3HADA

Biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
293
structure length
293
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKRAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical characterization and crystal structure determination of human heart short chain L-3-hydroxyacyl-CoA dehydrogenase provide insights into catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords PROTEIN (L-3-HYDROXYACYL COA DEHYDROGENASE)
total genus 117
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3hadA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hadA01
3VOSA 3KOUA 3U09A 5IDXA 1UXKA 4KTTE 4R16A 5LDGA 1EMDA 2H6EA 2XAAA 2PLAA 1W4ZA 1M66A 1NBOA 4EEXA 2IODA 1DIRA 2PKQO 1LRLA 3B70A 4OO3A 4PLTA 3C7DB 5TC4A 4IINA 2FPGA 1TEHA 4CUJA 2CVZA 3QHAA 3KLPX 4PLCA 5DBIA 2X0RA 4WLOA 1V9LA 2NVUA 5MDHA 3FHLA 3KETA 2I6TA 3R1IA 1I2CA 2AE2A 5K6AC 2RHRA 4BO8A 1DJQA 1UXHA 2Q4BA 2CDBA 3TN7A 3WICA 3C7CB 1BDMA 1CDOA 5K0ZA 1C14A 3MJCA 2VT3A 4FOOA 3PGJA 4IDCA 5JC1A 1GZ3A 1DSSG 3QVSA 2BELA 1X13A 1CYDA 2HDHA 1KOLA 2WE7A 1QV7A 3IC5A 3OJLA 2B4QA 3F47A 2IZ0A 4XJSA 3WOHA 3GHYA 4RVGA 5G4KB 3FWNA 1QORA 2OGUA 3M1AA 4OOEA 4S1VA 5BSFA 2Y1DA 3R0IA 1UZLA 1H2BA 3I4FA 4KP7A 4NBVA 3D5TA 5CDYA 1R4MB 1EDZA 3IOYA 2ZB8A 5A5EA 3BMNB 1G1AA 2QYSA 1SOWA 2WWRA 2YV1A 2PFGA 3HJAA 2O3QA 2EKLA 1GYQA 4CM4A 1LDYA 3ASUA 2E82A 4MINA 3TL3A 4B4VA 1IL0A 1NXQA 3GDOA 1NFFA 2BFMA 3FNEA 2EV9A 4QTZA 2C7GA 2VYNA 3DTYA 3F5SA 5BSHA 4GX0A 3U4DA 5HM8A 2X0JA 3UCXA 1LC3A 4YWJA 3A28A 4DL9A 1QG6A 1QLJA 2DTEA 3ZHXA 5L4LA 4YTEA 3COSA 1OFGA 3DBLB 1DB3A 3RFVA 4CODB 1E3LA 3WWYA 4FC6A 5U9CA 3ZWPA 5IZ4A 3WGGA 5U1PA 1ZBQA 1G0OA 4MVJM 1Q0QA 4A2CA 3VKUA 1CQIA 4AJIA 1UP7A 1P45A 2HU2A 1DXYA 3EAGA 5DT9A 4DTIA 3ANLA 4PFJA 3PEFA 1LRJA 3PVZA 4HNHA 1HRDA 5CDTA 5IXSA 4L4RA 3TL2A 5CDGA 4HNGA 4D3FA 4TRRA 1Z45A 4NBUA 2FR8A 4ALMA 4WLNA 5C5IA 1H0KA 2C07A 2VQ3A 1TA4A 1BHSA 3TZ6A 4D3SA 1NASA 4U8GA 3B1KA 1D4FA 2ZCUA 4YAJA 1BGVA 3KYCA 4BMNA 2PNFA 1UP6A 1VJTA 4D0SA 3GRPA 1PGPA 3NAQA 4CMJA 3R6DA 4J1NA 3GC6A 4DYVA 4UREA 4F3YA 2GN4A 4CPDA 4DLBA 2XF8A 2JAHA 4DIFA 3VAZA 4U6QA 5TJ9A 4CMAA 3SX2A 5JC8A 2QW8A 5L7TA 4E6PA 4BNLA 3RSHA 3AM4A 2DLDA 1H9BA 5JO0A 4Z0TA 2H1SA 1MGOA 4FB5A 1GR0A 1ZSNA 3EW7A 4MKRA 3ZI0A 3AUAA 4RQTA 2O4CA 4Y67A 4Y6PA 1GUYA 3I3OA 2NTJA 3BMNA 3K8ZA 4YJGA 4TMFA 1EVZA 3GEGA 5CG1A 3DMTA 5ER9A 2VRCA 3BA1A 2JD2A 2O48X 4KOAA 4KQWA 3QE3A 4O63O 3TZHA 4C7KA 3W4KA 1FK8A 3NDIA 4IY1A 3FTNA 1NFRA 3RWBA 1PZFA 3RUIA 1PR3A 1YXMA 3I1JA 3IAHA 1J6UA 4R1TA 1YRLA 5TT1A 4DIOA 1HF3A 2VHYA 2BGKA 1JQBA 2EW8A 1X7DA 3QVXA 2R00C 2OXIA 4H16A 4IS3A 2BKAA 4BIIA 2I9PA 1D1SA 4NJMA 4JLWA 3PI7A 3UXYA 5KTKA 2Y1CA 3BTVA 4WLUA 2BFOA 1BVUA 4FFPA 1GUZA 1VJ0A 1R0KA 4R68A 2IDZA 1MLDA 1QKIA 4JROA 3DFZA 3KXDA 2Q1WA 1NM5A 1KEPA 4AFNA 2ZCVA 3PGXA 1HDXA 1DRWA 4JP3A 4JK3A 3ONEA 8LDHA 1HSZA 3JQBC 4JX8A 2DPHA 4WCFA 5JCJA 4XR4A 2BF7A 3WQQA 5A4DA 2CFCA 3GN1A 4DA9A 3HQ4O 1JW9B 3GPDG 3SC6A 1I2BA 1E7SA 4M87A 1CETA 4G65A 5G2OA 3LLVA 1IULA 1E1LA 5DCYA 4R54A 2Z95A 5KCZA 1I33A 1ZK0A 1H5QA 1PS9A 2IYOA 1MG5A 1HYEA 3PK0A 1MFPA 4KDEA 3VPFA 2ZJ1A 5JO9A 3PHHA 5KIAA 4L0QA 3WLEA 4XX0A 4D41A 2FWMX 3LC7O 5DZSA 4Y9DA 1C0PA 3V1TC 4CLRB 3VPSA 3GN2A 4E12A 4ZA2A 1JAYA 4GKBA 1U3UA 4L75A 4ALLA 3ROQA 4R1NA 1W0CA 5C7OO 5AQ1A 2CDAA 5KJEA 4CM4B 2GCGA 3CXRA 4QFCA 3C85A 3GDFA 1Z7EA 3GPIA 3TJRA 1B26A 3FPLA 4JGBA 4PG5A 4IQ0A 4H7PA 1ZH8A 1E6EA 1DRUA 3L9XA 4IXWA 1HT0A 1NX6A 5K6AA 3HN2A 3C1TA 3KV3O 2O2YA 3BTSA 4YJHB 1H6BA 3H65A 4YRAA 4CMEA 3B1JA 4OXNA 3P2OA 3WS7A 3GVXA 4B7CA 1ENZA 3NX4A 3FPCA 1ZSVA 5ITVA 3ZHBA 4FCCA 1BWSA 5L3ZA 2JJYA 2R2GA 2NTNA 2O3TA 2ZTMA 3D5QA 4CM1A 4CUZA 1T24A 4RO0A 2OOSA 2C2YA 1R66A 4CLOB 5BSEA 5JSFA 4PRLA 4XA8A 5IZCC 1X0VA 1GAEO 1T2EA 2IZZA 2IEBA 2Y1GA 3I52A 4EITA 3GRKA 4Q39A 2XXBA 1ZCJA 1BTOA 2AEMA 3ZV5A 3HG7A 3WX0A 3RFXA 4L8VA 3ZCXA 1IB6A 3MCVA 3FD8A 3RI3A 3NT4A 3QV1A 3V5NA 2DUUA 5A9SA 4E33A 4LMRA 5EQDA 1IZ0A 2J8ZA 4II2A 1N7GA 4W7HA 4RVHA 3OEYA 2BD0A 4J4HA 2I66A 4CMGA 1P0CA 3VPGA 2BI7A 3F9IA 5CDUA 1OI7A 5I8WA 3N7UA 2Q46A 1UJMA 4TRNA 1O89A 2WD7A 3BXXA 1T1SA 1P1HA 3VH3A 3GEDA 4MVJG 3JQ8A 4YDRA 1LQUA 3SXPA 4XRGA 2VHXA 3WGHA 1UXIA 5ITWA 1EBFA 1AXEA 1JAXA 2GYYA 5KVVA 3WYBA 5JNLA 3MJSA 4AVYA 2NU8A 1FDWA 4FFMA 4ZRNA 1YQGA 3WSVA 4EJ0A 5JE8A 1UDBA 2UUOA 3IUPA 4GSKA 4Z9YA 2DBRA 5JXWA 4KUGA 2I99A 4Q3CA 2CF5A 3WIDA 3ICPA 4TWRA 3TQHA 4KZPA 2HJRA 1E7MA 2BGMA 2PK3A 2AEFA 2X86A 3IS3A 4ITUA 3V2HA 5L4SA 1P33A 1PJSA 2DPGA 3VZQA 3NV9A 4R5HA 1E6UA 5H83A 2NUAA 1LC0A 2DTXA 3WNVA 1C0LA 1Y81A 1QYWA 2V6BA 3JQAA 2VYVA 3JQGB 1P74A 5JLAA 4FD3A 1EZ4A 4CMHA 5F1OA 4PIVA 4DRYA 1F17A 4IM7A 3R3SA 4G81A 1DRVA 4MIOA 4EUFA 3GVCA 4CM6A 5TQVA 1JVBA 5JY6A 4Q3AA 1MXFA 2OBNA 2QRLA 4B4WA 3DFUA 1MG0A 5KKCA 4UEJA 2YYYA 3RBXA 4E3ZA 4J1SA 5C7IO 1R37A 3QVOA 1WDKA 2YUTA 4J3FA 3U4CA 3AY3A 3PPIA 3OFSA 4W9NC 4B3JA 3E48A 1R6DA 1N2SA 2HLPA 2PGJA 2YFHA 1KIFA 4BNVA 3H7AA 4LW8A 3RKUA 1EUCA 1H6DA 1E3IA 4J7XA 3AJRA 4PVDA 2VHWA 5L7YA 3DOCA 3UW3A 1ISGA 1YGYA 3EVTA 3OIFA 1O8CA 1WXDA 2YV2A 4W4TA 2OFPA 2WTBA 1P1RA 4JJIA 1R16A 