3HA5A

Crystal structure of hma (mmaa4) from mycobacterium tuberculosis complexed with sinefungin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
281
structure length
281
Chain Sequence
IQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SADAE, A potent bisubstrate inhibitor of mycobacterium tuberculosis mycolic acid methyltransferases
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords METHOXY MYCOLIC ACID SYNTHASE 4
total genus 100
structure length 281
sequence length 281
ec nomenclature ec 2.1.1.-:
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3ha5A00
2C7RA 3PX3A 5CUQA 2IGTA 3P9IA 2B25A 2NNWB 5U4XA 2IBSA 5HOQA 1VP9A 1D2HA 5LQUA 4EQZA 1FPQA 4P7JA 4CXMA 4KRGA 5EZQA 3ER9A 3M33A 4AZTA 3F4KA 3P9KA 5C1IA 4RVDA 1M6EX 3KQPA 3EVGA 2PX8A 2IH4A 4RTPA 2PX2A 2UYHA 4AZWA 5K03A 3ER8A 3AJDA 3KR9A 4C07A 5DWQA 3P2IA 1QAQA 4HGZA 5KYGA 5FQOA 3OPNA 2P7HA 1YB2A 3UA3A 2OY0A 1SQFA 5EOVA 3FTDA 3P97A 4XUDA 1DCTA 2I62A 2G1PA 3G8BA 1G6Q1 4IKPA 2B3TA 4PCAA 5CM2Z 1BHJA 4EKIA 1I4WA 10MHA 4M37A 4KWCA 3BWMA 3DXZA 1VQ1A 3ELWA 1EIZA 1Q0TA 1VL5A 3AXSA 2UYOA 3KQTA 5JR3A 1UWVA 3H2BA 2AVDA 5HFJA 1B42A 3P9NA 2B2CA 4RVFA 3SX0A 1ORIA 4PGGA 5T67A 2AOUA 3ME5A 2P3LA 5E2AA 1JG3A 3NWEA 1NBHA 1XCJA 3CC8A 3LPMA 3OFKA 5FTWA 4E2WA 5LQJA 3EVZA 2FPOA 2HR1A 2P40A 4OQEA 2AOWA 1F3LA 5IH3A 3EEOA 3IV6A 3HVHA 5ICEA 3ID6C 2PXXA 4PYLA 3JWIA 5EEHA 1JSZA 2ADMA 1HMYA 1R18A 5E1MA 2PSSA 4BLVA 1NW7A 1O9HA 4C06A 4RTRA 5CVEA 3GJYA 1L9KA 3NDIA 1QAMA 2O57A 1VPTA 3FPJA 3HNRA 3GIWA 2ONYA 4YV1A 2HV9A 2HWKA 4BP3A 1AV6A 4IV0A 4MTLA 3FUXA 1U2ZA 4RVGA 2BH2A 1VP3A 3FTEA 3GWZA 5CVJA 2PBFA 1NW6A 3I64A 3IYLW 5ICFA 2ZZKA 3FYDA 3PX2A 4G56A 2AVNA 2EJTA 3FYCA 1DL5A 3NWBA 3SVZA 4BP1A 1YZ3A 2AR0A 2ZFUA 5DM2A 3KQOA 3E23A 4R6WA 3RW9A 4YV2A 1OR8A 3T7RA 1SVUA 1RJDA 4ER3A 5K09A 1EJ6A 4MQ4A 2P3QA 3DMGA 5FA5A 2OPBA 2FK8A 1JG1A 1KPIA 3EGIA 4AX8A 2PXCA 3OFJA 4MHTA 1VBFA 3E05A 4V0RA 3QV2A 3GRUA 2P41A 5EMLA 1AQJA 3A7DA 3BZBA 2BZGA 5LSAA 4RTOA 2YXLA 4PCLA 5GP1A 3PVCA 2PT9A 3UFBA 1JQDA 5GINE 2NP6A 2R6ZA 3KR1A 3FUVA 3OU7A 1AF7A 3BKXA 3G2MA 3OZTA 4QPNA 4RTQA 1BOOA 1I1NA 3C3PA 3LBFA 1YZHA 2FRXA 3KPUA 4QDKA 4WXHA 3TKYA 2OBFA 1JG4A 3UJ9A 3EVBA 2IDJA 5EHIA 4V0QA 1L3IA 3M6WA 3GRVA 2BR3A 2P35A 3QOWA 3LGAA 4RVHA 2FYTA 1KPGA 3MQ2A 3P2EA 2DULA 5F2OA 3I5UA 3KR0A 3R0QA 5LQKA 4CKBA 2CWWA 3LX6A 3OCJA 4A6DA 5KS2A 3GNLA 5E9JA 5P8WA 3HA7A 4E2YA 3G5LA 2CKDA 3HP7A 4CTKA 3DMFA 1NW5A 4RTJA 3KPYA 4Y30A 2JJQA 1RI3A 2Z6AA 1O54A 2KW5A 3SR4A 3TFWA 5D1NA 4PYQA 1WS6A 1NE2A 2ZLBA 3Q7EA 5FULA 4H0NA 5DTMA 2HNKA 2QM3A 1G60A 5E8RA 1WG8A 2BR5A 4GEKA 2PX5A 4DMGA 3U81A 3TMAA 4C08A 2R3SA 3UJCA 2EX4A 2XYRA 3JWHA 3A7EA 4PONA 2BR4A 3UA4A 3DLCA 4HSGA 4QTTB 4A6EA 4FS8A 4CWAA 1NW3A 5EIFA 1G8SA 2O06A 2GLUA 1AQIA 5FWDA 2ZVJA 5DM4A 1G55A 2I6GA 3UBTA 2UZ4A 5K0CA 1XCLA 4ER5A 3DMHA 5EGSA 4E2ZA 1JTEA 3G7UA 2XBMA 4QVKA 3M70A 4GC5A 2ZZNA 4YUWA 1L3CA 1M0EA 1SUSA 1XDSA 4E70A 2NP7A 3PS9A 3X0DA 4EVIA 1JG2A 1R8XA 4PIPA 4PWYA 5M5BA 4ATNA 3OU6A 2F8LA 5EG5A 3A26A 5C0OE 2C7PA 3FRIA 3LSTA 4YUYA 2JG3A 2BM8A 2QYOA 5CD1A 1NBIA 3MGGA 5CVVA 1WY7A 3NTVA 1QZZA 2PXAA 3GRYA 5LR6A 3ANXA 5LQAA 3QOXA 5DLYA 4QQNA 1FP2A 4LECA 2PJDA 4KDRA 4PYMA 1XVAA 3EVCA 1BC5A 2JH9A 4LG1A 3BGVA 3CVOA 3FZGA 2V74B 2YVLA 5K0LA 4YUZA 2ZWVA 2B9EA 2H11A 3BKWA 3G2QA 1H1DA 3MCTA 3NDJA 5K0NA 3B3FA 5DSXA 3K6RA 5C9ZA 2I9KA 1N7IA 3C0KA 3UJ7A 4RTNA 4P7GA 2QY6A 4WVLA 2GA9A 3KHKA 5HIMA 2A14A 4OX9Y 2VS1A 2FK7A 5MHTA 2NYUA 3E8SA 3LBYA 2WA1A 3I58A 5DRYA 3EPPA 3BWBA 3FPFA 1Y8CA 2VDWA 5LQRA 4U7PB 3LDFA 4C05A 5BP7A 4X41A 5E1DA 1I9GA 2Q41A 1XDZA 2YR0A 3R3HA 3Q87B 1JSXA 2G71A 1X1DA 2PT6A 1TW3A 4KVZA 3EMBA 4Y2HA 3T7TA 3UJAA 1P91A 3LDGA 3M4XA 4GBED 2IP2A 5EVJA 2IH5A 3GGDA 3B89A 3BGDA 2VZ9A 3REOA 5F2NA 2IBTA 3DXYA 4GOLD 4DF3A 2CL5A 2FCAA 2YTZA 3M6UA 4DKJA 1JR4A 3CGGA 4ER7A 2AOTA 1ZGJA 4FP9A 5E1OA 1N7JA 4K6MA 1KR5A 1P39A 1MHTA 4PNEA 1L1EA 1X19A 3OU2A 4KIGA 4FZVA 2ZZMA 4GOMD 3G8AA 1WZNA 4OA8A 2VDUE 5HZMA 2H00A 5K8VA 2P1DA 2ORED 2PV0A 2OB1A 1NV8A 3FUWA 1R6AA 5FCDA 5DSTA 1UIRA 3OZRA 1QAOA 2ZIEA 5E8JA 3KQQA 4E32A 5GOZA 4C4AA 5ICGA 5KQSA 2NXJA 3ERCA 5DPMA 2O05A 3CKKA 1D2CA 5EZSA 3G2OA 3B3GA 3LECA 2E5WA 4R6XA 4ER6A 5EC8A 4DA4A 3O4FA 1RI4A 2AN5A 2I7CA 3A27A 3SGLA 2AOVA 4PYKA 5FADA 4HRAA 1Z3CA 2OZVA 2CMGA 1IXKA 1XTPA 2PGXA 4L7VA 1RJFA 3T7SA 3L8DA 1L3BA 4DQ0A 3S68A 5EPEA 3UWPA 2XVMA 3GRRA 4RWZA 5HIJA 2EJUA 2G72A 3D2LA 3FPHA 5FUBA 1MJFA 3DTNA 1NT2A 3EGEA 2ZW9A 1PJZA 2O07A 2NXCA 3HA3A 2GAFA 3O7WA 4CTJA 3SSNA 2ZBRA 3MTIA 3K0BA 1EQAA 3PLAE 2YXEA 3KQSA 1ZG3A 3C3YA 4FSDA 3RIEA 3DOUA 5BXYA 1XXLA 3AXTA 2GS9A 2OYRA 3PB3A 3UJ8A 3EVFA 4HGYA 5DTRA 3HTXA 2K4MA 3KQYA 4FR0A 1F38A 5G02A 3HCEA 1V39A 1YFLA 5ICCA 2JH8A 4QQKA 3G5TA 3SMQA 4LWPA 3LCCA 4DM3A 1EG2A 4E2XA 4ER0A 1BKYA 3C6KA 5CCXA 5FHRA 4CKEA 2YQZA 3KQMA 2IFTA 2JHPA 2VP3A 3MB5A 5HEKA 5JUWA 5EKXA 1RI5A 1R00A 5FWAA 3FRHA 3NVMB 4IWNA 3V97A 4P7KA 3THSA 4DCGA 2C7OA 3FTFA 9MHTA 4LWOA 4B17A 2G8NA 4E30A 4KW7A 1KYZA 5T6BA 8MHTA 2HMYB 3GO4A 3LL7A 5HIKA 2IDKA 3AWIA 3R24A 1SUIA 1RJEA 1XDUA 4HTFA 3BWCA 4HG2A 