKQA 4R38A 3K3CA 2KLIA 3MFXA 4NXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ3 A;  2QJ7 A;  4NXF A;  4LRX C;  1S1Z A;  2PD8 A;  4GHI A;  2OOL A;  1TS0 A;  1XJ6 A;  4PKY G;  5HD5 A;  1TS6 A;  3D72 A;  3MQO A;  3RH8 B;  2ZBB A;  1DP9 A;  4HJ6 A;  3IS2 B;  4I39 A;  3E4Q A;  2VV8 A;  3NHQ A;  2BAS A;  3GEC A;  3UMD A;  2V0U A;  4BBV A;  5G4Z A;  4K08 A;  5IU1 A;  3MJQ A;  3F1O B;  5DJT A;  2QWS A;  3H7W B;  4WN5 A;  4L9E A;  3F1P A;  4WLA A;  2INW A;  1GSV A;  1LSV A;  3EWK A;  4YWZ A;  2P7J A;  5TBM A;  4GS9 B;  4HNB A;  2V0W A;  4F3L B;  2D01 A;  3ZQ5 A;  1T1A A;  1XJ4 A;  3LID A;  2PD7 A;  3NJA A;  1DP6 A;  2ZOH A;  4HH3 A;  4MN5 A;  5F69 A;  4EES A;  1T18 A;  3B33 A;  5G4Y A;  3SW1 A;  3EEH A;  3UB8 A;  2PHY A;  4EW7 A;  4HQA A;  5F68 A;  1XJ2 A;  5IS1 A;  2M1C A;  4H6J B;  1LSW A;  5F5Y A;  4RQ9 A;  3K3D A;  1OT9 A;  2PYP A;  3LIA A;  3LIB A;  4HP9 A;  3LUQ A;  1LT0 A;  3PYP A;  2YKH A;  3VE3 A;  2W27 A;  4LRY C;  1OTD A;  2Z6D A;  4B9O A;  3IS2 A;  2JN7 A;  1NWZ A;  3H82 B;  5HDS A;  1S67 L;  1OT6 A;  2OWJ A;  1V9Z A;  2ZOI A;  2L1M A;  2R78 A;  3LI9 A;  5J7E A;  4R70 A;  4WL9 A;  2H28 A;  3UB6 A;  3BY8 A;  1X0O A;  3BWL A;  5HWT A;  3H7W A;  5A8B A;  2VV6 A;  2I9V A;  1G28 A;  4GS9 A;  4F3L A;  5HWW A;  4HH2 A;  1F98 A;  5HDD A;  4L9G A;  1UWN X;  3G6O A;  4BBU A;  2EA9 A;  3H9W A;  4KUK A;  4KQD A;  1TS8 A;  1N9O A;  1N9L A;  3VOL A;  3NOU C;  4I3J A;  3IBR A;  4BBT A;  3LIC A;  1P97 A;  1XFQ A;  2W0N A;  5HZH A;  1F9I A;  1D7E A;  4H6J A;  3T50 A;  5DJU A;  3F1N B;  2QKP A;  1WA9 A;  3RTY A;  5HDC A;  4DJ3 A;  4LRZ E;  2Z6C A;  5J4E A;  1GSX A;  4LPZ A;  1P0Z A;  4JGR A;  1LL8 A;  3LIF A;  4EET B;  2J80 A;  3H82 A;  4XT2 B;  2VLG A;  1KOU A;  3VE4 A;  3NOT C;  4HY8 A;  2PR6 A;  1MZU A;  3LI8 A;  4PKY A;  2GJ3 A;  3C8C A;  2QHK A;  3NOP C;  4MN6 A;  5AVE A;  4HHD A;  2CMN A;  5KIZ A;  3E4O A;  1TS7 A;  3ULF A;  2V1A A;  3P7N A;  1D06 A;  3MQQ A;  1JNU A;  1N9N A;  5J3W A;  4GCZ A;  1S1Y A;  4I38 A;  1T1C A;  1EW0 A;  4DJ2 A;  1DRM A;  3F1O A;  1XFN A;  3FG8 A;  4M4X A;  5AVF A;  4JGO A;  3F1N A;  2QJ5 A;  5DKL A;  1UGU A;  2YKF A;  3UME A;  2V9A A;  1OTI A;  3MXQ A;  3FC7 A;  2D02 A;  3CLO A;  2V1B A;  4GW9 A;  2JHE A;  1S4S A;  1ODV A;  1DP8 A;  4XT2 A;  3A0R A;  2OWH A;  3HJK A;  4JGP A;  3GDI A;  3ICY A;  4LLO B;  1VB6 A;  2K7S A;  4EQ1 A;  1UWP X;  4JGQ A;  5HD3 A;  3UE6 A;  2A24 B;  2B02 A;  2L0W A;  3E4P A;  1S4R A;  4HJ4 A;  1OTB A;  1GSW A;  3BY9 A;  2VV7 A;  3CAX A;  5HWV A;  4WUJ A;  3LIE A;  4GHI B;  3A0S A;  3A0V A;  2HV1 A;  1OTE A;  1OJG A;  1LSX A;  4I3A A;  5DKK A;  4R6L A;  1OJ5 A;  2PDR A;  3C2W A;  3HJI A;  2PR5 A;  3LYX A;  3CWF A;  5F6A A;  4HI4 A;  2VEA A;  2L4R A;  3UB7 A;  3PHY A;  1XJ3 A;  3KX0 X;  4L9F A;  4NXB A;  1T19 A;  1S66 L;  3OLO A;  2PYR A;  1T1B A;  2KX6 A;  5HSQ A;  3F1P B;  3MR0 A;  4I3I A;  4EER A;  4HOI A;  5EFW A;  5I5L A;  4EEP A;  5TBM B;  3UB9 A;  4HIA A;  4R3A A;  4EXO A;  1OTA A;  4E04 A;  4HP4 A;  1Y28 A;  2WKR A;  4KUO A;  4NXE A;  4EEU A;  2WKP A;  1BYW A;  4WF0 A;  2A24 A;  1V9Y A;  4I5S A;  4R38 A;  2WKQ A;  3K3C A;  2KDK A;  3MFX A;  4NXG A; 