1MB4A 1ZK4A 4GGOA 2YQ4A 1UDAA 1ZMTA 4FFOA 4M49A 4W9NA 4KUHA 4D46A 3OJEA 2O23A 3DHYA 4IJKA 3U4HA 2IEDA 1FF9A 1AE1A 4XB2A 5DP1A 3VH4A 2OORA 2PGLA 3OP4A 3OIGA 1MC5A 4RVUA 4D79A 1EE2A 3VZRA 3HB4X 1HDGO 4PLGA 4CMEC 1KERA 1A9YA 2HCTA 2Q49A 4DVJA 5HA5A 3VVBA 2FPIA 4HKTA 2P4HX 3A9WA 1HZZA 3ROKA 3F46A 2JFGA 2QX7A 1PGQA 2JAPA 5DF1A 4FIZA 1LDBA 1JKIA 1OC4A 3AFMA 1EEHA 3JQ9C 1J49A 4GI2A 2OUIA 2VUTA 3KUXA 1SEPA 2O7QA 4NJOA 1F14A 4ZD6A 2JFFA 2BRUA 3BHIA 2DAPA 3CKYA 2X5JO 1JKFA 1YO6A 4WJZA 1JTVA 1CWUA 3DBHB 2ZB3A 2CVQA 3B6ZA 4F45A 1PS8A 1JDJA 1U4SA 4IUYA 2O3UA 5EMHA 4DLAA 1EFKA 3MWEB 3JQ6A 4Q3BA 3UH1A 1N92A 2W98A 3S8MA 3QVWA 4IQ8A 4CL8A 2A4KA 4IDDA 2DFDA 1MC4A 1WZEA 2DFVA 3QWIA 2X5KO 3AU8A 1M76A 4IXTA 4UAGA 4P8RA 4WEOA 3GVHA 1GCUA 4XYBA 4MOWA 2WSBA 2EP5A 1CQJA 5IXYA 1XA0A 3JQGA 4IDGA 4JIGA 4MVJH 3HWRA 1KEWA 1E1MA 4XR9A 3WMXA 1Z82A 1G6KA 1DC3A 2JCYA 4BKQA 4K9DA 2RCYA 5JDIC 5FWNA 4MP6A 3WJ7A 2A92A 1Z6ZA 2CUKA 4MKXA 4D0RA 3PLRA 2NLOA 3KTDA 1N1EA 1M2WA 1B16A 3HNPA 3QW2A 2HRBA 4BO9A 2AQKA 2I5PO 2J5KA 2D4AA 1JU9A 5EESA 4GMGA 5KJ1A 1ADFA 1HDZA 5EJ2A 2GSDA 3KSDO 1TLTA 3ZW9A 3TZCA 4RF3A 2Z1NA 5ER6A 2X9VA 3A1NA 5T8KC 3BMOA 4ZICA 4GQAA 4R1SA 4QO7A 1YONA 4WOJA 4BO3A 4PZEA 4UUNA 4PRKA 4OKNA 4JBGA 5BNTA 3GAFA 3AI3A 4E21A 4J6FA 1LSOA 3H8VA 1ZVMA 4URFA 3JYNA 3DL2A 3ZHYA 1KYQA 1P1FA 3NGLA 3FBTA 1K3TA 3CMMA 1LLUA 5IFLA 1U7HA 1SMKA 3CZRA 1E1KA 3IJPA 1YBMA 1ADGA 3V8BA 1PQWA 2YDYA 2Y93A 5FFFA 3WFIA 2YJZA 1LQTA 3PWKA 4II3A 1ZW1A 3V2UA 4BNXA 2OP0A 3CZMA 1PSDA 2GR9A 1GFSA 1R15A 2VZ0A 4OYRA 3C24A 5A05A 1U2GA 3NRCA 3RUAA 2EXXA 1Y5RA 5TT0A 5IG2A 4J1QA 4OMUA 2GD1O 5ENDA 4D7AA 1E77A 2VRBA 4ESOA 1CERA 3PRJA 4FGSA 5F3RA 2GN6A 1B7GO 4HWKA 1KETA 4HUJA 1HYGA 4ND5A 3IUSA 2A35A 3E18A 3KEQA 2X6TA 1YWGO 3ZNQA 1LJ8A 2C29D 1I2ZA 4JNKA 1ENOA 1NWCA 3I4CA 1RYDA 4Q3NA 4A10A 3ZWVA 4FS3A 1BMDA 2Y0DA 4YT4A 4P38A 1AHHA 3KYDB 4BQPA 4LSWA 4NJMB 1PJ2A 3O26A 1SZJG 5EN4A 3TF5A 4PVCA 2EHDA 2GZ2A 1BG6A 3JD4A 4XDYA 1H6CA 2HKIA 4CM8B 1C3VA 3GUCA 1GYRA 4XYLA 3LLSA 8ADHA 2HUNA 1NWHA 4ZQBA 3GH3A 5CP8A 3AWDA 3L77A 1GADO 1CJCA 3FCOA 4QSMA 2ZJ0A 3IDSA 4LMPA 4XGKA 2O4UX 1GQQA 1LXCA 2E4AA 4MIEA 1GQ2A 3B1FA 4FGWA 5L9AA 5I7FA 1P44A 5DN9A 4DMLA 1E3WA 4E0BA 4OL9A 4FFLA 2VWHA 5L45A 4DUPA 1BW9A 4XQ9A 4LRTB 1XSEA 4ZJUA 2QZZA 1UP4A 4P22A 2AEJA 3F4LA 1ZK1A 3HB5X 3MJVA 5G0SA 5DCUA 2X9NA 4WK6A 4Z0PA 3ZHZA 3RQSA 4F6LA 3DZGA 1F06A 2JD0A 3L6EA 4NK5A 2WM3A 2BLLA 4NK4A 4R5MA 4E5YA 4EYEA 3PJEA 3GGOA 3U3XA 3VH1A 2ZB4A 4N5NA 1UR5A 1FJHA 3ETDA 4EZBA 4WEQA 4E2XA 3WWZA 5TLSA 5BT9A 1LSJA 2FMUA 1LDGA 4ZQHA 4U0JA 5TX7A 1U2DA 1V3TA 1Z75A 1XEAA 3ANMA 4J16A 2V7PA 1PL6A 2RAFA 3PJDA 4NR0A 7ADHA 3G79A 3F1LA 3OA2A 3AY7A 3GG9A 4FR5A 3OJFA 1YKFA 2J3IA 5COAA 3AY6A 3PWSA 3FR7A 3KYDA 3GZNA 4IBOA 4B4OA 4PN3A 1XQ1A 4FJ1A 4NIMA 3U4IA 4C4OA 5AXAA 2ZYDA 4RQUA 5K9ZA 3TNLA 4EJ6A 3B20A 2BHLA 4NU5A 4RDHA 5G0TA 3I9KA 4AJPA 2EERA 3AOGA 4XB1A 4CMCA 3Q9NA 4Y6RA 2IZ1A 3H9QA 4J7UA 3BMOB 3W1VA 1B0AA 3AM3A 4ALJA 5ILOA 2B36A 2AG8A 4BS9A 2FOIA 4AJHA 1I32A 2CMDA 4LSMA 3HHPA 2EIHA 4B8WA 2YY7A 2HQ1A 4A7PA 3I9LA 5GZ6A 3DHEA 3N74A 1NQAO 4FFRA 1E6WA 2WJPA 4RCVA 1V6AA 1ZK2A 1HLDA 4J43A 4N5LA 2P9CA 3QA9A 5TSDA 4RZIA 4CV3A 4UUOA 1X0XA 1PL8A 2NQTA 5CEJA 5A5FA 5JDIA 1FXSA 5DBFA 4CMBA 4ZQGA 4DPLA 1NAHA 1ISJA 4GGPA 1A5ZA 2GZ1A 1AN9A 1OBFO 2Q2VA 3I23A 4S3MA 5HBRA 3GLQA 3CPSA 3PHGA 4LCEA 1K0UA 3RUHA 2YHUA 1YJQA 4PLWA 1NVMB 1LNQA 4RPGA 4RL6A 2PZKA 2CZCA 3WQRA 1SPXA 4FN4A 4QO8A 2EP7A 1ORRA 4RGBA 4WKGA 3O38A 3DMYA 4NNJA 4Z0HO 4R9RA 3HDJA 3BYZA 3G0OA 5CDSA 1DIBA 2FSVA 2FRDA 1U3TA 1GV0A 2WEKA 2W90A 1B8VA 4WE3A 2RBEA 1QLHA 4LRSB 1T2FA 4GMFA 2I3AA 1HDCA 3DOOA 1AXGA 3O03A 2C20A 3MJTA 5I9LA 1EE9A 4M86A 3F3SA 4W99A 3G1TA 5G4LA 4L4SA 3PJFA 3W6ZA 1X14A 5C3MA 1U3VA 4HFNA 1ISFA 2R00A 2X4GA 2BFPA 1B15A 4CJXA 4BMVA 4L76A 3IQDB 3M2PA 1E7YA 2AG5A 2GASA 4GWKA 3HN7A 2ZQZA 4A26A 2DBQA 3GGGA 3EZLA 1OAAA 2D3TA 1PL7A 4RPHA 2PGDA 3F6YA 3RAJA 3JQ7B 2D5AA 4IGEA 2UDPA 4ONEA 1B3BA 4I1IA 3ZNPA 3ZZNA 1KBZA 4XIYA 3EDMA 2LDBA 3GNQA 1WNTA 4ZRMA 2PV7A 3D1LA 2GNAA 4RPJA 3OHSX 1P77A 1XWFA 4MKZA 1A7KA 4WASA 5B4VA 1PJQA 4R3WA 3NDRA 1RM0A 3EVNA 3L4BA 1EUDA 3PQDA 1QV6A 1R4MA 1IZ9A 4B7XA 4LCJA 5KJ6A 1A7AA 2BFAA 1H93A 3LYLA 1ZNQO 3WGIA 1O94A 5IZCA 4TVOA 1BW9B 2AW5A 2NVBA 3MJEA 4YT5A 4CM9D 2FY8A 4YVFA 5I9NA 2I3GA 1VRWA 1PGOA 3ULKA 4Q9NA 1O6ZA 3QY9A 4XYEA 3ASVA 4BNWA 4BMSA 1HSOA 2Q2WA 1DPGA 5JCJD 4J4TA 3OBBA 3JV7A 1YOVB 5HTOA 3VH2A 4EW6A 4ZHSA 1MX3A 4YJDA 3PWZA 3C1OA 4RZHA 1RPNA 3CUKA 4KWHA 1F8FA 4FW8A 4JBHA 4DC0A 1PJBA 2QRKA 1GUFA 1S7CA 3MTJA 3UUWA 2C54A 4FJ2A 5EPOA 2C5EA 1KVRA 4RVSA 3WIEA 3GMSA 4F6CA 5JBIA 3NEPX 2B0JA 2G1UA 1CF2O 2Q3EA 3K6JA 5T8KA 3K92A 4WNIA 6LDHA 5FI3A 3T4EA 2EKPA 1UUFA 2VTEA 4BKUA 2JFHA 4J1TA 1Y9EA 2G0TA 2DBVO 2GERA 1XR3A 4I8XA 3E5RA 5L53A 5IDWA 3IP3A 1IPEA 2X5OA 2FZWA 2LDXA 4HY3A 4IPTA 3GFGA 3PIIA 4PG6A 4K28A 3O4RA 2W2LD 2P4QA 3E9NA 4NBTA 3HFSA 4Z6KA 1F8GA 1RM5A 3BAZA 1QP8A 1KVQA 3L07A 5AOVA 4ZVVA 4JBIA 1HKUA 5T5QA 3ZU5A 2DU8A 3ITKA 4CM7A 3H9EO 3JCZA 2HO5A 4UVHA 2YW9A 4RPLA 1AHIA 2HRZA 2JHFA 5TGDA 