3HA4A

Crystal structure of the type one membrane protein mix1 from leishmania
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
127
structure length
127
Chain Sequence
b'EELEAQRQRHNDPRRPPWPLLHQRVVLLREGKGAPEDIALMWEQTKHYYPADWLIPLELTQVLKYSSGKYLQTYVADPDEMRKEVLMQLLNVKYGRVSDPNGGRVNKDVEEIISMAVDDLENMDLNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIX1
publication title Crystal structure of the Leishmania major MIX protein: A scaffold protein that mediates protein-protein interactions.
pubmed doi rcsb
source organism Leishmania major
molecule tags Unknown function
total genus 44
structure length 127
sequence length 127
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.690 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ha4A00
3HA4A
chains in the Genus database with same CATH superfamily
4U74A 2LM9A 4TNWA 2J4GA 4UF0A 4H9RC 3NRXA 4AIUA 2C5KT 3GN5B 4JUYA 3MJXA 4NUUA 5AFUL 4UIGA 5FXVA 2CXFA 3PE0A 4JYAT 2XQ5A 5KXJA 4YFSA 3EVYA 4J2CA 3P4SA 4KI0F 4YTNA 5CJ5A 5L3GB 3NZPA 2FJAA 4PK5A 4O4IE 3B5MA 3O1HA 4NXMT 3N9LA 3OYZA 3RH3A 1Y01A 3HI2A 4GYSA 1XMOT 3VRBA 1IBKT 1KNZA 3G06A 5FL1A 5JDFA 1YKEB 4PFOA 4OX9T 2BVLA 3E0ZA 2WWUA 4U7YA 5ETWA 4GK0E 3J7Yq 3UUBA 4HFBA 2CLYB 3EI0A 4DIDB 3C4ZA 4IE4A 3UU5A 2WQYA 5CFBA 2XQ7A 4IDZA 2LSJA 3UQ4A 4PJNA 4QH4A 4TWHA 3P8CD 3NKZA 2YKSA 1B7TA 4Z91A 2HN1A 3NZQA 4UF0B 3CIRA 4NPPA 2H88A 3ZN0B 2VKJA 1CUNA 2H3RA 4ZS3A 1NENA 3AVRA 4DV2T 3ZMVB 2A9UA 2K3WA 2QVAA 3AE4A 2WU2A 5AQSB 1ZOYA 3PJAJ 2WCAA 5IYZE 4YJ3E 5ABFA 1WYCA 4AISA 4QH5A 4BJMA 4ZXLA 4JI5T 1WRDA 2E5LT 4NUVA 2IW5B 3NVOA 3JADA 2CXDA 4PJMA 4WZXA 4TWDA 3KBTA 4QXBB 5L47A 5HXEA 2BKNA 3C4WA 1NWMX 3WI3A 3IBPA 3ONXA 4LFBT 3R6NA 4ISTA 2EHOD 2DLRA 3U78A 4KUMB 5ABEA 3L8RA 3FZKB 4IHJE 4DR7T 1SE7A 3HL6A 3CWZB 4ZEYA 3RYFE 4AXPA 3F31A 4I50E 2XHEB 2XAQB 2LE8A 4C91A 4DNDA 1WCRA 2NWBA 4E7SA 4DR4T 1XNRT 3PURA 4HWDA 2KZ7B 4EXTA 4O8SA 1XWMA 3HKDE 4JI1T 2MYSA 3A8YC 2LJLA 3ZT6A 4DMVA 3C51A 4EZ4A 2XAHB 1T72A 1T98A 2OLTA 1WR6A 4DO0A 2OV9A 2UXNB 2MTQA 4HFIA 4YSZA 3BQIA 3AEAA 5LBMA 1N36T 2FBWA 5GONE 2YINA 5JREA 2VWAA 2CA5A 3M65A 4EB6E 2DWKA 2V7KA 3FZHB 2VQET 4C90A 2KSRA 4Q25A 3ZLIA 3TKLB 4X64T 4UELA 3RIFA 4YTPA 5HXSA 3OPCA 5LHIB 3I0OA 3FZFB 1D0ZA 5AQJB 4DV1T 2D5UA 3ZYKA 2OA5A 3AE8A 3CPZA 4H63H 1HCIA 5FP3A 1G73A 2A2FX 3ZSSA 4U2YA 4Z90A 2Z6EA 3I1AA 1SUMB 2XQ4A 2E9XA 4IE7A 1KEYA 3AAAB 4LF7T 4EZHA 3CMLA 5A1LA 3AA7B 3LDQB 4AKGA 3OVUA 3NBXX 4UVBB 4M1PA 2BG9A 2WMNA 4YXDA 3O9XA 2JJ9A 2YU2A 2NW8A 3AE7A 3CQGB 3J9X1 2BBHA 2VL8A 5KDMC 2BBJA 2L3LA 4JI7T 5TAOA 3ANWB 2WY2A 3L39A 4LF6T 2UUAT 1ZEEA 3AXJB 3SRZA 4F8HA 3EDVA 2NOXA 2LLYA 3GWHA 5HCJA 3MA9A 4DR2T 2CBJA 4OHFA 4JI0T 5LGUB 3FB2A 4LMKA 5JR9C 5JRCA 3K3NA 4B3TT 3K8PC 3Q5DA 4IL9A 1WLXA 5BMVE 2CM0A 4CXXA 3SWHA 2X0HA 3CQCB 3RQWA 4EGWA 2VASA 5FMNA 2CXLA 1JNRA 4YY3T 5ABHA 2LRKA 2V7IA 3KBUA 2CWOA 3ZYLA 2BS3A 2WAUA 4WBOA 5IUXA 3RIAA 3UU8A 5JDNA 1YXRA 2X9HA 3A7MA 2R6GF 1LRZA 4H9QC 5E0OA 3UT5E 4EAHA 3MZKB 4ZI2C 2WDQA 4AKIA 5JR9A 4AKRB 2BZBA 3FBZA 4OFZA 1KF6A 3ZCIA 5AQQB 1FMWA 4ILUA 1V9DA 2XQYA 2Q9QA 2HPLA 4UV8B 5HEGA 2KWHA 5AQLB 4IE5A 1I6ZA 5FXZA 4LMJA 4JI6T 4IGUA 3I9YA 4KHPT 5JRCB 3M3ZB 4YLHA 2WMOA 1NAFA 1XDPA 3VRAA 5L3FB 2I6HA 2ACXA 1E1HB 2XAGB 4PJLA 3QC9A 5HCMA 1QSDA 1D1AA 1N32T 4AKHA 3H3MA 5AQKB 2L9QA 2XSAA 3AE9A 4AI6A 4HFDA 2IMLA 3UFEA 5LXTE 3WAJA 4IREA 3EHZA 4HWCA 3LK42 3QOFA 4LFAT 3GA8A 1US7B 3DTOA 4UVCB 4IDOA 1UUSA 5LNKA 4JEUB 3N2KE 4V1Av 4Z8XA 5KX5E 2KLQA 4ZS2A 3AE2A 3ONLC 5JDQA 4X62T 4X5TA 5JR9B 2XQ8A 2XQ9A 4YT0A 1IJ5A 2E2AA 2DL1A 2VKDA 5EK3A 2WM9A 3ETVA 2W0GA 3Q2MA 1IAPA 3FXEB 2BKPA 3NWIA 2AE9A 3AB3B 3F57A 4KP3C 5DABA 2LSIA 4FJOA 4AQFC 2V6YB 2WWVA 5L4EA 2G0UA 5LG4A 3VKHA 3SFDA 3O1JA 3RRWA 4ZI3C 4X65T 2IDOB 4P0BA 4EEDA 4IE0A 3ZJ1A 1O3XA 4ILAA 2D9DA 4ASKA 4HFCA 3RHWA 4GYRA 4YHJA 1HX1B 1W9RA 3UUNA 5HEUA 1YKHB 2K5BB 3AEEA 4GKKT 4JEHB 5FNVE 2N1GA 1VCSA 2ZM2A 3F2EA 4L0RA 2Y48B 2W63A 2FJBA 2QGSA 2HHHT 2MAWA 1FEWA 3RC8A 3ZT5A 2VKHA 1OWAA 3ETUA 4AQGA 1ZHCA 3LBXB 2NW7A 3FHNA 1HNXT 3IEEA 5KMGP 2ES0A 1T7SA 4X1IE 5IHYA 3IHRA 2LT3A 3KV5A 3HKCE 2A72A 4LF4T 1W09A 4KHZF 3O1IA 2CE7A 2HN2A 2IAKA 4IDPA 2ZM0A 3AAIA 1R8IA 1HNZT 3D0TA 1T8BA 3BQKA 2K24A 1HX8A 5L3BB 3P7IA 2C0SA 4QWNB 1VCTA 1FMVA 3I0QA 4YTMA 3UUMA 4B6XA 2RA1A 