#chains in the Genus database with same CATH topology
 4HJ3 A;  1MBL A;  1Q2P A;  4EBN A;  4RX2 A;  4LRX C;  3MKE A;  1TDG A;  2XF3 A;  3T4J A;  2WKH A;  3FPW A;  3ZG8 B;  1XJ6 A;  2VA0 A;  4ETX A;  4LGW A;  5HD5 A;  5EVI D;  3MQO A;  1HLU P;  3C5A A;  4CQH A;  1CQA A;  2FFY A;  2VZW A;  4KZ8 A;  3RH8 B;  5F1F A;  3IWI A;  1BLS A;  3TJZ C;  3V67 A;  3IS2 B;  3E4Q A;  5TFQ A;  2ZM8 A;  1JWP A;  2BAS A;  3FZC A;  5FQI A;  4R4S A;  2ZQD A;  1YLZ A;  4BLM A;  4K08 A;  4OOM A;  1FIL A;  2ACG A;  2EX2 A;  2ZC3 B;  3F1O B;  4BD1 A;  5DJT A;  2QWS A;  1BUL A;  1GA0 A;  3IX3 A;  5HAI A;  4WN5 A;  1ERQ A;  1W63 M;  4PM8 A;  4QWO A;  2INW A;  3DTE A;  4MMN A;  4P87 A;  2V1Z A;  1STZ A;  2P7J A;  5TBM A;  2V0W A;  4UA6 A;  3MS6 A;  2JKR M;  1XJ4 A;  2PD7 A;  1DP6 A;  2ZOH A;  3G31 A;  2BG1 A;  4X55 A;  3T4O A;  3IXB A;  4WZ5 A;  3QP5 A;  1T18 A;  5CHU A;  2HJE A;  1I2S A;  1PZO A;  2OAQ 1;  4PPR A;  5E2H A;  3W4O A;  3HLE A;  1L0E A;  5CEC A;  4H6J B;  1LSW A;  2XGN A;  3EEA A;  3M6H A;  3DW0 A;  4ARZ A;  4EBP A;  4IHQ A;  3PYP A;  2YKH A;  4EWF A;  2W27 A;  1KGF A;  3T1Q B;  5CGS A;  4LRY C;  3OCL A;  2KOI A;  2Y2N A;  4UHU A;  4Y5F A;  2P08 A;  1S67 L;  1LL5 A;  4G3K A;  4ZDX A;  1V9Z A;  1EWZ A;  2L1M A;  4EU0 A;  1FR6 A;  4P85 A;  2R78 A;  3CIT A;  2G2U A;  3A3E A;  4L0L A;  3VSL A;  2HP6 A;  1NJ4 A;  1X0O A;  3BWL A;  4PM9 A;  5EVL A;  2VV6 A;  4Q0H A;  4WBG A;  1S0W A;  1YAX A;  5KMW A;  4C75 A;  4GS9 A;  2HDR A;  3OCN A;  5JYP A;  3Q07 A;  3S7N A;  5HDD A;  2J9O A;  4L9G A;  4OON A;  1E4D A;  3LY4 A;  5DF9 A;  3H9W A;  2H5S A;  1TVF A;  1L2S A;  4KQD A;  5FQK A;  2H0T A;  3OZH A;  2A3U A;  2ZM2 A;  3IF5 A;  1GHI A;  4I3J A;  2MJ6 A;  2M7U A;  3LIC A;  2FH5 A;  1XPB A;  1L3L A;  1IYQ A;  4S2J A;  1D7E A;  4DDS A;  5CX7 A;  2XQZ A;  5DTS A;  4Q0J A;  1PZP A;  2ZLY A;  1WA9 A;  1NY0 A;  1KDW A;  5U47 A;  2VJW A;  2Z6C A;  4X1M A;  4E3L A;  4YFM A;  4LV3 A;  1GSX A;  1MKI A;  2ZMA A;  5DF8 A;  2HPB A;  2J80 A;  3ISG A;  1RGZ A;  4ZTK A;  3HLC A;  3VE4 A;  4MNR A;  3LI8 A;  4PKY A;  3R4K A;  2GJ3 A;  4FD8 A;  1NYM A;  5AQ7 A;  4CLC E;  1G6A A;  5AQB A;  3BFD A;  4MN6 A;  2ZQ9 A;  5AVE A;  2HDU A;  3RJU A;  1W63 Q;  3VP0 A;  3VV4 A;  4CPK A;  4HBU A;  2X71 A;  4IVK A;  3ZVW A;  3KSG A;  3ULF A;  4FTX A;  3ZGA B;  4IUK A;  3VP3 A;  3P7N A;  1N9N A;  5EV0 A;  3E98 A;  4GCZ A;  3JVU A;  1SDN A;  3HUO A;  4R3B A;  1S1Y A;  4I38 A;  2XK1 A;  3C4O A;  3MQ0 A;  1EW0 A;  4DJ2 A;  4OP8 A;  3P98 A;  4YOF A;  3UE3 A;  1Z6F A;  2RL3 A;  3FWL A;  3UB5 P;  4CLC C;  3F1N A;  5KSH A;  1RP5 A;  4WM9 A;  2OLU A;  2EXA A;  3FC7 A;  2D02 A;  4BWI A;  4RVA A;  3HRE A;  5EUA A;  4LV0 A;  2Z2L B;  1PWC A;  2W3G A;  4JKT A;  3PBR A;  