3W8FA 1JKJA 4FOSA 4E5PA 1DLJA 3NTOA 1R0SA 1GQYA 3WFJA 5DP2A 3D3WB 1Y5MA 4OOFA 5HWSA 3GOHA 1BXGA 2ZYGA 4ILKA 4GAEA 4EI2A 4CLXA 4IDEA 4E32A 2J3JA 2OZPA 3CSDA 3SLKA 3ROMA 2B69A 3LC2O 2FPPA 3AI2A 1PGNA 4IS2A 4TZKA 3OA0A 2A9FA 4DWVA 1DFIA 3BMCB 3JYQA 4J7CA 1T4DA 3CE6A 4CLDA 3IJRA 4N5MA 1A4IA 1YS4A 4HX5A 4BGVA 4X54A 1I3LA 2WYWA 1HDYA 4E2WA 2PKRA 5KJFA 3RC9A 1PQUA 3OIDA 1YDEA 4NDNE 5B1YA 4PCVA 4GLOA 3DAPA 1HL3A 4BO1A 3GEMA 2X58A 3RC1A 1H2HA 2ZB7A 2CF6A 2CSUA 3NTRA 4DQUA 3A06A 3ZWWA 2P9EA 5DULA 3H5NA 1UH5A 1ARZA 4DBZA 1QYVA 1SBYA 1DC5A 4GLLA 4A5OA 3LK7A 2OHXA 1D1TA 2GUGA 3PIDA 2V65A 5ICMA 3I9NA 3OEWA 4AJOA 1EVYA 3UOGA 3DZHA 1QRRA 3D4NA 1L1FA 4R01A 4DIBA 1O5IA 1TI7A 1ID1A 4BNMA 4WUVA 1OZAA 4LISA 4E2YA 3ST7A 4ND2A 3KYBA 1HE2A 3OSUA 4B3IA 4A03A 2YHIA 3U49A 3ZWOA 1SB9A 2FN7A 4K26A 1U3WA 4CV1A 2PKQP 5F1PA 1CEQA 3Q2IA 3KYCB 3WGYA 3IL2A 4FDAA 3DAGA 4IDAA 5AYVA 4N7RA 1N9GB 1NVTA 1KVSA 2Y0CA 3RROA 4EUHA 4TZTA 4C7JA 3RKRA 1Z74A 2OO5A 4XWYA 2J5RA 1I3KA 3H2SA 1YQXA 2BI8A 3D0OA 3OH8A 1K89A 3HFGA 3QWBA 2Y1EA 4O1MA 4CR6A 3FF4A 2WD8A 2J5QA 1K6IA 2AQIA 1HXHA 2NU7A 3HUDA 2AA3A 1E3SA 2D5CA 4O0LA 4TRMA 5CEFA 1K6JA 3WGZA 4YQZA 1I0ZA 2X9GA 3I9JA 4NBWA 5J23A 3W4IA 1L7DA 1Y8QA 3ADPA 1ZJZA 4AICA 3MEQA 2VUUA 4YCAA 3WGTA 4BNNA 4M55A 1YVEI 2D8AA 4P4LA 4PLVA 5F5LA 2JL1A 1DHRA 4PLHA 4JCOA 3ZDFA 2NU9A 3GVIA 9LDBA 1DHTA 1PR9A 4CM5A 1M67A 5L51A 1IHXA 3JD2A 1HETA 5IDQA 1M6HA 4TVBA 1IE3A 4CLOA 2NM0A 4NU6A 5F5NA 1E0DA 4YT8A 5THQA 4CR7A 3L9WA 4ZQEA 1C0IA 3KVOA 4RVDA 2SCUA 2I76A 3GG2A 1YB4A 5AXDA 1B8UA 2P5UA 4PG7A 4KUEA 4OQZA 3UF0A 4YJFA 4BGIA 4YXFA 3PYMA 3MZ0A 5C7LO 2VZ9A 4TROA 3FSRA 1B14A 5BNIA 1WP4A 3Q0EA 1Z73A 3D3EA 1IPFA 3I6IA 4CQMB 4HADA 3SVTA 1T26A 4NBRA 4AJ2A 2BH9A 2F1KA 1BRMA 4EJMA 1FDSA 4DXHA 1BXGB 4A73A 1PWXA 4BB5A 4J49A 4AJNA 3Q1LA 3TZKA 3MTGA 4BNGA 3LT2A 3OQ6A 2DBZA 1DFGA 1OMOA 3WSWA 4YBZA 2IE0A 4YRDA 4OH1A 1EK5A 3DB2A 1Q7BA 3TOZA 3WQSB 2J3KA 3HDHA 3OF2A 1SO8A 3ENNA 1K2WA 4BO4A 1UZMA 5GMOA 5KVQA 5GY7A 4GVXA 1U28A 2DQ4A 2NSDA 3P2YA 2PD4A 3ZWAA 1G0NA 3JQEA 5T6BA 3D7LA 4M8SA 1JWBB 3LQFA 3PHLA 3G49A 3U0BA 2EJWA 3JQ8B 3JYLA 3RU9A 1KVUA 5FF9A 1NYTA 1Y8RA 1TT5B 1VPDA 4IJUA 3BTOA 3V2GA 2JCXA 1SNYA 1O9BA 1DDOA 3LT0A 4Q3EA 3RASA 5A04A 4IGFA 3I9MA 2CD9A 5HS4A 4E5KA 3JSAA 2V6MA 1KS9A 5GZ1A 4N54A 4QX6A 4U0KA 2POQX 4IJWA 4WLEA 1C1XA 1LDMA 1PGJA 3H6KA 4R41A 1YJ8A 4ZQFA 4PZCA 3O9ZA 4O59O 3X2FA 2W2LA 4WPGA 1U9JA 2P9GA 1B8PA 3OM9A 3M6IA 3LT1A 4W82A 4XKJA 2PD6A 2QZ9A 1IOLA 4PLZA 4QXMA 5LCXA 1ISIA 4YQYA 1TXGA 4FC7A 3L4SO 4R4JA 3U9LA 3PDUA 3K2EA 1VJ1A 3RIHA 4BGUA 3JQFA 3C8MA 5B4TA 2B83A 4YT2A 3ZNNA 4BNUA 2UAGA 3ICCA 2X0NA 2ZTVA 1XIVA 1ZFNA 3ABIA 4WLVA 1Q7CA 3FNFA 3TOXA 4KMSA 3F5QA 1D7OA 1P0FA 2VYVD 2H63A 3VZSA 2NQ8A 3BHJA 3WDSA 1MUUA 1NP3A 1GDHA 3OICA 3AUTA 3GHHA 1PZGA 2H5LA 4TRJA 3JQFC 2GF2A 1EDOA 4RLSA 2C0CA 3RC2A 5BNFA 5JMPA 4BQRA 4U7WA 4CQMA 3ADOA 1ADBA 4E13A 3VDRA 1R4NB 4BB6A 4BKRA 3INRA 1BXZA 5TRTA 1UXJA 5F1KA 2VZ8A 2HK9A 4PZDA 1GCOA 3WB9A 3NDJA 3LZ6A 3UN1A 1LSUA 1NVGA 4ZN6A 3V1YA 3BIOA 2NVUB 2P2SA 4U5QA 1ADCA 4JQCA 4K6FA 1SOVA 3WGOA 2Q1TA 4PLPA 4PG8A 5CPFA 3FN4A 3QLJA 4ND1A 3W8EA 1ZMOA 1HEUA 1LTHR 3Q3CA 2AQHA 1QYCA 2R6JA 1XELA 4OSOA 3ETGA 4OM8A 3DMTC 5TNXA 3RUDA 4GKVA 4QEDA 4YPOA 4BO5A 3NTQA 5G4KA 2FR0A 3FTPA 1V8BA 4R1UA 4B8ZA 1XDWA 3OETA 2FP4A 2X1HA 2GO1A 3HADA 1LI4A 2NU6A 1Q0LA 5AXBA 3ZWYA 5L40A 3IP1A 3DEYX 4CLRA 4MJLA 5A1TA 1NTOA 3H5RA 1F0YA 1MXHA 3ANNA 3RVDA 5IAAA 5KVSA 4B7UA 1NPYA 3H3JA 3WTBA 3H9UA 4BHTA 2HMSA 5TIIA 1KY4A 5LDHA 3H9GA 4L73A 4HFMA 2O2SA 1PJCA 2ZK7A 3MJ4A 4AJEA 4NMHA 2HMVA 1N1GA 2C82A 3OECA 2Q4EA 3GZ4A 1M6WA 1UZNA 3Q11A 3WXBA 3ZWBA 4AJ1A 4GX2A 4FSHA 1SC6A 5C37A 1JVSA 3DBLA 5JW6A 3PQEA 3HSKA 1HE5A 3QP9A 3ONDA 1H6AA 1LLDA 1OOEA 1WMBA 1BSVA 3ZU3A 1V35A 2GRAA 2HAEA 3DR3A 5CPBA 1E7RA 4ALNA 4BNIA 1I3NA 5DNAA 1KEUA 3A4VA 2NTVA 1ZXLA 5GZ3A 1X15A 1PJLA 1SB8A 5MGBA 1DFHA 5IDYA 3PHIA 3EY4A 3JYOA 1I5RA 1PIWA 2Y66A 1HE3A 2I67A 1HLPA 1FDUA 5FEUA 3UGKA 4L9RA 1LLCA 4I08A 3G17A 1X1EA 1M75A 3DQPA 3C7AA 5JPIA 4E30A 1KY5A 1Z7BA 3OJ0A 2WYUA 1XU7A 1T25A 2DUWA 1LUAA 3K9QO 3FR8A 2G5CA 3PZRA 1VC2A 3K5PA 4BNHA 5ICSA 1ZXBA 1GEEA 5ILGA 1WDMA 3DHNA 3FI9A 2VOJA 1VSVA 4GX5A 3JQ7A 2PY6A 4I9HA 1E7WA 5CFZA 1ONOA 2GZ3A 4EUEA 1XU9A 5A03A 3ZW8A 3GQVA 1A27A 2DM6A 3L6DA 3PZBA 4WOKA 3TWOA 3WYCA 1I8TA 3QVTA 1YB1A 2AQ8A 3JD1A 2IYPA 3PTZA 2QQ5A 1IUKA 1EUZA 3T7EA 5KKAA 3S2IA 3NGXA 1MA0A 1NHGA 3RUEA 5CAEA 1OC2A 5COQA 5I7EA 1PU2A 4TKMA 4XGIA 2CY0A 3DONA 5AXCA 2DT5A 1CRWG 3GDGA 3PFFA 4MO2A 1C1XB 2PZJA 4FBGA 4DGSA 4LVUA 1XG5A 2Y68A 4PLYA 4EGFA 3TDKA 1F12A 4KDFA 4YYZA 1WW8A 4QECA 1J4AA 4G5HA 1Q0HA 4EEZA 3LVFO 3JD0A 2JHGA 5DOZA 2Z5LA 3TFOA 2J6IA 4BV9A 2NV6A 4J2HA 1U5CA 3QQPA 3P5SA 3K31A 3OQ1A 2BMAA 2B35A 1N8KA 5G0WA 1DBVO 4DC1A 4BL5A 3JTMA 2E37A 1GD1O 4P4GA 1U5AA 2ET6A 1EVIA 4XGNA 4AJKA 1X1TA 1SAYA 5CEEA 1GY8A 4ZGWA 3L4BC 4CV2A 1MP0A 4RJTA 2BGLA 3DTTA 1JA9A 1Y1PA 5JMWA 2EF1A 1HZJA 2PA3A 3DBHA 4WCDA 3CTMA 4BNKA 1R4NA 2VUSA 3AI1A 1Y9AA 2Q1UA 4RF5A 1I36A 1ZKMA 4ZU3A 5T64A 3INTA 1U8XX 4OAQA 1ONPA 5JYDA 