4EYYR 3RKOA 3E08A 3EUHA 4MLKA 4TV9E 3LJCA 2WDVA 4G2AA 2DI4A 3QNUA 1UGOA 3QB5A 2BS2A 5AQPB 5ABGA 4JI3T 3PJAA 4ZHQE 1XDOA 4HFEA 4H9PC 2KWIB 2MOZA 1SHZC 2KINB 4O4LE 2RP4A 1QLBA 3Q5XA 3A5XA 3ZEFB 4AQYT 5CA0E 2JMKA 3ESLA 4JLEA 4WW0A 3P4PA 2F4VT 4DBRA 4ZI7E 2IUBA 3JC6D 3P50A 3Q9DA 2PJQA 2QA7A 4U2ZA 3C4XA 5LJNA 5LJMA 3UUXB 3CQXC 3B57A 1LVKA 2UXXB 1UX4A 3B13A 5L3DB 3ZMZB 2V6XA 5CB4E 3SFEA 5H6QB 3VHLA 4CN6A 5J2TE 2YOEA 4QXCB 4MBQA 4NXNT 2W67A 2NTXA 3OKQA 2D0UA 3BK9A 5JDMA 3C98B 1ZKEA 2E9XD 2UUCT 2JQ9A 2P9BA 5L3CB 3RKGA 2XQ3A 3DJBA 2YEVC 1VRBA 2WS3A 2NTYA 2L8KA 2BKOA 1L0VA 5DQVA 5C3JA 3N5LA 3ANWA 1J1JA 5AQGB 5FY1A 4UV9B 4XAXB 2V7LA 3AXJA 4IDQA 1IZNB 2XZEA 1N33T 3AVSA 3R84B 3UFGA 3HKEE 5AQMB 2JIWA 2H89A 4P1NA 2KNDA 5FYMA 5LHHB 1SA0E 2UU9T 2LSYA 4IDNA 2X67A 2W62A 4DR3T 3MK7C 3KVBA 4TUYE 3FXDB 4CXWA 3PUGA 5ADXL 1W0BA 4DR5T 4JI2T 2NP9A 4LF5T 4PNIA 3C64A 4DR1T 4UVAB 3ZCJA 1Z8UA 3LG7A 1M7KA 2JPFA 1N34T 3AECA 3GMIA 5FXWA 3FZMB 4LFCT 4A5XA 2D0TA 3EAMA 5AQHB 2XAJB 2XQ6A 2V7MA 2KT9A 4LMLA 5JTGA 2MBGA 3V5UA 2YU1A 1HS7A 2HPJA 2CMRA 2VL0A 3ONJA 4H63V 4QKNA 4YSXA 3KINB 5LOVE 2B1EA 1HTJF 3MKDA 5AQUB 5F5WA 3T1HT 4DV3T 2Q9QD 4F6RC 4PW8A 1Y64B 5JQGE 5JH7E 5LB7B 3MXZA 2QRXA 1HFAA 1X79A 5AQRB 3OBVE 5LMNT 4PK4A 2LOSA 1IBMT 1Z0PA 1H7CA 2BVMA 3TLUA 2PG8A 5C2TA 4LF9T 2VQFT 4EOZB 1X9BA 2LHRA 1LVFA 4A97A 3FZLB 1S94A 1D1BA 2WP9A 1LKXA 4X1YE 2VURA 2WB5A 2M6BA 3JCFA 2FJEA 1D1CA 4ZI2D 3RYIE 2B76A 4H9SE 5LG3A 5LGNB 3TLVA 2ZMAA 4X20E 3ZN1B 4CI3B 5JVDE 2J1DG 3AEGA 4ZZCA 4IIJE 4ISSA 2V5CA 5EK4A 4LF8T 3OJAA 4PAGA 4WBNE 4PJJA 3E22E 3ABVA 4JI8T 1UX5A 3QB5K 2V6YA 3AA6B 3OTOT 1MNEA 3ZSTA 4HFHA 2Y6XA 3NRYA 2YDSA 4FI5A 5LCYA 3PUAA 2W00A 4TNVA 3TLTA 4BA9A 4COFA 3PTRB 1KNPA 1YQ3A 4EIWA 1BR2A 1FJGT 5L2LA 4U7IA 2DCFA 1OEDC 4HTEA 3WAKA 2YK0A 1KFYA 2UUBT 3H3AA 3CX8B 1ZV4X 3RC3A 3PU8A 4QX7B 4HWHA 2PTFA 2Y8DA 4ILBA 4UXNB 5AQNB 4YHHT 3N9OA 2NR4A 4DR6T 3QUJA 3P4RA 3V5SA 5AQVB 4DV7T 5HEHA 4WYVA 1E2AA 3LBXA 4A56A 5IWAT 5J1GA 1YD8G 5HEJA 2XM1A 4XZCA 3KV6A 1KK7A 2VK9A 1U5PA 5DQWA 3ZMSB 4BAYB 4MHCA 5HYAA 4DUYT 3PUWF 2JMHA 2XJ7A 2PBIA 2ODVA 2V26A 4I55E 4UEMA 3T8OA 2H7OA 1IJ6A 2J47A 3S4UA 2XAFB 5AQOB 3RYHE 3H37A 2E5VA 4HGAA 3Q5WA 3PU3A 4B3ST 2K9AA 1XMQT 4O2BE 2WZIA 5HXCA 4AQFA 2YDQA 1XNQT 2CHOA 4X1KE 4UR9A 3UU4A 1QUUA 4BJNA 2A3DA 3K1SA 3AE5A 3AEBA 3ZMUB 4WNKA 4CXYA 4KX6A 1OXZA 2DHRA 4CN1A 5J2UE 2XQAA 3VKGA 5CA1E 1OEDE 3L3PA 5DJQC 2CHNA 5H6RB 2ACZA 3TLWA 5LP6E 2VB6A 3Q5EA 3UU3A 3N2GE 1JNZA 1OEDB 2D2SA 2BS4A 3RI5A 2V1DB 1WFDA 2DWGA 2ODUA 3AE6A 3CK6A 2YDRA 3KDSE 4QHOA 3JAFA 1GQEA 2XY8B 3N2OA 2W66A 5F8PA 2I59A 2LRLA 1J5ET 3ZKRA 5AQTB 4B3RT 2XM2A 4X66T 1UK5A 2LOPA 2N9DA 4CQIA 3SOLA 4KBMB 2C5IT 1HNWT 3LFMA 4B3MT 4ADZA 2BDEA 1BR1A 2CEAA 3HR0A 2WSSV 3CX7B 4DVDA 5LGTB 5C8YE 3ZC0A 2X9XA 2N2NA 4IL4A 3KVAA 3HKBE 3RYCE 4HE8A 2DNXA 1VOMA 4PFPA 4IE6A 4YJ2E 2I0MA 2W2UA 2XPKA 4TWFA 4ZOLE 2VVSA 3P4WA 2CCQA 3AE1A 3LK3B 1MMGA 4E7ZA 2NW9A 4EYUA 3BQLA 4NIQA 1MIYA 2X0YA 5HWYA 4EV6A 3RQUA 5FL0A 3CVRA 3UQ7A 2EHOC 2LSGA 5HXHA 3UU6A 4ERRA 3PUQA 4GKJT 1XZYA 2XASB 4O4JE 3AE3A 4CN4A 2QYWA 3JC6C 1U4QA 3PUZF 5EK2A 3OYXA 3RLFF 1E7PA 5ABFB 1J5WA 4G63A 3EABA 5F3JA 2JQHA 5JDGA 2CBIA 1HG2A 4JV5T 1UCUA 1I94T 3VR9A 2EHOA 3PDYA 3RRCA 4EEBA 4L9IA 2WZHA 3O4XE 2RPAA 2E9XC 2LKGA 2CWYA 1IBLT 2ZLYA 1WYBA 2W4XA 2X51A 2VKOA 1MIWA 4MALA 2X68A 4OYJA 3RGLA 2KMFA 3C50A 4U33A 5LYJE 1M62A 2BG9C 3K3OA 4TV8E 3IF8B 4HWFA 4AKLA 4DUZT 3VR8A 1WR0A 4DV0T 3ZC1A 4ILCA 3W15B 4DMWA 1ZP0A 4QXHB 4MFRA 5J0ZA 2LHNA 2LM2A 2M6IA 4GOUA 5L3EB 5FKYA 3SS1A 5CGMA 4TX5A 5EZYE 3N9MA 3JAEA 2GK9A 1EZ3A 3AA1B 4QH1A 3N9QA 3UULA 3ZJ2A 2H7VC 4OK0A 3PUVF 4HFVA 1G8XA 1MIVA 3N9NA 4CI2B 5LHGB 1BR0A 4U72A 4DV4T 2X9WA 2EHOB 5FVLA 2E8IA 4XBFB 4I4TE 5LA6E 2WU5A 4HEAA 3ZYMA 3ZPOA 3PV0F 2YN6A 2X66A 3KV9A 3KFWX 5FVKA 3AEFA 2CPTA 5HEOA 5BR8T 1KNRA 3X1DA 2IIUA 1YQ4A 3MACA 2FUPA 1HF8A 5AQIB 3AEDA 3UTKA 1FIOA 3AAEB 2XUEA 3RX6A 3RIUC 4O4HE 3HA4A 2UXCT 2ZM6T 5JDHA 2SPCA 4JI4T 1MMDA 4N78D 2UXDT 5FY0A 2FJDA 4CI1B 1D0XA 2E9XB 3RF1A 1UURA 5HXRA 4I43B 2Q9QC 2C5JA 2IC6A 3K3QC 4K0UA 3QK6A 2BG9E 2J62A 4IT4A 4H9OC 5HAXA 2XTLA 3TLSA 2BG9B 2IHR1 1BR4A 4GK5E 5FXXA 1NEKA 3VU7H 3FBLA 2VVNA 5JDLA 2V8SV 4YSYA 4ANJA 2JRKA 2LSKA 4TZ4C 1YW0A 4HN9A 4OYKA 4A98A 3RIUA 1MMAA 3L09A 2IC9A 3AA0B 3PUSA 2W61A 2X0LB 3EDUA 2LEHA 1DU2A 2M67A 1AJ3A 3PUYF 5AQFB 5LMUT 2JQQA 2AXDS 1D0YA 3LK2B 3U3IA 5FY7A 2ZM8A 4QX8B 1S35A 2CLYC 5L4HA 4K0KT 2HH7A 4ZZBA 3GN5A 2MPKA 3CKDA 2V5DA 3PUXF 2CRBA 2X9YA 5HWXA 4JBWF 3I9WA 3IA3A 2WBLA 5M4YA 4TN7B 3KV4A 4DV6T 4U31A 4DBQA 4HKAA 2WDRA 2K48A 1W0AA 3P4QA 1MNDA 1HG5A 2JQKA 2UXBT 2LKHA 2XSBA 2PFVA 4KMCA 2V7JA 4CZZB 3LSVA 4O2AE 3DP7A 4H9NC 4I0UA 1CHUA 3ZT7A 2KXPB 5LBQB 4P0AA 3T1YT 4ZI3D 1OEDA 3ZMTB 4HWIB 4P09A 1MMNA 3N9PA 4U3CA 2Q9QB 4PK6A 3RPUA 4DV5T 1HR0T 3CX6B 4L5GA 4GIWA
