3H9WA

Crystal structure of the n-terminal domain of diguanylate cyclase with pas/pac sensor (maqu_2914) from marinobacter aquaeolei, northeast structural genomics consortium target mqr66c
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
109
Chain Sequence
KAIPWKINWQTMAFEYIGPQIEALLGWPQGSWKSVEDWATRMHPEDQEWVVNFCVKQSECGVDHEADYRALHRDGHYVWIRDVVHVVRDDSGEVEALIGFMFDISLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diguanylate cyclase with PAS/PAC sensor
publication title Northeast Structural Genomics Consortium Target MqR66C
rcsb
source organism Marinobacter aquaeolei
molecule tags Structural genomics, unknown function
total genus 30
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h9wA00
1TS7A 5F5YA 5HZHA 4JGRA 2OOLA 1XJ3A 3MQOA 3G6OA 2INWA 5DJTA 3KX0X 4WLAA 3T50A 4HP4A 4NXGA 1UGUA 2ZOIA 1T18A 2VV6A 5DKKA 3H82B 2B02A 3EEHA 2V0WA 4GW9A 1LSVA 3H7WA 3E4QA 3BY8A 5AVEA 3GECA 4KUKA 2R78A 3ULFA 1NWZA 3VE3A 4BBVA 4I3IA 5KIZA 3H7WB 3VOLA 3F1PB 4K08A 4BBUA 5J7EA 5G4ZA 1G28A 1S1ZA 1P0ZA 2V9AA 2QHKA 4H6JB 5TBMB 1DP8A 1GSVA 1OTBA 5EFWA 1DP6A 3LIDA 4GS9B 4BBTA 2JN7A 4E04A 1OT9A 1TS6A 3LICA 2WKQA 1ODVA 4L9EA 3A0RA 4WF0A 2D01A 3NOPC 1F98A 3UB8A 2M1CA 5AVFA 4HI4A 2VV8A 1MZUA 1XFNA 1UWNX 4DJ3A 3UB7A 4EETB 1XJ6A 3BY9A 1Y28A 2PD8A 1S4SA 1TS0A 3D72A 3E4PA 1DP9A 4F3LB 3LIEA 4R3AA 2PYRA 4NXEA 4GHIB 1XJ4A 5DKLA 4HHDA 3LIFA 1DRMA 4LLOB 2D02A 5J3WA 3IBRA 2ZBBA 2V0UA 3BWLA 5F6AA 5IS1A 5IU1A 1UWPX 3CWFA 3FC7A 5HWVA 1D06A 4JGPA 1T19A 2HV1A 4HQAA 4HOIA 4YWZA 4I38A 3UB6A 4R70A 1LT0A 3VE4A 4EERA 3LIAA 1LSWA 1WA9A 3LI8A 3UE6A 2Z6CA 4EQ1A 2W0NA 2V1AA 1X0OA 4HJ4A 2J80A 4EEUA 1BYWA 1XFQA 4HH3A 4PKYG 1OTAA 3EWKA 2I9VA 3GDIA 5HWTA 2JHEA 1OTEA 2GJ3A 3ICYA 2W27A 1V9ZA 2P7JA 2L0WA 5HD5A 3F1OA 2QWSA 3ZQ5A 2L4RA 3E4OA 1EW0A 2PDRA 4LRXC 3OLOA 1N9LA 1S1YA 4WUJA 3F1OB 2BASA 3A0SA 2V1BA 4HY8A 1D7EA 4KQDA 4HJ6A 2VV7A 1OTDA 5J4EA 1GSXA 3F1NA 2PD7A 5DJUA 3CAXA 1N9OA 2PR5A 2PR6A 2A24A 4DJ2A 4MN5A 3NHQA 2YKFA 4HIAA 5I5LA 1P97A 3UMDA 2WKPA 2PHYA 1LSXA 2A24B 3MFXA 4XT2A 3HJIA 2WKRA 3UB9A 5HSQA 2OWHA 5HD3A 4I3AA 4L9GA 4B9OA 1N9NA 1OJ5A 2QJ7A 2KX6A 3UMEA 5HWWA 3MR0A 1OT6A 1T1AA 4EXOA 2CMNA 2ZOHA 3H82A 1LL8A 3RTYA 4HJ3A 2KDKA 3CLOA 3H9WA 4LRYC 3MQQA 3C2WA 4NXFA 5HDDA 5HDSA 3LI9A 5G4YA 2OWJA 4LRZE 1GSWA 3NOTC 5HDCA 3K3DA 4JGQA 2QJ5A 2Z6DA 3SW1A 3F1PA 3C8CA 5A8BA 1TS8A 1JNUA 4WL9A 3PHYA 4L9FA 4R38A 3K3CA 3A0VA 4H6JA 4KUOA 5TBMA 1T1CA 5F68A 4WN5A 2EA9A 4HH2A 2VEAA 4HNBA 4GS9A 1S67L 1OTIA 1KOUA 4EEPA 4EW7A 4M4XA 5F69A 1XJ2A 2VLGA 3B33A 2PYPA 4R6LA 4I3JA 4RQ9A 4HP9A 3MXQA 4I39A 2L1MA 3LYXA 4LPZA 3F1NB 3IS2A 3RH8B 3NJAA 1S4RA 3LUQA 3P7NA 2QKPA 1T1BA 4NXBA 3MJQA 3PYPA 4EESA 1OJGA 4F3LA 4GCZA 4PKYA 1S66L 3HJKA 3IS2B 4JGOA 3LIBA 2YKHA 4GHIA 3FG8A 1F9IA 2K7SA 1V9YA 4XT2B 1VB6A 2H28A 3NOUC 4I5SA 4MN6A
chains in the Genus database with same CATH superfamily
5HZHA 4B4ZA 4JGRA 3QP5A 1A0KA 2OOLA 3G6OA 1EI5A 2INWA 1VETB 4JBFA 5DJTA 1LL5A 3ZG0A 1S0WA 4EU0A 1FR6A 2FZ0A 1UGUA 2ZOIA 4OQHA 3EEHA 4JXSA 4B4XA 3E4QA 5CEDA 4LV0A 2OAQ1 3PTEA 1L3LA 1HVBA 3ULFA 2EFXA 4BBVA 4I3IA 5CTMA 3C7UA 4EQIA 5HW3A 3VOLA 3F1PB 4GN2A 1TDGA 4K08A 4Q8IA 4CJNA 2WGWB 1DY6A 5CXWA 4QY6A 1FOFA 3PBNA 3FPVA 3ITBA 2W3FA 3IF6C 1XA7A 1J3WA 1XPBA 4D2OA 4E6XA 2O9AA 4NEED 5A91A 3UDFA 4K0WA 5EE8A 3G2YA 5FQIA 5FQQA 1GHMA 2XFSA 1JWZA 4JF6A 1TVFA 5HARA 3SH9A 4RYEA 1HZOA 5M1AA 3ZG7B 4S2NA 1F98A 5F82A 1H5XA 5AVFA 5FI6A 4UQIS 1MZUA 1XFNA 3R7WA 1UWNX 4LCLA 3UB7A 4EETB 3BY9A 2VA0A 1Y28A 1KE0A 4PM6A 5KMWA 4K91A 3KO6A 2X71A 3U4LP 4X1LA 3E4PA 4MBFA 4CLCB 4YNRA 2FFYA 1ERQA 4F3LB 1BSGA 4Y2FA 3DW0A 2PU4A 4YOFA 3BFGA 4GHIB 3ZNTA 1XJ4A 5DKLA 1YLZA 4X68A 3V5MA 1FILA 3V39A 2D02A 3Q82A 3IF5A 1TD5A 1YAXA 2GNXA 4GKUA 2JKRI 3LR3A 4OLDA 2BLSA 5E2EA 3ZFZA 3Q07A 4Q0IA 5A93A 3GSGA 3KSGA 3LR0A 4O8GA 1NXYA 4YWZA 4IUHA 2JKTI 4R70A 1E4DA 2ZQ7A 1O07A 1EROA 2IA2A 2VZWA 4QB8A 1X0OA 2J80A 3IXGA 3KSFA 1YSQA 4PM5A 5IT5A 1PZOA 4OPYA 3S1YA 3T4SA 3P01A 4G3VA 1OTAA 4PM8A 5KSCA 3GDIA 3HLEA 2QMIA 1Q2PA 5HWTA 3IHAA 2JHEA 2GJ3A 4PMAA 1PI5A 2XD1A 1V9ZA 1DJCA 1FCMA 2WGVA 5CTNA 3AGEA 3BQAA 2QWSA 3ZQ5A 2V20A 2L4RA 1EW0A 5CGXA 2NUTC 2XK1A 3LEZA 3SS3A 3A0SA 4ZTKA 5CX7A 4LCMA 3W2ZA 1XKZA 4HY8A 2ACGA 4FH4A 4HJ6A 5E2GA 2VV7A 3D4FA 3MFDA 5CHJA 2C5WB 2J3TC 3OC2A 1IEMA 3HLGA 3QNCA 2P04A 4WELA 2EFUA 1MWTA 3FKWA 1N9OA 4JLFA 3TW8A 2XA7M 4DJ2A 5CEBA 2YKFA 1NJ4A 4PM9A 1P97A 4M3KA 4KZ3A 1O7EA 4PPRA 4WMCA 2PHYA 3CPTB 4GOGA 4XT2A 4R3JA 5HL6A 4WEKA 2DCFA 3AGDA 1MKMA 3ISGA 3VSKA 5E43A 1OT6A 1T1AA 3UDXA 1NYYA 3LO7A 4FTXA 4L0LA 4S2IA 3RTYA 4KG5A 4QY5A 2OLVA 3CLOA 3G2ZA 2JKRM 3WS0A 4MNRA 3BRMA 4FSFA 2WAFA 4LRZE 4O7DA 3K3DA 4WYYA 2Z6DA 1IKGA 1MY8A 5D3OA 2JKTM 3C8CA 3IF6B 3DWZA 4A5RA 4MCWA 2O9CA 4IBXA 3NECA 1ALQA 2ZL1A 3B47A 2Z2MB 3R4KA 2FFFB 3M2JA 3V3RA 4LV2A 3WWXA 3NC8A 4L9FA 4H6JA 5TFQA 4KZ5A 4WN5A 2EA9A 4UA9A 2Y2JA 3BW6A 1BLHA 1BULA 4NK3A 1KOUA 3G32A 3DWKA 1KE3A 1IYSA 4Y0UA 3QP8A 2V8FA 3W4OA 2P74A 2Y8HA 4OONA 3C4PA 2Y2HA 1SKOB 3HLFA 3CJMA 5DFXA 1K56A 4PM7A 4CLCD 4UA7A 2DRWA 2ZC7A 2HGVA 3VP4A 4MMNA 1SHVA 4LPZA 3F1NB 