5E2F A;  3LGO A;  1ZHH B;  1DY6 A;  4FOF A;  2IWD A;  2OLV A;  1P9R A;  1K38 A;  4GLQ A;  4JF4 A;  1UWP X;  3Q7V A;  1MKM A;  3OC2 A;  5KZH A;  4Y2F A;  1W5D A;  2G2W A;  1BT5 A;  1Y54 A;  2BTF P;  3MXS A;  1FCO A;  3WS2 A;  1GSW A;  3T1R A;  2VV7 A;  1ACF A;  2IWC A;  2W3E A;  3LIE A;  4GHI B;  1LHY A;  2HV1 A;  2XH9 A;  1OTE A;  3ZNY A;  1K4E A;  3IF6 A;  3O88 A;  1YLT A;  4QY5 A;  4KZ3 A;  1PWG A;  4I3A A;  1PNE A;  5DKK A;  4S2K A;  4N9K A;  1OJ5 A;  3K2N A;  4DE0 A;  3C2W A;  3HJI A;  1BLC A;  3LYX A;  2WK0 A;  5CTN A;  2VEA A;  1JWV A;  2ZQC A;  5DF7 A;  2J9P A;  2ZQ7 A;  4PM5 A;  3TW8 A;  4PMA A;  4NXB A;  1T19 A;  2ZC6 B;  1T1B A;  4Q8I A;  4GDN A;  3G32 A;  5EFW A;  2Y2P A;  5I5L A;  5GL9 A;  4Y0O A;  2PU4 A;  1NXY A;  3OOV A;  4UQI M;  4EEP A;  4YNR A;  1YM1 A;  3HVF A;  4EXO A;  2HZ5 A;  1OTA A;  5HW3 A;  4WEL A;  4S2M A;  1Y28 A;  2WKR A;  3G2Z A;  1PFL A;  2A49 A;  4NXE A;  1BYW A;  3OPR A;  2J8Y A;  3EGX C;  4BEN A;  2P04 A;  2Y2L A;  3P09 A;  4NXF A;  4AFI A;  2PD8 A;  3VMA A;  4Q0I A;  4FH2 A;  4KZA A;  3UE0 A;  4CLC A;  1H8Y A;  2DNS A;  4PKY G;  1TS6 A;  3IH9 A;  2B18 A;  5HPI A;  4I39 A;  1NRJ A;  4OVD A;  5A92 A;  2V8F A;  3MFD A;  1OME A;  3VP1 A;  2VV8 A;  3UN7 A;  1ZKJ A;  1EI5 A;  4GN2 A;  5M1A A;  1SKF A;  2V0U A;  4BBV A;  3WS0 A;  1G68 A;  2EWW A;  2Y59 A;  2AVX A;  3VP2 A;  3GRJ A;  2C5W B;  4DMZ A;  2WGW B;  2FFF B;  4MBF A;  3WWX A;  2B5R A;  3CPT A;  4WZ5 C;  1LSV A;  1OPX A;  5DTT A;  1VEU B;  4YWZ A;  1PI5 A;  4ZJ2 A;  5FSR A;  1I5Q A;  4H8R A;  4F3L B;  2D01 A;  1T1A A;  4E6X A;  3NJA A;  1S6R A;  3HLB A;  4PHT A;  5HFO A;  4X1L A;  1NLY A;  2JKT M;  3QNC A;  4MN5 A;  2VGL M;  3W4Q A;  5G4Y A;  3HLF A;  3UB8 A;  4Y17 A;  3PR6 A;  4UAA A;  4E3J A;  4R3J A;  3BW6 A;  3BJN A;  1K4F A;  3GMW A;  3BQA A;  4EW7 A;  3HLG A;  5F68 A;  4RQ9 A;  3R7W A;  1ESI A;  1MPL A;  2IA2 A;  4XUX A;  3G2Y A;  4GD8 A;  2OV5 A;  4WYY A;  4GJ4 A;  1LT0 A;  5D3O A;  2UV0 E;  4JBF A;  1N9B A;  1OTD A;  4WMC A;  1ZC2 A;  4E3O A;  2OWJ A;  2E8J A;  1FQG A;  1IEL A;  4K91 A;  5DTK A;  4S2L A;  2ZOI A;  4EBL A;  2PRF A;  2O9B A;  4EUZ A;  4KZB A;  3UPO A;  3MZE A;  3E2L A;  2H28 A;  3UB6 A;  4BL3 A;  4IED A;  3H7W A;  4D60 A;  5EE8 A;  5A8B A;  1G28 A;  3A3F A;  5HWW A;  1UWN X;  3T4S A;  2EA9 A;  2W3D A;  3A3I A;  3UDF A;  1XGJ A;  4GZB A;  1N9O A;  4GB7 A;  3IBR A;  4JLF A;  4RYE A;  3DWZ A;  3WRZ A;  4P6Z S;  3B42 A;  2W0N A;  4K0W A;  5CRF A;  3T50 A;  4U3T A;  2WAD A;  2ZM0 A;  3O86 A;  5FQQ A;  2QKP A;  2QPN A;  1NZO A;  2EWV A;  3Q7Z A;  3RTY A;  5HDC A;  1Y4O A;  3FPV A;  4LRZ E;  5J4E A;  3IHA A;  4A5R A;  2X02 A;  2HP9 A;  1IYP A;  1PW8 A;  3SH7 A;  5EVI C;  2ZMF A;  3LIF A;  4EET B;  1YKD A;  3H82 A;  4BJP A;  2HP5 A;  1KOU A;  3M2K A;  2GNX A;  3D9Y A;  2PR6 A;  4GOG A;  3EQU A;  2P74 A;  3C8C A;  5GLA A;  2CC1 A;  2WGI A;  4LEN A;  2JC7 A;  5HAQ A;  5FA7 A;  2X01 A;  3UDX A;  3E0Y A;  