3SBOA 5A06A 3Q6IA 4U6SA 4UVIA 1IYZA 2NADA 4IIUA 2HSDA 4LN1A 4EBFA 4IDFA 3W4JA 2A94A 4Q3DA 4BUCA 5A3JA 4N18A 1PJTA 2XPCA 5I9MA 4ID9A 1T1RA 3VHRA 3ZWMA 4GSLA 2RH8A 3F4BA 5L95A 3ZN2A 3AK4A 3KBOA 4DMMA 4MP3A 1ENPA 3LC1O 1EVJA 1Q2XA 4CM8A 4J4BA 3STHA 4IIVA 2Y1FA 5A9SB 4OSPA 1HDOA 3D4OA 3PYXA 4MVJE 3KO8A 3RBZA 2O7SA 2YV3A 1HE4A 2P68A 3X2EA 2W8ZA 1K5HA 2PD3A 4MIYA 3CINA 4CUKA 2VWPA 4L4XA 1WMAA 3QRWA 2EWMA 1RM3A 5KNLA 3AOEA 3H9JA 6ADHA 1O0SA 3R3JA 5BSGA 5F21A 3EHEA 2ZYAA 3V1UA 4NZ9A 4GX1A 3SJUA 1I30A 1RYEA 4WNCA 2Z1MA 3NYWA 4UVGA 4FJ0A 5KVCA 1D8AA 1T2DA 2DC1A 2FZEA 5FI5A 3TPCA 2WE8A 2VWQA 2ZTUA 5EIOA 1W8DA 1Y8QB 1E3EA 3QJ5A 5EERA 3BHMA 3NT5A 3G3EA 5AVOA 2DVMA 1KVTA 4MVJD 3GUYA 1ML3A 2XOXA 3RUCA 3IKTA 2EW2A 4FQ8A 1B2LA 1IHYA 1DAOA 2CDCA 1NPDA 3ORFA 1P1JA 4TQGA 3LU1A 1GV1A 2O50A 3DO5A 4ALKA 5BQFA 5A02A 4DLLA 3N58A 1GL3A 2AXQA 3CMCO 4BV8A 2QRJA 4B4UA 4R51A 4RPKA 1GTMA 3RD5A 4J91A 1YBAA 3JQCA 1DC4A 3FNGA 3ZV3A 1SEVA 1UXGA 4MDHA 4W7IA 4CLHA 3AUUA 3GT0A 4QFDA 1WAMA 1V3UA 1X7HA 3MWDB 4KQXA 5JDCC 3GMDA 5ADHA 1DIHA 3FWZA 2JD1A 3L6OO 3JD3A 3UFXA 1YL5A 2JKVA 2RIRA 3FNHA 4B3HA 2Y67A 2PH3A 4XEHA 2VNSA 3VVCA 1I24A 3F1KA 4DBVO 5JYEA 2VHZA 3EC7A 5JDCA 5T57A 4BNJA 4JJFA 4IZHA 1L7EA 2WD7B 5A3VA 2O3SA 4NFSA 3HZZA 3I83A 2Y0EA 4GVLA 3SC4A 2VCYA 4HFJA 3PQFA 3ZWNA 4YR9A 3DDNA 3W6UA 2B4TO 4FFNA 4G2NA 2J3HA 3WR5A 1H94A 4QT0A 4XJTA 2HK7A 4HP8A 3UICA 1NHWA 3DZJA 4YAGA 3BMCA 3ZWXA 4XQCA 4YJHA 1FMCA 4Y6SA 3S2GA 4AJJA 2Q1SA 3K73O 4DPKA 2ZQYA 2EJVA 4E2ZA 1RM4A 3VTZA 4DREA 2UV8A 1C1DB 3WYEA 2D0IA 2O3JA 1U7TA 3CH6A 4Z3DA 1N7HA 1QYXA 3EUWA 3GK3A 1ZK3A 4J9UE 2AMFA 1XLTA 3VKVA 1NPTO 1MV8A 4I5GA 2HMTA 1GPJA 3GGPA 2Y99A 4DQXA 3GR6A 4HXYA 3UCEA 1K6XA 1PZHA 3JQAB 5BR7A 1TVEA 3S1LA 2HJSA 4XQGA 2Q2QA 1I3MA 4P4NA 4XDZA 5TF4A 4CMIB 1P31A 2X22A 3NKLA 2ZIZA 3PHJA 3SEFA 4EDFA 3UVEA 3LF2A 3O8QA 2P91A 3GNSA 1E5QA 4BO7A 3WBBA 3NJ4A 4BKPA 3QWHA 1ULSA 2HMWA 1KEVA 2QHXA 4OHUA 2E48A 1T2AA 3MOIA 1LRKA 4NG5A 2C5AA 4HV4A 3GNTA 4YACA 1LDNA 3T4XA 2DTDA 4AG3A 4MVJA 4BO2A 4M1QA 1TB4A 1WZIA 3PJGA 4OJNA 4HBGA 4IZIA 3WBFA 2PZMA 2Q45A 4Y98A 2PWZA 3RFTA 3GAZA 4DPMA 4WECA 2UUPA 4XZ3A 4RF4A 2V6GA 1GU7A 3OMLA 3RCBA 4IJVA 5ES3A 2X23A 1E3JA 3RJ9A 5IF3A 4LGVA 3KSZO 2GLXA 1QXSA 3PLNA 3E9MA 2YFQA 3EK2A 4Z3KA 5KWEA 1I10A 2X0IA 4W6ZA 3DBRA 5IJZA 1YL6A 3I6QA 5G0VA 3KZVA 3DWFA 4J90A 2F00A 3WJAA 4CQLB 1CIVA 3AW9A 3LDHA 4WGGA 1NR7A 2G76A 4FPXA 5JAIA 2HK8A 4KTVE 1PQPA 4OXYA 1A71A 3H4VA 1JWAB 1PEDA 2YQ5A 3ETEA 5TJHA 3UHAA 5JS6A 4D45A 2I65A 4XYGA 1O95A 1YQDA 2IRWA 1EFLA 2WDZA 1DO8A 3ZGYA 3H5AA 2W4QA 5JFOA 1C0KA 1YB5A 3JQ9A 4NI5A 4BNZA 5ENVA 2NACA 3ITDA 2WYVA 1LEHA 1ISHA 3Q9UA 4R9SA 1WPQA 5B4UA 4UUPA 1VL8A 3C3XA 3P7MA 4XYMA 5LC1A 2YZ7A 2WMDA 4YAEA 2QIOA 3WLFA 1SCUA 3HDYA 3DOJA 4PGFA 4Z9FA 3U5TA 3E5MA 2X7HA 4J0EA 3UCFA 4E5MA 3GY0A 4UEOA 2ZTLA 5DDIP 4L74A 4AJ4A 2ZATA 2P5YA 4OXKA 1A9ZA 1KC3A 1RWBA 3GVPA 4K1LA 1QMGA 2IXBA 4MPDA 4CMIA 1PJ4A 4Y8VA 4MVJF 4QQRA 4XRRA 1YBVA 5EINA 5JAZA 4DQVA 2QYTA 5B37A 4D42A 5H82A 2ILTA 1EQ2A 1LLQA 3RJ5A 1ENYA 3S2FA 1NQTA 1ZSYA 1WDLA 3AU9A 2G17A 3L0DA 3PXXA 4D44A 1YH3A 1J5PA 3O8QB 1XQ6A 1N5DA 2G82A 2VNAA 2C59A 1ZO8A 2PTGA 3K2BA 4TSKA 3S2EA 3AOEC 1WWKA 3IIEA 3QWAA 2OBYA 1T4BA 4YJFB 1V0JA 2VHVA 3JYPA 4RV9A 3JQAD 3VTFA 4K6CA 5A9RA 3DZIA 2ZKLA 2B4RO 1ZJYA 1R12A 1LBEA 1QR6A 4H3VA 3LT4A 1E7QA 1ISMA 3BZUA 4YEDA 4CM3A 1XHLA 3RUFA 1VL6A 1NFQA 1E92A 1VL0A 4IQGA 4R69A 1AUPA 2HMUA 3DXFA 3PFWO 4R3NA 3QIVA 3D64A 4DYDA 4TKLA 1H9AA 3UKOA 4CM9A 4NQZA 5IN5A 1WLYA 4NPCA 2PZLA 4IDBA 5KJCA 1HTBA 4OGWA 2GN9A 4AL4A 2Q50A 2PR2A 3K96A 3CEAA 2B37A 3EZYA 4E31A 5KOIA 1HWYA 3KRTA 4O6VA 1MFZA 1P9LA 3PYLA 1NR1A 2JCVA 4F46A 4LVCA 2B5VA 2D2IA 2EG9A 3E8XA 1Y8RB 1TT5A 5HS6A 3GF4A 4NHEA 5G0UA 3VPHA 3SJ7A 1DIGA 3WNQA 3ONFA 4GH5A 4CLEA 1PWZA 1T2CA 3ENKA 4M89A 1PS0A 3CIFA 3DZFA 3HDQA 1Q1NA 1W73A 3WMWA 4E4YA 2D1YA 1DIAA 1ZEJA 5FYDA 1UDCA 2H9IA 4BVAA 1RKXA 2FSSA 3KHUA 4BO6A 1V3VA 2TMGA 4GL4A 3VC7A 4RORA 2X8LA 4WLFA 4GBJA 1ZZEA 3JQBA 4I5DA 4IMRA 3BMQB 1U1IA 2E6UX 3EGOA 3SLGA 3H2ZA 4JP2A 1LSSA 2YDXA 3EMKA 3M2TA 2UVDA 1KC1A 3ZH2A 4MP8A 3DAFA 5JY1A 3Q2KA 4XD2A 2V6FA 1J0XO 5T67A 1VLLA 3DZBA 3JQDA 9LDTA 5DCWA 1PJ3A 2OP1A 4UVEA 2QG4A 3FRJA 4JJGA 1LA2A 4OIMA 1VM6A 4J0FA 7MDHA 4QUKA 3MOGA 1U8FO 1NQOA 2RH4A 4WCFB 1ULUA 4YAIA 3FBGA 1GYPA 2DKNA 4Z9XA 4CQLA 1GZ6A 2IXAA 3NT2A 3ZWCA 1LU9A 4YB8A 3KEOA 2EEZA 5EQFA 3E6AA 5A9TA 5I7VA 4YAKA 2AHRA 2NVWA 5B12A 3INGA 5EL0A 4MVJP 3KSUA 5CG2A 1B3RA 1JN0A 3AUSA 1DEHA 2D59A 3VZPA 1VI2A 3QWFA 2CNBA 1C1DA 4AJLA 4BNYA 4RF2A 2VT2A 3UAGA 1BXKA 2PH5A 3ZV4A 1BDBA 2XXJA 2OL4A 4RVFA 3KB6A 3M1LA 1S6YA 3K30A 4GPD1 3DBVO 2EKQA 2TMDA 5HRUA 3EYWA 3ON5A 4ALIA 4XQEA 3VDQA 4IMPA 4E5NA 3I5MA 3GFBA 4OQYA 1LX6A 1NAIA 4CQMD 3LF1A 4YA6A 1VKNA 4I9UA 5L4NA 1P1IA 4LK3A 1HYHA 1VKOA 3TRIA 4UEKA 2E49A 3GA0A 3E03A 4GWGA 5DBGA 4CV0A 4MVJI 1JLLA 2NNLD 1XGKA 4XCVA 1I01A 4OKIA 4CR8A 3OJOA 1ZUD1 4KWIA 4ROSA 3RU7A 1P1KA 1FDVA 4I9NA 3RC7A 4BGEA 1DJNA 1GEGA 2O3RA 3OQBA 1DLIA 1NQ5A 4NFYA 2YHIB 4PG4A 5JCXA 5TS3A 4INAA 3AM5A 4UVDA 5JAQA 3WTCA 