3IS2A 3NJAA 1S4RA 2XR0A 3UY6A 1T1BA 3EGXC 4DF6A 3PYPA 2W3HA 4XUZA 3MS6A 3HJKA 4IVKA 3RFBA 4G3WA 5M18A 1QMFA 2WAEA 4E3JA 2OLUA 3T1RA 1SZVA 2H28A 5FEFA 4R3BA 4RA7A 4GDBA 3ZNYA 4UEYA 5EM1A 1JWPA 1TS7A 4UAAA 5F5YA 1NY0A 2P9VA 3U2AA 4DE0A 1SDEA 1DJBA 4N9LA 5M19A 2JKGA 3RXXA 3KX0X 4IBRA 3EQUA 2B18A 4X53A 1JWVA 4GD8A 3E98A 3V67A 2ZC4B 1SKFA 5DKKA 1JTDA 1W79A 3W4QA 2B02A 4EWFA 1YLJA 4GW9A 3PBSA 5DVAA 3H7WA 3UB5P 3GECA 1ACFA 2R78A 4KQQA 3SZTA 1NWZA 4Y13A 3Q7VA 5EVEA 2UWXA 3HUNA 4X6TA 4FOFA 3MKEA 2MJ6A 3BFFA 5FI7A 1ZKJA 4BBUA 5J7EA 4KZAA 3WRTA 4Y15A 4KZBA 2IWCA 1S1ZA 2V9AA 2HDQA 4WEJA 5AJGA 3VFFA 5TBMB 1DP8A 3LFVA 4GS9B 4S2PA 2JN7A 1YSPA 4E3LA 4F94A 3DBAA 2GDNA 4OPZA 4EBLA 3LICA 1ODVA 3W4PA 4R0QA 3IWIA 4L9EA 3A0RA 1Y54A 4WF0A 2VJWA 1JTGA 3EEAA 3TG9A 1K0KA 1BLPA 2M1CA 1I5QA 5E2HA 4CQHA 1GA0A 1WYBA 4DJ3A 1PZPA 4E3IA 1XJ6A 1PW8A 4NG2A 4NETA 1KVMA 4QU3A 2PD8A 2PAVP 4DN0A 2WKIA 4S2OA 4Y0OA 1GHIA 3D72A 5TJJA 3LEQA 1GCEA 1ESUA 3A3IA 5AQ9A 5HL1A 2G2UA 5HX9A 3VP1A 2PYRA 5U47A 1F5MA 1L0DA 3BLSA 3QP4A 2J9OA 2ZQDA 1P9RA 5FATA 3GR2A 5J3WA 2IWDA 2Y2PA 3BWLA 4P85A 5FA7A 2ZM0A 4OOLA 5IU1A 3N8RA 5DTSA 4II7A 1P9WA 1VQQA 3D9YA 4BLMA 3B42A 2WKHA 4JF4A 4GJ4A 5FEGA 1D06A 3K2NA 5GLBA 4JGPA 3IX3A 2ZM8A 2ZMFA 4HOIA 3WS2A 3KYEA 1LT0A 1XX2A 5CRFA 4KZ8A 1Z6FA 3LGOA 5CGSA 1NZUA 4FH2A 4EQ1A 2J7VA 3HL9A 1OMEA 2I72A 1H0MA 3HLWA 4HJ4A 2A3UA 3B3XA 1XFQA 4ZJ1A 2IWBA 4Q0HA 2I9VA 4R1GA 2XDMA 4B88A 4BMWA 3PBRA 2H10A 2XD5A 3LR5A 4IEDA 3IH8A 1YQSA 2Y91A 3HREA 1LHYA 2HDRA 1N9LA 3MXRA 3I7JA 4LENA 1S1YA 1FSWA 4P6ZS 4DMZA 4RX2A 3DTIA 2V1BA 4YFMA 1FCNA 4KQDA 5GHYA 4CLCE 3MZFA 3M6BA 1EWZA 2PD7A 3N7WA 5DJUA 5FDHA 2WGIA 2W3EA 2A24A 1K57A 4OOYA 5JYOA 2J8YA 4OP8A 3Q7ZA 3ZVWA 4E6WA 4KZ4A 4N1XA 3MFXA 5DF9A 1HTZA 2WKRA 3OPLA 2EX8A 3P98A 1K4FA 4I3AA 4B9OA 3CG5A 1G5UA 1OJ5A 3BFEA 2ZQ8A 1SDNA 2W1TB 2KX6A 3UMEA 5HWWA 1KVLA 1VETA 3LCEA 2VGLM 2Y2KA 3G34A 1K54A 3P09A 2ZOHA 1J9MA 4O0PA 3UPNA 3VP0A 5HPFA 2H5SA 4MLLA 2R9XA 3ZVTA 4DE1A 3KSHA 4OPQA 3G31A 4P6BA 3BM6A 3T1XA 2OWJA 5G4YA 2OV5A 2J3TD 1IELA 3NOTC 3T12B 4JXGA 5EM0A 2QJ5A 3SW1A 4OPRA 3F1PA 4BL3A 2XRNA 2WGWA 3A3FA 1JNUA 4KZ7A 1K6RA 4LV1A 3PHYA 2GX5A 3K3CA 3UPOA 3QNBA 1RCJA 1ERMA 4KUOA 3HVFA 2Y2GA 4EBNA 5HAIA 3E2KA 3PR6A 1ZC2A 2DMWA 3T4JA 2C6WB 4HBUA 2XF3A 3T4KA 1H8YA 5GHZA 4OH0A 1VEUA 4DDSA 4GD6A 2A2LA 4RX3A 2K2NA 2KLIA 2H0YA 3JVVA 4LV3A 1FSYA 1TF1A 3LYXA 1H8ZA 2XH9A 3O87A 2HJ9C 1CF0A 5EVIA 3OCNA 4K0XA 4KQOA 2QKPA 5IHVA 5L10A 3A3JA 3MJQA 4F3LA 1CK3A 1S66L 2XSSA 1G68A 1BZAA 3IS2B 3MQ0A 4GHIA 3FG8A 4S2NC 5EOOA 2K7SA 1MWUA 5CHUA 1OPXA 1E3UA 3NOUC 5F83A 2Q9MA 2VKSA 4MN6A 2CC1A 2JBFA 1YMSA 3IWQA 3LY3A 4Q0JA 1ES3A 2V2FF 1NLZA 4HP4A 4MEZA 1AWIA 3HCYA 2P9VB 1T18A 4Y7PA 3GVBA 3H82B 3NY4A 3O3VA 1AXBA 1H3QA 4QD4A 3T1SA 4ARZA 3BY8A 4DE3A 4KUKA 2Y2OA 2QPNA 3CUEA 3VE3A 4GNUA 3CI6A 3H7WB 5HAQA 1MKIA 5FI2A 4H8RA 4X69A 1PFLA 3S7NA 1CQAA 1XP4A 3EOIA 5FQMA 3WS5A 5AQBA 1M40A 2ZQAA 4QJGA 4MBKA 2K31A 1P0ZA 1YLWA 4EUVA 2ZD8A 2WKEA 1GSVA 3NIAA 3RJUA 3BQ8A 2HJEA 4OQ0A 1OTBA 5A92A 4GLQA 3MZDA 2G2WA 2AVXA 4E04A 1OT9A 1TS6A 2EX2A 3N4IA 2WKQA 2XA7S 2WADA 3G35A 4WMCD 2Y4AA 2D01A 1ZG4A 3NOPC 2J3WA 2LB5A 2ZC3B 4HI4A 2VV8A 5CECA 1W8QA 4IHQA 3SS5A 3OCLA 1F2KA 1C3BA 2JKFA 4BD1A 1S4SA 4PAUA 3OOVA 4N1HA 3FKVA 3NDGA 1XGJA 3M6HA 5GLCA 3QP2A 1DP9A 2PRFA 3PBOA 3O5YA 3BEBA 5FQJA 1PWDA 4R3AA 4ME4A 5A90A 3SS4A 4NXEA 1L0FA 2Y2NA 4HHDA 3BECA 5DFYA 4JF5A 1DRMA 4OVDA 4LLOB 2PBDP 2WZZA 3IBRA 5EVIC 2ZBBA 2V0UA 5IS1A 3IWOA 1UWPX 2JC7A 1W8YA 1BUEA 2Y2IA 3CWFA 4GB7A 3W8KA 4OP5A 1T19A 2HV1A 1CEFA 3O86A 4XUXA 3UNWA 3VE4A 4OQGA 3BLMA 1W63M 3CMZA 2VGJA 3UE6A 4EBPA 2ZQCA 1CI8A 2Z6CA 5EOEA 2WK0A 3LY4A 2W0NA 3SH7A 3T4OA 2ZJ9A 4MBHA 3MF0A 4QWOA 4Y5FA 5GHXA 4EEUA 3UE3A 3JPUA 5KSHA 2LB9A 3S7PA 2E8IA 2XLNA 1OTEA 3ICYA 2W27A 2O9BA 2L0WA 1DJAA 3F1OA 4N92A 1LL9A 5E2FA 1PW1A 3M2KA 1YM1A 4LRXC 3OLOA 1L0GA 3T4TA 3TJZC 4YINA 3CUEC 1SKOA 3V50A 5LBRA 1MPLA 1BT5A 1K25A 4WM9A 3ZDJA 5G18A 3MBZA 3FV7A 1K6SA 2HDSA 4WUJA 4ID4A 2XROA 3L9KA 2BASA 1LLBA 2JE5A 1W63Q 3MKFA 1D7EA 5C5KA 3QP1A 4Y3IA 1OTDA 2J9PA 3EGDC 3OZHA 3A3DA 3HUOA 3IT9A 3F1NA 3WS4A 3O88A 2PR5A 1K38A 2RL3A 4MN5A 3NHQA 4HIAA 5I5LA 2WKPA 2OAP1 3R7WB 4UQIM 3IX8A 2KOIA 4MN7A 2XFTA 1JVJA 2A24B 1TEMA 5K5BA 5HD3A 4O01A 4L9GA 4EUZA 4LFUA 3VFHA 2QJ7A 2WZXA 2HZ5A 3C38A 4Z9QA 3T4LA 1PYYA 4U0TA 4HEFA 1E25A 1D1JA 2NUPC 1WYCA 4C75A 5TR7A 3PXPA 5MC7A 1LL8A 2Y2LA 4FCFA 3H9WA 4LRYC 3IXDA 1BTLA 1ES5A 4NXFA 4UHUA 5HDDA 4OOMA 3LI9A 3DTEA 1ZG6A 1GSWA 1MC0A 3HLDA 3IX4A 2X02A 5HDCA 4C3QA 4WZ4A 1YLPA 2EXAA 4ZDXA 3GMWA 4DRTA 5A8BA 4X56A 1TS8A 3IXBA 1CEGA 5KZHA 4UA6A 4R38A 4JXWA 3A0VA 1Z09A 3NCKA 5TBMA 1KDWA 4IVIA 5F68A 5FL3A 3G30A 3OPHA 2W3DA 1FR1A 5HAPA 3IH9A 4GS9A 3GRJA 3HLBA 1ES4A 3MZEA 4DXBA 3D3OA 4EW7A 4M4XA 5F69A 4ZBEA 1XJ2A 2Q0OA 2VLGA 2ZMAA 3B33A 2PYPA 3WRZA 3BFDA 3ZHHA 3CZDA 4I3JA 4S2MA 1NLYA 3IHBA 4RQ9A 2ZC6B 2FH5A 4I39A 4MDZA 3EQVA 1IYQA 3TE8A 4BL2A 2L1MA 4FD8A 1VEUB 1XGIA 2EWVA 3C5AA 2PBYA 4NXBA 1OJGA 2HP5A 4E3KA 4GCZA 5L07A 4KG6A 4PKYA 5EVIB 1G6OA 4IJGA 3VP3A 5HPIA 3LIBA 3V3SA 1S6RA 