1KGG A;  1JVJ A;  2ZL1 B;  3KSF A;  1W8Y A;  3WRT A;  3B47 A;  4OOL A;  3ZDJ A;  1K57 C;  1E25 A;  3A3J A;  1HZO A;  5J3W A;  1GCE A;  4LFU A;  4PAU A;  5L07 A;  5CTM A;  4ME4 A;  3D4F A;  3FG8 A;  5L8M A;  4JF6 A;  3N4I A;  4S2N C;  4M4X A;  5E2E A;  3MZF A;  5AVF A;  2QJ5 A;  5DKL A;  1UGU A;  4KZ9 A;  2YKF A;  2V9A A;  1OTI A;  3N8L A;  1XP4 A;  5EOE A;  1F5M A;  4MDZ A;  2ZC5 B;  1DJC A;  2V1B A;  2Q0O A;  2XA7 S;  3G34 A;  4GW9 A;  4U0T A;  5LBR A;  1FSY A;  2JHE A;  4WZ4 A;  2XSS A;  3G35 A;  5EM0 A;  1DP8 A;  1LLB A;  3VSK A;  4XT2 A;  2LB9 A;  3UO9 A;  2OWH A;  1WYC A;  2JKR I;  3GDI A;  3CZD A;  1SKO B;  1YLP A;  5AQ9 A;  4LLO B;  3MBZ A;  2K7S A;  4OQH A;  2M7V A;  1L0D A;  4JGQ A;  3UE6 A;  2ZC7 A;  2XFT A;  2B02 A;  3E4P A;  1AWI A;  3IF6 C;  1XX2 A;  4HJ4 A;  2I72 A;  1OTB A;  4X53 A;  1G5U A;  3AGF A;  5TGF A;  1NLZ A;  1FR1 A;  1YSQ A;  4WUJ A;  1ERO A;  4IVI A;  4OPR A;  3A0S A;  3A0V A;  3ZCZ A;  5AQA A;  1W7F A;  5I94 A;  4OOY A;  4X25 A;  3UE1 A;  3NDE A;  2GDN A;  1K55 A;  4ZJ1 A;  1J9M A;  3CI6 A;  3BRM A;  5EM1 A;  1RCJ A;  5F1G A;  4S2O A;  3V3S A;  3IXG A;  4R6L A;  3BFG A;  4N1H A;  3SOI A;  1H0M A;  3T4T A;  3T1X A;  5EVI A;  4S2I A;  5FAT A;  2PR5 A;  2ZD8 A;  3VFF A;  1FCM A;  3BEB A;  4LV1 A;  4FUW A;  3MF0 A;  3U4L P;  3GVB A;  4ZRR A;  2Y2M A;  2L4R A;  4KZ7 A;  3HCY A;  3OPL A;  2HF6 A;  3KX0 X;  4OP5 A;  3KSI A;  2WZX A;  4WEK A;  1NRF A;  2HJ9 C;  1S66 L;  3OLO A;  2PYR A;  3IQA A;  3PAE A;  3IXD A;  1K0K A;  4EER A;  4HOI A;  3N7W A;  3PAG A;  4EUV A;  2WGV A;  1PW1 A;  5FI6 A;  3MZD A;  5TBM B;  3G4P A;  1ES5 A;  3BLS A;  1WE4 A;  1O07 A;  2GZA A;  3V50 A;  2QMI A;  2OAP 1;  1MY8 A;  4E04 A;  1J3W A;  1U60 A;  1K57 A;  4KQR A;  4DN0 A;  3SS4 A;  4EV4 A;  2PU2 A;  4QD4 A;  2A24 A;  4I5S A;  1IYS A;  5HAR A;  3NDG A;  4KEN B;  2KDK A;  4NXG A;  4N92 A;  1LI0 A;  2QJ7 A;  3W8K A;  2V20 A;  5TJJ A;  2P9V A;  3OPH A;  4S2N A;  4KQO A;  2OOL A;  4ARZ B;  1TS0 A;  1BUE A;  3C38 A;  5GLD A;  1ES2 A;  3C7V A;  3FKW A;  3D72 A;  2W1T A;  1HTZ A;  2ZBB A;  3FV7 A;  4HEF A;  1H8Z A;  1IOU A;  3PXP A;  1P9W A;  4X68 A;  3GTC A;  2K2N A;  5M18 A;  2ZQ8 A;  1HVB A;  3SS5 A;  2JKG A;  3GEC A;  4MBH A;  3UMD A;  2EXB A;  1GA9 A;  1ES4 A;  3C30 A;  5FI2 A;  5MC7 A;  2R9X A;  1XKZ A;  3NCK A;  1W79 A;  3ZG0 A;  4OPZ A;  5CXW A;  3F1P A;  4WLA A;  5FI7 A;  4LV2 A;  1L0G A;  1ES3 A;  4GS9 B;  3NI9 A;  3BQ8 A;  1XA7 A;  2PAV P;  4Y0U A;  2PT7 A;  2PBD P;  3QP2 A;  5CED A;  5F69 A;  3C7U A;  3KSH A;  4EES A;  4Z9Q A;  2EX8 A;  3OPP A;  1E3U D;  5FQM A;  2NUP C;  3EEH A;  3LEQ A;  4Y3I A;  4DDY A;  5FAS A;  3IHB A;  2PHY A;  4XXR A;  1HD8 A;  1FIK A;  3N8S A;  1QME A;  1XJ2 A;  2M1C A;  3ITA A;  5F5Y A;  4FCF A;  4OQG A;  1OT9 A;  5CHJ A;  3LIA A;  4MBK A;  3S7O A;  2HDS A;  4HP9 A;  4IBX A;  3LUQ A;  5DFX A;  1KE4 A;  2B95 A;  1MC0 A;  3GSG A;  1YLJ A;  3QHY A;  4P6B A;  4B9O A;  2XRO