chains in the Genus database with same CATH topology
3ZYLA 3MK7C 5C8YE 3ZC0A 4U74A 3KVBA 2WAUA 2X9XA 4TUYE 2N2NA 3FXDB 4WBOA 2LM9A 5JDNA 4UF0A 4CXWA 3KVAA 3HKBE 3PUGA 3RYCE 4H9RC 4HE8A 5ADXL 3NRXA 2X9HA 2DNXA 2C5KT 3GN5B 1VOMA 4JUYA 4PFPA 3MJXA 1LRZA 4IE6A 4NUUA 4YJ2E 5AFUL 4UIGA 4H9QC 5FXVA 5E0OA 2CXFA 3UT5E 3PE0A 4ZOLE 4EAHA 2NP9A 2CCQA 3MZKB 4ZI2C 4AKIA 5JR9A 3LK3B 4YFSA 4AKRB 4PNIA 2BZBA 3C64A 1MMGA 3EVYA 4E7ZA 3FBZA 2NW9A 4J2CA 4OFZA 4EYUA 4UVAB 3ZCJA 3BQLA 3ZCIA 5L3GB 1FMWA 3NZPA 3LG7A 4ILUA 1MIYA 1V9DA 4PK5A 2XQYA 5HWYA 4O4IE 2Q9QA 2HPLA 2JPFA 4UV8B 3O1HA 3N9LA 2KWHA 3OYZA 3RH3A 4IE5A 3CVRA 5FXZA 3HI2A 3GMIA 5FXWA 4GYSA 2EHOC 2LSGA 5HXHA 4ERRA 4IGUA 1KNZA 3PUQA 5JDFA 3I9YA 5JRCB 2D0TA 1YKEB 4PFOA 2BVLA 3E0ZA 2WWUA 4YLHA 2WMOA 5ETWA 2XAJB 2XASB 4GK0E 1NAFA 2V7MA 2KT9A 3J7Yq 4O4JE 5L3FB 2XAGB 2ACXA 1E1HB 2MBGA 3V5UA 2CLYB 2YU1A 4PJLA 3QC9A 1QSDA 1HS7A 1D1AA 2HPJA 4AKHA 2CMRA 3C4ZA 4IE4A 3JC6C 1U4QA 2L9QA 4IDZA 5EK2A 4AI6A 4H63V 2LSJA 4QKNA 3OYXA 3UFEA 5LXTE 3WAJA 3KINB 4PJNA 3LK42 5LOVE 4G63A 3P8CD 3GA8A 2B1EA 1US7B 3DTOA 1HTJF 3MKDA 4UVCB 5F3JA 5JDGA 1B7TA 2Q9QD 4F6RC 4PW8A 1HG2A 5LNKA 3NZQA 4JEUB 1UCUA 4UF0B 3N2KE 4V1Av 4Z8XA 1Y64B 5JQGE 5KX5E 2KLQA 3ZN0B 5JH7E 2EHOA 4ZS2A 2VKJA 1CUNA 2H3RA 3MXZA 3PDYA 4ZS3A 3RRCA 1HFAA 5JDQA 1X79A 3O4XE 4L9IA 3OBVE 4PK4A 2LOSA 2E9XC 2CWYA 1Z0PA 1H7CA 3AVRA 2BVMA 5JR9B 3ZMVB 2ZLYA 2PG8A 1WYBA 2X51A 2VKOA 1IJ5A 1MIWA 4EOZB 4MALA 2X68A 4OYJA 5IYZE 2KMFA 2LHRA 1LVFA 3C50A 4YJ3E 2VKDA 1S94A 1WYCA 5EK3A 2WM9A 5LYJE 1D1BA 3ETVA 2W0GA 3K3OA 4TV8E 3Q2MA 3IF8B 1LKXA 4X1YE 1IAPA 3FXEB 4BJMA 4KP3C 3AB3B 3F57A 5DABA 2LSIA 4FJOA 4AQFC 4AKLA 1D1CA 1WRDA 4ZI2D 3RYIE 2G0UA 4NUVA 3ZC1A 2IW5B 4H9SE 5LGNB 3W15B 4DMWA 2ZMAA 4X20E 5LG4A 4QXHB 3VKHA 3ZN1B 4CI3B 4MFRA 5JVDE 2LHNA 2CXDA 3O1JA 4PJMA 3RRWA 4ZI3C 2J1DG 4GOUA 3KBTA 4QXBB 4P0BA 5L3EB 4IIJE 5HXEA 4IE0A 3SS1A 3ZJ1A 3C4WA 1NWMX 3WI3A 3IBPA 3ONXA 4ISSA 3R6NA 5EK4A 4TX5A 3OJAA 1O3XA 4ISTA 2EHOD 2DLRA 3N9MA 5EZYE 4ASKA 2GK9A 1EZ3A 3AA1B 3U78A 4PAGA 4WBNE 4PJJA 3E22E 3UULA 3N9QA 3ZJ2A 1UX5A 2H7VC 4KUMB 4OK0A 4GYRA 4IHJE 4YHJA 3AA6B 3HL6A 3CWZB 4HFVA 1G8XA 1MIVA 3N9NA 3RYFE 3UUNA 1MNEA 4AXPA 4CI2B 5LHGB 1BR0A 4U72A 1YKHB 3F31A 2K5BB 2Y6XA 2X9WA 3NRYA 4I50E 4FI5A 2XHEB 2XAQB 2LE8A 4C91A 5LCYA 4JEHB 4DNDA 5FNVE 2N1GA 3PUAA 2NWBA 2EHOB 2W00A 4E7SA 2ZM2A 2E8IA 4BA9A 3F2EA 3PURA 4XBFB 4I4TE 5LA6E 4L0RA 2KZ7B 2Y48B 4HEAA 3ZYMA 3ZPOA 3PTRB 4EXTA 4O8SA 4EIWA 2W63A 1BR2A 2QGSA 5L2LA 2X66A 3KV9A 1FEWA 3KFWX 3RC8A 3HKDE 2MYSA 2VKHA 2DCFA 4HTEA 2LJLA 3WAKA 1OWAA 3ETUA 2YK0A 3C51A 4AQGA 4DMVA 4EZ4A 1ZHCA 2XAHB 2NW7A 3FHNA 3LBXB 3H3AA 3IEEA 5KMGP 1T98A 2ES0A 3CX8B 1ZV4X 1WR6A 4X1IE 5IHYA 3RC3A 4DO0A 3IHRA 2UXNB 2MTQA 2LT3A 3KV5A 3MACA 3PU8A 3HKCE 2A72A 4QX7B 1HF8A 2Y8DA 3UTKA 1FIOA 3AAEB 4UXNB 2XUEA 3BQIA 3N9OA 3RX6A 3O1IA 5LBMA 2CE7A 4O4HE 3HA4A 5GONE 2YINA 5JREA 2VWAA 2IAKA 5JDHA 2CA5A 2SPCA 3M65A 3QUJA 4EB6E 2ZM0A 1MMDA 4N78D 3V5SA 2DWKA 3AAIA 2V7KA 5FY0A 4CI1B 4C90A 1D0XA 3D0TA 2E9XB 3BQKA 3ZLIA 2K24A 1HX8A 3TKLB 5HXRA 3LBXA 4I43B 2Q9QC 2C0SA 3P7IA 2C5JA 4QWNB 4A56A 4UELA 5L3BB 2IC6A 5J1GA 5HXSA 1YD8G 3K3QC 3I0QA 1FMVA 5LHIB 3I0OA 4K0UA 3UUMA 2RA1A 4B6XA 3QK6A 4EYYR 4XZCA 3RKOA 3KV6A 1D0ZA 1KK7A 3E08A 3EUHA 4MLKA 4H9OC 2VK9A 4TV9E 3LJCA 4G2AA 5HAXA 1U5PA 2DI4A 2XTLA 5DQWA 3ZMSB 2D5UA 4BAYB 3ZYKA 2OA5A 1BR4A 3CPZA 4H63H 4GK5E 5FXXA 3VU7H 4MHCA 5HYAA 3FBLA 1HCIA 5FP3A 2JMHA 1G73A 2A2FX 4ZHQE 2PBIA 5JDLA 2ODVA 4ANJA 2JRKA 2LSKA 2V26A 4I55E 2Z6EA 4H9PC 4UEMA 2KWIB 4TZ4C 3I1AA 2MOZA 1YW0A 1SHZC 2KINB 4O4LE 3T8OA 4HN9A 2H7OA 1IJ6A 2RP4A 2E9XA 4OYKA 3Q5XA 1MMAA 3L09A 4IE7A 3S4UA 2IC9A 3AA0B 3A5XA 3PUSA 3AAAB 2W61A 3ZEFB 2X0LB 2XAFB 5CA0E 