1V9YA 2HF6A 2A49A 1M6KA 4Y17A 4XT2B 3Q81A 5GLAA 4OLGA 3VOZA 1N9BA 2EX9A 1CJFA 2HP6A 1NRFA 5I94A 1XXMA 1K4EA 1XJ3A 3MQOA 4R23A 2UV0E 4WLAA 1STZA 3T50A 1RP5A 3MXSA 3MMHA 1ONGA 4NXGA 1IYOA 2Y59A 2VV6A 4ZRRA 2V0WA 2O99A 5FAQA 1LSVA 1SCWA 2BTFP 3IBJA 5FASA 1KGEA 5AVEA 3G4PA 4ZAMA 3FWLA 3UN7A 1IKIA 2EWWA 1MXOA 3HUMA 3UE1A 5KIZA 4PHTA 3VV4A 3FZCA 4GZBA 2PT7A 4ARZB 1PIOA 1LI9A 3BFCA 1YPRA 2W3GA 3C7VA 1PWGA 4OQIA 4QHCA 2RCXA 2ZL1B 1WE4A 1QMEA 5F1FA 5G4ZA 1G28A 4Z1WA 4E3MA 3T4QA 2QHKA 4H6JB 2ZLYA 3ITAA 1ES2A 5FSRA 4XXRA 5EFWA 1DP6A 3LIDA 3CHWP 1YLTA 4BBTA 3N8LA 4LGWA 3GV9A 2B5RA 4P87A 1IOUA 1NYMA 2QYBA 2PU2A 4KG2A 3C30A 4R4SA 1KGFA 2B95A 2V1ZA 3NDEA 3UB8A 1L0EA 1W7FA 3TOIA 5JYPA 4CLCA 1TDLA 3KYZA 4E3NA 5L8MA 3CITA 1CI9A 1TS0A 3S4XA 3OPPA 3LIEA 2VGLS 2W1TA 2Q9NA 2HP9A 3QP6A 1K55A 3JVUA 1K57C 3C4OA 4BQMA 2WYXA 3LIFA 1NZOA 3DTMA 4ZJ3A 2OSUA 2XGNA 3T1QB 5F6AA 1YLYA 2JCHA 1HLUP 1Y4OA 3GQZA 4N9KA 4U0XA 5TGFA 3SH8A 3LR4A 2Y2QA 3E0YA 4S2KA 4WZ5A 4BD0A 3FC7A 5EPHA 5HWVA 3VSLA 1IFQA 1I2WA 4JKTA 1I2SA 5L2FA 4HQAA 2Y55A 1U60A 1ONHA 4I38A 3VMAA 3UB6A 2BG1A 4EERA 3LIAA 1K54C 1LSWA 1WA9A 2GZAA 2X01A 3LI8A 3OPRA 4P0MA 4DKIA 4U3TA 1VM1A 2V1AA 1BYWA 3Q7VB 3ZG8B 4HH3A 4PKYG 1ZTUA 3EWKA 1KGGA 1L2SA 1PI4A 5F1GA 2Z2LB 2ZQ9A 5BOHA 4AFIA 2ZM2A 4JPMA 2P7JA 3BYDA 1GHPA 5FQKA 2W1RA 2VGKA 3PAEA 5HD5A 3TSGA 4BJPA 4DXCA 3E4OA 2PDRA 2R9WA 3DTKA 5FAOA 3F1OB 5EVID 4KZ9A 5CERA 3S22A 3NBLA 5HFOA 1IYPA 5EUAA 3BJNA 4BENA 3UO9A 1NRJA 2VX8A 3FPWA 4X1MA 4D60A 1GSXA 5J4EA 2EX6A 4BWIA 3CAXA 3RXWA 3CPTA 5FDSA 2PR6A 3S7OA 2HDUA 4JXVA 2V8CA 4DE2A 1E3UD 3UMDA 1ESIA 3MSHA 1MWRA 3A3EA 2M7UA 5EVLA 1LSXA 3HJIA 3IXHA 1N4OA 1G6AA 3UB9A 5AQAA 3NI9A 4OKPA 1RGZA 5HSQA 2P08A 2OWHA 3AGFA 5AQ7A 2EXBA 3UE0A 3ZGAB 1N9NA 2H0TA 4E3OA 3E2LA 3TRCA 3KSIA 4KENB 2ZMVA 5EECA 5CGWA 4G3KA 3OBFA 3MR0A 2E8JA 4ESPA 3PBQA 4CLCC 4EXOA 2CMNA 5DF8A 4Y0TA 3N6IA 4HBTA 3H82A 5CHMA 4HJ3A 3PAGA 3FYZA 3VP2A 2KDKA 1VHMA 4CPKA 3MQQA 3UPPA 2G7UA 3C2WA 4ZJ2A 1LI0A 1MWSA 2DNSA 4KQRA 3SOIA 3N8SA 3IF6A 1K55C 3HBRA 5DTKA 1YMXA 5HDSA 1PRQA 4B93A 2WUQA 2Y2MA 3PBTA 4JGQA 3JYIA 3WS1A 1GA9A 1RGYA 1BLCA 4QPRA 1FCOA 2O0YA 4WZ5C 4WL9A 1HD8A 4WBGA 1K56D 1MBLA 4DDYA 1T1CA 2Y79A 5DTTA 1PWCA 5EV0A 1FQGA 5J8XA 4HH2A 2VEAA 1KDSA 4HNBA 3ZCZA 1S67L 1BLSA 1OTIA 4X25A 4EEPA 3IQAA 3DAVA 4R4RA 1YT4A 4ETZA 4NKPA 2XEPA 5L09A 2ZC5B 4R6LA 1H8MA 5DF7A 4HP9A 3ZYTA 4S2JA 3MXQA 1Q2QA 3L7HA 4GDNA 2QZ6A 4P6ZM 2VK3A 3ZG9B 4ETXA 1YKDA 4IUKA 4HESA 4KZ6A 4X55A 3ZG5A 4EV4A 1FIKA 5GL9A 3RH8B 1W5DA 3LUQA 3P7NA 3VOYA 1PNEA 3KYQA 4EESA 5FAPA 4C6YA 4FUWA 3NULA 3QHYA 5FQ9A 5GLDA 3S7QA 1XA1A 1KE4A 2M7VA 4RVAA 4JGOA 2YKHA 1F9IA 3GTCA 4S2LA 3UDIA 2XQZA 1VB6A 1ZHHB 3Q1FA 4I5SA 3HLCA 2HPBA
chains in the Genus database with same CATH topology
4UEYA 1TS7A 5F5YA 5HZHA 3U2AA 4JGRA 2OOLA 1XJ3A 3MQOA 3G6OA 2INWA 5DJTA 4Q0JA 3KX0X 3EQUA 4WLAA 1NLZA 1STZA 3T50A 2B18A 4EU0A 4HP4A 3E98A 3MMHA 3V67A 3HCYA 4NXGA 2FZ0A 1UGUA 2ZOIA 1T18A 2VV6A 5DKKA 4ZRRA 3H82B 2B02A 3EEHA 2V0WA 2O99A 1H3QA 4GW9A 3PBSA 1LSVA 3H7WA 3IBJA 3E4QA 4ARZA 2OAQ1 3BY8A 5AVEA 3GECA 4KUKA 2R78A 3ULFA 1NWZA 3CUEA 3VE3A 2EWWA 4BBVA 4I3IA 5KIZA 4PHTA 3VV4A 4FOFA 3CI6A 3H7WB 2MJ6A 2PT7A 4ARZB 3S7NA 3VOLA 3F1PB 3EOIA 2W3GA 4K08A 4BBUA 5J7EA 5G4ZA 1G28A 1S1ZA 4Z1WA 2K31A 1P0ZA 3T4QA 2V9AA 2QHKA 4WEJA 3PBNA 4H6JB 3FPVA 4EUVA 2W3FA 5AJGA 5TBMB 1DP8A 1GSVA 3BQ8A 2HJEA 1OTBA 5EFWA 4GLQA 1DP6A 3LFVA 3LIDA 4GS9B 4BBTA 2O9AA 4NEED 2JN7A 4E04A 1OT9A 1YSPA 1TS6A 3DBAA 3LICA 2WKQA 1IOUA 1ODVA 2XA7S 4L9EA 3A0RA 4WF0A 2QYBA 2D01A 3C30A 2VJWA 3EEAA 3NOPC 1F98A 2J3WA 3UB8A 2LB5A 2M1CA 5AVFA 4UQIS 4HI4A 2VV8A 4CQHA 1MZUA 1XFNA 3R7WA 1UWNX 4CLCA 4DJ3A 4IHQA 3UB7A 4EETB 3OCLA 1XJ6A 3BY9A 2VA0A 1Y28A 3KYZA 2PD8A 3KO6A 5L8MA 4DN0A 1S4SA 3CITA 4PAUA 3OOVA 1TS0A 3D72A 3E4PA 5TJJA 4CLCB 1DP9A 4YNRA 4F3LB 3PBOA 4Y2FA 3LIEA 2VGLS 3O5YA 2W1TA 4R3AA 4ME4A 4YOFA 2PYRA 1F5MA 4NXEA 4GHIB 1XJ4A 5DKLA 4HHDA 3JVUA 3LIFA 5DFYA 1P9RA 1DRMA 4LLOB 2D02A 5J3WA 3IBRA 2ZBBA 2V0UA 3BWLA 5F6AA 1TD5A 5IS1A 1YAXA 4OOLA 5IU1A 1UWPX 2GNXA 2JKRI 3LR3A 3LR4A 4II7A 1P9WA 3E0YA 3B42A 4Q0IA 3CWFA 4GJ4A 3FC7A 3KSGA 5HWVA 1D06A 3K2NA 3LR0A 4JGPA 1IFQA 4O8GA 1T19A 2HV1A 4HQAA 2ZMFA 4HOIA 4YWZA 4I38A 3UB6A 4IUHA 2JKTI 4R70A 1LT0A 3VE4A 4EERA 3LIAA 1LSWA 1WA9A 1W63M 2GZAA 3LI8A 3UE6A 2Z6CA 4EQ1A 2IA2A 2VZWA 2W0NA 3T4OA 2V1AA 3MF0A 1X0OA 4HJ4A 2J80A 4Y5FA 4EEUA 1BYWA 3KSFA 1YSQA 3UE3A 1XFQA 5IT5A 4HH3A 4PKYG 4Q0HA 3T4SA 3P01A 4G3VA 1OTAA 1ZTUA 3EWKA 2I9VA 5KSHA 2LB9A 3GDIA 3S7PA 5HWTA 2JHEA 1OTEA 4BMWA 2GJ3A 3PBRA 4AFIA 3ICYA 2W27A 1V9ZA 2O9BA 2P7JA 2L0WA 2W1RA 3BQAA 3LR5A 5HD5A 3F1OA 2QWSA 4BJPA 3ZQ5A 2L4RA 3E4OA 1EW0A 2PDRA 4LRXC 3OLOA 3T4TA 3TJZC 1N9LA 3CUEC 2NUTC 5LBRA 1S1YA 4P6ZS 4WUJA 2XROA 3F1OB 4DMZA 2BASA 3A0SA 2V1BA 5CX7A 3W2ZA 1W63Q 4HY8A 1D7EA 4KQDA 5C5KA 4HJ6A 4Y3IA 2VV7A 3BJNA 1OTDA 2J3TC 3OC2A 1NRJA 2VX8A 3FPWA 3EGDC 4CLCE 5J4EA 1GSXA 3F1NA 2P04A 4BWIA 2PD7A 4WELA 5DJUA 3CAXA 1N9OA 2PR5A 2PR6A 2W3EA 3TW8A 2A24A 2XA7M 4DJ2A 3S7OA 4MN5A 3NHQA 2YKFA 4HIAA 5I5LA 1P97A 3UMDA 