A;  3IS2 A;  2EFU A;  5HDS A;  1OT6 A;  2Q9N A;  1WYB A;  2A2L A;  2JKF A;  2JCH A;  3G30 A;  3LI9 A;  4R70 A;  1K54 A;  4N9L A;  1BZA A;  4WL9 A;  3QP4 A;  3S1Y A;  2K31 A;  1YSP A;  1I2W A;  2UWX A;  4II7 A;  1LI9 A;  2E8I A;  5HPF A;  2O99 A;  3O5Y A;  4JPM A;  4B4Z A;  2I9V A;  3UY6 A;  4OLG A;  3E2K A;  2W3H A;  2Y91 A;  4BBU A;  4KZ6 A;  2VKS A;  5BOH A;  4KG6 A;  4KUK A;  5KSC A;  4E3N A;  3NOU C;  1LL9 A;  2WYX A;  2JBF A;  5GLB A;  1MWR A;  1P97 A;  1XFQ A;  3JVV A;  3RXW A;  5HZH A;  2W1R A;  4H6J A;  1TD5 A;  3F1N B;  5GHZ A;  4DXB A;  3BFF A;  4MN7 A;  3KO6 A;  3WS5 A;  1PI4 A;  3KYE A;  5CEB A;  4LPZ A;  1P0Z A;  4JGR A;  1YT4 A;  1LL8 A;  2H10 A;  3EGD C;  4QPR A;  4QY6 A;  3IWO A;  3UDI A;  3TG9 A;  3TE8 A;  5EPH A;  3NY4 A;  1MZU A;  1YPR A;  4DRT A;  4ESP A;  3NOP C;  2XFS A;  2Y2K A;  3N8R A;  2Y4A A;  4QB8 A;  3Q7V B;  3TSG A;  1SCW A;  4NG2 A;  1CI9 A;  5HL6 A;  4YIN A;  5A90 A;  3S7Q A;  5L2F A;  3QP8 A;  3HL9 A;  4OLD A;  3E4O A;  1TS7 A;  1KGE A;  1AXB A;  3S7P A;  1JNU A;  1W8Q A;  4HES A;  3HLD A;  3IF6 B;  1T1C A;  1K6S A;  4EQI A;  1IKG A;  1D1J A;  2J3T D;  3ZG7 B;  4Z1W A;  1Z09 A;  1SHV A;  5FAP A;  4S2P A;  3AGD A;  4GKU A;  2Q9M A;  4JXW A;  3PTE A;  4ZJ3 A;  1CEF A;  2O9C A;  3MXQ A;  4MLL A;  1E3U A;  2G7U A;  3MSH A;  4PM6 A;  3Q1F A;  2J7V A;  3CLO A;  3A3D A;  4QU3 A;  2Y8H A;  5CER A;  1CEG A;  5GHX A;  3LO7 A;  5E43 A;  3JPU A;  4KZ4 A;  3HJK A;  4JGP A;  2ZC4 B;  2XRN A;  4FH4 A;  4PM7 A;  1VB6 A;  4NET A;  2JKT I;  2J3T C;  4NK3 A;  4KZ5 A;  4DE1 A;  2ZMV A;  5HD3 A;  2XD1 A;  3BLM A;  1PYY A;  1JTD A;  1K55 C;  3VP4 A;  3VFH A;  4O0P A;  3BY9 A;  4F94 A;  5GLC A;  5FAO A;  3NUL A;  3HUN A;  5HWV A;  2V8C A;  3T4Q A;  4CLC B;  3DBA A;  1JTG A;  4XUZ A;  3LR0 A;  1OJG A;  1LSX A;  5DVA A;  3N6I A;  1ZG4 A;  3V3R A;  2RCX A;  1L0F A;  2PDR A;  3BEC A;  3LR5 A;  3UPP A;  1M6K A;  1MWU A;  1A0K A;  3HBR A;  3ZNT A;  1BTL A;  2JE5 A;  2NUT C;  3V5M A;  2IWB A;  4R4R A;  3IX4 A;  1IKI A;  2DCF A;  1XJ3 A;  3IT9 A;  2C6W B;  3IWQ A;  2Z2M B;  3BM6 A;  5EOO A;  4ID4 A;  2KX6 A;  1CF0 A;  3CPT B;  4G3W A;  4LCL A;  4KG5 A;  4X56 A;  4HIA A;  2XEP A;  1VET A;  5FAQ A;  2Y2H A;  4M3K A;  4UQI S;  5FDH A;  1YLW A;  1YLY A;  3CMZ A;  4DKI A;  2XD5 A;  3ITB A;  4HP4 A;  4HBT A;  1H5X A;  2W3F A;  4EEU A;  4JF5 A;  2DMW A;  4UA9 A;  2WKP A;  3ZYT A;  1V9Y A;  4R38 A;  2WKQ A;  3Q81 A;  4ZBE A;  1XXM A;  3B3X A;  2KLI A;  3MFX A;  1PIO A;  3PBS A;  2BLS A;  4BQM A;  5TR7 A;  1TF1 A;  3LCE A;  1KDS A;  5IT5 A;  3FKV A;  3QNB A;  1S1Z A;  3SH8 A;  3R7W B;  2VGJ A;  4GHI A;  1DJA A;  3QP1 A;  1CJF A;  3PBT A;  3LR3 A;  3IXH A;  3RXX A;  4GDB A;  5GHY A;  4BD0 A;  1DP9 A;  4HJ6 A;  3NEC A;  1TDL A;  3NHQ A;  1KVL A;  3M2J A;  4IUH A;  5G4Z A;  3L9K A;  4BL2 A;  4OH0 A;  1C3B A;  4LCM A;  5IU1 A;  3CUE C;  5FL3 A;  3MJQ A;  3L7H A;  5A93 A;  3H7W B;  4BMW A;  4L9E A;  2O9A A;  4X6T