3EDUA 3RYHE 2JMKA 3ESLA 3H37A 4EZHA 4JLEA 3CMLA 5A1LA 2LEHA 4HGAA 3Q5WA 4WW0A 3AA7B 4AKGA 2M67A 3NBXX 3PU3A 4UVBB 2K9AA 4M1PA 1AJ3A 4DBRA 2WMNA 4O2BE 3O9XA 2JJ9A 2YU2A 4ZI7E 2NW8A 3JC6D 3CQGB 5HXCA 3J9X1 3Q9DA 4AQFA 2JQQA 2PJQA 2QA7A 1D0YA 4X1KE 1QUUA 4BJNA 2A3DA 3LK2B 3C4XA 3U3IA 5LJNA 5FY7A 2VL8A 3UUXB 5LJMA 2ZM8A 5KDMC 4QX8B 1S35A 2CLYC 2L3LA 3CQXC 2HH7A 3B57A 3ZMUB 1LVKA 5TAOA 4WNKA 2UXXB 1UX4A 3B13A 5L3DB 3GN5A 3ZMZB 4CXYA 3ANWB 5CB4E 3CKDA 5H6QB 3VHLA 1OXZA 2DHRA 5J2TE 2X9YA 4QXCB 1ZEEA 4MBQA 3SRZA 5CA1E 5HWXA 5J2UE 2NTXA 3VKGA 3EDVA 3I9WA 3L3PA 3OKQA 5DJQC 2WBLA 5H6RB 5M4YA 5LP6E 2D0UA 3BK9A 5JDMA 2NOXA 4TN7B 2VB6A 3C98B 1ZKEA 2E9XD 3N2GE 3GWHA 3KV4A 2D2SA 2P9BA 3MA9A 4DBQA 5L3CB 4HKAA 2K48A 2V1DB 2DWGA 2ODUA 2YEVC 3DJBA 1VRBA 2NTYA 3KDSE 2L8KA 4QHOA 4OHFA 5LGUB 5DQVA 3FB2A 1MNDA 1HG5A 5JR9C 3N5LA 3ANWA 5JRCA 3N2OA 5F8PA 2I59A 2PFVA 4KMCA 5FY1A 4UV9B 2V7JA 4XAXB 3K3NA 2V7LA 4CZZB 1IZNB 2LOPA 3K8PC 4O2AE 3DP7A 4H9NC 1WLXA 5BMVE 3AVSA 2N9DA 3R84B 4CQIA 2CM0A 3SOLA 4CXXA 3SWHA 3HKEE 4KBMB 2KXPB 5LBQB 4P0AA 2C5IT 3CQCB 4ZI3D 3LFMA 4ADZA 3ZMTB 2BDEA 2VASA 1BR1A 2CEAA 4P09A 1MMNA 3N9PA 5FMNA 2CXLA 2KNDA 2Q9QB 3HR0A 5FYMA 5LHHB 1SA0E 4PK6A 3RPUA 2WSSV 3CX6B 2V7IA 2LSYA 3CX7B 2CWOA 3KBUA 4DVDA 2X67A 4L5GA 2W62A 4GIWA 5LGTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HA4 A; 
#chains in the Genus database with same CATH topology
 4U74 A;  2LM9 A;  4TNW A;  2J4G A;  4UF0 A;  4H9R C;  3NRX A;  4AIU A;  2C5K T;  3GN5 B;  4JUY A;  3MJX A;  4NUU A;  5AFU L;  4UIG A;  5FXV A;  2CXF A;  3PE0 A;  4JYA T;  2XQ5 A;  5KXJ A;  4YFS A;  3EVY A;  4J2C A;  3P4S A;  4KI0 F;  4YTN A;  5CJ5 A;  5L3G B;  3NZP A;  2FJA A;  4PK5 A;  4O4I E;  3B5M A;  3O1H A;  4NXM T;  3N9L A;  3OYZ A;  3RH3 A;  1Y01 A;  3HI2 A;  4GYS A;  1XMO T;  3VRB A;  1IBK T;  1KNZ A;  3G06 A;  5FL1 A;  5JDF A;  1YKE B;  4PFO A;  4OX9 T;  2BVL A;  3E0Z A;  2WWU A;  4U7Y A;  5ETW A;  4GK0 E;  3J7Y q;  3UUB A;  4HFB A;  2CLY B;  3EI0 A;  4DID B;  3C4Z A;  4IE4 A;  3UU5 A;  2WQY A;  5CFB A;  2XQ7 A;  4IDZ A;  2LSJ A;  3UQ4 A;  4PJN A;  4QH4 A;  4TWH A;  3P8C D;  3NKZ A;  2YKS A;  1B7T A;  4Z91 A;  2HN1 A;  3NZQ A;  4UF0 B;  3CIR A;  4NPP A;  2H88 A;  3ZN0 B;  2VKJ A;  1CUN A;  2H3R A;  4ZS3 A;  1NEN A;  3AVR A;  4DV2 T;  3ZMV B;  2A9U A;  2K3W A;  2QVA A;  3AE4 A;  2WU2 A;  5AQS B;  1ZOY A;  3PJA J;  2WCA A;  5IYZ E;  4YJ3 E;  5ABF A;  1WYC A;  4AIS A;  4QH5 A;  4BJM A;  4ZXL A;  4JI5 T;  1WRD A;  2E5L T;  4NUV A;  2IW5 B;  3NVO A;  3JAD A;  2CXD A;  4PJM A;  4WZX A;  4TWD A;  3KBT A;  4QXB B;  5L47 A;  5HXE A;  2BKN A;  3C4W A;  1NWM X;  3WI3 A;  3IBP A;  3ONX A;  4LFB T;  3R6N A;  4IST A;  2EHO D;  2DLR A;  3U78 A;  4KUM B;  5ABE A;  3L8R A;  3FZK B;  4IHJ E;  4DR7 T;  1SE7 A;  3HL6 A;  3CWZ B;  4ZEY A;  3RYF E;  4AXP A;  3F31 A;  4I50 E;  2XHE B;  2XAQ B;  2LE8 A;  4C91 A;  4DND A;  1WCR A;  2NWB A;  4E7S A;  4DR4 T;  1XNR T;  3PUR A;  4HWD A;  2KZ7 B;  4EXT A;  4O8S A;  1XWM A;  3HKD E;  4JI1 T;  2MYS A;  3A8Y C;  2LJL A;  3ZT6 A;  4DMV A;  3C51 A;  4EZ4 A;  2XAH B;  1T72 A;  1T98 A;  2OLT A;  1WR6 A;  4DO0 A;  2OV9 A;  2UXN B;  2MTQ A;  4HFI A;  4YSZ A;  3BQI A;  3AEA A;  5LBM A;  1N36 T;  2FBW A;  5GON E;  2YIN A;  5JRE A;  2VWA A;  2CA5 A;  3M65 A;  4EB6 E;  2DWK A;  2V7K A;  3FZH B;  2VQE T;  4C90 A;  2KSR A;  4Q25 A;  3ZLI A;  3TKL B;  4X64 T;  4UEL A;  3RIF A;  4YTP A;  5HXS A;  3OPC A;  5LHI B;  3I0O A;  3FZF B;  1D0Z A;  5AQJ B;  4DV1 T;  2D5U A;  3ZYK A;  2OA5 A;  3AE8 A;  3CPZ A;  4H63 H;  1HCI A;  5FP3 A;  1G73 A;  2A2F X;  3ZSS A;  4U2Y A;  4Z90 A;  2Z6E A;  3I1A A;  1SUM B;  2XQ4 A;  2E9X A;  4IE7 A;  1KEY A;  3AAA B;  4LF7 T;  4EZH A;  3CML A;  5A1L A;  3AA7 B;  3LDQ B;  4AKG A;  3OVU A;  3NBX X;  4UVB B;  4M1P A;  2BG9 A;  2WMN A;  4YXD A;  3O9X A;  2JJ9 A;  2YU2 A;  2NW8 A;  3AE7 A;  3CQG B;  3J9X 1;  2BBH A;  2VL8 A;  5KDM C;  2BBJ A;  2L3L A;  4JI7 T;  5TAO A;  3ANW B;  2WY2 A;  3L39 A;  4LF6 T;  2UUA T;  1ZEE A;  3AXJ B;  3SRZ A;  4F8H A;  3EDV A;  2NOX A;  2LLY A;  3GWH A;  5HCJ A;  3MA9 A;  4DR2 T;  2CBJ A;  4OHF A;  4JI0 T;  5LGU B;  3FB2 A;  4LMK A;  5JR9 C;  5JRC A;  3K3N A;  4B3T T;  3K8P C;  3Q5D A;  4IL9 A;  1WLX