2WKPA 2OAP1 3R7WB 4UQIM 2PHYA 2KOIA 2M7UA 4MN7A 1LSXA 2A24B 5DF9A 3MFXA 4XT2A 3HJIA 2WKRA 5K5BA 3UB9A 5HSQA 5HL6A 2P08A 2OWHA 5HD3A 4O01A 4I3AA 4L9GA 4WEKA 4B9OA 1N9NA 1OJ5A 2QJ7A 3TRCA 3KSIA 2W1TB 2KX6A 2ZMVA 1MKMA 3UMEA 5HWWA 4G3KA 3OBFA 3C38A 3MR0A 3T4LA 2VGLM 1OT6A 3PBQA 4CLCC 1T1AA 4EXOA 2CMNA 2ZOHA 4O0PA 2NUPC 5HPFA 3H82A 3PXPA 5MC7A 1LL8A 4L0LA 3RTYA 4HJ3A 2KDKA 3CLOA 3H9WA 1VHMA 4LRYC 4I5SA 3MQQA 3KSHA 2G7UA 2JKRM 3C2WA 4NXFA 5HDDA 4OOMA 2OWJA 3LI9A 4FSFA 5G4YA 4LRZE 5HDSA 4B93A 2J3TD 1GSWA 1MC0A 3PBTA 3NOTC 5HDCA 3K3DA 4JGQA 2QJ5A 2Z6DA 3SW1A 3F1PA 4QPRA 2JKTM 3C8CA 4MCWA 2O9CA 2XRNA 5A8BA 1TS8A 3B47A 2O0YA 3R4KA 1JNUA 4WL9A 3PHYA 2GX5A 4L9FA 4R38A 3K3CA 3A0VA 4H6JA 4KUOA 5TBMA 1T1CA 5F68A 5FL3A 2Y79A 4WN5A 2EA9A 2W3DA 4HH2A 2VEAA 4HNBA 3BW6A 4GS9A 1S67L 3PR6A 1OTIA 1KOUA 2DMWA 3T4JA 4EEPA 3D3OA 4EW7A 4M4XA 4ETZA 4NKPA 5F69A 3T4KA 1XJ2A 2VLGA 3B33A 2PYPA 4R6LA 1H8MA 2Y8HA 4I3JA 5DFXA 1NLYA 4RQ9A 4HP9A 4CLCD 3ZYTA 2FH5A 2A2LA 3MXQA 4I39A 4MDZA 3EQVA 3TE8A 2K2NA 2HGVA 2KLIA 3JVVA 4P6ZM 2L1MA 1TF1A 3LYXA 4ETXA 4MMNA 1YKDA 4IUKA 2HJ9C 4LPZA 3F1NB 3IS2A 3RH8B 3OCNA 3NJAA 1S4RA 3LUQA 3P7NA 2EWVA 4KQOA 2QKPA 1T1BA 3EGXC 4NXBA 3KYQA 3MJQA 3PYPA 2W3HA 4EESA 1OJGA 4F3LA 4GCZA 4PKYA 1S66L 3S7QA 1G6OA 3HJKA 4IJGA 3RFBA 4G3WA 2M7VA 2XSSA 3IS2B 3MQ0A 3LIBA 4JGOA 5HPIA 2YKHA 4GHIA 3FG8A 1F9IA 2K7SA 1V9YA 2HF6A 4XT2B 1OPXA 1VB6A 2H28A 1ZHHB 3NOUC 2VKSA 4MN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS7 A;  5F5Y A;  5HZH A;  4JGR A;  2OOL A;  1XJ3 A;  3MQO A;  3G6O A;  2INW A;  5DJT A;  3KX0 X;  4WLA A;  3T50 A;  4HP4 A;  4NXG A;  1UGU A;  2ZOI A;  1T18 A;  2VV6 A;  5DKK A;  3H82 B;  2B02 A;  3EEH A;  2V0W A;  4GW9 A;  1LSV A;  3H7W A;  3E4Q A;  3BY8 A;  5AVE A;  3GEC A;  4KUK A;  2R78 A;  3ULF A;  1NWZ A;  3VE3 A;  4BBV A;  4I3I A;  5KIZ A;  3H7W B;  3VOL A;  3F1P B;  4K08 A;  4BBU A;  5J7E A;  5G4Z A;  1G28 A;  1S1Z A;  1P0Z A;  2V9A A;  2QHK A;  4H6J B;  5TBM B;  1DP8 A;  1GSV A;  1OTB A;  5EFW A;  1DP6 A;  3LID A;  4GS9 B;  4BBT A;  2JN7 A;  4E04 A;  1OT9 A;  1TS6 A;  3LIC A;  2WKQ A;  1ODV A;  4L9E A;  3A0R A;  4WF0 A;  2D01 A;  3NOP C;  1F98 A;  3UB8 A;  2M1C A;  5AVF A;  4HI4 A;  2VV8 A;  1MZU A;  1XFN A;  1UWN X;  4DJ3 A;  3UB7 A;  4EET B;  1XJ6 A;  3BY9 A;  1Y28 A;  2PD8 A;  1S4S A;  1TS0 A;  3D72 A;  3E4P A;  1DP9 A;  4F3L B;  3LIE A;  4R3A A;  2PYR A;  4NXE A;  4GHI B;  1XJ4 A;  5DKL A;  4HHD A;  3LIF A;  1DRM A;  4LLO B;  2D02 A;  5J3W A;  3IBR A;  2ZBB A;  2V0U A;  3BWL A;  5F6A A;  5IS1 A;  5IU1 A;  1UWP X;  3CWF A;  3FC7 A;  5HWV A;  1D06 A;  4JGP A;  1T19 A;  2HV1 A;  4HQA A;  4HOI A;  4YWZ A;  4I38 A;  3UB6 A;  4R70 A;  1LT0 A;  3VE4 A;  4EER A;  3LIA A;  1LSW A;  1WA9 A;  3LI8 A;  3UE6 A;  2Z6C A;  4EQ1 A;  2W0N A;  2V1A A;  1X0O A;  4HJ4 A;  2J80 A;  4EEU A;  1BYW A;  1XFQ A;  4HH3 A;  4PKY G;  1OTA A;  3EWK A;  2I9V A;  3GDI A;  5HWT A;  2JHE A;  1OTE A;  2GJ3 A;  3ICY A;  2W27 A;  1V9Z A;  2P7J A;  2L0W A;  5HD5 A;  3F1O A;  2QWS A;  3ZQ5 A;  2L4R A;  3E4O A;  1EW0 A;  2PDR A;  4LRX C;  3OLO A;  1N9L A;  1S1Y A;  4WUJ A;  3F1O B;  2BAS A;  3A0S A;  2V1B A;  4HY8 A;  1D7E A;  4KQD A;  4HJ6 A;  2VV7 A;  1OTD A;  5J4E A;  1GSX A;  3F1N A;  2PD7 A;  5DJU A;  3CAX A;  1N9O A;  2PR5 A;  2PR6 A;  2A24 A;  4DJ2 A;  4MN5 A;  3NHQ A;  2YKF A;  4HIA A;  5I5L A;  1P97 A;  3UMD A;  2WKP A;  2PHY A;  1LSX A;  2A24 B;  3MFX A;  4XT2 A;  3HJI A;  2WKR A;  3UB9 A;  5HSQ A;  2OWH A;  5HD3 A;  4I3A A;  4L9G A;  4B9O A;  1N9N A;  1OJ5 A;  2QJ7 A;  2KX6 A;  3UME A;  5HWW A;  3MR0 A;  1OT6 A;  1T1A A;  4EXO A;  2CMN A;  2ZOH A;  3H82 A;  1LL8 A;  3RTY A;  4HJ3 A;  2KDK A;  3CLO A;  3H9W A;  4LRY C;  3MQQ A;  3C2W A;  4NXF A;  5HDD A;  5HDS A;  3LI9 A;  5G4Y A;  2OWJ A;  4LRZ E;  1GSW A;  3NOT C;  5HDC A;  3K3D A;  4JGQ A;  2QJ5 A;  2Z6D A;  3SW1 A;  3F1P A;  3C8C A;  5A8B A;  1TS8 A;  1JNU A;  4WL9 A;  3PHY A;  4L9F A;  4R38 A;  3K3C A;  3A0V A;  4H6J A;  4KUO A;  5TBM A;  1T1C A;  5F68 A;  4WN5 A;  2EA9 A;  4HH2 A;  2VEA A;  4HNB A;  4GS9 A;  1S67 L;  1OTI A;  1KOU A;  4EEP A;  4EW7 A;  4M4X A;  5F69 A;  1XJ2 A;  2VLG A;  3B33 A;  2PYP A;  4R6L A;  4I3J A;  4RQ9 A;  4HP9 A;  3MXQ A;  4I39 A;  2L1M A;  3LYX A;  4LPZ A;  3F1N B;  3IS2 A;  3RH8 B;  3NJA A;  1S4R A;  3LUQ A;  3P7N A;  2QKP A;  1T1B A;  4NXB A;  3MJQ A;  3PYP A;  4EES A;  1OJG A;  4F3L A;  4GCZ A;  4PKY A;  1S66 L;  3HJK A;  3IS2 B;  4JGO A;  3LIB A;  2YKH A;  4GHI A;  3FG8 A;  1F9I A;  2K7S A;  1V9Y A;  4XT2 B;  1VB6 A;  2H28 A;  3NOU C;  4I5S A;  4MN6 A; 
#chains in the Genus database with same CATH topology