4PYNA 3SXJA 4RV9A 4QVGA 4E33A 4POOA 1ZKDA 4PIMA 4BY9E 3PT9A 2GPYA 1FBNA 4YMHA 1IM8A 3DP7A 3CCFA 2P3OA 5FQNA 4AZVA 1VLMA 4YUXA 5DXJA 2AN4A 5EIWA 4PYIA 5DT2A 4KIFA 3HCDA 7MHTA 1X1CA 1EJ0A 3LCUA 4KDCA 2EFJA 4NECA 2PWYA 2ZBPA 2PKWA 3HM2A 3BT7A 2O0LA 2AZTA 2QRVB 3DH0A 2P8JA 2PLWA 5E9QA 3TM5A 1NW8A 3EVEA 1R74A 2ZIGA 2WA2A 3DXXA 1Q0SA 2DPMA 3GXOA 3NW9A 4ISCA 4M7RA 4YMGA 3LKDA 2AOUB 3NJRA 3FUUA 5D1HA 5KVAA 3O31A 2IPXA 4EMSA 2EG5A 5EMJA 3G2PA 4MIKA 1FP1D 4RTLA 2JHCA 1JQEA 2N47A 1O9GA 2PVCA 5F2KA 4RYLA 4PINA 3M6VA 3C6MA 4XUEA 3UJBA 4AUKA 5DX8A 2ZCJA 4JXJA 2Z6UA 3EEYA 5IKMA 5DX1A 2UYCA 4RSRA 1R8YA 2XYVA 2ZBQA 2YXDA 3G89A 3HCCA 1ZGAA 4F84A 3I9FA 1KXZA 1KPHA 1YUBA 1RI1A 4M36A 1ZHFA 1SG9A 2OB2A 3GU3A 4X60A 2XYQA 3E7PA 4AZSA 4CKCA 1UFKA 1ORHA 1FJXA 3JWJA 4R8SA 5BW5A 1KP9A 4F85A 3BGIA 1DUSA 1IY9A 3KQVA 4UOEA 1D2GA 2OXTA 3ELDA 1KIAA 1NKVA 3P9CA 4U7TB 3TR6A 4DZRA 2AS0A 1NV9A 3UJDA 3EVDA 2ZULA 1X1BA 3FPGA 2ZSUA 3TOSA 4EKGA 3R6TA 3T0IA 5LQNA 3P8ZA 3MAGA 3HCAA 3CJTA 3B7PA 3CJQA 4BLUA 3HVJA 3UZUA 3P71T 5BW4A 4FT2A 3BUSA 3HEMA 5K01A 1KHHA 2GH1A 2VDVE 5DM0A 4MWZA 2UYQA 3CBGA 3EGVA 3OZSA 3AY0A 5CVUA 4FGZA 3A4TA 2ZWAA 4X61A 3MERA 4F86A 5FA8A 1X1AA 1YFJA 2G70A 1EAMA 5K0JA 4RTMA 5KQRA 5HILA 5GM1A 3I53A 2C7QA 1INLA 5K0EA 3HCBA 2P7IA 2ERCA 5CIYA 1SKMA 3TLJA 2Y1WA 3JWGA 1XJ5A 2PX4A 4PGHA 4BLWA 4RTSA 3KQWA 4QPPA 2YX1A 2GB4A 3KPVA 5CCBA 2ZTHA 2XVAA 1WXWA 4PYJA 3KPJA 5H02A 5EEGA 2NXNA 5B1SA 3LHDA 3DLIA 3GRZA 1G38A 2JHAA 1TW2A 5DTQA 3GCZA 3VSEA 5GIOE 2AN3A 3SSMA 3KR2A 2AOTB 3HVKA 4XUCA 4R8RA 4C03A 3OE5A 1P1CA 1QANA 3IHTA 3LCVB 4P58A 4YUVA 4OA5A 2IH2A 2B78A 3WSTA 4ZTBA 2ONZA 4XCXA 5EHGA 2NXEA 4E31A 5HIIA 5K0FA 2LD4A 2ZIFA 4R05A 3DULA 5DRTA 2BM9A 1N2XA 3LDUA 3P2KA 4HH4A 4GOND 4HTFB 4O29A 4QDJA 3NMUF 3ELUA 3HCFA 3DR5A 2IIPA 1KYWA 1VIDA 2PWPA 1TPYA 1PRYA 3EMDA 3MTEA 4OBXA 1WXXA 5DXAA 5E9WA 1ZQ9A 3KKZA 3PFHA 4GOOD 1VE3A 4FT4A 4M38A 1HNNA 3TRKA 4FSXA 3UJ6A 2HTEA 4YV0A 2QE6A 4X63A 5E1BA 2ESRA 3BXOA 4X1OA 5ERGB 5GWXA 3TKAA 2QRVA 5E2BA 4GF5A 5GIPE 1M6YA 4HC4A 3BWYA 3TQSA 5LQCA 2OKCA 3HVIA 4QTUB 3A25A 2CMHA 4RTKA 3M6XA 1RJGA 1SQGA 3OE4A 2Y1XA 4C04A 5FHQA 3THRA 3TM4A 2WK1A 4P7FA 3V8VA 5EKUA 3B3JA 1P1BA 1G8AA 3CJRA 5T64A 3VYWA 4GC9A 3FUTA 5EQJB 3GDHA 5K0GA 3MHTA 2YUIA 3FTCA 3R9XB 3ELYA 3NVKI 4GQBA 4PYOA 3ORHA 4RX1A 3MCZA 5EMKA 1JTFA 4IV8A 5EMMA 4OQDA 3VC2A 2Z6QA 3G88A 1YF3A 3RODA 3FPEA 1QYRA 5CVDA 3EVAA 3KU1A 5GM2A 5DM1A 2PY6A 3LKZA 4Z2YA 3SM3A 1T43A 5DX0A 1RI2A 1JQ3A 2FHPA 2H1RA 2V7EA 4GUAA 3HA5A 4OBWA 3KPWA 3VC1A 5K0BA 3PTAA 3B5IA 2OO3A 3IEIA 2AOXA 3TPZA 4DCMA 5K05A 3PFGA 3DUWA 3SSOA 4EK9A
chains in the Genus database with same CATH superfamily
5FJJA 1GTMA 3BJMA 4DLRA 3F6BX 1HRDA 2V3WA 3HGTA 2XDQA 3DTVD 4YXFA 2WIBA 5EZQA 5FWXA 2EATA 3H8VA 3B9BA 1CUSA 3U3ZA 1GNPA 4YT8A 1E5TA 1O96B 2QN6A 2H65A 3GUHA 4BFXA 5C8YB 1NNEA 3AHIA 2RH4A 4RA6B 1QQBA 1U3VA 4HLUA 4PG8A 5F4BA 2QE7D 1TGYA 2WSMA 3K32A 4IG9A 1QJCA 4TLMB 5FQOA 4YAIA 2NU6A 4FFMA 3GEEA 3EDRA 1RFLA 2H2IA 1OLSA 1Z63A 2B92A 3SOPA 4LY3A 4QFDA 3SBXA 3GLGA 1V3QE 2XZOA 1E8DA 5BSEA 4W99A 13PKA 1LF5A 2OE2A 1CLEA 4D9NA 1R6UA 2R6GA 1VSTA 3ABSB 2F00A 1ND6A 3MWDB 4YCAA 2YJ3A 3THOA 5EJFA 2XMRA 2IIVA 1BGWA 3LUBA 4I5IA 4MUMA 2JDIA 4RSGA 1NP7A 2QRLA 2BZ0A 3H2BA 3P9NA 4OGLA 3UGTA 4U6NA 4ZVNA 2XWJI 1TMGE 4Q3KA 4ZHQB 1FCJA 121PA 4Y3UA 1ESCA 3RV4A 5E2AA 3ZHRA 3OFKA 4E2WA 3CC8A 3V7UA 3I42A 1JDSA 5IG2A 1OH7A 3N2EA 1NF2A 4U63A 2Q5JA 3U3JA 2VJYA 1RYEA 1AHHA 2HR1A 3U7QA 2ZRQA 2HT1A 1WHSA 1IUPA 1HQCA 1JKFA 1F3LA 2XQGA 3CH6A 3HZOA 4LHWA 4U2GA 4K40A 3HK2A 5KSYA 2A1UA 1LDGA 2B8TA 1GVHA 3B7WA 1YCDA 4BMYA 1G17A 3JWIA 3L46A 3H2GA 3AEKB 1E6WA 3WOVA 1TECE 4CQMA 3V32A 4R9NA 4C06A 2R96A 4E51A 1L9KA 3Q7QA 4N9QA 1MJ5A 3CVXA 4RPGA 1ORRA 3K1ZA 2QTNA 3WLSA 3M1AA 1PCXA 4B6JA 3RU7A 1CF2O 4CL8A 4D3YA 2HWKA 2VTKA 5B6JA 2VT6A 3B6ZA 2P3SA 3ZE6A 4N76A 1B7GO 2V0NA 1T2UA 1I4EB 5K4GA 4B6QA 4R54A 1NUSA 2EBWA 1TC1A 1K6EA 1TL7C 1XL0A 2ZZKA 5CFOA 3FOWA 3O4HA 3PX2A 1GSOA 3BK1A 3HSYA 3GR6A 2HLDA 3VYTB 4YT4A 1BMFA 2B2XA 5EESA 1KZGB 1NJ1A 3GI1A 4R6WA 1RLJA 3NETA 1DJOA 3KAQA 4YV2A 1W30A 4CF5A 1SB9A 3Q4GA 4ER3A 5K0SA 3SE7A 4ALJA 2FPPB 2Q9AA 5DZSA 3U4MA 1L1FA 3DDHA 1A7AA 2FSIA 5JATA 1SFRA 1QMPA 4KSYA 3SYNA 4BMVA 2JH3A 4KAXA 2OYSA 1RYHA 1V35A 3A7DA 4MDHA 3G68A 1DXOA 1OWNA 2HZBA 4QXPA 2XTNA 3NG1A 5CHEA 2B4KA 3CEHA 1Y98A 2HHCA 3WLHA 3GH1A 4C0AC 3AU8A 3FUVA 3CO5A 3K9LA 3PD7A 4FNOA 3PZRA 5JSKA 4NXNB 5JJCA 1ZZEA 1YZHA 2GUGA 2W2XA 3NTUA 1BYUA 3R0VA 5GGXA 5AH0A 3T94A 5IFKA 3CPSA 2NGRA 1DT5A 1HFJA 1I2DA 3RB8A 1XJQA 3WLEA 3EXIA 4A7PA 1P1RA 1A69A 2WF7A 3I9V1 2XX3A 4F5WA 3PNKA 2GN1A 2QMZA 3TB6A 3MQ2A 2HXSA 4PWZA 1T1SA 5JSZB 1EU1A 3I5UA 5FBLB 1E18A 1KEEA 5K0TA 2RJNA 4E2YA 5P8WA 1NXQA 2CKDA 2XE7A 4OP1A 3NHSA 4RTJA 3HYCA 3T9DA 4XPZA 3TDNA 1LSUA 3DBLA 3QRWA 3NHPA 4G5RA 4HFJA 4IR7A 16PKA 4GZ3A 4MKHA 3IMGA 2OSVA 4NARA 4WN3A 5AQEA 3RANA 4F9TA 4JLBA 2ZLBA 1V1RA 1RSZA 4MJLA 4P4SB 1F8GA 4MYDA 4GKVA 5CXQA 4Z49A 3KKPA 5KNCA 1EFLA 2D1QA 1U0HC 1UK8A 1OI3A 2Z4TA 3ABRB 3Q72A 4DMGA 4G3XA 1MIOB 4Z3DA 3PL1A 4I2VA 4LGCA 3WAGA 