3W8DA 1YL7A 4JXKA 4PLFA 1QSGA 2FR1A 2EGGA 3D3WA 1YE3A 3ZNOA 1UAGA 1N9GA 1P3DA 3T7CA 1DC6A 2VRCD 1HDRA 5I8ZA 1NNUA 4UUMA 1W6UA 1LDEA 3AFNA 4J9VA 5COBA 4BNFA 2C2XA 3GZNB 1ZIDA 4HFRA 4RDIA 1IY8A 1GZ4A 2Q99A 2VOEA 4UULA 4XIJA 3VPXA 4BKOA 3IKVA 1GPDG 3ZU2A 3TSCA 3C1AA 3ROPA 3PDJA 1Y6JA 4CL3A 3A14A 2UYYA 5U4QA 3DZKA 3G1UA 1A4UA 2OMEA 3I9OA 1X7GA 1EBUA 1RJWA 2GDZA 5L7WA 2FHSA 3E9QA 1YOVA 4I5FA 1R0LA 4D3DA 3DC2A 3E1KA 2RHCA 4NH4A 1YDWA 4BOYA 3E82A 4M54A 4BNTA 1EK6A 5CHEA 3S55A 1FDTA 2CVOA 3DBRB 3LSYA 2B5WA 4YRBA 1QYDA 3D4PA 3IMFA 2Y05A 5H81A 1E5LA 3WGQA 1PX0A 3NUGA 3PP8A 1ZEMA 3RBVA 3ZU4A 1EQUA 3ZV6A 4RLHA 1DAPA 1E3WB 2W2KB 5DOVA 4A0SA 3NJ8A 2GN8A 2VTDA 1AGNA 1XYGA 2C7VA 3U62A 5I7SA 1XCBA 1PTJA 1UAYA 2GPTA 3BMQA 3QSGA 1VE9A 3H3FA 4WCFC 1D3AA 4NFHA 1TT7A 4ND4A 3CTVA 1Q7GA 2NWQA 3BTUA 4ND3A 3WG9A 1PZEA 2EGHA 1ONNA 1DOHA 4O5OA 3HE3A 3TFQA 4I5EA 1BVRA 3KM0A 4D43A 1U4OA 3KLMX 4A27A 4YJGB 5IN4A 1Y7TA 4JN6B 1WVGA 1E1NA 4H15A 5JAMA 2W2KA 2AE1A 4B79A 1XKQA 4BO0A 1VSUA 3TZQA 4J2OA 2VN8A 2Y1OA 4CMKA 5THKA 3P19A 1A72A 2GGSA 2VWGA 2VYND
chains in the Genus database with same CATH superfamily
1ODTC 3KIPA 1VGRA 2YIMA 2XCRB 1NXWA 1A4XA 3ESZA 3RIYA 4ETMA 4EPTA 2HGSA 3FUCA 4X0EA 4RTLA 2DFKB 3QOWA 4MA0A 4UEWA 4ENVA 5JALA 5KX5B 3B9BA 3IP5A 1BMTA 1UJ5A 2QM8A 2CVFA 3KJFA 4EEXA 5C5CA 3WSTA 1BFDA 1M8PA 1AQYA 4OO3A 5LD2C 1OR8A 1RWPA 2B0CA 4NEGA 3Q7RA 5TC4A 1QHIA 5BT8A 3IP9A 4KNWA 2WSSD 2WWTA 4PAQA 1NRWA 1DBWA 1WCWA 1V9LA 2Q1XA 1ADJA 1V5EA 3RANA 3JWGA 3KETA 1MHPA 3D4IA 2HH9A 5DYNA 3BJZA 2IZ6A 2RHRA 3MTAA 1DJQA 2MINA 3L0CA 2CDBA 4LHZA 3TN7A 3WICA 1BDMA 1CDOA 1OTYA 3FLMA 3U48A 5E38A 3PGJA 3NHSA 3RS9A 3TIIA 3QFHA 5JC1A 1OROA 1DSSG 2I71A 1X13A 3CLVA 1SVNA 1ULAA 4B09A 3PKJA 2RAUA 7YASA 2PMKA 1EG2A 1FNSA 1QV7A 3IC5A 4HRYA 3OJLA 1HL7A 2B4QA 2IHKA 2HQSA 3FUXA 1J9GA 4CT4B 1BROA 3D3QA 4XJSA 4EA7A 1AB5A 5KSZA 1JFSA 3ZKWB 1PNTA 3M1AA 3MMNA 4RBNA 3NB0A 3WLTA 3KKQA 2QXYA 1P4SA 2OCIA 4TMYA 4RV4A 1H2BA 3THRA 4YREA 5CDYA 2BEVB 4OXIA 5FD8A 4DSAA 4N4AA 1YIAA 3IOYA 2ZB8A 3KKOA 5A5EA 1G1AA 2ZJ4A 3VV3A 2QYSA 2L82A 1JF8A 1SG6A 1YDGA 3T0FA 3VC1A 1SOWA 2YV1A 4M8KA 4EY5A 2O8FA 4RA9A 4TLCA 2PFGA 3HJAA 3TINA 2XKKA 4OX9Y 2EKLA 4KAJA 3B1ZA 1GIAA 3A2LA 3ASUA 1N7IA 1JEAA 3GP3A 4MW5A 5AMXA 4FE4A 3VR6D 5LP6B 3BBPA 1NXQA 1FFAA 4M1WA 1T35A 1NFFA 1M1ZA 2BFMA 2D0DA 2EV9A 2X8WA 3LUDA 1EYZA 3A4YA 1KYVA 3DMNA 3DTYA 1JEJA 3UBMA 4O8ZA 2VQFB 1YZGA 4OIFA 4D57A 4HXFB 1T29A 4KN9S 3C3BA 3NUZA 2NZWA 4OXQA 4RDXA 2P77A 2IEZA 3AR5A 3EIEA 4N6NA 4OHWA 3A28A 2K4MA 2I7CA 1W85B 1DAKA 2B78A 1RXEA 1S8FA 2XGSA 3FYSA 4LZPA 2J32A 1QTNA 3HKEB 3NC0C 3COSA 3DBLB 3PIRA 1DB3A 4YTEA 5EQJB 4Q18A 2FMFA 2PBRA 3FCEA 4CODB 1BWPA 1N6PA 3UMBA 4DWWA 3R6WA 2GEJA 3AGQA 3FPGA 3UYLA 4GXNA 3GLKA 2F3SA 5DNWA 5ULLA 3VKUA 1B0ZA 2Q6TA 4AJIA 5HUHA 3R5SA 4LI0A 3AI7A 5A2QA 1TCBA 4Q1CA 1UP7A 5KSYA 1IBMB 3DFKA 1TJ5A 3A6LA 3GGCA 4B6QA 3L92A 2V7QD 2CLOB 1LRJA 1Y98A 1RZUA 1K4MA 1GPBA 2Q6OA 3OQJA 2GBCA 1HRDA 2Z8ZA 4QGHA 3VNSA 3TL2A 4F4HA 2IU3A 1OLXB 1W30A 3LWNA 1L4LA 4MSUA 1Z45A 3OUTA 1Q1AA 1Z2DA 3AEUA 5CB6A 2OO7A 2C97A 3O93A 1P2FA 4UU7A 4N3NA 2Z9CA 4UDYX 3E0QA 3T34A 3SKXA 3C4VA 4Q21A 1ODKA 4FI3F 5ERGB 1NASA 4ZAYA 4WFJA 1QMPA 2H5JA 1D4FA 3D31A 4OQEA 3NHZA 5CNIA 3P9SA 1OBHA 1BGVA 3IDAA 5E6UB 3L7KA 2Y4NA 2PNFA 3U7IA 4D0SA 1VJTA 2QN3A 1AKMA 1FX0A 5D86A 3TTVA 4DTCA 1OLUA 3B6IA 1SU8A 1PGPA 1GR1A 2XAUA 3NAQA 1FXWF 4OQLA 4MW0A 4QXRA 2HA7A 2YS7A 1J9ZA 4N7JA 1WXIA 2W2VA 1QFSA 2XF8A 3S70A 2H1IA 3VKFA 3LY5A 2XKAA 4DIFA 1D5WA 5BOSB 3QI7A 3VKGA 3SX2A 5JC8A 2GBLC 4GMXA 4OQXA 1YZ3A 4CTMA 2XZTA 1CZHA 1RTTA 2RIPA 4CKBA 1QCZA 2GPAA 3DOIA 3VO1A 3A8TA 4LJAA 1XZFA 2H85A 3T94A 1ZSNA 3EW7A 4UD2A 5FR2A 3AESB 3HEMA 2PUHA 3AUAA 3TR5A 4Y67A 5JNWA 1APBA 2PVSA 4AK9A 3QMVA 3I3OA 5I4BA 4H18A 4YJGA 2AOTB 1I6MA 2QE7D 2CNNA 5ER9A 2VRCA 4KOAA 4Q9AA 3TZHA 2JI7A 4KQWA 3MJHA 4LDNA 1NG9A 1FK8A 3RWBA 5A1JA 1MKYA 1NFRA 1J20A 3IVRA 4H7DA 5DM4A 3RUIA 1PR3A 1QNLA 1YXMA 1ZGJA 2DECA 2X4IA 3I1JA 4Q3KA 4QXPA 4R1TA 4FR2A 4LF8B 3VISA 1UKVY 2VHYA 1PQ4A 3CRZA 5EUMA 5BSTA 3VR2D 2GK4A 2EW8A 5KWJA 2Z8YM 1H4SA 2BHTA 3RJMA 2K7ZA 4IS3A 3M3HA 4B3CA 1FP6A 2I9PA 4S05A 3BPSA 3JQQA 2WQZA 1DBRA 1NGSA 3MMSA 3GLHA 1E2DA 5KU1A 5IKMA 1KNXA 4FFPA 1R4ZA 2OQVA 4C06A 3GRUA 5CYPA 3AVWA 3MGCA 1RAFA 1MLDA 3UT5B 5HZMA 3R7BA 2Q1WA 3DP9A 2X19A 4FHZA 4C2AA 2NYRA 1LS6A 1NM5A 3D9QX 1KEPA 3PC8A 5SYNA 1X19A 3ISTA 1HDXA 1DRWA 3CT4A 2F8TA 3FYUB 4ISBA 4JK3A 2PBLA 2BWJA 2RH9B 2OECA 4FDTA 1SKAA 4KK4A 3VO8A 8LDHA 1O58A 4TV9B 3H04A 2ZAMA 3IT0A 1QRUA 1TAUA 1BWRA 3GN1A 4DA9A 1JV2B 4OHXA 3MUFA 1JW9B 2DHCA 4PHHA 3IMGA 4YY3B 1CETA 4H27A 4MXDA 5G2OA 4B3TB 1NMXA 1SHZA 1E1LA 4ENWA 4IF6A 4KWEA 2Z95A 4KQGA 4OSEA 1ZK0A 5HQ3B 2IYOA 1MG5A 5HCNA 1MFPA 5T4BA 2CHQA 1QKKA 2INGX 1DG1G 1SUAA 4Y30A 2ZBQA 1YKSA 2XUAA 1IIBA 2FWMX 4EB8A 2WHXA 1XRLA 3LC7O 1HR0B 3V1TC 1U2TA 5AVSA 3VPSA 4UBMA 4WZZA 5F7JA 2EARA 3GN2A 1KEEA 3EXIA 3TVDA 2XGMA 1JLLB 2D3WA 4ZA2A 3UC5A 4HGOA 4CIXA 4EHNA 3CRRA 1G8JA 2XNDD 4ALLA 1U3UA 3H2JA 4L75A 3ROQA 3UY4A 5JJBA 4ER3A 4EQ6B 5AQ1A 2AXNA 3DEHA 