 5HZH A;  4B4Z A;  4JGR A;  3QP5 A;  1A0K A;  2OOL A;  3G6O A;  1EI5 A;  2INW A;  1VET B;  4JBF A;  5DJT A;  1LL5 A;  3ZG0 A;  1S0W A;  4EU0 A;  1FR6 A;  2FZ0 A;  1UGU A;  2ZOI A;  4OQH A;  3EEH A;  4JXS A;  4B4X A;  3E4Q A;  5CED A;  4LV0 A;  2OAQ 1;  3PTE A;  1L3L A;  1HVB A;  3ULF A;  2EFX A;  4BBV A;  4I3I A;  5CTM A;  3C7U A;  4EQI A;  5HW3 A;  3VOL A;  3F1P B;  4GN2 A;  1TDG A;  4K08 A;  4Q8I A;  4CJN A;  2WGW B;  1DY6 A;  5CXW A;  4QY6 A;  1FOF A;  3PBN A;  3FPV A;  3ITB A;  2W3F A;  3IF6 C;  1XA7 A;  1J3W A;  1XPB A;  4D2O A;  4E6X A;  2O9A A;  4NEE D;  5A91 A;  3UDF A;  4K0W A;  5EE8 A;  3G2Y A;  5FQI A;  5FQQ A;  1GHM A;  2XFS A;  1JWZ A;  4JF6 A;  1TVF A;  5HAR A;  3SH9 A;  4RYE A;  1HZO A;  5M1A A;  3ZG7 B;  4S2N A;  1F98 A;  5F82 A;  1H5X A;  5AVF A;  5FI6 A;  4UQI S;  1MZU A;  1XFN A;  3R7W A;  1UWN X;  4LCL A;  3UB7 A;  4EET B;  3BY9 A;  2VA0 A;  1Y28 A;  1KE0 A;  4PM6 A;  5KMW A;  4K91 A;  3KO6 A;  2X71 A;  3U4L P;  4X1L A;  3E4P A;  4MBF A;  4CLC B;  4YNR A;  2FFY A;  1ERQ A;  4F3L B;  1BSG A;  4Y2F A;  3DW0 A;  2PU4 A;  4YOF A;  3BFG A;  4GHI B;  3ZNT A;  1XJ4 A;  5DKL A;  1YLZ A;  4X68 A;  3V5M A;  1FIL A;  3V39 A;  2D02 A;  3Q82 A;  3IF5 A;  1TD5 A;  1YAX A;  2GNX A;  4GKU A;  2JKR I;  3LR3 A;  4OLD A;  2BLS A;  5E2E A;  3ZFZ A;  3Q07 A;  4Q0I A;  5A93 A;  3GSG A;  3KSG A;  3LR0 A;  4O8G A;  1NXY A;  4YWZ A;  4IUH A;  2JKT I;  4R70 A;  1E4D A;  2ZQ7 A;  1O07 A;  1ERO A;  2IA2 A;  2VZW A;  4QB8 A;  1X0O A;  2J80 A;  3IXG A;  3KSF A;  1YSQ A;  4PM5 A;  5IT5 A;  1PZO A;  4OPY A;  3S1Y A;  3T4S A;  3P01 A;  4G3V A;  1OTA A;  4PM8 A;  5KSC A;  3GDI A;  3HLE A;  2QMI A;  1Q2P A;  5HWT A;  3IHA A;  2JHE A;  2GJ3 A;  4PMA A;  1PI5 A;  2XD1 A;  1V9Z A;  1DJC A;  1FCM A;  2WGV A;  5CTN A;  3AGE A;  3BQA A;  2QWS A;  3ZQ5 A;  2V20 A;  2L4R A;  1EW0 A;  5CGX A;  2NUT C;  2XK1 A;  3LEZ A;  3SS3 A;  3A0S A;  4ZTK A;  5CX7 A;  4LCM A;  3W2Z A;  1XKZ A;  4HY8 A;  2ACG A;  4FH4 A;  4HJ6 A;  5E2G A;  2VV7 A;  3D4F A;  3MFD A;  5CHJ A;  2C5W B;  2J3T C;  3OC2 A;  1IEM A;  3HLG A;  3QNC A;  2P04 A;  4WEL A;  2EFU A;  1MWT A;  3FKW A;  1N9O A;  4JLF A;  3TW8 A;  2XA7 M;  4DJ2 A;  5CEB A;  2YKF A;  1NJ4 A;  4PM9 A;  1P97 A;  4M3K A;  4KZ3 A;  1O7E A;  4PPR A;  4WMC A;  2PHY A;  3CPT B;  4GOG A;  4XT2 A;  4R3J A;  5HL6 A;  4WEK A;  2DCF A;  3AGD A;  1MKM A;  3ISG A;  3VSK A;  5E43 A;  1OT6 A;  1T1A A;  3UDX A;  1NYY A;  3LO7 A;  4FTX A;  4L0L A;  4S2I A;  3RTY A;  4KG5 A;  4QY5 A;  2OLV A;  3CLO A;  3G2Z A;  2JKR M;  3WS0 A;  4MNR A;  3BRM A;  4FSF A;  2WAF A;  4LRZ E;  4O7D A;  3K3D A;  4WYY A;  2Z6D A;  1IKG A;  1MY8 A;  5D3O A;  2JKT M;  3C8C A;  3IF6 B;  3DWZ A;  4A5R A;  4MCW A;  2O9C A;  4IBX A;  3NEC A;  1ALQ A;  2ZL1 A;  3B47 A;  2Z2M B;  3R4K A;  2FFF B;  3M2J A;  3V3R A;  4LV2 A;  3WWX A;  3NC8 A;  4L9F A;  4H6J A;  5TFQ A;  4KZ5 A;  4WN5 A;  2EA9 A;  4UA9 A;  2Y2J A;  3BW6 A;  1BLH A;  1BUL A;  4NK3 A;  1KOU A;  3G32 A;  3DWK A;  1KE3 A;  1IYS A;  4Y0U A;  3QP8 A;  2V8F A;  3W4O A;  2P74 A;  2Y8H A;  4OON A;  3C4P A;  2Y2H A;  1SKO B;  3HLF A;  3CJM A;  5DFX A;  1K56 A;  4PM7 A;  4CLC D;  4UA7 A;  2DRW A;  2ZC7 A;  2HGV A;  3VP4 A;  4MMN A;  1SHV A;  4LPZ A;  3F1N B;  3IS2 A;  3NJA A;  1S4R A;  2XR0 A;  3UY6 A;  1T1B A;  3EGX C;  4DF6 A;  3PYP A;  2W3H A;  4XUZ A;  3MS6 A;  3HJK A;  4IVK A;  3RFB A;  4G3W A;  5M18 A;  1QMF A;  2WAE A;  4E3J A;  2OLU A;  3T1R A;  1SZV A;  2H28 A;  5FEF A;  4R3B A;  4RA7 A;  4GDB A;  3ZNY A;  4UEY A;  5EM1 A;  1JWP A;  1TS7 A;  4UAA A;  5F5Y A;  1NY0 A;  2P9V A;  3U2A A;  4DE0 A;  1SDE A;  1DJB A;  4N9L A;  5M19 A;  2JKG A;  3RXX A;  3KX0 X;  4IBR A;  3EQU A;  2B18 A;  4X53 A;  1JWV A;  4GD8 A;  3E98 A;  3V67 A;  2ZC4 B;  1SKF A;  5DKK A;  1JTD A;  1W79 A;  3W4Q A;  2B02 A;  4EWF A;  1YLJ A;  4GW9 A;  3PBS A;  5DVA A;  3H7W A;  3UB5 P;  3GEC A;  1ACF A;  2R78 A;  4KQQ A;  3SZT A;  1NWZ A;  4Y13 A;  3Q7V A;  5EVE A;  2UWX A;  3HUN A;  4X6T A;  4FOF A;  3MKE A;  2MJ6 A;  3BFF A;  5FI7 A;  1ZKJ A;  4BBU A;  5J7E A;  4KZA A;  3WRT A;  4Y15 A;  4KZB A;  2IWC A;  1S1Z A;  2V9A A;  2HDQ A;  4WEJ A;  5AJG A;  3VFF A;  5TBM B;  1DP8 A;  3LFV A;  4GS9 B;  4S2P A;  2JN7 A;  1YSP A;  4E3L A;  4F94 A;  3DBA A;  2GDN A;  4OPZ A;  4EBL A;  3LIC A;  1ODV A;  3W4P A;  4R0Q A;  3IWI A;  4L9E A;  3A0R A;  1Y54 A;  4WF0 A;  2VJW A;  1JTG A;  3EEA A;  3TG9 A;  1K0K A;  1BLP A;  2M1C A;  1I5Q A;  5E2H A;  4CQH A;  1GA0 A;  1WYB A;  4DJ3 A;  1PZP A;  4E3I A;  1XJ6 A;  1PW8 A;  4NG2 A;  4NET A;  1KVM A;  4QU3 A;  2PD8 A;  2PAV P;  4DN0 A;  2WKI A;  4S2O A;  4Y0O A;  1GHI A;  3D72 A;  5TJJ A;  3LEQ A;  1GCE A;  1ESU A;  3A3I A;  5AQ9 A;  5HL1 A;  2G2U A;  5HX9 A;  3VP1 A;  2PYR A;  5U47 A;  1F5M A;  1L0D A;  3BLS A;  3QP4 A;  2J9O A;  2ZQD A;  1P9R A;  5FAT A;  3GR2 A;  5J3W A;  2IWD A;  2Y2P A;  3BWL A;  4P85 A;  5FA7 A;  2ZM0 A;  4OOL A;  5IU1 A;  3N8R A;  5DTS A;  4II7 A;  1P9W A;  1VQQ A;  3D9Y A;  4BLM A;  3B42 A;  2WKH A;  4JF4 A;  4GJ4 A;  5FEG A;  1D06 A;  3K2N A;  5GLB A;  4JGP A;  3IX3 A;  2ZM8 A;  2ZMF A;  4HOI A;  3WS2 A;  3KYE A;  1LT0 A;  1XX2 A;  5CRF A;  4KZ8 A;  1Z6F A;  3LGO A;  5CGS A;  1NZU A;  4FH2 A;  4EQ1 A;  2J7V A;  3HL9 A;  1OME A;  2I72 A;  1H0M A;  3HLW A;  4HJ4 A;  2A3U A;  3B3X A;  1XFQ A;  4ZJ1 A;  2IWB A;  4Q0H A;  2I9V A;  4R1G A;  2XDM A;  4B88 A;  4BMW A;  3PBR A;  