A;  3D3O A;  5CHM A;  3V39 A;  3ZFZ A;  1GSV A;  3NC8 A;  3BYD A;  2QZ6 A;  4DXC A;  3EWK A;  4E6W A;  5JYO A;  4HNB A;  5HL1 A;  2XDM A;  3ZQ5 A;  3LID A;  2EX9 A;  5DFY A;  1ONG A;  2Y2G A;  2FZ0 A;  4HH3 A;  4OQ0 A;  1VHM A;  3KYZ A;  3B33 A;  3DTI A;  3SW1 A;  1ONH A;  4WEJ A;  3KYQ A;  4R0Q A;  5HAP A;  2Y79 A;  5IHV A;  3ZVT A;  3IH8 A;  3BFE A;  1PWD A;  2VGL S;  3IX8 A;  4Y15 A;  1Q2Q A;  4NKP A;  5K5B A;  4HQA A;  4CLC D;  1KVM A;  3MMH A;  5L09 A;  4JXS A;  1IYO A;  5IS1 A;  2R9W A;  5E2G A;  3GR2 A;  3K3D A;  4C6Y A;  4RX3 A;  4DE3 A;  2PYP A;  3T4K A;  1FSW A;  3LIB A;  3P01 A;  1CI8 A;  3CG5 A;  2QYB A;  3VE3 A;  3DAV A;  4O01 A;  1NYY A;  1K54 C;  1GHP A;  2Y2I A;  2PBY A;  2Z6D A;  5A91 A;  1N4O A;  2VX8 A;  2WAF A;  2JN7 A;  1NWZ A;  3H82 B;  4NEE D;  4B4X A;  3PBO A;  3IBJ A;  5AJG A;  4Y13 A;  3W2Z A;  4O7D A;  4B88 A;  3ZG9 B;  3HLW A;  5J7E A;  4OPY A;  1NZU A;  3U2A A;  2EFX A;  3BY8 A;  1K6R A;  4IJG A;  5HWT A;  2ZQA A;  4JXG A;  2WGW A;  3T1S A;  3ZHH A;  4GD6 A;  1KE0 A;  1VEU A;  5F83 A;  3LR4 A;  4F3L A;  1BLP A;  1IEM A;  3PBN A;  4HH2 A;  1F98 A;  3T4L A;  3G6O A;  4Y7P A;  1H8M A;  4E3M A;  1TS8 A;  4P6Z M;  1N9L A;  1K56 D;  3VOL A;  2DRW A;  4BBT A;  1VET B;  1F9I A;  4Y0T A;  2HGV A;  3BFC A;  5FDS A;  5DJU A;  3S4X A;  1G6O A;  3OBF A;  4UEY A;  3TOI A;  3O3V A;  4DJ3 A;  4WMC D;  3CUE A;  3WS4 A;  1ESU A;  5J8X A;  1YQS A;  1SDE A;  3WS1 A;  4O8G A;  5EEC A;  4OQI A;  2WKI A;  1VQQ A;  1KE3 A;  4P0M A;  3MXR A;  4XT2 B;  2VLG A;  4JXV A;  1SZV A;  3NOT C;  4HY8 A;  3UNW A;  2VGK A;  3CJM A;  2WZZ A;  3W4P A;  2QHK A;  3GV9 A;  4ETZ A;  3AGE A;  2WKE A;  1TEM A;  4MEZ A;  5C5K A;  4D2O A;  4R23 A;  2XLN A;  4HHD A;  1MXO A;  3DWK A;  3LEZ A;  3RFB A;  3T12 B;  4ZAM A;  2CMN A;  5KIZ A;  3CHW P;  2V1A A;  4FSF A;  5FEG A;  3PBQ A;  3QP6 A;  1D06 A;  5F82 A;  3MQQ A;  5G18 A;  3VOZ A;  4KG2 A;  4MCW A;  5FQ9 A;  4CJN A;  4QJG A;  4R1G A;  1DRM A;  5FEF A;  5EVI B;  3F1O A;  1XFN A;  3UPN A;  3HUM A;  1ALQ A;  2OSU A;  2GX5 A;  3DTK A;  4JGO A;  1H3Q A;  1ERM A;  2XA7 M;  3UME A;  3MKF A;  1ZTU A;  3NBL A;  1S4S A;  3M6B A;  3DTM A;  1JWZ A;  4C3Q A;  1ODV A;  4K0X A;  1IFQ A;  1K25 A;  1YMX A;  4E3K A;  1MWS A;  2LB5 A;  2XR0 A;  3A0R A;  3TRC A;  3EOI A;  4X69 A;  5EVE A;  3S22 A;  1YMS A;  3I7J A;  4OKP A;  4IBR A;  1RGY A;  2Y2O A;  5HX9 A;  2VK3 A;  3ICY A;  1DJB A;  2O0Y A;  2V2F F;  4EQ1 A;  4RA7 A;  2A24 B;  2ZL1 A;  2L0W A;  4OPQ A;  3GQZ A;  1S4R A;  5M19 A;  3NIA A;  2Y2Q A;  4UA7 A;  1BLH A;  1MWT A;  3CAX A;  2P9V B;  4U0X A;  4KQQ A;  1ZG6 A;  5L10 A;  3SS3 A;  3LFV A;  4B93 A;  4QHC A;  1M40 A;  4G3V A;  3ZG5 A;  4E3I A;  4GNU A;  1BSG A;  2W1T B;  1F2K A;  1CK3 A;  1FOF A;  1FCN A;  1PRQ A;  2WAE A;  2Y55 A;  3CWF A;  4HI4 A;  5F6A A;  3O87 A;  2ZJ9 A;  3VOY A;  3UB7 A;  3EQV A;  3PHY A;  5FQJ A;  4L9F A;  1VM1 A;  1K56 A;  5HSQ A;  3F1P B;  3MR0 A;  4I3I A;  3Q82 A;  4DF6 A;  4N1X A;  1XGI A;  2WUQ A;  3LY3 A;  5CGW A;  4DE2 A;  2Y2J A;  2J3W A;  3UB9 A;  3SH9 A;  3FYZ A;  3SZT A;  4R3A A;  1QMF A;  1SKO A;  1XA1 A;  3JYI A;  4KUO A;  1GHM A;  2HDQ A;  2H0Y A;  5CGX A;  4WF0 A;  3K3C A;  1O7E A;  3C4P A;  2EX6 A; 