1SXPA 1H3EA 2BR4A 4MVWA 1Y6JA 3ICPA 2QL6A 2X40A 2H52A 3UHAA 3WFZA 3JAKA 5LMCA 1QCYA 3AF2A 2R6R1 1EFDN 4KI0A 4AFNA 2NZYA 4ZCSA 5FOTA 3F1KA 5CVCA 3QVGA 4ZAFA 3IC5A 4MICA 2A9VA 1Y8QB 2BJWA 1YQXA 1ADCA 1C50A 1E6EA 3AQ4A 2VPIA 2SNIE 4QASA 4HQ0A 3BDAA 5DGXA 4EUNA 2R79A 3JQ9A 3UB3A 1PWYE 1RJ9A 4YTEA 1E5DA 1AQUA 2VLBA 4M8SA 1M73E 1KXJA 1I0IA 1H2HA 1PTJA 5FPYA 2V0CA 2ST1A 1TKRA 2XUPA 2NQ8A 3K3PA 4GT1A 2DECA 4FYXA 3DF7A 4PYMA 5AM3A 1VYHA 1XIVA 1NDHA 2J0VA 1Y6GA 3H7AA 4TUYA 2EVWX 3TTXA 2XRFA 2UVPA 4M9UA 4Q4DA 1UFVA 2I4NA 2J09A 3SR0A 4P7GA 3ENZA 4KO1S 5FPSA 5HIMA 5BN3B 4P3NA 2B1GA 1D1TA 3EA4A 4W63A 3N70A 3LBYA 3H11B 3RWBA 2NPIA 2QN9A 2EAUA 4C0BA 3BL5A 4MWEA 4RC9A 1AKUA 1EFCA 1Q14A 3TIVA 4JX9A 1KEZA 4NBLA 5IDVA 3WLRA 2ZR0A 1GQOA 2VHQA 3OCWA 4I8DA 4UDYX 5L7TA 2BDEA 2QYTA 2R8XA 1CETA 5ENVA 4E07A 3AVWA 1T3SA 3C70A 2G9ZA 1K7XB 1X8XA 2GERA 3M6FA 1WU7A 3GLHB 1OFUX 3BWDD 3KS9A 3PI7A 3PR1A 5LYJA 3T7TA 3LDGA 4GBED 4E03A 4TT3D 3REOA 4MB2A 5LNK1 1REQA 1ENPA 2OHOA 5K3BA 1USGA 2V96A 3MJHA 3RK1A 2Q6VA 1FRNA 3JXEA 4DYDA 4RMJA 3CEPB 2DLCX 1KIMA 1ZGJA 1ZMTA 1V9SA 2PSJA 4FQ5A 3V8BA 4YMVA 3GZNA 2PBLA 4HDAA 2NVUB 1MHTA 4ZVOA 3BM5A 4YGYA 1YULA 4N3BA 5HWSA 4P5DA 3VZCA 5DM70 3VU9B 4Y6GB 1YV9A 1DRKA 3GVXA 4DKXA 2Q3HA 4F4CA 3VNRA 1ONBA 4QDZA 3UK0A 1N75A 1E3DA 2HD4A 4MLDA 1V3VA 3LNCA 1NV8A 2QMUA 2J9RA 5T8KA 5I51A 3IT2A 3R40A 2R11A 3IELA 2XODA 1T15A 3LH5A 4WNAB 1XZIA 1NX9A 3SYRA 2NZ2A 3MHPA 4H3SA 1PW7A 3AP2A 4B79A 3ZS8A 4CFYA 4QGSA 1QPBA 3G2OA 1IMOA 2W2KA 2WJ6A 4BKPA 4EG7A 5BSVA 3JYHA 1D4AA 4XGKA 1QS0B 3LRTA 1M2GA 4PYKA 4MIYA 4B3CA 5IABA 5BSTA 4MO9A 4BKQA 4G4SP 4NU5A 2LIVA 3AIMA 3E3AA 4QBTA 2Q0QA 1VMKA 1ZGCA 1QDLB 4Q9NA 3B1FA 1JUDA 5ECDA 2CHQA 2QLFA 4GLBA 3UKOA 4NZOA 3PXCX 1EVLA 4CIXA 1AB5A 1CDOA 3WOHA 5TLSA 2HBRA 2R86A 4TMWA 2MOKA 2VP4A 3EMKA 3EZGA 2NXCA 1GA1A 1PFUA 1RRFA 1T5DX 2G63A 2ZIUB 5DMHA 3UQYS 4ZCTA 5A9SA 3CVVA 4L6CA 3H3JA 1YMQA 5HQ3B 2FX2A 3K0BA 1VL2A 4KYUA 5AD1A 3K6SA 2PUJA 1Z7BA 4MUGA 2EDCA 1UF9A 1AS2A 3RH0A 4A4DA 2J9GA 2F64A 3LUCA 1ZISA 1Z73A 4FR0A 5KTRA 5G02A 3WQQA 1V39A 5D85A 5I7AA 3COJA 5DIZA 1ADBA 4DCPA 2PYIA 3DE5X 4G4JA 3H7IA 4EKDA 1P1FA 1KQ3A 4OSOA 1MQ9A 1TAUA 1EBUA 1EGVB 2BI8A 3HCNA 4OH1A 4RIHA 2ORIA 4G1BA 4PN3A 1G1AA 4TTJA 1N3BA 2EKQA 3RT1A 1JLMA 1MB9A 1JHVA 1T25A 3L49A 4JZYA 5AK4A 1NX6A 2X19A 4Q12A 1RC0A 4DBLC 1TEXA 1TM1E 3NVMB 3LF1A 3Q41A 3CNQS 4WUVA 4YRRA 4N49A 4WLFA 8OHMA 2JI8A 1Z0KA 1L4NA 2ZB2A 1TUIA 5DGTA 1WXFA 1C4KA 1JR3E 2PD6A 1T26A 4M9RA 3Q5DA 1RQGA 1VLJA 5LL6P 4B3JA 4WOJA 3UWOA 4PSVA 2BUCA 3COPA 4WCDA 5A3QA 5A0TA 3HEBA 1NATA 1KEKA 3AVOA 2EKLA 2EQ5A 1CZKA 3Q7PA 1R0WA 1XRSB 5DFAA 3TSAA 3FMOB 2XMSA 4FLFA 3EXEA 4DSOA 1TOAA 2UUCB 2QDXA 4Z4EA 5JS2A 2HSDA 2OK8A 5JEEA 3USZA 4DLWA 1CUJA 2XPCA 3AVTA 2ZBPA 2Y3IA 5AI9A 3U3XA 2ZSJA 2IXAA 3HM2A 4FFNA 4DL9A 3DH0A 3SZUA 2GZAA 2HOQA 5ALNA 3WJ2A 2X4GA 3UW1A 1B00A 1LVHA 3CR7A 3GXOA 4QBFA 4RL4A 4BGEA 4C4PA 2GXUA 2QT1A 5D8DA 1XLWA 1I4LD 4RIIA 3ZDCA 1R4NB 1IN6A 2IPXA 1LS1A 4DA9A 4P32A 1V5EA 5L6MB 1PI3A 3EODA 3CU5A 1T9BA 3A9TA 2FEAA 1KO7A 4GR9A 3W3AD 4EDHA 3KETA 3W8RA 5HP4A 2OD7A 1E7YA 4XYMA 1KE2A 4RYLA 1C1XB 2VQ6A 4G07A 3C6MA 4LHYA 4Y2SA 5L3QB 2WLTA 2FZEA 5AW7A 2O2DA 5DX1A 3CMMA 4OU5A 2QTRA 4A3SA 4FGLA 3L82B 3WNQA 4BJHB 2J6IA 1G0NA 2WIDA 4ACAA 1ECLA 2MDTA 2WSYB 4X60A 1RXIA 1TCUA 2WTNA 1WPXA 2X8JB 5IAGA 5IU6A 4HEHA 3PPXA 1FFYA 1JDVA 1M1YB 3VM6A 3ADKA 3BA1A 5A7FA 2J6BA 1S96A 2O5CA 2XB2A 1UDBA 2OXTA 1NKVA 4O4HB 4UHCA 2I3AA 1YB7A 4WY2A 4MCJA 3RRZA 1EUDA 1JKJB 5JS7A 1T4CA 2ZU0C 3CVJA 1JPVA 1R0KA 1AKNA 1CNEA 1JBEA 3CJQA 5KAPA 3HVJA 5JCJA 4ANFA 1OXUA 2HA6A 3NR2A 2ZRBA 2XXAA 5HJ2A 5EIBC 4M98A 3UFXB 1O58A 1FNMA 4HDQB 2XXBA 3V8MA 4RZ2A 5CVUA 2WD8A 4CTNA 1J9EA 4HXEB 1IM5A 3OIYA 4BVHA 3A4NA 3FPLA 1JIQA 4CE6A 1A9XB 2Z56A 3RSZA 4RGVA 3DB2A 1I10A 4IVQA 3C1OA 3GAFA 3LZDA 3VO9A 8ABPA 3FBGA 6REQB 5DYNA 3AO0B 1KOGA 1XJ5A 1GRCA 1E69A 4J03A 3AF0A 2HA4A 2ZRGA 3HHPA 4FD2A 1XJ0A 3LQYA 4O33A 2NACA 2A0KA 5H02A 2PANA 2B4AA 1ZWLA 3DLPX 3ZW7A 4F2DA 5KU1A 1T5HX 1DKRA 4EFDA 2WD7B 1OFUA 4KREA 1JHXA 3HR4A 3V8NA 3OEED 2V7TA 4D6PA 4DWJA 4L22A 2PMBA 2O54A 1ZD3A 3CW2A 4BQNA 2HFJA 3TD2A 3W8FA 4C0XA 2QF7A 2V6GA 5B2EA 2JF0A 2ES4A 1MV5A 1U02A 5PGMA 2MWMA 2V4ZA 4HLUC 4C21A 4E31A 5JWRA 2V6FA 3GUCA 5AKZA 4F96A 1G66A 1VCNA 3HLYA 5CLIA 5CNJA 3AZQA 1CHDA 4AZ3B 5AXAA 4MEAA 2IIPA 4GPIB 3GJ3A 2XAUA 3I62A 4FFBB 1KKMA 2Z9DA 4D2IA 4JXKA 5J63A 4XJXA 3LQFA 2CVZA 2OZEA 1BXZA 4N65A 5J4LA 3I28A 2HU5A 4EMTA 4BO5A 2PRZA 1O6GA 3UXMA 2VWGA 4NBSA 5FPHA 1R4ZA 1JFLA 3EHEA 3L7IA 1CJBA 3T3EA 3QLTA 2ZYWX 2E5FA 2QRVA 3DYIA 1AK9A 3PDHA 4Q05A 3QVKA 5FBQB 2DHEA 1DC3A 4JA2A 3BWYA 1U7OA 3OBBA 4A92A 1YOBA 1Q0HA 3DKIA 1QYDA 3VX4A 4G6ZA 4AQYB 4R0MA 3PGXA 3THRA 3TSYA 1GT6A 4KK3A 5IM4F 4BFZA 1J2JA 1VKJA 2BGLA 4FEGA 4FE3A 3ZOZA 5JJKA 1QHHA 3GDHA 5HRUA 3ELYA 2GRUA 4GMKA 1AKTA 5CDGA 3BXHA 3ORHA 2X6RA 3B1ZA 3ND7A 2WW8A 4Z6KA 1WTAA 1SD5A 5GM2A 5DNAA 2Y92A 2FEXA 1T43A 4CR7A 2Z04A 3ASVA 2C2HA 2PUVA 3BK7A 4LOIA 3ZYCA 3R9KA 2QL9A 3HNOA 3L7JA 3PHGA 3VC1A 2ZATA 4FYVA 1GNLA 1N2GA 3A06A 5T7BA 3OOJA 4R83A 