5KJEA 1OXMA 5LZ4A 5H4GA 3K0EA 4XPZA 1CUXA 2H00A 3JWHA 3MRXA 4OI2A 3NHKA 4UCFA 4QFCA 3GDFA 4YRQA 4DC9A 3U6KA 1Z7EA 3CZ9A 3H5VA 5JHHB 3G2NA 2TRSB 3ER9A 4IV0A 4JGBA 3IR5A 4PG5A 4IQ0A 4JBNA 3RAEC 3L9XA 2E2WA 4BQOA 1I4WA 1GGKA 1HT0A 1C1HA 1CSEE 1NX6A 1ZNXA 3AERB 5K6AA 1TECE 3BTSA 5FULA 4G3XA 4Q6WA 3BX1A 1C4XA 1RLIA 3QMPA 1RWQA 4HS4A 5CLJA 3T7DA 1JT2A 4P0PB 1PFKA 2DHRA 3WS7A 4PU0A 3CRQA 5ALTA 3I9FA 2WZQA 5C31A 3EXAA 1ZSVA 4U2EA 3X1MA 4FCCA 1YJCA 4KXFB 1NF8A 1PG5A 1UZUA 1EK1A 4Q7KA 1Z5OA 5L3ZA 3AVUA 1LNZA 2O3TA 4CM1A 3MAAC 2BHSA 4PR3A 1T24A 1UDRA 1IJBA 1HQCA 3RABA 2OOSA 2RAPA 4AP9A 5BSEA 2WFLA 3QPWA 5HNKA 3COJA 1DBQA 2VSOA 3TKAA 2G9UA 1T2EA 4D6XA 3W6NA 2AKYA 1K5GA 1TM7E 2IEBA 3E9YA 4RD2A 3HK2A 3WV5A 3I30X 4U3JA 2PL9A 3H1AA 3B12A 3GRKA 2XXBA 3B9RA 2AEMA 3DJFA 2GILA 1IBKB 3WX0A 4XFKA 3ANYB 1KMIY 1MHTA 1ZUNA 3NOXA 4HWPA 2XLCA 3VNUA 5LPNA 4DM3A 3FD8A 3OZRA 3RI3A 2Q0XA 3VDNB 3T5PA 2UXDB 1KTVA 1IQ0A 2WJYA 3P71T 4II2A 4XUEA 2ZRPA 4AS1A 1U31A 4B6RA 3OEYA 5HIAA 1HMYA 1RHQA 2F6RA 2EIXA 4CMGA 1X1SA 5CDUA 1OI7A 5SYMA 1XTKA 5IT0A 1DAGA 4TRNA 1IEVA 4UJ5A 3VH3A 1LPNA 3BXXA 1T1SA 1U5BB 4BJ6A 1ZGCA 3PGMA 4QM7A 1ZWLA 5D2CA 4MVJG 4DMKA 5FTMA 1IWOA 1LQUA 2XX3A 1Q57A 2RBKA 4XRGA 3EVFA 1R3DA 5F52A 1P2DA 5JAOA 4A4DA 3IR6A 2J87A 2RGCA 1AXEA 3W5UA 4JT2A 4WI1A 5B3JC 5KVVA 2FN4A 2FUG1 1M0SA 2BE9A 2J3MA 4B7AA 5JNLA 3K32A 2C8JA 2G5PA 2J41A 3DL0A 1QTRA 1OLSB 1Z5ZA 1FDWA 4FFMA 1L2TA 2RHOA 3ETCA 3NRBA 4M99A 4IMJB 4NJEA 4KSCA 5JE8A 1UDBA 2UUOA 2XSZD 5CM2Z 1KDRA 3U44B 4AF7A 2YC4C 1AMNA 2ZBFA 3KWFA 4RY9A 5EMKA 2I99A 4HLUC 2MWMA 2J3QA 2KHZA 3AEKB 3IMKA 3KOYA 4Q3CA 3ICPA 3H0EA 4ZXFA 4LYYA 4WQMA 2IFTA 4AQ7A 1G5HA 1V7CA 2AEFA 5EE3A 2R0QC 1KYYA 3V2HA 5B36A 4UCXA 1EFVB 1P33A 4DWOA 3CYFA 3Q7IA 3WK8A 1P2VA 4DIOA 2G6TA 2I8AA 1T9GS 5J1SB 3Q85A 1W581 1RW4A 3DD1A 3U3OA 1Q0SA 1JFFB 1DKNA 5BYAA 4EI7A 1Y81A 4C6RA 1X77A 3GEIA 3N75A 3JQGB 4WZBA 3HS3A 1P74A 5BQ5A 3EA5A 5CGQB 5LQJA 3VAYA 3IJEB 4PIVA 4DRYA 1F17A 4IM7A 1PR0A 4G67A 4D9MA 3R3SA 3A1EA 2YNMD 1A9PA 4MIOA 4OYHA 4FYJA 4X92A 1MXFA 1FMJA 2OBNA 3Q72A 4G8CA 1K7FB 4RH0A 1UPTA 3VR2A 3VPBA 4G1EB 2AR9A 3VR5D 1FP4B 5C7IO 3COZA 3SPXA 1WDKA 2OBMA 1VB3A 2ZE6A 2A84A 5KNBA 4J3FA 2DFPA 2FYTA 3AY3A 3PPIA 4P93A 3OFSA 5TEWA 1L7OA 3TKLA 1YCGA 1MB9A 3NCTA 1CVIA 1G7CA 4W9NC 4P7BA 1N5JA 1R6DA 2Z5GA 2PGJA 3NDBB 1ZRNA 1BX3A 1OU4A 4I7EA 3X1DA 1EUCA 4F2GA 4J7XA 3AJRA 3ICEA 2F62A 3BDAA 4FR0A 1QVWA 2GX6A 1G2IA 1Z4JA 3WAGA 4DAOA 3H5LA 1NVXQ 4S0ZA 2Q2NA 3LQRA 2WTBA 2GA8A 2R6HA 1P1RA 4PHCA 1BA3A 1YZQA 3CCFA 4M9RA 4DM7A 1ZK4A 2FEPA 3AQ4A 2PL5A 3AFGA 1LK0A 2EHJA 1A4RA 4FOPA 3AZPA 1YVRA 2B4KA 2J46A 4YGXB 3TIVA 5CITA 1DZIA 2CNDA 3V2IA 2C84A 2E1PA 2GB4A 3U4HA 3ZE0B 4ZV4A 2I4TA 5MF6A 3Q3GE 1XCGB 1JDZA 2OORA 5JCOC 3V4FA 1U7XA 2BSQA 3THXA 1JAHA 5L6MB 3GJ5A 1MC5A 3FNIA 5FADA 1QQTA 4YP9A 2HIMA 3KR0A 3NM4A 3HNOA 5ESWA 1EHYA 1PTJC 4H0NA 1T5BA 3CGGA 4IEFB 4XWTA 3G8AA 3FY4A 3PX2A 3WRXA 2Q3LA 1NNLA 1QZTA 2DHQA 4PGMA 1SCAA 4DVJA 1SXQA 1V8PA 2IUEA 3FNQA 3R3HA 4TTRA 2P4HX 3A9WA 1HZZA 1VRVA 3M3DA 3OQIB 4NMXB 1JDBC 1SXJC 2JFGA 3TE6A 1U7ZA 1JKIA 3W5JA 3AFMA 2HOQA 5JADA 5DM70 3W5AA 1K5DA 1J49A 1F0KA 1I5EA 3HXTA 1Y3CE 3HZRA 4FLFA 2B4YA 2O7QA 2V7QA 3GLRA 4NJOA 4KQ6A 2JFQA 5FKJA 2JFFA 3N1UA 4P36A 2BRUA 2ZI3A 5AKEA 3WRXC 4K0KB 1VXOA 2Z2KA 3HRHA 1SZPA 1GQFA 3CKYA 1I0IA 2AYXA 2QUHA 3G2KA 1RLTA 2BFFB 4N8SA 1CBUA 2OCXA 1CWUA 4WJZA 3IO5A 1OHHD 4ZMBA 2FI1A 4F45A 1JDJA 2GH1A 3BILA 3MWEB 1QPGA 4LHXA 3EBOA 1HTWA 1UQTA 2POCA 1M8FA 2VXCA 4Q3BA 3KQNA 1N92A 3ZLJA 3S8MA 1IBRA 4X63A 3QVWA 1F9EA 2ECFA 5AW6A 1MC4A 1CQJB 1WZEA 3QWIA 2JASA 4IEIA 4G5FA 4JJAA 2VBGA 1MOPA 4HAVA 4KRFA 3ABZA 3BEDA 3VNRA 2O8EA 1X2BA 2O2EA 4ARSA 3TUJC 3OEED 1EINA 1Y6ZA 5FBZA 3L7CA 2XCUA 5FPQA 3J81k 1W1UA 2FXVA 4BDSA 5JJKA 4AX4A 5IXYA 1CQJA 1XA0A 4JIGA 1AKTA 4MVJH 4NATA 1E1MA 2A0YA 3EASA 3WMXA 1WV0A 4E4RA 3ENZA 4ZQIA 4I0WB 3BULA 4K9DA 4Q7MB 4LUCA 4P3NA 5LZ8A 1QUFA 1G5TA 3UJHA 2D2XA 4AU1A 3JY6A 4LHYA 4CI0B 3FCXA 1DBSA 2OR3A 2CUKA 3E9RA 4MKXA 3TKYA 4B46A 2NLOA 3V1MA 5EHNA 1CJSA 5FNZA 3QW2A 3OFND 1DG3A 1DXHA 1RBQA 2HRBA 4Q05A 1C7JA 3K5IA 4UTOA 1SKMA 2A33A 4R6WA 4X20B 5KJ1A 4XUCA 1JU9A 5EESA 5EJ4A 1P2UA 1SURA 1ADFA 3PFBA 3BGOS 1K5PA 3KSDO 3U9TA 3AL3A 5AVWA 1TLTA 4R0NA 3RO7A 1H23A 2X2OA 2IK8A 4RF3A 4XFJA 4XDHA 2Z1NA 3QBJA 4XPIA 5H59A 4K86A 5FOQA 2OXTA 3BMOA 1STOA 1KP2A 4R1SA 2R1TB 1YONA 2AR0A 2FEOA 1FRZA 1EKXA 5DYYA 4BO3A 3R9WA 1X1CA 1UBNA 2FGJA 4MDFA 4RZUA 4BVLA 4ZJZA 3GAFA 4X8MA 2VA8A 1YQWA 3A25A 2JLQA 1UOOA 3ZD7A 2X8JB 2XHZA 1NKVA 3AYXB 3JYNA 1FYFA 3AEKA 3JZAA 1YHNA 3FBTA 4RANA 2X4LA 4Y2XA 3WLNA 4OLBA 1EDEA 1LLUA 3VI3B 1SMKA 3STWA 5JV5A 4L28A 2OHIA 2OV6A 1IEQA 1VL1A 2UZ1A 1ECCA 3V8BA 4ML3A 2YDYA 3H5IA 3LSTA 3ES9A 2YJZA 4TT8A 3FI0A 3AQIA 3V2UA 1L5QA 1OI3A 1PSDA 3ME5A 1VIAA 1GFSA 2GR9A 2HXGA 3C24A 4YH1A 4OBEA 2OAP1 4F9EA 1M1NB 5FFNA 1CY4A 1TU0A 3EQZA 1LVGA 4JP8A 4E1BA 2ZZNA 3NRCA 3LQ2A 3MTIA 1ZC3A 2EF0A 3KAJA 2LNDA 4RH3A 3GFFA 4NOLA 3RUAA 2BLNA 1DBIA 5EAIA 5TT0A 1RQ7A 4TLDA 3RRXA 3VOTA 5K3AA 4DJFC 5LP6A 2CLIB 4F2DA 1HNNA 4B43A 