#chains in the Genus database with same CATH homology
 3PBS A;  2P04 A;  4HJ3 A;  2QJ7 A;  1TF1 A;  4NXF A;  5IT5 A;  4AFI A;  5TJJ A;  4LRX C;  1S1Z A;  2PD8 A;  4Q0I A;  3R7W B;  4GHI A;  4KQO A;  2OOL A;  3T4J A;  4ARZ B;  3FPW A;  4CLC A;  3PBT A;  1TS0 A;  3LR3 A;  1XJ6 A;  3C38 A;  2VA0 A;  4PKY G;  4ETX A;  5HD5 A;  1TS6 A;  3D72 A;  3MQO A;  4CQH A;  2VZW A;  3RH8 B;  2W1T A;  2ZBB A;  1DP9 A;  2B18 A;  4HJ6 A;  5HPI A;  3TJZ C;  3V67 A;  3IS2 B;  1IOU A;  3PXP A;  1NRJ A;  3E4Q A;  4I39 A;  1P9W A;  2K2N A;  2VV8 A;  3NHQ A;  2BAS A;  3GEC A;  4IUH A;  3UMD A;  2V0U A;  4BBV A;  5G4Z A;  4K08 A;  4OOM A;  5IU1 A;  3C30 A;  2EWW A;  3CUE C;  5FL3 A;  5MC7 A;  3MJQ A;  3F1O B;  5DJT A;  2QWS A;  3H7W B;  4DMZ A;  4WN5 A;  4BMW A;  1W63 M;  4L9E A;  2O9A A;  3F1P A;  4WLA A;  3D3O A;  2INW A;  1GSV A;  4MMN A;  1LSV A;  1OPX A;  3EWK A;  4YWZ A;  1STZ A;  2P7J A;  5TBM A;  4GS9 B;  4HNB A;  2V0W A;  4F3L B;  2D01 A;  3ZQ5 A;  1T1A A;  2JKR M;  3BQ8 A;  1XJ4 A;  3LID A;  2PD7 A;  3NJA A;  1DP6 A;  2ZOH A;  5DFY A;  4PHT A;  2FZ0 A;  2PT7 A;  2KDK A;  4HH3 A;  3T4O A;  1NLY A;  1VHM A;  2JKT M;  4MN5 A;  5F69 A;  4EES A;  3KSH A;  2VGL M;  1T18 A;  3B33 A;  3KYZ A;  5G4Y A;  2HJE A;  3SW1 A;  4WEJ A;  3KYQ A;  2NUP C;  3EEH A;  3UB8 A;  2Y79 A;  3PR6 A;  4Y3I A;  2OAQ 1;  2VGL S;  2PHY A;  3BW6 A;  3BJN A;  4NKP A;  5K5B A;  3BQA A;  4EW7 A;  4HQA A;  5F68 A;  4CLC D;  3MMH A;  1XJ2 A;  5IS1 A;  2M1C A;  4H6J B;  1LSW A;  5F5Y A;  3EEA A;  4RQ9 A;  3K3D A;  3R7W A;  1OT9 A;  2PYP A;  3T4K A;  3LIA A;  4ARZ A;  3S7O A;  3LIB A;  2IA2 A;  3P01 A;  4IHQ A;  4HP9 A;  3LUQ A;  4GJ4 A;  1LT0 A;  2QYB A;  2YKH A;  3PYP A;  5DFX A;  3VE3 A;  2W27 A;  4O01 A;  1MC0 A;  4LRY C;  3OCL A;  2KOI A;  1OTD A;  2Z6D A;  4B9O A;  2VX8 A;  2XRO A;  3IS2 A;  2JN7 A;  1NWZ A;  3H82 B;  4NEE D;  4Y5F A;  2P08 A;  5HDS A;  1S67 L;  3PBO A;  3IBJ A;  1OT6 A;  4G3K A;  2OWJ A;  5AJG A;  1V9Z A;  3W2Z A;  2ZOI A;  2A2L A;  2L1M A;  4EU0 A;  2O9B A;  2R78 A;  3LI9 A;  5J7E A;  3CIT A;  4R70 A;  3U2A A;  4WL9 A;  2H28 A;  3UB6 A;  3BY8 A;  4L0L A;  4IJG A;  1X0O A;  3BWL A;  5HWT A;  3H7W A;  2K31 A;  1YSP A;  5A8B A;  2VV6 A;  4Q0H A;  4II7 A;  5HPF A;  1YAX A;  2O99 A;  3O5Y A;  2I9V A;  3LR4 A;  1G28 A;  4GS9 A;  3OCN A;  4F3L A;  5HWW A;  3PBN A;  2W3H A;  4HH2 A;  3S7N A;  1F98 A;  5HDD A;  4L9G A;  1UWN X;  3T4L A;  3T4S A;  3G6O A;  4BBU A;  2VKS A;  2EA9 A;  5DF9 A;  1H8M A;  3H9W A;  2W3D A;  4KUK A;  4KQD A;  1TS8 A;  1N9O A;  4P6Z M;  1N9L A;  3VOL A;  3NOU C;  4I3J A;  3IBR A;  2MJ6 A;  2M7U A;  4BBT A;  3LIC A;  4P6Z S;  3B42 A;  1P97 A;  1XFQ A;  2FH5 