A;  5BMV E;  2CM0 A;  4CXX A;  3SWH A;  2X0H A;  3CQC B;  3RQW A;  4EGW A;  2VAS A;  5FMN A;  2CXL A;  1JNR A;  4YY3 T;  5ABH A;  2LRK A;  2V7I A;  3KBU A;  2CWO A;  3ZYL A;  2BS3 A;  2WAU A;  4WBO A;  5IUX A;  3RIA A;  3UU8 A;  5JDN A;  1YXR A;  2X9H A;  3A7M A;  2R6G F;  1LRZ A;  4H9Q C;  5E0O A;  3UT5 E;  4EAH A;  3MZK B;  4ZI2 C;  2WDQ A;  4AKI A;  5JR9 A;  4AKR B;  2BZB A;  3FBZ A;  4OFZ A;  1KF6 A;  3ZCI A;  5AQQ B;  1FMW A;  4ILU A;  1V9D A;  2XQY A;  2Q9Q A;  2HPL A;  4UV8 B;  5HEG A;  2KWH A;  5AQL B;  4IE5 A;  1I6Z A;  5FXZ A;  4LMJ A;  4JI6 T;  4IGU A;  3I9Y A;  4KHP T;  5JRC B;  3M3Z B;  4YLH A;  2WMO A;  1NAF A;  1XDP A;  3VRA A;  5L3F B;  2I6H A;  2ACX A;  1E1H B;  2XAG B;  4PJL A;  3QC9 A;  5HCM A;  1QSD A;  1D1A A;  1N32 T;  4AKH A;  3H3M A;  5AQK B;  2L9Q A;  2XSA A;  3AE9 A;  4AI6 A;  4HFD A;  2IML A;  3UFE A;  5LXT E;  3WAJ A;  4IRE A;  3EHZ A;  4HWC A;  3LK4 2;  3QOF A;  4LFA T;  3GA8 A;  1US7 B;  3DTO A;  4UVC B;  4IDO A;  1UUS A;  5LNK A;  4JEU B;  3N2K E;  4V1A v;  4Z8X A;  5KX5 E;  2KLQ A;  4ZS2 A;  3AE2 A;  3ONL C;  5JDQ A;  4X62 T;  4X5T A;  5JR9 B;  2XQ8 A;  2XQ9 A;  4YT0 A;  1IJ5 A;  2E2A A;  2DL1 A;  2VKD A;  5EK3 A;  2WM9 A;  3ETV A;  2W0G A;  3Q2M A;  1IAP A;  3FXE B;  2BKP A;  3NWI A;  2AE9 A;  3AB3 B;  3F57 A;  4KP3 C;  5DAB A;  2LSI A;  4FJO A;  4AQF C;  2V6Y B;  2WWV A;  5L4E A;  2G0U A;  5LG4 A;  3VKH A;  3SFD A;  3O1J A;  3RRW A;  4ZI3 C;  4X65 T;  2IDO B;  4P0B A;  4EED A;  4IE0 A;  3ZJ1 A;  1O3X A;  4ILA A;  2D9D A;  4ASK A;  4HFC A;  3RHW A;  4GYR A;  4YHJ A;  1HX1 B;  1W9R A;  3UUN A;  5HEU A;  1YKH B;  2K5B B;  3AEE A;  4GKK T;  4JEH B;  5FNV E;  2N1G A;  1VCS A;  2ZM2 A;  3F2E A;  4L0R A;  2Y48 B;  2W63 A;  2FJB A;  2QGS A;  2HHH T;  2MAW A;  1FEW A;  3RC8 A;  3ZT5 A;  2VKH A;  1OWA A;  3ETU A;  4AQG A;  1ZHC A;  3LBX B;  2NW7 A;  3FHN A;  1HNX T;  3IEE A;  5KMG P;  2ES0 A;  1T7S A;  4X1I E;  5IHY A;  3IHR A;  2LT3 A;  3KV5 A;  3HKC E;  2A72 A;  4LF4 T;  1W09 A;  4KHZ F;  3O1I A;  2CE7 A;  2HN2 A;  2IAK A;  4IDP A;  2ZM0 A;  3AAI A;  1R8I A;  1HNZ T;  3D0T A;  1T8B A;  3BQK A;  2K24 A;  1HX8 A;  5L3B B;  3P7I A;  2C0S A;  4QWN B;  1VCT A;  1FMV A;  3I0Q A;  4YTM A;  3UUM A;  4B6X A;  2RA1 A;  4EYY R;  3RKO A;  3E08 A;  3EUH A;  4MLK A;  4TV9 E;  3LJC A;  2WDV A;  4G2A A;  2DI4 A;  3QNU A;  1UGO A;  3QB5 A;  2BS2 A;  5AQP B;  5ABG A;  4JI3 T;  3PJA A;  4ZHQ E;  1XDO A;  4HFE A;  4H9P C;  2KWI B;  2MOZ A;  1SHZ C;  2KIN B;  4O4L E;  2RP4 A;  1QLB A;  3Q5X A;  3A5X A;  3ZEF B;  4AQY T;  5CA0 E;  2JMK A;  3ESL A;  4JLE A;  4WW0 A;  3P4P A;  2F4V T;  4DBR A;  4ZI7 E;  2IUB A;  3JC6 D;  3P50 A;  3Q9D A;  2PJQ A;  2QA7 A;  4U2Z A;  3C4X A;  5LJN A;  5LJM A;  3UUX B;  3CQX C;  3B57 A;  1LVK A;  2UXX B;  1UX4 A;  3B13 A;  5L3D B;  3ZMZ B;  2V6X A;  5CB4 E;  3SFE A;  5H6Q B;  3VHL A;  4CN6 A;  5J2T E;  2YOE A;  4QXC B;  4MBQ A;  4NXN T;  2W67 A;  2NTX A;  3OKQ A;  2D0U A;  3BK9 A;  5JDM A;  3C98 B;  1ZKE A;  2E9X D;  2UUC T;  2JQ9 A;  2P9B A;  5L3C B;  3RKG A;  2XQ3 A;  3DJB A;  2YEV C;  1VRB A;  2WS3 A;  2NTY A;  2L8K A;  2BKO A;  1L0V A;  5DQV A;  5C3J A;  3N5L A;  3ANW A;  1J1J A;  5AQG B;  5FY1 A;  4UV9 B;  4XAX B;  2V7L A;  3AXJ A;  4IDQ A;  1IZN B;  2XZE A;  1N33 T;  3AVS A;  3R84 B;  3UFG A;  3HKE E;  5AQM B;  2JIW A;  2H89 A;  4P1N A;  2KND A;  5FYM A;  5LHH B;  1SA0 E;  2UU9 T;  2LSY A;  4IDN A;  2X67 A;  2W62 A;  4DR3 T;  3MK7 C;  3KVB A;  4TUY E;  3FXD B;  4CXW A;  3PUG A;  5ADX L;  1W0B A;  4DR5 T;  4JI2 T;  2NP9 A;  4LF5 T;  4PNI A;  3C64 A;  4DR1 T;  4UVA B;  3ZCJ A;  1Z8U A;  3LG7 A;  1M7K A;  2JPF A;  1N34 T;  3AEC A;  3GMI A;  5FXW A;  3FZM B;  4LFC T;  4A5X A;  2D0T A;  3EAM A;  5AQH B;  2XAJ B;  2XQ6 A;  2V7M A;  2KT9 A;  4LML A;  5JTG A;  2MBG A;  3V5U A;  2YU1 A;  1HS7 A;  2HPJ A;  2CMR A;  2VL0 A;  3ONJ A;  4H63 V;  4QKN A;  4YSX A;  3KIN B;  5LOV E;  2B1E A;  1HTJ F;  3MKD A;  5AQU B;  5F5W A;  3T1H T;  4DV3 T;  2Q9Q D;  4F6R C;  4PW8 A;  1Y64 B;  5JQG E;  5JH7 E;  5LB7 B;  3MXZ A;  2QRX A;  1HFA A;  1X79 A;  5AQR B;  3OBV E;  5LMN T;  4PK4 A;  2LOS A;  1IBM T;  1Z0P A;  1H7C A;  2BVM A;  3TLU A;  2PG8 A;  5C2T A;  4LF9 T;  2VQF T;  4EOZ B;  1X9B A;  2LHR A;  1LVF A;  4A97 A;  3FZL B;  1S94 A;  1D1B A;  2WP9 A;  1LKX A;  4X1Y E;  2VUR A;  2WB5 A;  2M6B A;  3JCF A;  2FJE A;  1D1C A;  4ZI2 D;  3RYI E;  2B76 A;  4H9S E;  5LG3 A;  5LGN B;  3TLV A;  2ZMA A;  4X20 E;  3ZN1 B;  4CI3 B;  5JVD E;  2J1D G;  3AEG A;  4ZZC A;  4IIJ E;  4ISS A;  2V5C A;  5EK4 A;  4LF8 T;  3OJA A;  4PAG A;  4WBN E;  4PJJ A;  3E22 E;  3ABV A;  4JI8 T;  1UX5 A;  3QB5 K;  2V6Y A;  3AA6 B;  3OTO T;  1MNE A;  3ZST A;  4HFH A;  2Y6X A;  3NRY A;  2YDS A;  4FI5 A;  5LCY A;  3PUA A;  2W00 A;  4TNV A;  3TLT A;  4BA9 A;  4COF A;  3PTR B;  1KNP A;  1YQ3 A;  4EIW A;  1BR2 A;  1FJG T;  5L2L A;  4U7I A;  2DCF A;  1OED C;  4HTE A;  3WAK A;  2YK0 A;  1KFY A;  2UUB T;  3H3A A;  3CX8 B;  1ZV4 X;  3RC3 A;  3PU8 A;  4QX7 B;  4HWH A;  2PTF A;  2Y8D A;  4ILB A;  4UXN B;  5AQN B;  4YHH T;  3N9O A;  2NR4 A;  4DR6 T;  3QUJ A;  3P4R A;  3V5S A;  5AQV B;  4DV7 T;  5HEH A;  4WYV A;  1E2A A;  3LBX A;  4A56 A;  5IWA T;  5J1G A;  1YD8 G;  5HEJ A;  2XM1 A;  4XZC A;  3KV6 A;  1KK7 A;  2VK9 A;  1U5P A;  5DQW A;  3ZMS B;  4BAY B;  4MHC A;  5HYA A;  4DUY T;  3PUW F;  2JMH A;  2XJ7 A;  2PBI A;  2ODV A;  2V26 A;  4I55 E;  4UEM A;  3T8O A;  2H7O A;  1IJ6 A;  2J47 A;  3S4U A;  2XAF B;  5AQO B;  3RYH E;  3H37 A;  2E5V A;  4HGA A;  3Q5W A;  3PU3 A;  4B3S T;  2K9A A;  1XMQ T;  4O2B E;  2WZI A;  5HXC A;  4AQF A;  2YDQ A;  1XNQ T;  2CHO A;  4X1K E;  4UR9 A;  3UU4 A;  1QUU A;  4BJN A;  2A3D A;  3K1S A;  3AE5 A;  3AEB A;  3ZMU B;  4WNK A;  4CXY A;  4KX6 A;  1OXZ A;  2DHR A;  4CN1 A;  5J2U E;  2XQA A;  3VKG A;  5CA1 E;  1OED E;  3L3P A;  5DJQ C;  2CHN A;  5H6R B;  2ACZ A;  3TLW A;  5LP6 E;  2VB6 A;  3Q5E A;  3UU3 A;  3N2G E;  1JNZ A;  1OED B;  2D2S A;  2BS4 A;  3RI5 A;  2V1D B;  1WFD A;  2DWG A;  2ODU A;  3AE6 A;  3CK6 A;  2YDR A;  3KDS E;  4QHO A;  3JAF A;  1GQE A;  2XY8 B;  3N2O A;  2W66 A;  5F8P A;  2I59 A;  2LRL A;  1J5E T;  3ZKR A;  5AQT B;  4B3R T;  2XM2 A;  4X66 T;  1UK5 A;  2LOP A;  2N9D A;  4CQI A;  3SOL A;  4KBM B;  2C5I T;  1HNW T;  3LFM A;  4B3M T;  4ADZ A;  2BDE A;  1BR1 A;  2CEA A;  3HR0 A;  2WSS V;  3CX7 B;  4DVD A;  5LGT B;  5C8Y E;  3ZC0 A;  2X9X A;  2N2N A;  4IL4 A;  3KVA A;  3HKB E;  3RYC E;  4HE8 A;  2DNX A;  1VOM A;  4PFP A;  4IE6 A;  4YJ2 E;  2I0M A;  2W2U A;  2XPK A;  4TWF A;  4ZOL E;  2VVS A;  3P4W A;  2CCQ A;  3AE1 A;  3LK3 B;  1MMG A;  4E7Z A;  2NW9 A;  4EYU A;  3BQL A;  4NIQ A;  1MIY A;  2X0Y A;  5HWY A;  4EV6 A;  3RQU A;  5FL0 A;  3CVR A;  3UQ7 A;  2EHO C;  2LSG A;  5HXH A;  3UU6 A;  4ERR A;  3PUQ A;  4GKJ T;  1XZY A;  2XAS B;  4O4J E;  3AE3 A;  4CN4 A;  2QYW A;  3JC6 C;  1U4Q A;  3PUZ F;  5EK2 A;  3OYX A;  3RLF F;  1E7P A;  5ABF B;  1J5W A;  4G63 A;  3EAB A;  5F3J A;  2JQH A;  5JDG A;  2CBI A;  1HG2 A;  4JV5 T;  1UCU A;  1I94 T;  3VR9 A;  2EHO A;  3PDY A;  3RRC A;  4EEB A;  4L9I A;  2WZH A;  3O4X E;  2RPA A;  2E9X C;  2LKG A;  2CWY A;  1IBL T;  2ZLY A;  1WYB A;  2W4X A;  2X51 A;  2VKO A;  1MIW A;  4MAL A;  2X68 A;  4OYJ A;  3RGL A;  2KMF A;  3C50 A;  4U33 A;  5LYJ E;  1M62 A;  2BG9 C;  3K3O A;  4TV8 E;  3IF8 B;  4HWF A;  4AKL A;  4DUZ T;  3VR8 A;  1WR0 A;  4DV0 T;  3ZC1 A;  4ILC A;  3W15 B;  4DMW A;  1ZP0 A;  4QXH B;  4MFR A;  5J0Z A;  2LHN A;  2LM2 A;  2M6I A;  4GOU A;  5L3E B;  5FKY A;  3SS1 A;  5CGM A;  4TX5 A;  5EZY E;  3N9M A;  3JAE A;  2GK9 A;  1EZ3 A;  3AA1 B;  4QH1 A;  3N9Q A;  3UUL A;  3ZJ2 A;  2H7V C;  4OK0 A;  3PUV F;  4HFV A;  1G8X A;  1MIV A;  3N9N A;  4CI2 B;  5LHG B;  1BR0 A;  4U72 A;  4DV4 T;  2X9W A;  2EHO B;  5FVL A;  2E8I A;  4XBF B;  4I4T E;  5LA6 E;  2WU5 A;  4HEA A;  3ZYM A;  3ZPO A;  3PV0 F;  2YN6 A;  2X66 A;  3KV9 A;  3KFW X;  5FVK A;  3AEF A;  2CPT A;  5HEO A;  5BR8 T;  1KNR A;  3X1D A;  2IIU A;  1YQ4 A;  3MAC A;  2FUP A;  1HF8 A;  5AQI B;  3AED A;  3UTK A;  1FIO A;  3AAE B;  2XUE A;  3RX6 A;  3RIU C;  4O4H E;  3HA4 A;  2UXC T;  2ZM6 T;  5JDH A;  2SPC A;  4JI4 T;  1MMD A;  4N78 D;  2UXD T;  5FY0 A;  2FJD A;  4CI1 B;  1D0X A;  2E9X B;  3RF1 A;  1UUR A;  5HXR A;  4I43 B;  2Q9Q C;  2C5J A;  2IC6 A;  3K3Q C;  4K0U A;  3QK6 A;  2BG9 E;  2J62 A;  4IT4 A;  4H9O C;  5HAX A;  2XTL A;  3TLS A;  2BG9 B;  2IHR 1;  1BR4 A;  4GK5 E;  5FXX A;  1NEK A;  3VU7 H;  3FBL A;  