2H10 A;  2XD5 A;  3LR5 A;  4IED A;  3IH8 A;  1YQS A;  2Y91 A;  3HRE A;  1LHY A;  2HDR A;  1N9L A;  3MXR A;  3I7J A;  4LEN A;  1S1Y A;  1FSW A;  4P6Z S;  4DMZ A;  4RX2 A;  3DTI A;  2V1B A;  4YFM A;  1FCN A;  4KQD A;  5GHY A;  4CLC E;  3MZF A;  3M6B A;  1EWZ A;  2PD7 A;  3N7W A;  5DJU A;  5FDH A;  2WGI A;  2W3E A;  2A24 A;  1K57 A;  4OOY A;  5JYO A;  2J8Y A;  4OP8 A;  3Q7Z A;  3ZVW A;  4E6W A;  4KZ4 A;  4N1X A;  3MFX A;  5DF9 A;  1HTZ A;  2WKR A;  3OPL A;  2EX8 A;  3P98 A;  1K4F A;  4I3A A;  4B9O A;  3CG5 A;  1G5U A;  1OJ5 A;  3BFE A;  2ZQ8 A;  1SDN A;  2W1T B;  2KX6 A;  3UME A;  5HWW A;  1KVL A;  1VET A;  3LCE A;  2VGL M;  2Y2K A;  3G34 A;  1K54 A;  3P09 A;  2ZOH A;  1J9M A;  4O0P A;  3UPN A;  3VP0 A;  5HPF A;  2H5S A;  4MLL A;  2R9X A;  3ZVT A;  4DE1 A;  3KSH A;  4OPQ A;  3G31 A;  4P6B A;  3BM6 A;  3T1X A;  2OWJ A;  5G4Y A;  2OV5 A;  2J3T D;  1IEL A;  3NOT C;  3T12 B;  4JXG A;  5EM0 A;  2QJ5 A;  3SW1 A;  4OPR A;  3F1P A;  4BL3 A;  2XRN A;  2WGW A;  3A3F A;  1JNU A;  4KZ7 A;  1K6R A;  4LV1 A;  3PHY A;  2GX5 A;  3K3C A;  3UPO A;  3QNB A;  1RCJ A;  1ERM A;  4KUO A;  3HVF A;  2Y2G A;  4EBN A;  5HAI A;  3E2K A;  3PR6 A;  1ZC2 A;  2DMW A;  3T4J A;  2C6W B;  4HBU A;  2XF3 A;  3T4K A;  1H8Y A;  5GHZ A;  4OH0 A;  1VEU A;  4DDS A;  4GD6 A;  2A2L A;  4RX3 A;  2K2N A;  2KLI A;  2H0Y A;  3JVV A;  4LV3 A;  1FSY A;  1TF1 A;  3LYX A;  1H8Z A;  2XH9 A;  3O87 A;  2HJ9 C;  1CF0 A;  5EVI A;  3OCN A;  4K0X A;  4KQO A;  2QKP A;  5IHV A;  5L10 A;  3A3J A;  3MJQ A;  4F3L A;  1CK3 A;  1S66 L;  2XSS A;  1G68 A;  1BZA A;  3IS2 B;  3MQ0 A;  4GHI A;  3FG8 A;  4S2N C;  5EOO A;  2K7S A;  1MWU A;  5CHU A;  1OPX A;  1E3U A;  3NOU C;  5F83 A;  2Q9M A;  2VKS A;  4MN6 A;  2CC1 A;  2JBF A;  1YMS A;  3IWQ A;  3LY3 A;  4Q0J A;  1ES3 A;  2V2F F;  1NLZ A;  4HP4 A;  4MEZ A;  1AWI A;  3HCY A;  2P9V B;  1T18 A;  4Y7P A;  3GVB A;  3H82 B;  3NY4 A;  3O3V A;  1AXB A;  1H3Q A;  4QD4 A;  3T1S A;  4ARZ A;  3BY8 A;  4DE3 A;  4KUK A;  2Y2O A;  2QPN A;  3CUE A;  3VE3 A;  4GNU A;  3CI6 A;  3H7W B;  5HAQ A;  1MKI A;  5FI2 A;  4H8R A;  4X69 A;  1PFL A;  3S7N A;  1CQA A;  1XP4 A;  3EOI A;  5FQM A;  3WS5 A;  5AQB A;  1M40 A;  2ZQA A;  4QJG A;  4MBK A;  2K31 A;  1P0Z A;  1YLW A;  4EUV A;  2ZD8 A;  2WKE A;  1GSV A;  3NIA A;  3RJU A;  3BQ8 A;  2HJE A;  4OQ0 A;  1OTB A;  5A92 A;  4GLQ A;  3MZD A;  2G2W A;  2AVX A;  4E04 A;  1OT9 A;  1TS6 A;  2EX2 A;  3N4I A;  2WKQ A;  2XA7 S;  2WAD A;  3G35 A;  4WMC D;  2Y4A A;  2D01 A;  1ZG4 A;  3NOP C;  2J3W A;  2LB5 A;  2ZC3 B;  4HI4 A;  2VV8 A;  5CEC A;  1W8Q A;  4IHQ A;  3SS5 A;  3OCL A;  1F2K A;  1C3B A;  2JKF A;  4BD1 A;  1S4S A;  4PAU A;  3OOV A;  4N1H A;  3FKV A;  3NDG A;  1XGJ A;  3M6H A;  5GLC A;  3QP2 A;  1DP9 A;  2PRF A;  3PBO A;  3O5Y A;  3BEB A;  5FQJ A;  1PWD A;  4R3A A;  4ME4 A;  5A90 A;  3SS4 A;  4NXE A;  1L0F A;  2Y2N A;  4HHD A;  3BEC A;  5DFY A;  4JF5 A;  1DRM A;  4OVD A;  4LLO B;  2PBD P;  2WZZ A;  3IBR A;  5EVI C;  2ZBB A;  2V0U A;  5IS1 A;  3IWO A;  1UWP X;  2JC7 A;  1W8Y A;  1BUE A;  2Y2I A;  3CWF A;  4GB7 A;  3W8K A;  4OP5 A;  1T19 A;  2HV1 A;  1CEF A;  3O86 A;  4XUX A;  3UNW A;  3VE4 A;  4OQG A;  3BLM A;  1W63 M;  3CMZ A;  2VGJ A;  3UE6 A;  4EBP A;  2ZQC A;  1CI8 A;  2Z6C A;  5EOE A;  2WK0 A;  3LY4 A;  2W0N A;  3SH7 A;  3T4O A;  2ZJ9 A;  4MBH A;  3MF0 A;  4QWO A;  4Y5F A;  5GHX A;  4EEU A;  3UE3 A;  3JPU A;  5KSH A;  2LB9 A;  3S7P A;  2E8I A;  2XLN A;  1OTE A;  3ICY A;  2W27 A;  2O9B A;  2L0W A;  1DJA A;  3F1O A;  4N92 A;  1LL9 A;  5E2F A;  1PW1 A;  3M2K A;  1YM1 A;  4LRX C;  3OLO A;  1L0G A;  3T4T A;  3TJZ C;  4YIN A;  3CUE C;  1SKO A;  3V50 A;  5LBR A;  1MPL A;  1BT5 A;  1K25 A;  4WM9 A;  3ZDJ A;  5G18 A;  3MBZ A;  3FV7 A;  1K6S A;  2HDS A;  4WUJ A;  4ID4 A;  2XRO A;  3L9K A;  2BAS A;  1LLB A;  2JE5 A;  1W63 Q;  3MKF A;  1D7E A;  5C5K A;  3QP1 A;  4Y3I A;  1OTD A;  2J9P A;  3EGD C;  3OZH A;  3A3D A;  3HUO A;  3IT9 A;  3F1N A;  3WS4 A;  3O88 A;  2PR5 A;  1K38 A;  2RL3 A;  4MN5 A;  3NHQ A;  4HIA A;  5I5L A;  2WKP A;  2OAP 1;  3R7W B;  4UQI M;  3IX8 A;  2KOI A;  4MN7 A;  2XFT A;  1JVJ A;  2A24 B;  1TEM A;  5K5B A;  5HD3 A;  4O01 A;  4L9G A;  4EUZ A;  4LFU A;  3VFH A;  2QJ7 A;  2WZX A;  2HZ5 A;  3C38 A;  4Z9Q A;  3T4L A;  1PYY A;  4U0T A;  4HEF A;  1E25 A;  1D1J A;  2NUP C;  1WYC A;  4C75 A;  5TR7 A;  3PXP A;  5MC7 A;  1LL8 A;  2Y2L A;  4FCF A;  3H9W A;  4LRY C;  3IXD A;  1BTL A;  1ES5 A;  4NXF A;  4UHU A;  5HDD A;  4OOM A;  3LI9 A;  3DTE A;  1ZG6 A;  1GSW A;  1MC0 A;  3HLD A;  3IX4 A;  2X02 A;  5HDC A;  4C3Q A;  4WZ4 A;  1YLP A;  2EXA A;  4ZDX A;  3GMW A;  4DRT A;  5A8B A;  4X56 A;  1TS8 A;  3IXB A;  1CEG A;  5KZH A;  4UA6 A;  4R38 A;  4JXW A;  3A0V A;  1Z09 A;  3NCK A;  5TBM A;  1KDW A;  4IVI A;  5F68 A;  5FL3 A;  3G30 A;  3OPH A;  2W3D A;  1FR1 A;  5HAP A;  3IH9 A;  4GS9 A;  3GRJ A;  3HLB A;  1ES4 A;  3MZE A;  4DXB A;  3D3O A;  4EW7 A;  4M4X A;  5F69 A;  4ZBE A;  1XJ2 A;  2Q0O A;  2VLG A;  2ZMA A;  3B33 A;  2PYP A;  3WRZ A;  3BFD A;  3ZHH A;  3CZD A;  4I3J A;  4S2M A;  1NLY A;  3IHB A;  4RQ9 A;  2ZC6 B;  2FH5 A;  4I39 A;  4MDZ A;  3EQV A;  1IYQ A;  3TE8 A;  4BL2 A;  2L1M A;  4FD8 A;  1VEU B;  1XGI A;  2EWV A;  3C5A A;  2PBY A;  4NXB A;  1OJG A;  2HP5 A;  4E3K A;  4GCZ A;  5L07 A;  4KG6 A;  4PKY A;  5EVI B;  1G6O A;  4IJG A;  3VP3 A;  5HPI A;  3LIB A;  3V3S A;  1S6R A;  1V9Y A;  2HF6 A;  2A49 A;  1M6K A;  4Y17 A;  4XT2 B;  3Q81 A;  5GLA A;  4OLG A;  3VOZ A;  1N9B A;  2EX9 A;  1CJF A;  2HP6 A;  1NRF A;  5I94 A;  1XXM A;  1K4E A;  1XJ3 A;  3MQO A;  4R23 A;  2UV0 E;  4WLA A;  1STZ A;  3T50 A;  1RP5 A;  3MXS A;  3MMH A;  1ONG A;  4NXG A;  1IYO A;  2Y59 A;  2VV6 A;  4ZRR A;  2V0W A;  2O99 A;  5FAQ A;  1LSV A;  1SCW A;  2BTF P;  3IBJ A;  5FAS A;  1KGE A;  5AVE A;  3G4P A;  4ZAM A;  3FWL A;  3UN7 A;  1IKI A;  2EWW A;  1MXO A;  3HUM A;  3UE1 A;  5KIZ A;  4PHT A;  3VV4 A;  3FZC A;  4GZB A;  2PT7 A;  4ARZ B;  1PIO A;  1LI9 A;  3BFC A;  1YPR A;  2W3G A;  3C7V A;  1PWG A;  4OQI A;  4QHC A;  2RCX A;  2ZL1 B;  1WE4 A;  1QME A;  5F1F A;  5G4Z A;  1G28 A;  4Z1W A;  4E3M A;  3T4Q A;  2QHK A;  4H6J B;  2ZLY A;  3ITA A;  1ES2 A;  5FSR A;  4XXR A;  5EFW A;  1DP6 A;  3LID A;  3CHW P;  1YLT A;  4BBT A;  3N8L A;  4LGW A;  3GV9 A;  2B5R A;  4P87 A;  1IOU A;  1NYM A;  2QYB A;  2PU2 A;  4KG2 A;  3C30 A;  4R4S A;  1KGF A;  2B95 A;  2V1Z A;  3NDE A;  3UB8 A;  1L0E A;  1W7F A;  3TOI A;  5JYP A;  4CLC A;  1TDL A;  3KYZ A;  4E3N A;  5L8M A;  3CIT A;  1CI9 A;  1TS0 A;  3S4X A;  3OPP A;  3LIE A;  2VGL S;  2W1T A;  2Q9N A;  2HP9 A;  3QP6 A;  1K55 A;  3JVU A;  1K57 C;  3C4O A;  4BQM A;  2WYX A;  3LIF A;  1NZO A;  3DTM A;  4ZJ3 A;  2OSU A;  2XGN A;  3T1Q B;  5F6A A;  1YLY A;  2JCH A;  1HLU P;  1Y4O A;  3GQZ A;  4N9K A;  4U0X A;  5TGF A;  3SH8 A;  3LR4 A;  2Y2Q A;  3E0Y A;  4S2K A;  4WZ5 A;  4BD0 A;  3FC7 A;  5EPH A;  5HWV A;  3VSL A;  1IFQ A;  1I2W A;  4JKT A;  1I2S A;  5L2F A;  4HQA A;  2Y55 A;  1U60 A;  1ONH A;  4I38 A;  3VMA A;  3UB6 A;  2BG1 A;  4EER A;  3LIA A;  1K54 C;  1LSW A;  1WA9 A;  2GZA A;  2X01 A;  3LI8 A;  3OPR A;  4P0M A;  4DKI A;  4U3T A;  1VM1 A;  2V1A A;  1BYW A;  3Q7V B;  3ZG8 B;  4HH3 A;  4PKY G;  1ZTU A;  3EWK A;  1KGG A;  1L2S A;  1PI4 A;  5F1G A;  2Z2L B;  2ZQ9 A;  5BOH A;  4AFI A;  2ZM2 A;  4JPM A;  2P7J A;  3BYD A;  1GHP A;  5FQK A;  2W1R A;  2VGK A;  3PAE A;  5HD5 A;  3TSG A;  4BJP A;  4DXC A;  3E4O A;  2PDR A;  2R9W A;  3DTK A;  5FAO A;  3F1O B;  5EVI D;  4KZ9 A;  5CER A;  3S22 A;  3NBL A;  5HFO A;  1IYP A;  5EUA A;  3BJN A;  4BEN A;  3UO9 A;  1NRJ A;  2VX8 A;  3FPW A;  4X1M A;  4D60 A;  1GSX A;  5J4E A;  2EX6 A;  4BWI A;  3CAX A;  3RXW A;  3CPT A;  5FDS A;  2PR6 A;  3S7O A;  2HDU A;  4JXV A;  2V8C A;  4DE2 A;  1E3U D;  3UMD A;  1ESI A;  3MSH A;  1MWR A;  3A3E A;  2M7U A;  5EVL A;  1LSX A;  3HJI A;  3IXH A;  1N4O A;  1G6A A;  3UB9 A;  5AQA A;  3NI9 A;  4OKP A;  1RGZ A;  5HSQ A;  2P08 A;  2OWH A;  3AGF A;  5AQ7 A;  2EXB A;  3UE0 A;  3ZGA B;  1N9N A;  2H0T A;  4E3O A;  3E2L A;  3TRC A;  3KSI A;  4KEN B;  2ZMV A;  5EEC A;  5CGW A;  4G3K A;  3OBF A;  3MR0 A;  2E8J A;  4ESP A;  3PBQ A;  4CLC C;  4EXO A;  2CMN A;  5DF8 A;  4Y0T A;  3N6I A;  4HBT A;  3H82 A;  5CHM A;  4HJ3 A;  3PAG A;  3FYZ A;  3VP2 A;  2KDK A;  1VHM A;  4CPK A;  3MQQ A;  3UPP A;  2G7U A;  3C2W A;  4ZJ2 A;  1LI0 A;  1MWS A;  2DNS A;  4KQR A;  3SOI A;  3N8S A;  3IF6 A;  1K55 C;  3HBR A;  5DTK A;  1YMX A;  5HDS A;  1PRQ A;  4B93 A;  2WUQ A;  2Y2M A;  3PBT A;  4JGQ A;  3JYI A;  3WS1 A;  1GA9 A;  1RGY A;  1BLC A;  4QPR A;  1FCO A;  2O0Y A;  4WZ5 C;  4WL9 A;  1HD8 A;  4WBG A;  1K56 D;  1MBL A;  4DDY A;  1T1C A;  2Y79 A;  5DTT A;  1PWC A;  5EV0 A;  1FQG A;  5J8X A;  4HH2 A;  2VEA A;  1KDS A;  4HNB A;  3ZCZ A;  1S67 L;  1BLS A;  1OTI A;  4X25 A;  4EEP A;  3IQA A;  3DAV A;  4R4R A;  1YT4 A;  4ETZ A;  4NKP A;  2XEP A;  5L09 A;  2ZC5 B;  4R6L A;  1H8M A;  5DF7 A;  4HP9 A;  3ZYT A;  4S2J A;  3MXQ A;  1Q2Q A;  3L7H A;  4GDN A;  2QZ6 A;  4P6Z M;  2VK3 A;  3ZG9 B;  4ETX A;  1YKD A;  4IUK A;  4HES A;  4KZ6 A;  4X55 A;  3ZG5 A;  4EV4 A;  1FIK A;  5GL9 A;  3RH8 B;  1W5D A;  3LUQ A;  3P7N A;  3VOY A;  1PNE A;  3KYQ A;  4EES A;  5FAP A;  4C6Y A;  4FUW A;  3NUL A;  3QHY A;  5FQ9 A;  5GLD A;  3S7Q A;  1XA1 A;  1KE4 A;  2M7V A;  4RVA A;  4JGO A;  2YKH A;  1F9I A;  3GTC A;  4S2L A;  3UDI A;  2XQZ A;  1VB6 A;  1ZHH B;  3Q1F A;  4I5S A;  3HLC A;  2HPB A; 
#chains in the Genus database with same CATH homology
