3HADA

Biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
293
structure length
293
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKRAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical characterization and crystal structure determination of human heart short chain L-3-hydroxyacyl-CoA dehydrogenase provide insights into catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords PROTEIN (L-3-HYDROXYACYL COA DEHYDROGENASE)
total genus 117
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3hadA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hadA01
5EQFA 3UHAA 1Z7EA 4BNNA 4AFNA 1GQQA 1K5HA 5U9CA 4XYMA 2W2LD 1B26A 4CQLB 2JAHA 3JV7A 1B0AA 4BL5A 4Q3AA 4E3ZA 4R5HA 2QYSA 4IMPA 4NH4A 1WAMA 5EINA 3H2ZA 1EVZA 4LSWA 3KLPX 4W6ZA 5F5NA 4LRTB 3C85A 4OXYA 2CVOA 1GQ2A 3VH3A 3F1LA 5KWEA 1KC3A 3DFZA 1GYPA 3LZ6A 4EYEA 5CEEA 1BW9A 4NI5A 1TT7A 1GCUA 3RC2A 4EBFA 2DPHA 2Y93A 2PY6A 2TMDA 1EFKA 1NBOA 1OAAA 3QY9A 1T2CA 1C1DA 1EDZA 1PZHA 1HSZA 3FTPA 3HFGA 4L4SA 5EJ2A 5KJ6A 2PZJA 3EMKA 4CODB 4D3DA 4WEQA 4FD3A 2H1SA 3STHA 2QZ9A 4L4XA 5JMPA 4XDZA 1D4FA 1LLCA 2W90A 2HCTA 4YRDA 3GN1A 4ZGWA 5CFZA 1Y7TA 2BGLA 4IIVA 4UREA 5G2OA 4XWYA 4LK3A 3O26A 4K28A 4R9SA 5JMWA 2OO5A 2W2LA 1HYHA 1U5AA 3I9LA 4OYRA 1YVEI 1Q2XA 3FWZA 4FC7A 1EE2A 2B4RO 3PWSA 4MVJP 3NV9A 1CYDA 3E5MA 3OMLA 4H16A 4PG8A 2UYYA 4GKVA 4R1UA 5EQDA 2VZ0A 1EBFA 2P4HX 4ALJA 3U5TA 4BO0A 1FK8A 5L9AA 4GSLA 1ADFA 1C0KA 4J7XA 2HMVA 3GUCA 4MJLA 2QIOA 2EXXA 3BMCA 2NTVA 4G2NA 1LLQA 2G17A 1E3WA 2HK7A 4J49A 3AW9A 1E3IA 2YHIA 2FSVA 2PR2A 1R0SA 2X86A 3B1JA 3LK7A 2H6EA 4J1TA 3E5RA 4NNJA 1JDJA 4AJ2A 1YXMA 4I9UA 5HBRA 3C1AA 1E6EA 3A9WA 3S2EA 4B3IA 3Q2IA 1MV8A 4L9RA 1XA0A 2F1KA 4M87A 1Z45A 1M6WA 1DOHA 1T2EA 2FSSA 2VTDA 1UXIA 3PI7A 4R41A 3I9OA 2GERA 4NMHA 1NWHA 5KVVA 1W73A 2V7PA 1ZKMA 4UUOA 1NX6A 2YUTA 4JROA 2A35A 1GDHA 3HUDA 2Q1SA 4Y8VA 1R6DA 2I99A 4AJLA 2NACA 1UZNA 3D7LA 1IY8A 2EW2A 4Z9YA 4DBVO 4BB5A 5KOIA 5IXSA 1DLJA 2DC1A 2QQ5A 1PIWA 3WGIA 1KYQA 4IY1A 4UVEA 1NAHA 1DDOA 2FP4A 4YB8A 1JA9A 1ZO8A 5A05A 4Z6KA 3NTRA 1O89A 3PIIA 4W7HA 4R1NA 4I5FA 3P19A 4BNZA 3SEFA 1N2SA 1JWBB 2WYWA 1ID1A 1B16A 3INRA 3C1OA 3DMYA 