1QBGA 3OT5A 1QQAA 3VBEA 1E77A 1PFYA 1UMBB 3KLBA 3DTVD 1G21E 3R40A 1B7GO 4HWKA 1KETA 5GIOE 4FXPA 1HYGA 3IXQA 4Z4EA 1GPLA 1O97D 3KEQA 4EF5A 5H7XA 1JDNA 3P2IA 1CUJA 3L7AA 5JRDS 3C48A 1JQ3A 3I4CA 1NWCA 1TMOA 2ZBVA 2HFKA 2J48A 4Q3NA 5EIFA 3QKUA 1JFLA 2WPDD 5AW5A 3TDMA 4MV4A 1XA4A 2V54A 3G89A 2AFRA 1CUDA 3C6MA 3L7YA 4YJ3A 5CTAA 4BQPA 1QZ3A 1WB9A 2NPIA 5A3QA 4NJMB 2KMLA 3GA5A 3CNBA 5D3KA 5EN4A 2I6UA 1ECJA 5IT4A 3A04A 4PVCA 1QYIA 2QW0X 4NS4A 1M2FA 1IHPA 4GEKA 3NBKA 3NFYA 1NU8A 4I2VA 1H6CA 1WCIB 1ZOOA 1DCKA 3LCMA 5C8YA 3QLVA 2WG1A 2HKIA 3RS5A 4KLAA 1L4YA 3DMRA 1VLVA 4YFYA 3VYVA 4L5BA 3GJ3A 4BLUA 3NOOA 1Z0ZA 3P8ZA 1Y80A 4FKZA 4ZPJA 1PR4A 2BEKA 2I62A 3AWDA 5DEIA 1YF3A 3F5MA 3DE0X 1IQPA 1NLYA 1QX3A 2B8NA 4HZUA 1V5GA 3K8QA 4LRUA 2XGOA 2N1MA 2ZBGA 4XGKA 1CC1S 2EQ5A 4PNPA 2YYZA 1JJBA 4GUAA 4KOEC 1GQQA 1G3UA 3MB5A 4TV8B 2FN9A 4MIEA 2A6PA 2ZSUA 3RUPA 3GCXA 3LHFA 4RS4A 3SEAA 1CNMA 4UM5A 2SHKA 4NULA 1FW8A 4OL9A 4WX2B 2BGRA 2BM9A 3F7TA 2IHTA 4LHWA 5JOQA 4Z4IA 1Q5PA 5L45A 5TMEA 1TYEB 1ZVJA 4K6MA 3ZEAA 1XFDA 3N6RA 3K70D 5KTOA 4ZJUA 2QZZA 5IBCA 1F6WA 1UJ2A 4MS1A 3ZHUA 1UP4A 2IL1A 4P22A 3RV3A 4RS3A 4QAQA 2X9NA 2IGBA 3Q3EA 3OTWA 4WK6A 5DTIA 4XD7A 1D4OA 3EIOA 1BC5A 1KI6B 4KEAA 3F67A 3EJWA 1F06A 4ER7A 3DUWA 2RGBA 3QELA 4FYXA 4NMLA 2QR2A 4K81B 4H6XA 2BLLA 2UZ3A 2EL7A 2XUIA 2UYQA 5D01A 4F85A 1LWNA 4HGPA 4EYEA 2FW9A 2C8LA 1GUDA 1UR5A 1C30B 3OP1A 4K9LA 3UQYS 3DV9A 4EZBA 4WEQA 4DMGA 1S3IA 4RLFA 2F3PA 3GCDA 3CZAA 4LJYA 3WWZA 1KJWA 2ZXFA 1FVFA 1VKJA 2A9JA 4TXJA 2E6KA 4D6YA 1MNAA 1X1BA 4TUYB 4U0JA 1WBJB 4ZQHA 5C8YB 3G0HA 1TKCA 1DKOA 4HGZA 4KQIA 3IALA 1BAPA 3PDIA 4GI7A 3SQNA 4KMOA 2BDTA 3H0KA 5IC6A 4TKVB 4XCXA 3E2IA 5TVGA 3AY7A 3OJFA 4W63A 5DXJA 2J3IA 1SQ6A 1IY0A 3D2BA 1NBMA 3L79A 4GGMX 3DR5A 4JBLA 2O57A 4B4OA 4EF6A 1MJGA 4FJ1A 1DO0A 5HSGA 4NIMA 3UHFA 3U3RA 1T1JA 2CXHA 1I1HA 4L95C 4C4OA 1NUAA 5AI0A 1H22A 4RQUA 4UTPA 3M6VA 2GA9A 4QFMA 5L3VA 2QM0A 1SD1A 1EXMA 1J2JA 2GM5A 1VHTA 1CP2A 3DEJA 4BMZA 4AS3A 4F3CA 4ZYVA 1DKMA 1YB2A 4EKIA 2IIQA 4G1MB 5H4HA 4QVGA 4XB1A 3UUGA 4CMCA 4L0DA 2ZWVA 1HEYA 2QTBA 4ZO8A 2JBAB 1L5HA 3JAKA 5AK5A 4ZO9A 3DXYA 2HNKA 3GMIA 3R8XA 1EP9A 5JMOA 3KQHA 3LUGA 4PC3A 1YZFA 2B20A 5EGNA 4QDOA 3ZZMA 4ZGBA 4KR6A 4E51A 1H8HA 4R9VA 6ABPA 4AJHA 2Q9BA 1I32A 1RZVA 3Q9SA 4NDAA 3HHPA 4HDSB 1XP8A 2VXYA 3SSNA 4RFSA 1HO3A 2YY7A 3FUTA 3T5DA 2HQ1A 4A7PA 4I5IA 3LI2A 1KFCB 2AUNA 5I5EA 1WBDA 5JNVA 4OATA 2G36A 3I53A 3P0HA 4RCVA 3AHIA 3CNHA 3E15A 3SJAA 3FOEC 4JZYA 4PZ9A 4HVTA 2OD9A 1NZFA 1X0XA 1CUEA 3X0DA 4LXIA 5A5FA 5CT9A 4KQ1A 3BDIA 4CMBA 4P4TA 1GNQA 4G0VA 1CUSA 1T4MA 2YWJA 3WC4A 2FFJA 3FCUB 1HEIA 2YMLA 1AN9A 4PTLA 1OBFO 1F7UA 1J8DA 3AR3A 1OAOA 3H5WA 3KDSE 4YRFA 4DLPA 1A5AB 3PHGA 2ZI5A 1K0UA 1PX2A 3IIJA 3NORA 4WTOA 3F2VA 4YFVA 1SELA 2YHUA 1KDVA 5EMMA 1LNQA 1D03A 4RPGA 4DW8A 2CZCA 3JX9A 4Z7QB 1NW6A 1DU4A 1CR6A 1SPXA 2QVYX 3REFA 3ZK9A 1JI0A 3TW8A 5IVHA 4YLYA 4QE3A 1DWOA 3OC6A 4HMPA 3AF4A 4WKGA 4WZBB 3RAFC 1NVDA 4Z4GA 3RVBA 3SLRA 4NNJA 2EX0A 2P6UA 4CKXA 1P9OA 2CXOA 3N0XA 1DIBA 1GXSB 2PYZA 1YRQA 4J07A 5AKIA 3BWYA 1D1QA 4OY3A 4EZIA 4A2WA 1KZ1A 1QLHA 4B82A 3RRZA 3VSCA 1TTQB 1RMYA 3USZA 1A8SA 1KIAA 2GCNA 1HDCA 3DOOA 3RYIB 2C20A 3ZXSA 1V6SA 1HUQA 2QBYB 4ZYYA 3G9UA 1VJ5A 2JIDA 4BIMA 3OKCA 3PJFA 1Z2PX 1GSHA 3PXDA 4O02B 2V5UA 3R0VA 5EI5A 1OYVA 2IDMA 4HFNA 1JHAA 4JEHA 2WYOA 2B94A 1KQNA 3NATA 4MYSA 4CJXA 3SOPA 1G6HA 2CLKB 2ORED 2ZJ8A 3DLAA 3GP5A 4L76A 4PFKA 3T9EA 3M2PA 4AMBA 2O5RA 2VH2A 4KR9A 2CJYA 2D1QA 4FYMA 4B8YA 3HN7A 3EGEA 4HDKA 1WCV1 2OLKA 2ZAIA 4A26A 2EBFX 1EFRA 2YRXA 2FWBA 4HQKA 2O20A 3EZLA 4YXWD 2D3TA 2OV4A 4IH1A 4AF6A 2CLFB 3DB1A 3NEJA 3P2EA 4RZ3A 1DXQA 2VK1A 1YDMA 4G37A 3RIXA 2LCQA 4IGEA 2PFKA 1RAGA 2GWRA 4ONEA 3OPQA 3M1YA 3TQSA 1FUEA 1E8MA 4LOJA 4XLLA 5BXQC 2W2NA 3E9DA 3DKPA 1J24A 3EDMA 3NP7A 3FYUC 3TEJA 2LDBA 3MC1A 4MRRA 1R5JA 1UT6A 2F90A 2PV7A 3E9CA 3D1LA 2GNAA 3FOAA 3I32A 3IOEA 3OHSX 3FMGA 3C14C 3LBIA 4MI6A 4MKZA 1GSIA 1Y3DE 5B4VA 1SVLA 3TQIA 2PJZA 2JA2A 3GBSA 3KDAA 5DGXA 4DRXA 3T7TA 1GA6A 1Y7IA 1EUDA 4UTVA 5KYUB 5LOVF 4AY4A 1R4MA 1M2NA 2VS1A 3I39X 4IDQA 4GR5A 1FNDA 2Q3MA 3BSYA 5KJ6A 1UK9A 3IOCA 4Z8YA 5F51A 1PSWA 4TVOA 3O8OA 3SVLA 1JJAA 3O4FA 3MJEA 3TO5A 1QO9A 2NO7A 2FEKA 4I1SA 1PGOA 2A1IA 2I4RA 1I80A 3ULKA 5EP3A 1M83A 1UBGA 4MGEA 1GNPA 2YWRA 2TMYA 3ASVA 4XYEA 3NUQA 5K8UA 1DMSA 1QRDA 1XYYA 2XNSA 2C88A 2QU8A 5JCJD 3JV7A 2GHIA 4LGYA 4BTLA 1BA2A 4KR0A 5BN1A 4YRJA 1CY8A 1WG8A 2HSZA 3QLTA 4YJDA 5EVJA 3UTDA 3TG2A 4H08A 1JLKA 3ZJUA 1RPNA 4LXUA 2R62A 1KJJA 3LA6A 4F7DA 3N8IA 5DTEA 4EA9A 2PSEA 1KMCA 2IJGX 1N25A 5EIBD 3X1WA 1MAUA 4MWEA 1PJBA 4X6UA 4NBSA 4DA7A 4JMLA 5KHLB 2C54A 1R0XA 3WIEA 1KVRA 3DPIA 4RVSA 4FKMA 5DEOA 4M9QA 4AS2A 4YCBA 3S5JA 3NEPX 1QP0A 2HHHB 3O0TA 5T8KA 3BD8A 3UWSA 5LIRA 2HF2A 1DE0A 3SZ3A 3AEXA 4F1WA 5FI3A 3AO0B 1VLQA 2I3DA 2VTEA 2F3QA 3PUKA 4KE8A 4NYMQ 3V7FA 4EVIA 2XCSB 3NBMA 4J1TA 4CEIB 1H3NA 2G0TA 3DYVA 1II8A 4KXYA 2SKEA 1RACA 4MV3A 3IP3A 2X5OA 2FZWA 1Y6FA 4P3KA 2MCFA 3GFGA 7AT1A 4PZAA 4K28A 4PSDA 1IDOA 1Z6YA 5HJ2A 1CS0A 3E9NA 1JJIA 4O4IA 4WJLA 1AK2A 