 4UEY A;  1TS7 A;  5F5Y A;  5HZH A;  3U2A A;  4JGR A;  2OOL A;  1XJ3 A;  3MQO A;  3G6O A;  2INW A;  5DJT A;  4Q0J A;  3KX0 X;  3EQU A;  4WLA A;  1NLZ A;  1STZ A;  3T50 A;  2B18 A;  4EU0 A;  4HP4 A;  3E98 A;  3MMH A;  3V67 A;  3HCY A;  4NXG A;  2FZ0 A;  1UGU A;  2ZOI A;  1T18 A;  2VV6 A;  5DKK A;  4ZRR A;  3H82 B;  2B02 A;  3EEH A;  2V0W A;  2O99 A;  1H3Q A;  4GW9 A;  3PBS A;  1LSV A;  3H7W A;  3IBJ A;  3E4Q A;  4ARZ A;  2OAQ 1;  3BY8 A;  5AVE A;  3GEC A;  4KUK A;  2R78 A;  3ULF A;  1NWZ A;  3CUE A;  3VE3 A;  2EWW A;  4BBV A;  4I3I A;  5KIZ A;  4PHT A;  3VV4 A;  4FOF A;  3CI6 A;  3H7W B;  2MJ6 A;  2PT7 A;  4ARZ B;  3S7N A;  3VOL A;  3F1P B;  3EOI A;  2W3G A;  4K08 A;  4BBU A;  5J7E A;  5G4Z A;  1G28 A;  1S1Z A;  4Z1W A;  2K31 A;  1P0Z A;  3T4Q A;  2V9A A;  2QHK A;  4WEJ A;  3PBN A;  4H6J B;  3FPV A;  4EUV A;  2W3F A;  5AJG A;  5TBM B;  1DP8 A;  1GSV A;  3BQ8 A;  2HJE A;  1OTB A;  5EFW A;  4GLQ A;  1DP6 A;  3LFV A;  3LID A;  4GS9 B;  4BBT A;  2O9A A;  4NEE D;  2JN7 A;  4E04 A;  1OT9 A;  1YSP A;  1TS6 A;  3DBA A;  3LIC A;  2WKQ A;  1IOU A;  1ODV A;  2XA7 S;  4L9E A;  3A0R A;  4WF0 A;  2QYB A;  2D01 A;  3C30 A;  2VJW A;  3EEA A;  3NOP C;  1F98 A;  2J3W A;  3UB8 A;  2LB5 A;  2M1C A;  5AVF A;  4UQI S;  4HI4 A;  2VV8 A;  4CQH A;  1MZU A;  1XFN A;  3R7W A;  1UWN X;  4CLC A;  4DJ3 A;  4IHQ A;  3UB7 A;  4EET B;  3OCL A;  1XJ6 A;  3BY9 A;  2VA0 A;  1Y28 A;  3KYZ A;  2PD8 A;  3KO6 A;  5L8M A;  4DN0 A;  1S4S A;  3CIT A;  4PAU A;  3OOV A;  1TS0 A;  3D72 A;  3E4P A;  5TJJ A;  4CLC B;  1DP9 A;  4YNR A;  4F3L B;  3PBO A;  4Y2F A;  3LIE A;  2VGL S;  3O5Y A;  2W1T A;  4R3A A;  4ME4 A;  4YOF A;  2PYR A;  1F5M A;  4NXE A;  4GHI B;  1XJ4 A;  5DKL A;  4HHD A;  3JVU A;  3LIF A;  5DFY A;  1P9R A;  1DRM A;  4LLO B;  2D02 A;  5J3W A;  3IBR A;  2ZBB A;  2V0U A;  3BWL A;  5F6A A;  1TD5 A;  5IS1 A;  1YAX A;  4OOL A;  5IU1 A;  1UWP X;  2GNX A;  2JKR I;  3LR3 A;  3LR4 A;  4II7 A;  1P9W A;  3E0Y A;  3B42 A;  4Q0I A;  3CWF A;  4GJ4 A;  3FC7 A;  3KSG A;  5HWV A;  1D06 A;  3K2N A;  3LR0 A;  4JGP A;  1IFQ A;  4O8G A;  1T19 A;  2HV1 A;  4HQA A;  2ZMF A;  4HOI A;  4YWZ A;  4I38 A;  3UB6 A;  4IUH A;  2JKT I;  4R70 A;  1LT0 A;  3VE4 A;  4EER A;  3LIA A;  1LSW A;  1WA9 A;  1W63 M;  2GZA A;  3LI8 A;  3UE6 A;  2Z6C A;  4EQ1 A;  2IA2 A;  2VZW A;  2W0N A;  3T4O A;  2V1A A;  3MF0 A;  1X0O A;  4HJ4 A;  2J80 A;  4Y5F A;  4EEU A;  1BYW A;  3KSF A;  1YSQ A;  3UE3 A;  1XFQ A;  5IT5 A;  4HH3 A;  4PKY G;  4Q0H A;  3T4S A;  3P01 A;  4G3V A;  1OTA A;  1ZTU A;  3EWK A;  2I9V A;  5KSH A;  2LB9 A;  3GDI A;  3S7P A;  5HWT A;  2JHE A;  1OTE A;  4BMW A;  2GJ3 A;  3PBR A;  4AFI A;  3ICY A;  2W27 A;  1V9Z A;  2O9B A;  2P7J A;  2L0W A;  2W1R A;  3BQA A;  3LR5 A;  5HD5 A;  3F1O A;  2QWS A;  4BJP A;  3ZQ5 A;  2L4R A;  3E4O A;  1EW0 A;  2PDR A;  4LRX C;  3OLO A;  3T4T A;  3TJZ C;  1N9L A;  3CUE C;  2NUT C;  5LBR A;  1S1Y A;  4P6Z S;  4WUJ A;  2XRO A;  3F1O B;  4DMZ A;  2BAS A;  3A0S A;  2V1B A;  5CX7 A;  3W2Z A;  1W63 Q;  4HY8 A;  1D7E A;  4KQD A;  5C5K A;  4HJ6 A;  4Y3I A;  2VV7 A;  3BJN A;  1OTD A;  2J3T C;  3OC2 A;  1NRJ A;  2VX8 A;  3FPW A;  3EGD C;  4CLC E;  5J4E A;  1GSX A;  3F1N A;  2P04 A;  4BWI A;  2PD7 A;  4WEL A;  5DJU A;  3CAX A;  1N9O A;  2PR5 A;  2PR6 A;  2W3E A;  3TW8 A;  2A24 A;  2XA7 M;  4DJ2 A;  3S7O A;  4MN5 A;  3NHQ A;  2YKF A;  4HIA A;  5I5L A;  1P97 A;  3UMD A;  2WKP A;  2OAP 1;  3R7W B;  4UQI M;  2PHY A;  2KOI A;  2M7U A;  4MN7 A;  1LSX A;  2A24 B;  5DF9 A;  3MFX A;  4XT2 A;  3HJI A;  2WKR A;  5K5B A;  3UB9 A;  5HSQ A;  5HL6 A;  2P08 A;  2OWH A;  5HD3 A;  4O01 A;  4I3A A;  4L9G A;  4WEK A;  4B9O A;  1N9N A;  1OJ5 A;  2QJ7 A;  3TRC A;  3KSI A;  2W1T B;  2KX6 A;  2ZMV A;  1MKM A;  3UME A;  5HWW A;  4G3K A;  3OBF A;  3C38 A;  3MR0 A;  3T4L A;  2VGL M;  1OT6 A;  3PBQ A;  4CLC C;  1T1A A;  4EXO A;  2CMN A;  2ZOH A;  4O0P A;  2NUP C;  5HPF A;  3H82 A;  3PXP A;  5MC7 A;  1LL8 A;  4L0L A;  3RTY A;  4HJ3 A;  2KDK A;  3CLO A;  3H9W A;  1VHM A;  4LRY C;  4I5S A;  3MQQ A;  3KSH A;  2G7U A;  2JKR M;  3C2W A;  4NXF A;  5HDD A;  4OOM A;  2OWJ A;  3LI9 A;  4FSF A;  5G4Y A;  4LRZ E;  5HDS A;  4B93 A;  2J3T D;  1GSW A;  1MC0 A;  3PBT A;  3NOT C;  5HDC A;  3K3D A;  4JGQ A;  2QJ5 A;  2Z6D A;  3SW1 A;  3F1P A;  4QPR A;  2JKT M;  3C8C A;  4MCW A;  2O9C A;  2XRN A;  5A8B A;  1TS8 A;  3B47 A;  2O0Y A;  3R4K A;  1JNU A;  4WL9 A;  3PHY A;  2GX5 A;  4L9F A;  4R38 A;  3K3C A;  3A0V A;  4H6J A;  4KUO A;  5TBM A;  1T1C A;  5F68 A;  5FL3 A;  2Y79 A;  4WN5 A;  2EA9 A;  2W3D A;  4HH2 A;  2VEA A;  4HNB A;  3BW6 A;  4GS9 A;  1S67 L;  3PR6 A;  1OTI A;  1KOU A;  2DMW A;  3T4J A;  4EEP A;  3D3O A;  4EW7 A;  4M4X A;  4ETZ A;  4NKP A;  5F69 A;  3T4K A;  1XJ2 A;  2VLG A;  3B33 A;  2PYP A;  4R6L A;  1H8M A;  2Y8H A;  4I3J A;  5DFX A;  1NLY A;  4RQ9 A;  4HP9 A;  4CLC D;  3ZYT A;  2FH5 A;  2A2L A;  3MXQ A;  4I39 A;  4MDZ A;  3EQV A;  3TE8 A;  2K2N A;  2HGV A;  2KLI A;  3JVV A;  4P6Z M;  2L1M A;  1TF1 A;  3LYX A;  4ETX A;  4MMN A;  1YKD A;  4IUK A;  2HJ9 C;  4LPZ A;  3F1N B;  3IS2 A;  3RH8 B;  3OCN A;  3NJA A;  1S4R A;  3LUQ A;  3P7N A;  2EWV A;  4KQO A;  2QKP A;  1T1B A;  3EGX C;  4NXB A;  3KYQ A;  3MJQ A;  3PYP A;  2W3H A;  4EES A;  1OJG A;  4F3L A;  4GCZ A;  4PKY A;  1S66 L;  3S7Q A;  1G6O A;  3HJK A;  4IJG A;  3RFB A;  4G3W A;  2M7V A;  2XSS A;  3IS2 B;  3MQ0 A;  3LIB A;  4JGO A;  5HPI A;  2YKH A;  4GHI A;  3FG8 A;  1F9I A;  2K7S A;  1V9Y A;  2HF6 A;  4XT2 B;  1OPX A;  1VB6 A;  2H28 A;  1ZHH B;  3NOU C;  2VKS A;  4MN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...