2VVN A;  5JDL A;  2V8S V;  4YSY A;  4ANJ A;  2JRK A;  2LSK A;  4TZ4 C;  1YW0 A;  4HN9 A;  4OYK A;  4A98 A;  3RIU A;  1MMA A;  3L09 A;  2IC9 A;  3AA0 B;  3PUS A;  2W61 A;  2X0L B;  3EDU A;  2LEH A;  1DU2 A;  2M67 A;  1AJ3 A;  3PUY F;  5AQF B;  5LMU T;  2JQQ A;  2AXD S;  1D0Y A;  3LK2 B;  3U3I A;  5FY7 A;  2ZM8 A;  4QX8 B;  1S35 A;  2CLY C;  5L4H A;  4K0K T;  2HH7 A;  4ZZB A;  3GN5 A;  2MPK A;  3CKD A;  2V5D A;  3PUX F;  2CRB A;  2X9Y A;  5HWX A;  4JBW F;  3I9W A;  3IA3 A;  2WBL A;  5M4Y A;  4TN7 B;  3KV4 A;  4DV6 T;  4U31 A;  4DBQ A;  4HKA A;  2WDR A;  2K48 A;  1W0A A;  3P4Q A;  1MND A;  1HG5 A;  2JQK A;  2UXB T;  2LKH A;  2XSB A;  2PFV A;  4KMC A;  2V7J A;  4CZZ B;  3LSV A;  4O2A E;  3DP7 A;  4H9N C;  4I0U A;  1CHU A;  3ZT7 A;  2KXP B;  5LBQ B;  4P0A A;  3T1Y T;  4ZI3 D;  1OED A;  3ZMT B;  4HWI B;  4P09 A;  1MMN A;  3N9P A;  4U3C A;  2Q9Q B;  4PK6 A;  3RPU A;  4DV5 T;  1HR0 T;  3CX6 B;  4L5G A;  4GIW A; 
#chains in the Genus database with same CATH homology
 3ZYL A;  3MK7 C;  5C8Y E;  3ZC0 A;  4U74 A;  3KVB A;  2WAU A;  2X9X A;  4TUY E;  2N2N A;  3FXD B;  4WBO A;  2LM9 A;  5JDN A;  4UF0 A;  4CXW A;  3KVA A;  3HKB E;  3PUG A;  3RYC E;  4H9R C;  4HE8 A;  5ADX L;  3NRX A;  2X9H A;  2DNX A;  2C5K T;  3GN5 B;  1VOM A;  4JUY A;  4PFP A;  3MJX A;  1LRZ A;  4IE6 A;  4NUU A;  4YJ2 E;  5AFU L;  4UIG A;  4H9Q C;  5FXV A;  5E0O A;  2CXF A;  3UT5 E;  3PE0 A;  4ZOL E;  4EAH A;  2NP9 A;  2CCQ A;  3MZK B;  4ZI2 C;  4AKI A;  5JR9 A;  3LK3 B;  4YFS A;  4AKR B;  4PNI A;  2BZB A;  3C64 A;  1MMG A;  3EVY A;  4E7Z A;  3FBZ A;  2NW9 A;  4J2C A;  4OFZ A;  4EYU A;  4UVA B;  3ZCJ A;  3BQL A;  3ZCI A;  5L3G B;  1FMW A;  3NZP A;  3LG7 A;  4ILU A;  1MIY A;  1V9D A;  4PK5 A;  2XQY A;  5HWY A;  4O4I E;  2Q9Q A;  2HPL A;  2JPF A;  4UV8 B;  3O1H A;  3N9L A;  2KWH A;  3OYZ A;  3RH3 A;  4IE5 A;  3CVR A;  5FXZ A;  3HI2 A;  3GMI A;  5FXW A;  4GYS A;  2EHO C;  2LSG A;  5HXH A;  4ERR A;  4IGU A;  1KNZ A;  3PUQ A;  5JDF A;  3I9Y A;  5JRC B;  2D0T A;  1YKE B;  4PFO A;  2BVL A;  3E0Z A;  2WWU A;  4YLH A;  2WMO A;  5ETW A;  2XAJ B;  2XAS B;  4GK0 E;  1NAF A;  2V7M A;  2KT9 A;  3J7Y q;  4O4J E;  5L3F B;  2XAG B;  2ACX A;  1E1H B;  2MBG A;  3V5U A;  2CLY B;  2YU1 A;  4PJL A;  3QC9 A;  1QSD A;  1HS7 A;  1D1A A;  2HPJ A;  4AKH A;  2CMR A;  3C4Z A;  4IE4 A;  3JC6 C;  1U4Q A;  2L9Q A;  4IDZ A;  5EK2 A;  4AI6 A;  4H63 V;  2LSJ A;  4QKN A;  3OYX A;  3UFE A;  5LXT E;  3WAJ A;  3KIN B;  4PJN A;  3LK4 2;  5LOV E;  4G63 A;  3P8C D;  3GA8 A;  2B1E A;  1US7 B;  3DTO A;  1HTJ F;  3MKD A;  4UVC B;  5F3J A;  5JDG A;  1B7T A;  2Q9Q D;  4F6R C;  4PW8 A;  1HG2 A;  5LNK A;  3NZQ A;  4JEU B;  1UCU A;  4UF0 B;  3N2K E;  4V1A v;  4Z8X A;  1Y64 B;  5JQG E;  5KX5 E;  2KLQ A;  3ZN0 B;  5JH7 E;  2EHO A;  4ZS2 A;  2VKJ A;  1CUN A;  2H3R A;  3MXZ A;  3PDY A;  4ZS3 A;  3RRC A;  1HFA A;  5JDQ A;  1X79 A;  3O4X E;  4L9I A;  3OBV E;  4PK4 A;  2LOS A;  2E9X C;  2CWY A;  1Z0P A;  1H7C A;  3AVR A;  2BVM A;  5JR9 B;  3ZMV B;  2ZLY A;  2PG8 A;  1WYB A;  2X51 A;  2VKO A;  1IJ5 A;  1MIW A;  4EOZ B;  4MAL A;  2X68 A;  4OYJ A;  5IYZ E;  2KMF A;  2LHR A;  1LVF A;  3C50 A;  4YJ3 E;  2VKD A;  1S94 A;  1WYC A;  5EK3 A;  2WM9 A;  5LYJ E;  1D1B A;  3ETV A;  2W0G A;  3K3O A;  4TV8 E;  3Q2M A;  3IF8 B;  1LKX A;  4X1Y E;  1IAP A;  3FXE B;  4BJM A;  4KP3 C;  3AB3 B;  3F57 A;  5DAB A;  2LSI A;  4FJO A;  4AQF C;  4AKL A;  1D1C A;  1WRD A;  4ZI2 D;  3RYI E;  2G0U A;  4NUV A;  3ZC1 A;  2IW5 B;  4H9S E;  5LGN B;  3W15 B;  4DMW A;  2ZMA A;  4X20 E;  5LG4 A;  4QXH B;  3VKH A;  3ZN1 B;  4CI3 B;  4MFR A;  5JVD E;  2LHN A;  2CXD A;  3O1J A;  4PJM A;  3RRW A;  4ZI3 C;  2J1D G;  4GOU A;  3KBT A;  4QXB B;  4P0B A;  5L3E B;  4IIJ E;  5HXE A;  4IE0 A;  3SS1 A;  3ZJ1 A;  3C4W A;  1NWM X;  3WI3 A;  3IBP A;  3ONX A;  4ISS A;  3R6N A;  5EK4 A;  4TX5 A;  3OJA A;  1O3X A;  4IST A;  2EHO D;  2DLR A;  3N9M A;  5EZY E;  4ASK A;  2GK9 A;  1EZ3 A;  3AA1 B;  3U78 A;  4PAG A;  4WBN E;  4PJJ A;  3E22 E;  3UUL A;  3N9Q A;  3ZJ2 A;  1UX5 A;  2H7V C;  4KUM B;  4OK0 A;  4GYR A;  4IHJ E;  4YHJ A;  3AA6 B;  3HL6 A;  3CWZ B;  4HFV A;  1G8X A;  1MIV A;  3N9N A;  3RYF E;  3UUN A;  1MNE A;  4AXP A;  4CI2 B;  5LHG B;  1BR0 A;  4U72 