4BFYA 2IDKA 4NBTA 5AW3A 3LL7A 4TTSA 4OJTA 5TB5A 5DHFA 2O5CA 2PAAA 1RM5A 3CISA 4LEIA 3EIHA 4ZAXA 1KVQA 4ZVQA 5HF6A 1HX7A 1JDBB 2VF4X 1IQUA 2P1ZA 4JBIA 4M3NA 3GCZA 4ZVVA 2JNWA 5ANRB 2DU8A 4CM7A 1CZUA 3H9EO 3JCZA 4G5QA 1WETA 4NP6A 5F7XA 2WSMA 2IV2X 5TGDA 1FSSA 1L4UA 1J39A 3CEJA 3OCJA 4GMHA 3WFJA 3QUTA 4PPQA 4UPDA 1Y5MA 4KV9A 4EAQA 4FYYA 5BW4A 3QOYA 3GJ7A 2VZLA 1GHTA 3GOHA 4LZWA 4M53A 3UWMA 1X92A 2ZYGA 3FJ1A 1JJ7A 2YFYA 3OF5A 5H8WA 3VR6H 1U8AA 1UM9B 2KM1A 3AR9A 3IDFA 4K46A 2JF0A 1MRZA 4JZKA 4L7VA 4OH7A 4E32A 2OZKA 4MJ3A 2C0PA 2OZPA 2BBOA 3ND6A 1YTLA 1C50A 2NG1A 1MN6A 2B69A 3AF5A 2V9CA 4AROA 2NYAA 4QUHA 4DWVA 1O94C 2AWNA 3LBYA 1F2UA 2BBWA 4IDOA 4MAMA 1Q7EA 3MWGA 4J7CA 3C43A 3VVMA 4I50A 4CLDA 3C45A 9GPBA 4XWKA 1IVYA 2DOKA 4B71A 4IWYA 1GNLA 3E7XA 1I3LA 1JECA 1YFKA 3SN6A 3SYNA 3IVMA 4B5LA 1AC5A 2DX7A 4IFEA 1C9JA 3TLAA 5B30A 1KU6A 5D3MA 4ICIA 3PDWA 4PNHA 3PRHA 4M60A 4CN9A 3GU3A 4K2HA 4GLOA 3DAPA 2IS6A 1HL3A 2Q0QA 5DHQA 5LN1A 2ZSAA 2ZB7A 4EKYA 2DQYA 2QVXX 4DCUA 5FTJA 1LTKA 4MVWA 4F8EA 2MYTA 3GUHA 4G1CA 4UCWA 5E6RB 4F7WA 3KCQA 4CVNA 2V3CC 3MFYA 3QZUA 1QYVA 3ROTA 2REQA 2V0NA 4GLLA 2WJVA 3TGLA 1TYBE 2PUGA 5JH7A 3GRFA 4Q4AB 1A2QA 2GUGA 3PIDA 3M83A 5ICMA 2EL9A 4BLTA 3H4IA 1IN1A 5EP4A 5ETJA 2GQ0A 2XMPA 4LVOA 3NJRA 4NG4A 5ALKA 3DDWA 1AO0A 4RQAA 2X5XA 1OPXA 5BN5B 1FNNA 1SXJB 3UOGA 2HT6A 3C8UA 4GC9A 3D4NA 3NOQA 2ENWA 2B4AA 2EBHX 1K3FA 1H8ED 1ZRSA 3LK6A 4ZKEA 1HA3A 2FK7A 4IYJA 2VJKA 4H35A 4KBYA 2WABA 4FSDA 4OLFA 4UQPA 3URMA 4DIBA 3FUVA 4JL5A 4MW1A 4R1MA 1SXIA 2WIFA 1ID1A 1PZNA 2PSFA 1N2CE 1W34A 2WU3A 4JU9A 4E2YA 4Y2JA 4ND2A 3KYBA 5HMLA 3ER6A 3T5CA 4B2IA 1HE2A 3OSUA 4B3IA 3QHQA 1RIIA 2YHIA 5FNVF 3U49A 4A03A 4ZI7A 5MGNA 1CEYA 2I4IA 3EPPA 4HQFA 4K26A 2F3TA 3MK31 1G21A 3KYCB 1AQUA 3OZBA 3PXBA 3Q2IA 3QITA 4XQ0A 2EBUA 1MAVA 4H1VA 2WM8A 4D1YA 1XMSA 5BXYA 1FZTA 1X7ZB 4IHQA 1N9GB 3K0SA 4EPWA 5I4IA 1GU0A 1KVSA 4FIDA 1A8UA 4F86A 4YCMA 1D0VA 1LGYA 4C7JA 3ET5A 3B2NA 1Z74A 1Y5NA 1KO5A 3HBNA 3N2EA 2HWXA 2NU8B 1I3KA 3IVXA 4FDVA 2JFXA 3CV3A 4PGAA 1OILA 2REXB 2AI2A 3D0OA 4QDUA 3EB9A 4OP3A 1K89A 3HFGA 3QWBA 3GT4A 2Y1EA 2C83A 2Q8PA 4FXOA 2PZAA 4K6OA 4RXUA 4W1PA 2KW5A 3KL2A 4CR6A 4DLWA 1MJNA 1WVMA 5I9SA 5HVNA 1YU6A 4OCZA 1K6IA 2AQIA 1HXHA 2BR5A 1Z7YA 2QTFA 1NDQA 2AA3A 3GDHA 3R76A 1H2RS 1G8SA 4EFKA 2PT6A 3AVVA 4YQZA 5IK2A 3I9JA 4AQDA 3VR5H 3ONNA 3RYHA 1BCRB 2P1RA 1GCGA 2FZ4A 1L4NA 2YWDA 3W4IA 1QC5B 4OFBA 1G2PA 1V45E 2O1SA 4GZ5A 1YUBA 3ADPA 4OJQA 4BE7B 1U7PA 1ES9A 1UBTS 1ZISA 2R6ZA 5A4FS 5IS2A 2VUUA 3IUQA 1E1DA 1N5MA 1GOTA 1N2HA 1BDJA 1XTBA 3FCYA 3OT1B 4Q37A 1FQWA 3HLYA 3OLWA 2D8AA 5J5VA 3SI7A 1VSQA 4R1PA 4UBLA 4ZOBA 3FRHA 2ODBA 1K7SN 2JL1A 4DDVA 2D8MA 4PLHA 2C7BA 4C6HA 4JCOA 1JBQA 1E6MA 1N6OA 2NU9A 2NV2B 2Q1YA 4JDUA 1ECBA 4EW3A 2EKZA 5NULA 3LOUA 2NXCA 1V25A 4TSFD 1K08A 5IDQA 4Y9UA 1H2FA 4TX1A 1IE3A 3LHSA 4CDMA 1JG1A 2F9LA 4UHKA 4ZI2A 3A6ZA 4MQBA 4W9RA 1YJBA 1X8JA 2ZBEA 3BWVA 3PNKA 5THQA 1G9XA 3G8YA 5HZGA 2XGGA 3CZ5A 2O2IA 3FIUA 5JARA 1XOIA 2OM2A 2II6A 1B0UA 5DTQA 2WJ6A 1D2RA 3RTBA 3H05A 3U3JA 4E07A 1B8UA 4EY4A 1MPXA 3ADDA 1YHYA 5C1OA 1ZRHA 4KQJA 2GETA 3MWEA 1XZHA 2F2TA 5C7LO 4GKKB 1YGPA 1XVLA 4FQ5A 1IN4A 3JATB 3L6UA 1XWWA 2Q6IA 4I6GA 4TROA 1O54A 4EWLA 3EIUA 3LXRA 5JFGA 5LL6P 4ZXPA 3I62A 1OFUA 2FQWA 1X8LA 4FZJA 5AKGA 3D3EA 4EX6A 4CQMB 5JTUA 3NEAA 3S8YA 3QEAZ 3W2HA 4NBRA 4AZ0A 4R0MA 3LX6A 4CFYA 2JLYA 1BRMA 1C5KA 4XXHA 2H9YA 1V43A 2R8RA 4R1QA 3A9UA 3Q1LA 3MTGA 4FFWA 1F8XA 3OQ6A 3DEAA 3B7PA 3WSWA 2IE0A 4FEAA 2W48A 3UM9A 4RABA 3J7TA 3BXFA 1POWA 3A6GA 1AS0A 2EJTA 2J3KA 2H4WA 3OQVA 5GIPE 1XU4A 2G63A 3H87A 3OHPA 3UAYA 2J1LA 4BO4A 5LP1A 4AMVA 4HAXA 4CCWA 4A9AA 1L7XA 1WHTB 2NSDA 1U63A 3RHSA 5M5BA 1G0NA 3JQEA 4JSTA 5T6BA 5JQWA 3IT2A 4Y3UA 1JWBB 1QIHA 3HEAA 4IO1A 1XNGA 3CR7A 5EHQA 2AT1A 4DCPA 2EJWA 1J23A 2QWXA 1YR8A 5EFZA 1KVUA 1QGZA 3BH7A 3BXZA 3JASA 3DMHA 1L7NA 4IEEA 3KJIA 5JZSA 2GUWA 1E59A 3BTOA 3EXHA 3LT0A 2AF3C 1SNYA 1O9BA 3MS2A 1ZCBA 5C34B 1EG7A 1NQWA 2C9OA 3QLUC 4MEJA 4ZI5A 4RTPA 2CD9A 1GNTA 3DZDA 3JSAA 4X90A 2LUOA 2POQX 4TVSA 3ZOZA 3DLBA 4IJWA 1RPTA 1C1XA 3H6KA 4NBKA 3G82C 2PMEA 5EWMA 5KS2A 1T5TA 3AHDA 5JH7B 2ZFUA 1KNQA 3JZDA 4Q16A 3PDHA 1Z4OA 3OT4A 1T8WA 2P5SA 3BIXA 4ZAVA 2FMIA 3E27A 4HI0E 4WPGA 2P9GA 5FX2A 4U00A 5FAKA 5KREA 4XKJA 1CUAA 1XAGA 3R7FA 2P65A 4QXMA 2BSXA 1R0WA 3ECSA 4A23A 3TTYA 3V48A 1UWLA 3C5HA 3L4SO 4FC7A 3VZBA 2VO1A 4R4JA 3U9LA 3PDUA 1Q3HA 1C9MA 1VJ1A 1ZCZA 1ZWKA 2ONYA 2PS3A 3RYTC 4MK4A 3C8MA 4ND7A 1Q1EA 3DF7A 3FJOA 2JJ1D 4H4CA 4ER6A 4V1CI 5K5EA 1QIEA 1QU3A 3EQ6A 2ZTVA 3H86A 1ZFNA 1OF1A 1SCQA 4RHTA 3TOXA 3FNFA 3PICA 3DMFA 3F5QA 3HCCA 4Z5XA 3IP7A 4CEJB 2J6HA 3EPLA 2NQ8A 2VZEA 2CW5A 3N0VA 2QP9X 3OY7A 4FMCB 4K6HA 5DW0A 1SUFA 3UOWA 4MDYA 4YUAA 4B0PA 1ZH0A 4O0MA 5TGTA 2H5LA 4CI9A 3JQFC 2IXGA 3L1UA 5LQRA 4KAAA 3H1GA 2VAPA 4C3OB 1T8TA 2NUBA 2RCNA 5JMPA 1Z0IA 3HO8A 1VZ2A 5CT8A 2EC5A 3VU9B 1RKQA 2ZRNA 1OFCX 4E13A 1WUIS 1RWOA 3L01A 3VDRA 2G9QA 4BKRA 4DKXA 5JLJA 2ZU0C 1JLMA 1U0JA 3INRA 3L49A 5TRTA 3N2KA 4EUSA 1CIJA 3UMMA 2XRYA 2HK9A 4X24A 4AWAA 5FOSA 4PZDA 3O4HA 4D4GA