3FNRA 4OQXA 4QDUA 4BO2A 1I14A 4DCSA 3QMPA 3UMVA 2NZ8A 2WJPA 4X1IA 2X9GA 1C30B 2XQIA 3G2KA 2AA3A 1CYDA 2PLFA 3R5HA 3BPSA 4Q3BA 4UD6A 3VU0A 2C7RA 3ON5A 2IBSA 5HOQA 3NNNA 3SN6A 2AZXA 2EIHA 1RAAA 3NHYA 1YRAA 3DBRB 4P3KA 3M33A 2YRFA 3WNBA 4BNIA 2V7VA 5I9SA 2IH4A 2C4VA 2NZJA 2XMPA 5E7JA 5GOTA 3I92A 2QJRA 3IVXA 2XMGA 4H6PA 5LB2A 1KQOA 2ZQZA 4GRAA 4NENA 4RV5A 3O3MB 1G9SA 2ZB8A 3IX7A 2OAEA 2HN9A 1SVNA 3HUDA 4M1OA 3H5WA 4YECA 1DCTA 2I55A 2Q49A 1DUVG 4NCIA 3WIEA 4CUZA 4B3RB 1IXZA 1HSOA 3G8BA 3QIAA 1K6XA 2X4IA 3OZBA 4PCAA 4Q00A 2VQFB 2RIRA 10MHA 2IX9A 1U2SA 2Q5HA 3STWA 5JPDA 2MSKA 4LJ5A 4UULA 2BF4A 5I7VA 3ELWA 3PC3A 1NA5A 5ILGA 3U4AA 5EIEA 2PQMA 1G19A 2P5TB 4R3WA 3IE2A 1AHIA 5LM3A 4EA8A 5ALUA 3OC6A 2OHIA 5LOVF 3MYRA 1RPZA 1DG9A 2B2CA 2HJHA 4XQCA 5A3RA 4LNUA 4PGGA 2P77A 2AOUA 2OLEA 1Q77A 3T6KA 2QSUA 4MS1A 3OPYB 2ZWPA 4CKYA 5KWIA 5JBQA 3UAZA 2AC4A 5IAKA 2PRJA 4G0NA 1JZTA 1T2NA 1YK1A 1EXMA 4K05A 4LRXA 3RFCA 3CN9A 3PYXA 4ND2A 1R0SA 5EFOA 1SIOA 2J6CA 4X7RA 1P7CA 2FW7A 5ESRA 4ZQGA 1JQ5A 2LE0A 3L05A 4B4OA 2I7XA 2B3DA 4CUJA 3T1NA 1HMYA 1OKKD 1QUFA 2D2EA 2ZJBA 2BE9A 4R1PA 3PGJA 3C1AA 3T5DA 1KYYA 4B7AA 4GWKA 4QGBA 2DWCA 3GA7A 4C87A 4JUAA 3VVCA 1RHRA 4UHEA 2O8BB 1Z4MA 2OILA 5A3VA 4ZZ0A 2C59A 3C2QA 4K6FA 1CF9A 1TK3A 3KV1A 4KTVE 1MU0A 1XMSA 4MQFA 3EFEA 4PGFA 4ZPXA 1U2ZA 4RVGA 5T3YA 2ZIZA 1PYDA 3CN7A 1KI4A 1C7FA 1YR1A 2OCAA 4LHSA 3S70A 4ALLA 3JD1A 4B82A 2GAIA 2WU0A 1IHPA 4XZ3A 4G1UC 3WAKA 4CM4B 4H1WA 1P7VA 1W1UA 1E1DA 2Z2XA 2QJFA 4BZZA 1KC1A 1SVUA 3AFGA 2C96A 2BKEA 4CM7A 5FWNA 1D5CA 3K31A 5HKAA 2WHXA 1IN1A 2GEUA 5F3DA 4LQ4A 5IJ9A 3ZS9A 2PUCA 3P7MA 4NP6A 3ZE9A 3WDLA 3QSGA 2P9BA 3QV2A 1YBFA 2H4HA 4RTOA 2A7QA 3WS7A 4AYXA 2VXOA 2XF2A 2RAVA 5EKSA 2HQ1A 3O92A 1JQDA 3C4QA 4Q9HA 2NUTB 1FRQA 5DEIA 1V8OA 1VSVA 2ZAYA 4TTSA 1QDUA 1KKLA 3GG9A 3CLTD 2ATVA 1O9BA 2OPHA 2POQX 4BX8A 3QU4A 3KJNA 1SXQA 5JCOC 1V48A 4JC8A 3ETNA 1YZTA 3E3LA 1XP5A 3V1MA 1X15A 1Q0PA 2DBQA 3OX3A 4QXRA 4WFKA 5CIQA 5BVHB 1XTRA 2ASVA 4DDWA 2FYTA 3A6LA 1I4TD 3ANTA 4AJIA 4LWQA 4CKBA 5H81A 5E9JA 1QZUA 4Q82A 1T8RA 4CMIB 5SICE 1JBQA 4Y30A 3GLIE 3L4BA 2KW5A 3AF4A 3AINA 2D2XA 3N7AA 5BR8B 4LI0A 5FEMA 3V2GA 3OX4A 2WJ3A 1DWUA 3BEOA 5CYGA 3MS7A 1SURA 3COWA 3H1FA 2H8GA 4PAQA 2V4UA 2XHEA 1YZKA 1E58A 1G60A 4LZZA 1CIVA 2QVXX 1YO6A 2X5XA 2ZUWA 3T7DA 2YYYA 4QJ3A 5C7LO 1V5FA 2D00A 4UMVA 4V0LA 4JEIA 3FYUA 3BIJA 1DOHA 1N5OX 2O5RA 1GKUB 1WSAA 2VJQA 2W8ZA 2VJMA 2RHWA 3P0FA 1RMQA 4HSGA 4AB1A 2WBLC 3MWYW 3A6GA 1HL7A 1NW3A 1T1EA 4MI3A 1GFZA 3OF2A 4S1TA 3ZXIA 2QTTA 1ZUNB 1T9DA 5B4VA 4IOJA 2C2OA 3BMOB 4NC9A 2OGWA 3E53A 2I6FA 4P5PA 4NOKA 4EFNA 1XTJA 3DCJA 1DEAA 2Z6UA 3OZCA 4HNSA 5CFMA 5KX5B 1RWWA 4YRIA 1KFBB 2YVQA 1VGVA 4FOLA 4YUYA 3U3KA 1I4OA 2QYOA 1JXAA 3E15A 3L7OA 5A7HA 3L8HA 4PPQA 4F9FA 2XBLA 2YYZA 4Z51A 4CU5A 1BJKA 3AVPA 1U5AA 2M9MA 1W96A 3COSA 4YCJA 1HE2A 3OZUA 4CTMA 1PR9A 1VDMA 4LHVA 4LQLA 4RF4A 3VMMA 1BC5A 2CFSA 4Q1FA 3UW3A 4EW3A 2NIPA 2IKQA 3SNHA 1A88A 3UQZA 5IWAB 5A5FA 3HDGA 2G9NA 2EV9A 2I6SA 5KC8A 3O0TA 3WGNA 4UHKA 2W43A 1GDTA 2AMJA 1Z7YA 3ML1A 2OMKA 2H4XA 1DAGA 4DCTA 4U2KA 5LN1A 3R44A 1SKAA 1YQQA 2ZOSA 3N2IA 4NCJA 1U2DC 2AJBA 2FOXA 2FX5A 5A06A 4GOXA 2J9FB 2FN4A 3BL6A 3EPPA 1E3LA 1GZ3A 2D4AA 1IAVA 2WB4A 3GP5A 3OZDA 3PVSA 5G53C 4BOYA 2YJGA 2IDMA 3B53X 3NHMA 5LQRA 2PX0A 4GKAA 4H6VA 4OHKA 2GN6A 2XBUA 4XDYA 2BGIA 1L5GB 1RZUA 2WMNB 2Z5VA 3EIUA 4R98A 1DWQA 3HCPA 4G4GA 3E18A 1MGPA 2VHTA 1X7ZA 1D6NA 3ECCA 3FJYA 4LS3A 2GEJA 4BBAA 5CPFA 4EDFA 3N2ZB 4OAOA 1ANKA 3KE9A 4JT4A 3RSHA 4CM8A 4CHGA 4C7XA 2W22A 5DHRA 1R9JA 3KFLA 4X6XA 4UD2A 4IJ6A 4JBYA 3UK2A 1FP7A 1Z4PX 2XWPA 3BICA 3ESXA 3GJQA 3USCS 4E94A 2IZ0A 3RQIA 1OXVA 2VRCA 4GPZA 3PEYA 5ABPA 1T8PA 1BAPA 1KVTA 2IU6A 3IOMA 3G9ZA 4UNIA 2ZUVA 4QXMA 3RHZA 4W6QA 1B4DA 1Y5NA 3F96A 3MBKA 1O95A 2HKIA 2XUHA 1U4NA 5IJ0A 2EERA 2FG5A 3NHKA 2CFOA 4MKGA 4N5MA 4OJQA 4L5BA 2GCOA 4I3HA 3IT1A 2RK6A 3FNEA 2LDBA 3BB4A 4MS3B 1K1EA 1SMKA 3T9CA 3QFHA 3HKEB 4HH1A 4M8LA 3UIEA 4PLGA 4KUGA 5LIPA 1QGUB 1T2DA 3LECA 1TF7A 4OU4A 5GJWC 4BNYA 4F5EA 4KXUA 4DA4A 4LE2A 2O7VA 5HUQA 3OTWA 5BUZA 3FTPA 2HBQA 4J9UE 2WDZA 2ILVA 4CVNA 5C5EA 3AETA 4M7PA 1YJ5A 3HXTA 4WK0B 3F3MA 1GU0A 4JLPA 3UWPA 3E84A 1IC6A 3R1IA 5BWLA 2N9UA 4XARA 3BJIC 3HP4A 2B0JA 1V25A 3OECA 5JZVA 1MAHA 4WEOA 2WJIA 1M6NA 4GM1A 3A05A 2ZR8A 4J9VA 2DFVA 2XD9A 1WV0A 3GPBA 2C5AA 2O3QA 3H5NA 3MEQA 4S0XA 5CRIA 3GLUA 2P9EA 3D3WB 4OQMA 1JQBA 1V8BA 2FLVA 5ALWA 2P4UA 1MDFA 2G0TA 2GBGA 3BFPA 1U9IC 1Z4QA 3G5TA 3W2FA 4RY0A 4V2UA 1CJVC 3VR2D 1T36A 2Y6UA 4ME6A 2F3QA 4F5DA 4BJ3A 4WLUA 2NUPB 2DQ4A 3MPUA 4CNBA 1N2JA 2BFCA 1JIXA 3H4TA 1U8AA 3QELA 1ETUA 5JDIC 5COQA 5H59A 1YHYA 4MVYA 4F21A 1KRWA 2JGDA 4HWSA 1E3TA 4YJFA 1YDFA 1BCRA 3RUDA 3ZQ4A 2VSOA 3DL4A 4LOKA 1HTWA 3JAWB 1KYZA 8MHTA 3E27A 5CT9A 1W0JD 5DU2A 1E2QA 2IU0A 1Q44A 1RKUA 1DOAA 2QTBA 2XNHA 3UCFA 1KDVA 4V38A 4I50B 5REQA 1SUIA 1EWRA 2FSFA 2TMDA 1BX3A 4HG2A 4NZMA 1S01A 2M6KA 1I1QB 1TO1E 3R3WA 3FVQA 1J5PA 1VM6A 2DFLA 5FNVA 4CW7A 1CIJA 1K9SA 2C4NA 1G8KA 4LJ7A 3SZLA 3KALA 4MVJG 1G21E 4OBEA 4AUEA 4WCFA 3FNIA 2QAIA 5DT2A 1WSBA 1N1EA 