A;  1YKH B;  3F31 A;  2K5B B;  2Y6X A;  2X9W A;  3NRY A;  4I50 E;  4FI5 A;  2XHE B;  2XAQ B;  2LE8 A;  4C91 A;  5LCY A;  4JEH B;  4DND A;  5FNV E;  2N1G A;  3PUA A;  2NWB A;  2EHO B;  2W00 A;  4E7S A;  2ZM2 A;  2E8I A;  4BA9 A;  3F2E A;  3PUR A;  4XBF B;  4I4T E;  5LA6 E;  4L0R A;  2KZ7 B;  2Y48 B;  4HEA A;  3ZYM A;  3ZPO A;  3PTR B;  4EXT A;  4O8S A;  4EIW A;  2W63 A;  1BR2 A;  2QGS A;  5L2L A;  2X66 A;  3KV9 A;  1FEW A;  3KFW X;  3RC8 A;  3HKD E;  2MYS A;  2VKH A;  2DCF A;  4HTE A;  2LJL A;  3WAK A;  1OWA A;  3ETU A;  2YK0 A;  3C51 A;  4AQG A;  4DMV A;  4EZ4 A;  1ZHC A;  2XAH B;  2NW7 A;  3FHN A;  3LBX B;  3H3A A;  3IEE A;  5KMG P;  1T98 A;  2ES0 A;  3CX8 B;  1ZV4 X;  1WR6 A;  4X1I E;  5IHY A;  3RC3 A;  4DO0 A;  3IHR A;  2UXN B;  2MTQ A;  2LT3 A;  3KV5 A;  3MAC A;  3PU8 A;  3HKC E;  2A72 A;  4QX7 B;  1HF8 A;  2Y8D A;  3UTK A;  1FIO A;  3AAE B;  4UXN B;  2XUE A;  3BQI A;  3N9O A;  3RX6 A;  3O1I A;  5LBM A;  2CE7 A;  4O4H E;  3HA4 A;  5GON E;  2YIN A;  5JRE A;  2VWA A;  2IAK A;  5JDH A;  2CA5 A;  2SPC A;  3M65 A;  3QUJ A;  4EB6 E;  2ZM0 A;  1MMD A;  4N78 D;  3V5S A;  2DWK A;  3AAI A;  2V7K A;  5FY0 A;  4CI1 B;  4C90 A;  1D0X A;  3D0T A;  2E9X B;  3BQK A;  3ZLI A;  2K24 A;  1HX8 A;  3TKL B;  5HXR A;  3LBX A;  4I43 B;  2Q9Q C;  2C0S A;  3P7I A;  2C5J A;  4QWN B;  4A56 A;  4UEL A;  5L3B B;  2IC6 A;  5J1G A;  5HXS A;  1YD8 G;  3K3Q C;  3I0Q A;  1FMV A;  5LHI B;  3I0O A;  4K0U A;  3UUM A;  2RA1 A;  4B6X A;  3QK6 A;  4EYY R;  4XZC A;  3RKO A;  3KV6 A;  1D0Z A;  1KK7 A;  3E08 A;  3EUH A;  4MLK A;  4H9O C;  2VK9 A;  4TV9 E;  3LJC A;  4G2A A;  5HAX A;  1U5P A;  2DI4 A;  2XTL A;  5DQW A;  3ZMS B;  2D5U A;  4BAY B;  3ZYK A;  2OA5 A;  1BR4 A;  3CPZ A;  4H63 H;  4GK5 E;  5FXX A;  3VU7 H;  4MHC A;  5HYA A;  3FBL A;  1HCI A;  5FP3 A;  2JMH A;  1G73 A;  2A2F X;  4ZHQ E;  2PBI A;  5JDL A;  2ODV A;  4ANJ A;  2JRK A;  2LSK A;  2V26 A;  4I55 E;  2Z6E A;  4H9P C;  4UEM A;  2KWI B;  4TZ4 C;  3I1A A;  2MOZ A;  1YW0 A;  1SHZ C;  2KIN B;  4O4L E;  3T8O A;  4HN9 A;  2H7O A;  1IJ6 A;  2RP4 A;  2E9X A;  4OYK A;  3Q5X A;  1MMA A;  3L09 A;  4IE7 A;  3S4U A;  2IC9 A;  3AA0 B;  3A5X A;  3PUS A;  3AAA B;  2W61 A;  3ZEF B;  2X0L B;  2XAF B;  5CA0 E;  3EDU A;  3RYH E;  2JMK A;  3ESL A;  3H37 A;  4EZH A;  4JLE A;  3CML A;  5A1L A;  2LEH A;  4HGA A;  3Q5W A;  4WW0 A;  3AA7 B;  4AKG A;  2M67 A;  3NBX X;  3PU3 A;  4UVB B;  2K9A A;  4M1P A;  1AJ3 A;  4DBR A;  2WMN A;  4O2B E;  3O9X A;  2JJ9 A;  2YU2 A;  4ZI7 E;  2NW8 A;  3JC6 D;  3CQG B;  5HXC A;  3J9X 1;  3Q9D A;  4AQF A;  2JQQ A;  2PJQ A;  2QA7 A;  1D0Y A;  4X1K E;  1QUU A;  4BJN A;  2A3D A;  3LK2 B;  3C4X A;  3U3I A;  5LJN A;  5FY7 A;  2VL8 A;  3UUX B;  5LJM A;  2ZM8 A;  5KDM C;  4QX8 B;  1S35 A;  2CLY C;  2L3L A;  3CQX C;  2HH7 A;  3B57 A;  3ZMU B;  1LVK A;  5TAO A;  4WNK A;  2UXX B;  1UX4 A;  3B13 A;  5L3D B;  3GN5 A;  3ZMZ B;  4CXY A;  3ANW B;  5CB4 E;  3CKD A;  5H6Q B;  3VHL A;  1OXZ A;  2DHR A;  5J2T E;  2X9Y A;  4QXC B;  1ZEE A;  4MBQ A;  3SRZ A;  5CA1 E;  5HWX A;  5J2U E;  2NTX A;  3VKG A;  3EDV A;  3I9W A;  3L3P A;  3OKQ A;  5DJQ C;  2WBL A;  5H6R B;  5M4Y A;  5LP6 E;  2D0U A;  3BK9 A;  5JDM A;  2NOX A;  4TN7 B;  2VB6 A;  3C98 B;  1ZKE A;  2E9X D;  3N2G E;  3GWH A;  3KV4 A;  2D2S A;  2P9B A;  3MA9 A;  4DBQ A;  5L3C B;  4HKA A;  2K48 A;  2V1D B;  2DWG A;  2ODU A;  2YEV C;  3DJB A;  1VRB A;  2NTY A;  3KDS E;  2L8K A;  4QHO A;  4OHF A;  5LGU B;  5DQV A;  3FB2 A;  1MND A;  1HG5 A;  5JR9 C;  3N5L A;  3ANW A;  5JRC A;  3N2O A;  5F8P A;  2I59 A;  2PFV A;  4KMC A;  5FY1 A;  4UV9 B;  2V7J A;  4XAX B;  3K3N A;  2V7L A;  4CZZ B;  1IZN B;  2LOP A;  3K8P C;  4O2A E;  3DP7 A;  4H9N C;  1WLX A;  5BMV E;  3AVS A;  2N9D A;  3R84 B;  4CQI A;  2CM0 A;  3SOL A;  4CXX A;  3SWH A;  3HKE E;  4KBM B;  2KXP B;  5LBQ B;  4P0A A;  2C5I T;  3CQC B;  4ZI3 D;  3LFM A;  4ADZ A;  3ZMT B;  2BDE A;  2VAS A;  1BR1 A;  2CEA A;  4P09 A;  1MMN A;  3N9P A;  5FMN A;  2CXL A;  2KND A;  2Q9Q B;  3HR0 A;  5FYM A;  5LHH B;  1SA0 E;  4PK6 A;  3RPU A;  2WSS V;  3CX6 B;  2V7I A;  2LSY A;  3CX7 B;  2CWO A;  3KBU A;  4DVD A;  2X67 A;  4L5G A;  2W62 A;  4GIW A;  5LGT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...