3Q0EA 3OETA 1LNQA 2FR8A 1V8BA 4A10A 3C3XA 3GFBA 2Q1UA 3F1KA 4IDEA 3NEPX 4NBRA 5F1PA 5I7EA 3CZMA 3JQAD 2HDHA 2VZ9A 3UN1A 2B0JA 4FFOA 1N7GA 3L6DA 3OJLA 4FFPA 3VDRA 1J0XO 2ZB7A 1E3JA 4BKUA 3JQFC 2Y99A 1QYWA 2JCXA 3OIGA 3GMDA 4I5DA 5A5EA 2NVUB 4B3HA 4P22A 4HWKA 4ALMA 1LTHR 1XG5A 3FCOA 4AJIA 4BNHA 1WZEA 4CLHA 5BNTA 3ZHZA 1VL8A 4XQ9A 4XIYA 4DMMA 3V1YA 2ILTA 2WSBA 4MIOA 1WVGA 1LRKA 4RF5A 4BGEA 3CE6A 3JQ7B 4BKQA 3GR6A 1YO6A 3I23A 1SAYA 4AJPA 2BELA 4BNGA 5DP1A 1MA0A 1JQBA 2JL1A 4E6PA 3RU7A 1GR0A 3CEAA 4IGEA 4XB1A 3P7MA 3OM9A 5ER9A 3F4BA 3PLRA 4OOEA 3RWBA 3PTZA 4OQZA 2IEDA 3IKVA 2EP5A 3H3FA 2WJPA 1ZSYA 3QRWA 3JQAA 2Y0DA 3FWNA 3L9XA 3HG7A 1V35A 4MDHA 1I3LA 1MC5A 2BHLA 3FNFA 3VVCA 2EV9A 1CIVA 4YJGB 2C5EA 1AUPA 1QLHA 3R3JA 3RBVA 3UUWA 3I83A 2VRCA 2WEKA 1IZ0A 3H9UA 5L4LA 2P9GA 2D59A 1QG6A 5AXDA 4X54A 4BQPA 3SBOA 3WG9A 2PZLA 3JQBC 1ZK2A 3BZUA 3DZHA 1BGVA 4XGIA 3RC7A 4EUEA 1JLLA 2FOIA 4JN6B 3PZBA 1LJ8A 3DZFA 2YYYA 3VZSA 2V65A 3LVFO 4WLEA 1HE3A 4E5KA 5K9ZA 3EDMA 4IXTA 4WLUA 3JQGA 4NJMB 4WCFC 1GV1A 3B1KA 3ZU2A 3KSZO 4L4RA 2G5CA 3DMTC 3D4PA 4GX2A 4XEHA 5T64A 4JLWA 3VVBA 2O23A 1CDOA 5I7SA 1FDVA 3EGOA 4GLOA 2GGSA 4Q3BA 5TS3A 3V2HA 3A14A 2W8ZA 3IAHA 2RHRA 4R01A 1HDRA 3ZH2A 5F3RA 4BV8A 3NGXA 1VKNA 3NT4A 5L53A 1EQUA 3AUAA 5TT0A 5CG2A 1PJLA 1R4MA 1O0SA 3LT4A 4ILKA 4BO4A 1HYGA 3RUCA 1WDMA 4CV3A 2VHXA 4TVOA 4CR8A 2JFGA 1ADCA 1H2HA 1HLDA 2LDBA 3ZHBA 4HX5A 4PRKA 4WECA 4QSMA 2QHXA 4FB5A 3IJPA 1NP3A 4IUYA 4E2XA 4S1VA 1WP4A 2WTBA 3DBRB 4PZEA 4GWGA 3K31A 1H0KA 4DPMA 3ADPA 2E6UX 3GHYA 1CRWG 4DIOA 4RQUA 1KVQA 1U7HA 3RUFA 3T7CA 1GZ6A 4LRSB 2VYVD 2WWRA 3B6ZA 5T8KC 4GGPA 3WYEA 3F47A 3NT5A 1LSUA 3AUTA 3MOGA 5TT1A 4EUHA 2JFHA 3KSDO 2YJZA 1Y9AA 5ICMA 4L0QA 1YL7A 2NU6A 3DAFA 3AM3A 1SBYA 2XPCA 3BMOB 2VOEA 4GKBA 5COQA 3S2GA 5KVCA 4GI2A 4KQWA 2O3RA 3OJ0A 1VJ0A 3WGYA 5COAA 2VRBA 1HL3A 1KY4A 4IINA 3DBVO 4ND1A 2W2KB 4RPLA 4YVFA 3VDQA 1B8PA 1DFHA 2JCVA 3RROA 1PZEA 4FCCA 1RYEA 5IZCA 5JXWA 4J91A 1PZFA 3VKUA 3LQFA 1L7DA 5JC1A 4YJFA 5KNLA 3JD1A 3U4HA 2J3IA 2GO1A 3U4IA 3EY4A 1LDNA 2WMDA 3RUDA 3GMSA 5CPFA 1EUZA 3RFXA 5GMOA 1ISHA 4XKJA 2O7QA 5JW6A 4JJFA 4CUZA 5HRUA 4EJ6A 3FPLA 3KSUA 5U4QA 