3BILA 1DO2A 2IYYA 1GLNA 3WX0A 5LBTA 2ODQA 4MYSA 3LVBA 4GX0A 1XDBA 1AO0A 2PKWA 4NOLA 3BT7A 4JBXA 3RTAA 3AYXB 3ROPA 5E9QA 2R1UA 4IGIA 4RENA 3STHA 1Q0SA 1SWWA 1V71A 1ZVKA 1GPNA 2XIJA 3C1UA 1FFCA 1RRCA 2ZSAA 3KZOA 1JIKA 1C7QA 3PDUA 1EZ4A 1SWVA 4YCDA 3LWZA 3G2PA 2Q5EA 3M1LA 3TW0A 4U2FA 1GLGA 4JGIA 4KDFA 1NI4B 2H54A 3SXPA 1Z16A 4HDNA 2CMDA 5JVDA 3C45A 4NJMA 4MINA 1HNZB 4LSGA 4TRJA 2J7PA 4D4GA 4IILA 4X24A 1N0VC 4HBZA 3PFWO 1KVRA 3HJGA 3RF6A 2DHCA 3HCCA 1E9VA 3CKLA 2EG9A 5KTSA 1IRXA 2X0RA 1YH3A 2ECKA 2JJ2A 1U0EA 1ZHFA 2AQIA 1YA4A 4BWGA 3GG2A 3AJ9A 3RVQA 3U7JA 2Z08A 5EE3A 1N3YA 1EM8A 4G67A 3EXAA 4AMYA 5C3UA 4DXDA 1RIFA 2K2QB 2X8WA 3ELDA 3HMKA 4K28A 3RJ9A 1I1OA 4CN9A 1FXUA 1RXYA 1RWXA 1O6FA 1J0BA 3LU1A 3TOSA 1Z2CA 2VEOA 3VZSA 4AS2A 3AVVA 2G9RA 4NS1A 1IQUA 3HCRA 2CDCA 5AKYA 3W5SA 3CJTA 2X9NA 1LY1A 3WLOA 3C16C 5EERA 4EIWA 1KS2A 3TQQA 5IYZF 2J7KA 1CB7A 4LRQA 3P5SA 2E89A 4QWMA 2VYQA 1SC9A 1IJEA 1X7HA 4I19A 4EPXA 1E7MA 4JGGA 4U6QA 3VSDA 1D9ZA 3K0AB 1J7JA 4AKHA 5BUQA 4IJMA 4AY5A 1K7CA 1P9LA 4TM8A 1XTUA 3N2KA 1GPUA 4MUNA 4TYPA 2XOKD 4FB4A 1OY1A 3ZH2A 1P9RA 1ZFNA 3OKCA 5TB5A 2DUUA 1LFDB 2BLLA 2M1ZA 2ADFA 4BZWA 4BB9A 4OLBA 2CW5A 3OQ1A 3TYXA 3B9QA 3NLLA 3KPVA 1E89A 3KOMA 1GTJ1 1PV4A 1ODLA 1SQ5A 4MR7A 5FI1B 1IJFA 3RC2A 4G1FA 3T41A 1XAGA 3KCQA 2CNWD 2EW2A 4Y9SA 5D5HA 6NULA 1Y5IA 3U61B 3CLTC 1ZN7A 2JIZD 1AZSC 2G5PA 4LX0A 1DQNA 3G0OA 2H1FA 1B16A 4MR8B 5HCUA 2Q6LA 3GCZA 2AX3A 1E9EA 4MW9A 4C9BA 5B7PA 3HKCB 2PMWB 3H16A 2C57A 3EC1A 3RYFA 1MQSA 1QANA 2CZGA 3BE4A 1BGXT 1G20E 2CXXA 4KI7A 4AO7A 2CC2A 4OA5A 4BO1A 1N32B 2RCYA 1J99A 2WZQA 3VHRA 2H17A 3AGPA 4MAFA 3GT0A 4JT8A 2FU5C 5AIAA 5TS2A 2QROA 3ZXYA 1O0BA 4L28A 1XVVA 1N2XA 1V6SA 2GPNA 2GD2A 1G4HA 1DHRA 2QW1A 1SIWA 2VRCD 5GONB 3UUFA 1QLWA 2ZREA 5KQLA 4YXWD 3UPDA 1JEJA 3KQNA 1DCKA 1I13A 1ZH6A 5THQA 4BDSA 5DNUA 2REQB 4HB2A 1TD1A 4HD8A 5E9WA 4IIBA 3TBFA 3FWKA 3MCVA 3ZK7A 2Z8YA 3TLMA 1VE9A 2RK4A 1TCVA 5B1HA 5BY2A 5CDSA 3U5TA 2TMKA 3BXOA 3L9WA 1Z4JA 3PCTA 4IV5A 5BW6B 1CUHA 2VA9A 3ABZA 3DVAB 1OZHA 2FN8A 4HN9A 4DV6B 2QUZA 3TQSA 1K6IA 4R2WA 3I2FA 2GHIA 5FTMA 2G09A 1KK0A 3JY6A 2G08A 5BWMA 4UREA 1ZVMA 3M6XA 4Z7QB 5IXYA 1NFFA 2J5KA 3PUJA 1MOSA 1QMGA 4YCMA 4URVR 3FGNA 1RCUA 1BDMA 4UM9D 1IIBA 4L95C 3VVMA 4BKOA 2D0IA 3HXQA 1XYYA 3MHTA 1JSRA 3D64A 3F74A 1JXOA 2VG8A 4E12A 3Q7RA 4GQBA 5T8KC 4RVUA 4AMGA 2IEDA 3PCRB 1XT6A 4XFKA 4OQDA 4NFSA 3VKUA 1JNXX 2XF8A 3G88A 4F4UA 1I7QB 1QYRA 3IAXA 4P33A 4TSRA 4XASA 2A3NA 3SM3A 3WHIA 5A6SA 2PUWA 2P9JA 4N5NA 4HDMA 1SN7A 1MA3A 2GTIA 1M8JA 1A4RA 1VMDA 4Z4QA 5J3JA 5LYYA 3KOXA 3TTVA 3SBDA 2VXBA 5FORA 2PH7A 5IZCA 4FILA 3VV3A 1IG0A 2QNBA 3LS2A 3OOWA 3SNKA 3X1XA 2GOYA 2B25A 1XMXA 1CR0A 2BT4A 3L0SA 2BLNA 2NTVA 4OHVA 4QZVA 1GNSA 3ER6A 3OCCA 1L7BA 2CDNA 3EYWA 2VBCA 3SKYA 3T5BA 1YMVA 3KJGA 3LTEA 3NGMA 3AEYA 4RHXA 1PR4A 4AZTA 1H2RS 5FL3A 3WKBA 1YR3A 3UJNA 5ESDA 3OLZA 1CY7A 5ERXA 2QTWB 2XNDD 5J2UF 3I04A 4ZO8A 2C31A 4XTRA 1LW6E 5GONF 3WYCA 4TV8B 4C07A 1FA9A 3NH6A 5KYGA 3LBAA 4YAWA 3VZPA 5L51A 1Q19A 4FCVA 4MRMB 1XZPA 4G86A 1AZTA 2Z8XA 2OY0A 4YK7A 2W71A 4Z9FA 1UP7A 1P5HA 4D9FA 4D3DA 1MEJA 2WKRA 2AFHB 4FD3A 4N18A 4ZXFA 2LR0A 2ICAA 4KWCA 3WR5A 3W5UA 2QW0X 2YZMA 5TMBA 4ZCIA 5B7QA 4N8SA 4BDTA 1GZVA 5FO0A 1A71A 1BS9A 1E2DA 4GMHA 3UG6A 3S8EA 1WXQA 5LOVB 5IX8A 5JS1A 2XCIA 2IYVA 3QJYA 3LVRE 5HQ3A 2GFQA 1SEVA 3NWEA 4EB8A 3JU3A 3RC1A 1GU7A 4BMCA 1VJGA 3C5EA 1HDRA 1DTEA 1XU9A 1M34E 4OQEA 1NF9A 4TRMA 3T0FA 2DY0A 3ZYZA 2Y4NA 3IV6A 3KB1A 3LPLA 4I1IA 4R1TA 5JADA 3P0HA 4KFUA 1R64A 5DP2A 4F97A 5HDQA 2Q6TA 5EPOA 4B35A 4CU2A 3UJHA 5CVEA 1R2QA 1C14A 4DIOA 8ADHA 4MCAA 4ZT2A 4ZICA 3FPJA 1E3MA 1HE8B 1O94A 2H16A 1M6VA 1Z2DA 3QVXA 3C6ZA 5AI6A 3GLIA 1AV6A 1OT5A 3UATA 4H1TA 2ZJ5A 5CJ2A 3RHSA 2ZITA 4U1RA 3H2ZA 4JS0A 4QUEA 2FR1A 3Q9LA 3ITDA 2JDID 1QB8A 5D00A 4ZYZA 1AXGA 2C2GA 4R1UA 1QCZA 2ZYSA 3SYKA 2NVWA 5GJCA 5HRAA 4ZAYA 5FTNA 5KSZA 1V7QA 2QP3A 1CUDA 2XQKA 4PFSA 4GM0A 1AOXA 1T5BA 1C0KA 1PZXA 4OHOA 3T7RA 3STVA 4EGSA 1BH6A 2IV2X 2YBDA 4JT9A 4C4XA 1RM5A 2O8VA 2EF0A 3PA8A 1XQ9A 2PXCA 3V8EA 1V11A 3OG9A 4V0RA 1Y8RB 3EVNA 3V2UA 4I1OA 3Q8XB 1KJ8A 2ZVQX 4KX3A 2QPTA 3GRUA 2F9MA 2IYXA 1N2CE 5EMLA 4EW2A 3LQ4A 3FB4A 2EZTA 1PV1A 4P84A 3V33A 3U09A 3EXG2 1GCIA 1D8AA 1X42A 2IEBA 3SZRA 3UAOA 3L18A 1JI3A 2Q4EA 4B2PA 4M1SA 2H1OA 2NT3A 3WHLA 3L0PA 3KPUA 4RKQA 4I5FA 4Q3CA 4QDKA 4BUJA 3E35A 2AFIB 5K1ZA 3PDCA 2OUKA 5HXAA 3A32A 2PA0A 1ZK2A 2EJWA 4YJKA 5TF4A 2WOJA 4OUKX 1P4RA 1GVNB 1VRWA 1VIVA 1KPGA 1E3QA 3MWJA 4RMIA 1XVTA 2DTXA 2QRKA 1CQPA 1QBGA 2Q5FA 3KR0A 3RBXA 1B6RA 2H51A 2DKOA 1CSEE 3HBLA 3RTCA 2HU2A 4UVHA 5FWXB 2HF7A 4KQIA 4JLMA 3N0WA 3U9TA 1QHFA 3E70C 3EJWA 2HWYA 1O96A 1Y6RA 4DUGA 4REQB 2VF8A 3VDQA 2E1PA 1WS6A 3IILA 5ELXA 4XUGB 1YRYE 1KDYA 4WK4B 2VHVA 1OTYA 2PKRA 3O8QA 5D5PA 5E8RA 3LAWA 5L40A 3I01A 3FCCA 3ROKA 1YL5A 4C08A 1U7UA 2JW5A 3B8EA 3EAFA 3NPAA 3HWWA 5CB4A 1I30A 4MEJA 2XYRA 4I1RA 2WUGA 1KR2A 2X5KO 1J9ZA 2VKQA 5D3KA 3QE9Y 5F9HA 2V8OA 3KJZA 3HPRA 4KR0A 1AGYA 2O06A 4IYJA 4NEHB 3TOXA 3FROA 4G8JA 3NEAA 1BD4A 3LZ6A 1JTEA 2KYRA 2Q3DA 3ZVNA 3JQ6A 2PGIA 2HU8A 