A;  2W0N A;  3JVV A;  5HZH A;  1F9I A;  2W1R A;  2HGV A;  1D7E A;  4H6J A;  3T50 A;  5DJU A;  5CX7 A;  1TD5 A;  3F1N B;  1G6O A;  3OBF A;  2QKP A;  4MN7 A;  4UEY A;  4Q0J A;  2EWV A;  3KO6 A;  1WA9 A;  3RTY A;  5HDC A;  4DJ3 A;  3FPV A;  4LRZ E;  2VJW A;  2Z6C A;  3CUE A;  5J4E A;  1GSX A;  4LPZ A;  1P0Z A;  4JGR A;  4O8G A;  1LL8 A;  2ZMF A;  3EGD C;  4QPR A;  3LIF A;  4EET B;  2J80 A;  1YKD A;  3H82 A;  4XT2 B;  2VLG A;  4BJP A;  1KOU A;  2GNX A;  3VE4 A;  3NOT C;  4HY8 A;  2PR6 A;  3TE8 A;  3EQU A;  1MZU A;  3LI8 A;  3R4K A;  2GJ3 A;  4PKY A;  3C8C A;  2QHK A;  4CLC E;  3NOP C;  4ETZ A;  4MN6 A;  5AVE A;  5C5K A;  3E0Y A;  3KSF A;  1W63 Q;  4HHD A;  3VV4 A;  5HL6 A;  3B47 A;  3RFB A;  4OOL A;  3S7Q A;  2CMN A;  5KIZ A;  3E4O A;  3KSG A;  1TS7 A;  3ULF A;  2V1A A;  4IUK A;  4FSF A;  3PBQ A;  3S7P A;  3P7N A;  1D06 A;  3MQQ A;  1JNU A;  1N9N A;  3E98 A;  5J3W A;  4GCZ A;  3JVU A;  4MCW A;  1S1Y A;  4I38 A;  3MQ0 A;  1T1C A;  4PAU A;  1EW0 A;  4DJ2 A;  4ME4 A;  2J3T D;  4YOF A;  1DRM A;  3UE3 A;  4Z1W A;  3F1O A;  1XFN A;  3FG8 A;  5L8M A;  4M4X A;  5AVF A;  2GX5 A;  4CLC C;  4JGO A;  3F1N A;  2QJ5 A;  5KSH A;  5DKL A;  1UGU A;  1H3Q A;  2XA7 M;  2YKF A;  3UME A;  2V9A A;  1OTI A;  2O9C A;  3MXQ A;  1F5M A;  2G7U A;  4MDZ A;  3FC7 A;  2D02 A;  1ZTU A;  4BWI A;  3CLO A;  2V1B A;  2XA7 S;  4GW9 A;  5LBR A;  2JHE A;  1S4S A;  2XSS A;  1ODV A;  1DP8 A;  2Y8H A;  2W3G A;  1IFQ A;  4XT2 A;  2LB5 A;  3PBR A;  3A0R A;  2LB9 A;  3TRC A;  3EOI A;  2OWH A;  2JKR I;  3HJK A;  4JGP A;  3GDI A;  1ZHH B;  2XRN A;  4FOF A;  3ICY A;  4LLO B;  2O0Y A;  1VB6 A;  2JKT I;  2K7S A;  1P9R A;  2J3T C;  4EQ1 A;  4GLQ A;  2M7V A;  1UWP X;  2ZMV A;  4JGQ A;  5HD3 A;  3UE6 A;  1MKM A;  2A24 B;  2B02 A;  2L0W A;  3OC2 A;  3E4P A;  4Y2F A;  1S4R A;  4HJ4 A;  1OTB A;  4O0P A;  1GSW A;  3BY9 A;  2VV7 A;  1NLZ A;  3CAX A;  1YSQ A;  5HWV A;  4WUJ A;  2W3E A;  3LIE A;  3T4Q A;  4GHI B;  3A0S A;  3A0V A;  3LFV A;  4B93 A;  4CLC B;  2HV1 A;  3DBA A;  1OTE A;  3LR0 A;  1OJG A;  3CI6 A;  4G3V A;  1LSX A;  2W1T B;  4I3A A;  5DKK A;  4R6L A;  1OJ5 A;  3K2N A;  2PDR A;  3LR5 A;  3T4T A;  3C2W A;  3HJI A;  2PR5 A;  2NUT C;  3LYX A;  3MF0 A;  4ZRR A;  3CWF A;  5F6A A;  4HI4 A;  2VEA A;  2L4R A;  3HCY A;  3UB7 A;  2HF6 A;  3EQV A;  3PHY A;  1XJ3 A;  3KX0 X;  3TW8 A;  3KSI A;  4L9F A;  4NXB A;  4WEK A;  1T19 A;  2HJ9 C;  1S66 L;  3OLO A;  2PYR A;  1T1B A;  2KX6 A;  5HSQ A;  3F1P B;  3MR0 A;  4I3I A;  4EER A;  4HOI A;  4G3W A;  5EFW A;  5I5L A;  4EUV A;  3OOV A;  4UQI M;  2J3W A;  4EEP A;  5TBM B;  3UB9 A;  4HIA A;  4YNR A;  2GZA A;  4R3A A;  2OAP 1;  4UQI S;  4EXO A;  1OTA A;  4E04 A;  4WEL A;  4HP4 A;  1Y28 A;  2WKR A;  4KUO A;  4DN0 A;  2W3F A;  4NXE A;  4EEU A;  2DMW A;  2WKP A;  1BYW A;  3ZYT A;  4WF0 A;  2A24 A;  1V9Y A;  4I5S A;  3EGX C;  2WKQ A;  4R38 A;  3K3C A;  2KLI A;  3MFX A;  4NXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...