2HMVA 2DPHA 3PWKA 3EHDA 3WRXA 1DDOA 3OZEA 4KMRA 1DRWA 1LLDA 2XE4A 3DCIA 4ZHQA 1ZW6A 3I5XA 1JSCA 1ZY2A 2QTVA 1JG2A 4CM5A 2J33A 3DL2A 2F8LA 3WIOA 4KXQA 1RBYA 2YWFA 4E11A 1CP2A 4MYTA 5EVCA 2JG3A 4JEUA 1R8QA 1M75A 1MIHA 2X5NA 2IS2A 1WQ1R 1GTVA 5I9NA 1G6HA 4TT8A 3GMSA 2F9LA 1QZZA 4HUTA 2XUGA 1GIAA 4AMUA 5JSQA 1XELA 1RJWA 2MINB 2Y1EA 1E5QA 3DDZX 3V2HA 1TVKA 3RAEC 5LWHA 2GHTA 2HM7A 3LC1O 4Q9JA 4DQKA 1RDFA 4JI0B 4D6XA 4Q4JA 1D03A 1JIIA 4ALKA 1Y1LA 2N42A 1QORA 2JA1A 3O93A 4CODB 5C9ZA 2HDWA 3PXBA 2I9KA 1MFZA 3SX4A 3ZI7A 4LJSA 3C6XA 4EG3A 2AMLA 1VIYA 1F2DA 1FSSA 1PZEA 2IVZA 2VS1A 5JYBA 3Q3GE 4OHPA 1KNXA 2IBMA 2JB9A 5KTKA 5IJZA 1GR0A 5EXEA 3LOQA 4YHBA 4RLHA 3ZKWA 4B6EA 3LUAA 3WV4A 4C2UA 5IDWA 3LHKA 1RTTA 3EFBA 1F8UA 3OZXA 1FSZA 1AIPA 4TMTA 4ZO9A 1SNYA 3R3VA 1HI9A 4A0HA 4BTVA 5E1DA 4X3PA 2YR0A 4DMCA 3BWVA 3AB3A 5AMXA 5ESWA 2IHNA 1FP6A 1IPHA 2HYIC 2WP0A 2HMTA 3MF4A 2DUMA 2X13A 3LCRA 2QU7A 1J39A 4TTPA 1G42A 1GGNA 3B89A 4ITUA 4IYRA 5BNWA 3X2FA 3CH7A 3UEOA 3VHXB 3KSBC 1D3AA 4MQEA 4HLCA 3IPAA 5JXHA 1Q21A 2AOTA 1J42A 4FP9A 1MB2A 2FG6C 1OX4B 1XQ6A 3RD5A 4BKRA 4GIBA 3CNNA 4DBZA 3EVTA 1KR5A 1WMBA 2ZVDA 1HX7A 3TLGB 1ID8A 3MBIA 3ESQA 3AMVA 3R77A 4BEVA 4OO3A 2P90A 4DJDC 3G8AA 4DPKA 1CLUA 4R7TA 4KV9A 3O8LA 2BSQA 3MELA 1U8ZA 1VBNA 9GPBA 2L0XA 2OMEA 2G5CA 1R6AA 4PBTA 2IYAA 2R25B 5DSTA 3TEMA 7REQB 3KQQA 2H92A 3LUHA 3JQ9C 1SXJB 3P4XA 1XP8A 1SKUA 2WT8A 3PYMA 4RPCA 3T3HA 2GXAA 4J49A 4BO7A 1ZUIA 4L75A 3CCBA 3I1JA 4N6GA 5SYNA 3BH7A 1E2HA 2AC2A 4N7JA 3SZOA 2WF6A 2RJOA 3BCHA 2Y27A 3FWZA 2IRWA 3OZGA 4LZLA 1TTTA 2WJHA 4BTLA 3LHIA 3T4EA 5CNMA 5FOVA 4MUKA 4J43A 3HHEA 5K4AA 2H9YA 2HT6A 4NG5A 4OFZA 2WZDA 4FHDA 2C2KA 3ASYA 2G72A 2WM8A 2ONJA 4YUAA 3PC2A 1O6ZA 3NYQA 1QDEA 1JU4A 2EFCB 5AJTA 2JFHA 5ALTA 2VT2A 2NV2B 1ZAYA 5TGZA 1IH8A 3DBIA 3LKVA 4X7PA 3W2EA 4NXMB 3B38A 1UBLS 2BGKA 3K35A 1HMPA 1MRZA 2ZJ1A 1FYWA 3NIDB 1XXLA 2BFBB 4IDEA 4U0JA 4DKJA 4DDKA 4HVAA 2VTVA 4AKSA 4WMLA 3OJWA 3KYDB 2WIFA 1UINA 2HU7A 5G40A 2VAWA 1ZGZA 2OHXA 3A3OA 2HO5A 3QLVC 4QQKA 4XIGS 4BNKA 1HLFA 3G23A 1YQEA 4RAQA 3GCDA 4N3CA 4RD4A 3HU1A 3U1TA 2VJDA 4M0PA 4PVCA 3KT3A 2FQQA 2VUSA 3WXMA 4EG4A 1PT7A 2BBOA 2C99A 4LF9B 5BT8A 2UZ1B 2ZIXB 1ECCA 1HE1C 2R6FA 2C8LA 3V97A 4DCGA 2P11A 5F78A 3KEMA 4EB6B 1WVIA 4KW7A 1V8PA 2ZTVA 2IXBA 4WESB 1NVAA 3LL7A 4ZYVA 3JATA 5A4DA 1IB0A 3M3HA 3QYPA 3OIDA 4RK6A 1MW9X 1TZBA 3D4BA 4GVXA 4YCCA 2O1EA 4BFSA 4E33A 4PIMA 1TM3E 4A0RA 1HRKA 2QVBA 5MN5A 3UMMA 3F5DA 3IUMA 1KZ4A 4JROA 2P3OA 5IKEA 4LSZA 5HF8A 4YMWA 3QOYA 3WG9A 2MYUA 3J81k 1ZS9A 2J3JA 4H9GA 4RZXA 3VR0A 3CF4G 1YVRA 3SLKA 1T2CA 2JGKA 2VAPA 1ONPA 3KIPA 3V34A 5LYJB 3IHLA 3QFFA 1UT6A 1X9GA 4OD0A 3TIGA 4OYRA 2WA2A 4M7RA 3UM9A 1GLVA 2LP4Y 5JZOA 4BXOA 2WPDA 1B0AA 1DRUA 1VB3A 3O31A 3QXJA 2BPOA 4KYIB 3DKVA 4Q24A 5AJHA 2ZRPA 4M1TA 3PRHA 4K03A 2D5AA 5D3ZA 4ARCA 4D8WA 5TARA 2DP4E 1QONA 4DWWA 4WLEA 2XYGA 5EWJB 1JYSA 3GGPA 2ZE7A 4JXJA 3EFOB 1F48A 1GKIA 3H2SA 4P3YA 5IKMA 1LSSA 3CZ5A 2EZ8A 3N05A 1OKKA 3P26A 5ILQA 1HLPA 3IRVA 2FETA 4G37A 1GQSA 2FW1A 1NXPA 2JGEA 2L18A 2XOKA 1C4OA 4JUDX 5EXSA 2AQHA 4ZN6A 3KBOA 1P6UA 3F90A 4R9RA 2ZSEA 2OB2A 4NYIR 3F9RA 4Y2XA 4ZVQA 3SQMA 4LJRA 1ZICA 3E7PA 2ZUEA 1BA3A 3TPFA 1ZX1A 3RI3A 1AKEA 1KARA 1QF7A 2VZ0A 5CLQA 4CN8A 1CYEA 2WEKA 3S40A 3GOHA 4YN3A 5KJ6A 3TR6A 2UKDA 3CRQA 1DADA 4I4IA 3C74A 2WPNA 4LGYA 2XVYA 5TEWA 1BX0A 4B87A 3SDSA 3R09A 1Y1PA 3LFHA 4MA5A 4EUSA 3WI7A 1L9XA 2ZBFA 1ZC3A 3MAGA 2F3SA 1GNRA 4KPEC 4H1VA 721PA 3UZUA 4CMJA 1IM2A 2M1XA 2ZUDA 2YW2A 5ALKA 1BRTA 1IEWA 5K01A 4XX1A 4L15A 1THTA 5KINB 2VOEA 1V4BA 3HJBA 2AGVA 4RY8A 1L4GA 3MERA 1GCAA 5HBRA 1GTSA 4WHMA 4K8OA 2GEDA 4NE2A 1GN9A 4B3MB 3K2IA 4RM2A 2W4QA 3G6KA 2VYND 3HCBA 5EKDA 4B2LA 1H8HD 2ERCA 4I55F 4KO4S 4MIEA 2OXEA 1C2YA 4KFCA 3ND5A 3EPRA 5I5EA 5E6SA 5KOHA 1XTVA 5CCBA 1KOLA 4RTSA 4PZCA 2QAGC 1EJ2A 4HZUA 2ZTHA 3MUEA 4BLRA 1Z0JA 3W6PA 3DVSX 4EFMA 5EEGA 2ZPAA 1H3FA 1N8NA 1ZU5A 1DKUA 4CKEB 1FDRA 1SVOA 1NJ2A 1QHIA 3DLIA 4NFHA 4UW9A 5SZJA 4LJ8A 3CX7A 5DTQA 3K71B 1XZKA 2GRJA 4UJ3A 4HFNA 1KY5A 4MYHA 5BYBA 1HQYE 2B6HA 2VN8A 4QFMA 4KN8A 1SCUB 2ODNA 1VJTA 2Q29A 2QBYB 3LA6A 2NXEA 3D2BA 5I7SA 3UOGA 2R1TB 4C30A 4MA0A 5ALOA 3ULKA 4DM4A 1E3WA 5DRTA 2NG1A 2DH5A 3QZUA 3M6LA 3K5HA 2EKZA 4E5DA 3CONA 4N8DA 4BV3A 5CA1A 2JK1A 4TUYF 1OVMA 2VYVA 3ENWA 4GBJA 3LLVA 4BQSA 3ND8A 3DEAA 3RM3A 3TF5A 2MYNA 1DMSA 1WXXA 1UMKA 3PUVA 1A5AB 3PHBE 1YQ9A 5C18A 1GRRA 4AJEA 2BBSA 4EZEA 3IQWA 4PPGA 4YJ3A 4FSXA 1XXHE 1SQ0A 3LCJA 3KRTA 3LPAA 4DVGA 2E85A 1VJ5A 4AJPA 4Q4AA 1OHHA 4LJKA 1HORA 1KO4A 5KAMA 5GWXA 3TI9A 1MDBA 1Z0ZA 3WNZA 3X1WA 4AC9A 2GTPA 2HK6A 3UANA 4IDHA 4QFCA 1R0RE 4XYGA 4BP8A 2J4CA 1UPBA 3UT5A 3DJYA 1E2MA 1SQGA 3IJ5A 2C00A 3GWGA 1S2DA 3U39A 2NADA 5B6PA 3LYUA 9ATCA 3WWZA 4OP2A 4IMRA 4X8MA 4XB6B 3S81A 1Q17A 2DWOA 2HV8A 1Y3BE 2XEXA 3PV0A 1Z9BA 2DFDA 3RUPA 4DJAA 4JLJA 4GXNA 1OYWA 2MIIA 2Y0EA 3JS5A 3BHMA 1JTFA 3W5HA 2O2ZA 3ADCA 1FUKA 5K9ZA 1I0ZA 4S12A 3A4LA 3LKZA 2DHQA 3FFBA 3WGGA 5LFAA 4HVTA 3NTLA 2GNPA 1KH1A 2GAJA 3E7XA 3M5DA 3SF8A 2OCBA 3ADPA 3LY9A 1P2VA 3KFXA 3TRFA 1WPQA 1J4AA 1V26A 1SA0A 1P81A 2AMFA 3AR7A 4M0UA 5JD4A 5K8TA 4UUNA 1QV6A 3ZXXA 1YI1A 2GFHA 3I1YA 4D7AA 4EK9A 4LHEA 3IAS6 4ZVUA 3UK7A 4D0GA 1OBFO 5MN4A 3FR7A 4B45A 1UBFA 3ZQ6A 5LQUA 1IDN1 1RQLA 4AX4A 3GFRA 1T4BA 2YFKA 5AVWA 1G9XA 2CXPA 5LXTB 2FHSA 1QG0A 1E4VA 1DQSA 3BE6A 3QTTA 1K2WA 3VR5A 3WL3A 4XRGA 1H2XA 1W6UA 1M6EX 5AIBA 2UYHA 3TB4A 5LMNB 1MG5A 1BVRA 1M2NA 3D6AA 2OEPA 2AEJA 5EJ8A 3ISTA 1E1QA 3L3BA 1KJWA 4HWOA 1OJ7A 2IIQA 2UAGA 4UAJA 4IO0A 2PSEA 4UBLA 1JFVA 2GASA 2ZB7A 3PD1A 4BVBA 1QFXA 3IVCA 5GZ3A 4L0QA 1WO8A 1UAGA 3NIWA 1W0KA 2DQKA 1UZUA 2WSSD 1EESA 4JLUA 4WERA 4F6RA 1GG8A 1CUVA 1D9XA 1F51E 1FB5A 4LJLA 3VDMA 3GNTA 1E9SA 2LRHA 1M5RA 1CCWA 2C54A 4BNHA 1L6RA 2H1HA 4X66B 2R85A 3ITEA 4WA8A 3AXSA 5DHSA 1G16A 4JVLA 5AK3A 5KB3A 5LKRA 2X9LA 4Y2GA 3SC2B 2ILTA 4GXQA 3RUHA 3QFCA 4PNPA 5BOSB 1GYPA 3IE1A 1Y7LA 2INGX 4UZFA 5JCZA 4WOCA 3OFND 3LPMA 4KB5A 3AP1A 5AW8A 2QJTA 2ZYVX 3Q0EA 1XRPA 3QX8A 3BQ9A 1F2TA 3VTAA 3MIZA 4X92A 5ER6A 1GITA 3DWIA 3L6UA 4XSHA 4C0JA 1EFRA 3JRNA 1T29A 3PCXA 3ZJ4A 5A1TA 4LVUA 3JQFA 4L51A 1EVZA 1QLHA 1XPUA 3LDAA 3LBIA 3GGOA 4NEQA 2ONYA 3EDOA 4FKZA 4HDSB 4E4YA 5B12A 3RS8A 3O74A 2DETA 3N2LA 3KM0A 2CD7A 2H0RA 3UC5A 4G36A 1SXJC 1G98A 1Z6PA 1ODSA 3MMZA 1KWGA 1ZK3A 2HYDA 1FTSA 1KI6B 1GZHB 4GL2A 1KYXA 3QUQA 2DSTA 5ICFA 1L7MA 1W5FA 2ALJA 2VF7A 5CYPA 4Y1RB 5KBYA 2FN7A 2XRYA 3AKYA 1HBJA 3FYCA 3SVZA 3GGGA 1YZ3A 1EX6A 2JVIA 2XITA 1YJXA 3LP6A 5DEOA 4KLAA 1K0FA 1VDZA 1OX6A 5CDFA 1FDVA 1NBEA 2I8CA 3PGMA 3GT3A 2YHUA 4GOJA 1OOEA 5F76A 3TZEA 5ITSA 4EPRA 4AJKA 3H3XA 3PXAA 4UVDA 3O8BA 3WADA 1FJ2A 5J1SB 3IUPA 2CV2A 4OB7A 5H83A 1E99A 2N0SA 4PIVA 5AHOA 1EE9A 4K0KB 3BZBA 4PLCA 2LXNA 1JECA 1SUBA 1MT0A 1QTIA 4NCNA 5KNDH 1CQZA 1FW6A 4M1YA 4X20A 4ZVVA 2JI7A 2XSZA 4JLDA 5ALYA 1HXHA 3VUFA 4AJLA 2DR2A 4MHOA 2Z3ZA 3JQRA 2Y2UA 3YASA 4IDOA 1GAQA 1R3UA 1LBHA 3GYBA 3GEIA 3K72B 3MK31 4QREA 2GPTA 4JMPA 2OBFA 4KPFC 4J0JA 4BASA 3JALA 1QFZA 3L6DA 3ZDEA 1ULZA 2GKOA 4DEYA 4YJ2A 5I9TA 2RAUA 1FUEA 1QIJA 3JZFA 3FDIA 4V02A 3A10A 3W2GA 5ALMA 5A03A 1QYWA 1YBMA 1X3LA 3LHFA 4N40A 5JW6A 5KYTA 3DBRA 4S05A 5A0FA 3PWSA 2AB0A 2I1LA 3TNDA 4KXXA 2PNFA 2BKAA 2VWQA 1CUZA 4QG7A 3B1JA 3SKXA 1LF0A 3QPCA 2RHGB 2FJ0A 3JD4A 1YVEI 3SI7A 3SR4A 2BFFA 1BGVA 4L78A 1PG2A 4GD3Q 1DMRA 1RQ2A 5JYCA 4NENB 2ZJFA 4QT4A 4TLLB 3VR5D 1QB7A 1T9CA 2F8MA 4IHKA 1FXWF 1SC3A 3RYHA 2DBZA 3DVRX 4Y2QA 2A9PA 4AULA 1XQ1A 3UJ3X 1KK1A 4FI3C 2ZM5A 1HF3A 3H5AA 4M8KA 1J8MF 3C5CA 2FMHA 2EHDA 1K5PA 3RWOA 4C76A 2EL9A 5KSWB 1EXVA 1WD7A 1XAJA 2HGZA 2GLUA 3B6EA 1Q5PA 1CY1A 2CFCA 4GYWA 1QFYA 1UMBA 1VL6A 1ZK0A 1Z35A 2I7VA 3K4PA 4QARA 3ZJTA 3G7UA 2DQYA 5JFGA 3RQSA 4GC5A 4XX0B 2C4KA 4YROA 4AY4A 1IYZA 4UBKA 1M0EA 3HB0A 2BYTA 4O4IF 4XWAA 3SDZA 3R7LA 4RPLA 2QQEA 1SKYE 5C3MA 1J0CA 5M5BA 3OTOB 1HFKA 3BN3A 3A26A 4MV5A 2YKGA 1H5UA 3KTDA 3LUPA 3NHFA 2H9AA 5CLGA 1VFNA 2H1VA 3MGGA 4B9AA 1COWA 1WY7A 2B4QA 3S2EA 3ZG6A 4U8GA 1N6IA 1CF4A 4FN4A 1SGWA 3L0CA 1V2GA 3H8SA 5C7IO 1E2KA 1NQUA 1N6HA 1OI4A 4US0R 3IERA 3DBHA 2FDCA 1SCQA 1HLDA 3GFQA 2ZT8A 2B9EA 4PFJA 1JE0A 3GCGA 4FMPA 1FFEA 3MS2A 5I8WA 2EW8A 2QVZX 4MI6A 4PZ0A 2IY7A 2RBEA 3DO8A 5THKA 2Q6KA 3WLFA 5MHTA 1N5JA 5CTAA 4C7OB 1EB9A 1RACA 1IWOA 2CXTA 2QSZA 3MCWA 4M7OA 2B4RO 4PLWA 4AJ1A 4DEXA 5A1JA 2GFIA 3MWFA 5A3JA 2DPLA 5BN5B 1U04A 5LDDC 3NBMA 3P2JA 1D2AA 4I3GA 4KV7A 1MX9A 1WVGA 1BDBA 1S2IA 4P4LA 4MVJI 3ZE8A 1RWMA 2Z5FA 2FZCA 3GEDA 4KQ9A 1JW9B 5CLHA 4BMNA 1R6XA 1SVWA 3GHHA 1OFGA 2WMOB 3D0QA 3N2GA 2I0FA 3E22B 2HF2A 4Y2HA 3ETLA 1PL8A 5AUOB 2O8CB 3HABA 4PTZA 1U0RA 4BNFA 4BX3A 4F46A 2W6QA 5H80A 3WGYA 4YT5A 4IGEA 5JQWA 1RQRA 1DO0A 4XYEA 2OD2A 2KHZA 4DLYA 1Q22A 1VYUA 1T8TA 3SLRA 1ICEA 2CJWA 2K5UA 4PQRA 2KI5A 5E6UA 4ER7A 4ZOQI 2HRRA 1C0EA 3QVOA 5JDCC 3VU1A 2JLAA 4QGFA 4KFRA 1YMUA 1P39A 3IP6A 3MWDA 4FI3F 4K9PA 4TTTS 3TVDA 2A84A 1IB6A 1Z5WA 3BMNB 4GOMD 2QIOA 4XQ0A 1H4QA 5FUXA 1A7KA 4HRXA 3UAGA 7YASA 1HDXA 2ZUTA 2J4DA 1IK4A 1JS1X 2N1BA 4DRYA 4WOBA 2P1DA 1SELA 3QBVA 3LLCA 1UIRA 3B52X 1HE4A 4UFPA 4YMTA 2PCJA 2QD1A 5EXDA 1G3IA 3U80A 1A1SA 1ODIA 5LPNA 3CKKA 3H2IA 5KNLA 3PC6A 2HJVA 4BQIA 3SGLA 2PGJA 4N39A 4LDJA 4WZAB 3K70C 4RLFA 2P5UA 4X45A 2GF0A 4V3BA 4B4WA 1JI0A 2QRPA 2RGCA 3VSAA 1XTPA 4OXQA 3RS3A 3WGTA 1R5JA 2YWEA 4H0CA 5HMLA 2Q0SA 3L8DA 5KJEA 5PNTA 3RSSA 3PFNA 1DX6A 1PX0A 3NOOA 5J43A 2IS1A 3T1VA 3BULA 3GFFA 2R6JA 5FUBA 1A3CA 4MMXB 1ML4A 2EJVA 3EOAI 4AU1A 1OFVA 3GT7A 2IE0A 3IKMB 5AKKA 4ZTUB 2VDWB 3T3MB 4QJ4A 3EQ9A 1ZUNA 3JZAA 4YRPA 2F1IA 4EEZA 4Q1CA 1BMTA 3CNBA 1TO2E 4FSDA 5GTDA 3HM9A 2YWDA 1AC5A 3WL8A 4EEXA 2SHKA 3B48A 5ICMA 4MYCA 1VGRA 1KFCB 2R1VB 5CMLA 3GRFA 3DLBA 1EFKA 1CE8B 3FLEA 4M21A 4CR8A 2Q62A 2C3MA 2GRAA 2JLVA 1ZEJA 4ER0A 3MT0A 3REQB 4WK2B 1YZFA 5J4VA 3UPUA 2QP4A 4M49A 1V5GA 3FSRA 4NZYA 4HNUA 5AWFC 1E63A 3IH5A 1I6KA 4HNQA 3ZBPA 4JXXA 2EX0A 1F8YA 1W5EA 2A58A 2GZHA 4K2HA 4U3JB 3ZNQA 4DNPA 5AQ1A 3F8WA 5CIWA 6AT1A 1JL3A 1RXUA 4OQLA 3UTCA 4JP2A 3HYNA 2F3UA 4P7KA 4B71A 1J22A 2ZP1A 4B17A 1LW7A 4LY0A 3ZLBA 3IDSA 3NIFB 3W5JA 4C4SA 1CUXA 1SVIA 5EZYB 5KYUB 4HSEA 1K2VN 4GE0A 2ZXFA 1POXA 3R2JA 4OREX 1XU7A 5AESA 2PX6A 2P1RA 3CX6A 3TD6A 5KOJA 1ESMA 1N4AA 3SXJA 4O8CA 1LQUA 3SJAA 2XJ4A 6ABPA 4BY9E 5FXMA 4NK4A 1M2KA 3R74A 1UJCA 1VG8A 1WQ4A 3IIJA 3HMQA 5DXJA 1HYGA 2I4LA 2XCLA 2OT3B 3I9V6 1FP4B 1R0YA 5E0KB 4HZIA 7MHTA 4QWWA 4KRYA 2I6TA 2P4EA 3LDHA 3N2YA 4KDCA 2EP5A 3TDMA 1G8PA 3T38A 3FLAA 1TYDE 2ZGVA 2YJ5A 3OMWA 2E37A 2WYIA 3U17A 4TKUB 5IYZB 3TBHA 1DLJA 3H9GA 3QVJA 1Q3HA 3GDWA 4K86A 3QVUA 3UWSA 3S99A 2HSEA 3QWFA 4LJ4A 5IXSA 2R4UA 3PQDA 4PY2A 2H31A 1BVYF 2P6PA 3JD3A 4LV8B 4PICA 3OUUA 1KO5A 2CBXA 1FNNA 1ZOPA 2H2HA 1E6CA 2TMYA 2JHCA 2QAGB 4GI3A 1C1HA 3UG7A 2BHNA 4LY6A 4EA6A 4PINA 5IDXA 4DARA 3DZHA 1QJ4A 1N5IA 2CL6X 3H1AA 4Z0PA 1OQAA 2OBXA 2X0NA 3EXFB 4GQAA 3G89A 3OCYA 2FV8A 4HAWA 4FC7A 5AKLA 3E9NA 2AE2A 4TGLA 4U9IS 4MEBA 1FDOA 1J1UA 1RI1A 1I3KA 1SVSA 1RJ9B 1WPRA 2QR3A 1JHUA 4L9RA 1G5PA 4O63O 1F8XA 1J0EA 3GY0A 3VZQA 1EQUA 1ODJA 1ZN8A 3IBTA 2FFHA 3P0RA 3WL4A 1E4EA 1B41A 4IJKA 1OPRA 1IUKA 4PFKA 1OSNA 3MTJA 4ISBA 3VO1A 2R7LA 4DV1B 2R5WA 1K7EB 2CEKA 1WEHA 1ZA2A 4YJ2F 3FPGA 5A05A 3ZE1B 2IHJA 5JOQA 1LB1B 4BNDB 1DX9A 1CQIA 4LNAA 2VCEA 3HPQA 3Q7TA 1SVMA 5HE9A 3MT7A 3UMYA 3QUAA 3IPYA 4HGRA 4RJJA 3SOZA 2FZ5A 3U5ZB 4L57A 1EWKA 2X0DA 4HGPA 1LC0A 1YFJA 4O2BF 1NQ5A 2B34A 3WMRA 4DSNA 4EGJA 1EAMA 2C42A 4S0ZA 4CG3A 1EDDA 2BGJA 5TY0A 1S8AA 3UF0A 4ND4A 1INLA 1T3ZA 2VCYA 3FZYA 3IBYA 4YWJA 2IF0A 3VPGA 1EP1B 5B64A 2B5WA 1B3BA 4PGHA 2YWGA 4P3PA 2GB4A 4BCBA 1QIGA 2CXOA 2CYBA 3BWXA 4TXNA 2RGYA 4B8WA 4XM2A 1L7VC 2F3PA 2JD1A 5CLJA 1ADYA 1NRWA 1M2HA 4DMUB 3PQCA 1D04A 1V1JA 1NMQA 4Q4LA 4OF4A 2W6OA 2BM0A 4IBOA 3KDAA 4YQZA 4R8RA 1MOQA 2WTXA 5IW8A 1NONA 6LDHA 1ZGGA 2HC9A 4NBWA 4QUKA 4XD7A 4AO8A 4QSMA 3TD9A 4FUQA 3AOEA 4KOEC 2BTQB 2E4UA 1R66A 4FQ8A 4CV2A 2DT5A 1K27A 3WICA 4OQPA 4NYJQ 4N5LA 4DRXB 3KVNA 4GPEA 3HCFA 2DPGA 1LDBA 4Z0TA 2IX3A 1EX9A 2Z30A 3X1KA 3EPLA 2WUFA 1DJLA 2NVOA 4UU0A 5JAMA 1V2HE 2JFBA 2P79A 2B5VA 1JKMA 3DAYA 3OOHA 4HDOB 4WRRA 4GOOD 2OV8A 4DJEC 4JYMA 2YZGA 3GW8A 3O4IA 4DDUA 1Y6ZA 1GL3A 4HN4B 3W5BA 4KZKA 1BROA 1J06A 3KZXA 3R5FA 3CZCA 1AKYA 3ABIA 3E81A 5AUQA 5DV9A 2VRWA 1BW9B 3EZXA 3QHQA 4RTKA 1NVEA 4CEHB 4C3UA 3HSSA 3ILXA 3MRTA 1QHGA 4A36A 3O47A 5DM60 4Q4HA 1R3DA 1GR1A 5KPJA 1Y89A 1E79D 1P2UA 1BMQA 2CCKA 3ROEA 4BQEA 1TQ2A 1E77A 1WMFA 1XD2B 2EKPA 3QPWA 1FMCA 3C7KA 3UV7A 4NQZA 4LCEA 2D1TA 2QTZA 4NJMB 3RLFA 4NBKA 3AJAA 3WGLA 3ZQKA 4AJJA 5IBRA 4YUVA 3PUIA 1YF3A 5L7YA 3WDSA 1UDRA 2WYWA 4M1EA 2PY6A 2QL7A 1T34A 1T9GR 2C9CA 2REBA 4CR6A 5A9RA 5DX0A 2QXUA 4RK1A 1B23P 1QH1B 4TKVB 3EWIA 1B8VA 4P34A 1XTZA 4U02A 1QF9A 5FR1A 4CHTA 1I01A 1NI3A 3JQCA 4NG4A 5DK6A 4R3NA 4G63A 2O3RA 3P9IA 3WC4A 4LPKA 4MWOA 3ZWMA 5DKFA 1NWHA 1FPQA 1U8EA 4MP8A 3BH0A 4WT7A 5GV7A 3ZY5A 4CIBA 3F4KA 2D2VA 5JNRA 1E1YA 2JAQA 4ECEA 1KWKA 3ZGLA 3ZUGA 1PDVA 1Q74A 4UKDA 3L6RA 1EK5A 4AZ0A 4HS9A 4FOOA 5AK6A 4TTAA 2PM8A 2WWFA 5DIFA 3CRRA 1SZJG 4XLLA 5E3JA 5TGDA 1U6IA 3CUSA 3M6IA 4PHFA 3OPNA 3IB6A 3DOEA 3MTBA 2IZ7A 3N5KA 2J0EA 1E3IA 4UNQA 1M83A 4OJYA 2P9FA 5ENZA 4F1WA 4KWTA 5BV2P 2VUIB 1JHOA 3H75A 4LYJA 3EXEB 2GM4A 1I7PA 4Y67A 1LRLA 4RQAA 1XVLA 1XRQA 3JPWA 4UPEA 4MKZA 4LV6A 3SJ7A 3SYMA 5CX4A 3RFVA 4EY5A 2RH9B 1JMYA 2XMBA 4FJ2A 1N8TA 2H07A 3BHJA 1XNGA 1TZ2A 2I71A 4ND1A 4Q4CA 2IYWA 4CF7A 3IAUA 1R12A 4CT0A 1G18A 1N2EA 3H99A 5HFJA 5EZYF 1RWKA 1R4NA 1VKZA 1XVIA 1GRQA 1GPJA 2IOHA 3A3NA 2HRZA 2V7PA 4J1SA 4J0HA 4W5JA 5LQJA 2JRLA 2O9JA 4EG6A 2J3HA 3CNLA 4LGMA 3AY6A 3V9AA 4BUZA 1KJYA 4Z53A 2VWHA 3MIIA 3ZOKA 4CIVA 4JY7A 2HO4A 4B6OA 4QYTA 2CLIB 2Y8EA 3H6HA 3I83A 4BLVA 5LNK6 1U28C 3C6BA 3L41A 1T3TA 4EA9A 2XB6A 3G1UA 4MRVA 4ZOLF 3D0OA 1ATZA 4X71A 1MAUA 2HF8A 1YZGA 4R2HA 1LDEA 1YQGA 4M9XA 4Z4IA 3HJAA 1S2NA 1XEXB 1JEQB 3PR2B 1FDWA 1M1YA 3L1KA 2HXGA 3L7CA 2YV2A 2Y6VA 4ASUA 4LVNA 2AD5A 2EFEB 3T1QA 4A2QA 1V37A 4G1CA 2X2OA 4O4HA 3IDAA 4KL8S 2FW8A 4A6PA 4LXXA 1HOTA 4I5EA 1E2UA 1P1JA 1QXSA 2X3YA 2OA0A 1NVUQ 1FFSA 3EGXB 4MGZR 2UZ0A 2G1JA 3ORSA 1MVNA 4J94A 3HDJA 3Q10A 4FR5A 1AY0A 4KXWA 3KWJA 1W581 3W5VA 4TTIA 1Y8AA 3RW9A 1UEXC 1OR8A 1DIRA 1DG3A 1RXSA 1VLLA 3H1EA 4II7A 5LQDA 1AKRA 4E5UA 1A2KC 4D9KA 1VBFA 4EX6A 4BGDA 4PG4A 2DTEA 3V1TC 2J4FA 3F5FA 2VCHA 3O9ZA 4HXGA 3D4NA 1M7GA 4MSUA 5E9AA 4ARZA 4XDHA 2BZGA 2FF5A 4PAWA 3UOWA 3DTYA 1KDPA 4RORA 2J6HA 4DLUA 5KYVA 1MZPA 4P83A 1KEUA 1J5EB 2FUKA 2OD9A 3OZTA 3TQCA 3UB2A 4X84A 3HB5X 1MHPA 1D09A 4HT3B 4R8KA 1QIDA 4K3VA 2CZQA 3U4QA 1XJCA 1V8FA 2WT9A 4Q7EA 1ZRHA 1L7NA 2X8LA 1IDOA 3EVBA 2O2XA 3LA8A 4Q02A 2WD7A 3ZLTA 3S7TA 4OVKA 1A7JA 1MVOA 3OMLA 1UPFA 3BRWD 4LRUA 5G41A 1JEOA 1TUBB 1LZKA 2M32A 3CY6A 4POAA 3Q7IA 2J87A 3G0DA 5ESXA 3UUWA 5ADUS 2K7ZA 1RLOA 2BFOA 5EUQB 1COWD 3WLNA 4L3OA 4NCHA 1Q1NA 1QQAA 3S44A 4CIYA 1OA1A 1GZSA 4O2AA 3TEJA 1JDNA 3IALA 4YEDA 3U7RA 1XEWY 1Y82A 1WG8A 4V0ME 4GEKA 4YCSA 2PX5A 1NASA 3N58A 1MC1A 4QYMA 4JJEA 4DQXA 5I4BA 1PHRA 3C3DA 3JWEA 3FOEC 3C6QA 1ESNA 4JJ6A 4TMKA 1VE5A 2ZAIA 4OYHA 2GVZC 1II0A 4CRWB 4A6EA 4QODA 1A8IA 2OM2A 3DFMA 3K5PA 1SU6A 4PG5A 4JKYA 2P9QA 4EI9A 4B4KA 3BREA 4S2UA 2CBGA 3DT9A 3GA5A 5L95A 4UM5A 1NJGA 4FDTA 3I05A 4HQKA 1OI7A 3FKJA 3J7TA 1XDSA 1VCIA 4I99A 1HL3A 2JHFA 4XIJA 5TE9A 1EA7A 4UBJA 5K8UA 1VJCA