2CSUA 2VYVA 2NUAA 3VTZA 3L9WA 3ZNPA 1OMOA 4MVJM 2IXAA 5C7IO 4PRLA 1V0JA 3DAPA 2X5KO 1DIAA 1SOWA 2YY7A 3KYBA 2CFCA 2R2GA 3TQHA 4J0FA 4J2OA 2WD7B 4U6SA 5DCWA 1GEGA 4B79A 3K73O 4DQXA 4JK3A 1E0DA 4TRJA 2YHIB 5T8KA 1HWYA 1V3VA 2RHCA 4BNWA 2B36A 3E48A 4Y6RA 3T4EA 3SC4A 4J4HA 3ENKA 4PLFA 3TRIA 2X0RA 4XB2A 3ZWBA 2RCYA 3LC2O 9LDTA 1PGOA 2VUTA 1SZJG 2CVQA 3MTJA 1FDTA 1I32A 2BF7A 1VE9A 5BR7A 1T2FA 3BA1A 4A7PA 4R68A 1NWCA 3TOZA 2Q2QA 3PWKA 5JY1A 3N58A 4IJWA 2BGKA 3RUAA 4GX5A 3I5MA 1VSVA 1JAYA 3WGHA 1GZ3A 3C24A 1R4MB 4RCVA 2C7GA 5DT9A 1C1XB 4KP7A 1K3TA 3JYPA 4RORA 4JP2A 1PGJA 2AE2A 3A28A 3D4NA 1A7KA 1KVRA 4CM9D 1PGNA 3MCVA 2JD2A 5KJEA 3DHNA 4QQRA 1TB4A 4MVJH 1I36A 3ZV4A 1SEVA 4Z0HO 1DB3A 2GN4A 4BMSA 3GGPA 4XRRA 1LRLA 1EBUA 4BS9A 3GA0A 4CM5A 2WE8A 4PLTA 3JQ8A 2NQTA 2X58A 3PRJA 4CLOA 2QZZA 3OQBA 2CY0A 5A3JA 3QWBA 4YJHA 5ILGA 3PDUA 4CLDA 4J4TA 4BIIA 4MIYA 4F3YA 3RVDA 5B1YA 1MLDA 1N9GA 1LDGA 3V2UA 2P2SA 4HUJA 5F1KA 3JQ7A 5FYDA 4AJ4A 1BTOA 4W99A 4M8SA 1YH3A 2ZB3A 4BNLA 4CMAA 3W4KA 3O38A 4EDFA 3BMQA 1AXGA 5C3MA 3PEFA 1XR3A 1XYGA 3VZPA 3L4BC 4Y9DA 4AL4A 3GNTA 4Z9FA 1C0LA 4MKXA 3ZW8A 2X5OA 2NNLD 1MB4A 1Q7BA 3DHEA 3S1LA 1I5RA 1X7DA 3DDNA 3ZV6A 3HADA 1LC3A 3CIFA 1O8CA 3MJ4A 4XRGA 1YS4A 4GPD1 4CM9A 2P5YA 1DEHA 2V6BA 4OOFA 2OXIA 2HK9A 4XYBA 2GNAA 2DVMA 2PZMA 5IN5A 4OKNA 1GUYA 1GUFA 3C1TA 2NTNA 3PQEA 3KRTA 2I3AA 4IBOA 3CSDA 4K1LA 4ND4A 1GV0A 1U8FO 2VTEA 4BMNA 3G17A 1Y6JA 4IQ8A 4B8WA 3JSAA 2HMSA 3GDFA 3AOEC 1PL8A 5AOVA 3WNVA 4KWIA 3ANMA 4N5LA 2YHUA 3H5NA 3QJ5A 1X0XA 2Y1GA 5FEUA 1U3VA 1NYTA 1GL3A 2BH9A 4RLHA 5EN4A 2ZB8A 1UR5A 2VWQA 1HRDA 1KEPA 2Q99A 1HE5A 2ZB4A 4HP8A 1NAIA 2ZYDA 4CM6A 4J1NA 3U0BA 4FS3A 5JLAA 3ZGYA 4J6FA 3GFGA 4ZD6A 1DXYA 3CKYA 3OJOA 5DZSA 1E7MA 1EVJA 2O2YA 3V8BA 8LDHA 2TMGA 1P44A 3M6IA 4CUJA 4M1QA 3B1FA 4YJDA 1YJ8A 3K5PA 3OFSA 3NJ4A 4IMRA 2GF2A 2EF1A 1B3RA 3PYMA 2JFFA 3W6UA 4BGUA 4D3SA 2NSDA 1KETA 4KWHA 1D1SA 3CH6A 3WMWA 3C7DB 4I9NA 5MGBA 4OL9A 4B4OA 1MUUA 3IOYA 1R37A 1W6UA 1XQ1A 2CZCA 3RC9A 2P68A 3QQPA 2OL4A 4HY3A 4QUKA 5ITWA 3JD2A 4O1MA 3MEQA 4FN4A 1UXJA 1KVTA 5F5LA 4EJ0A 4NJOA 1BDMA 1ULSA 4J7UA 4IDCA 1H6CA 4YEDA 3RQSA 4RPKA 1LA2A 3LLVA 4YWJA 4A73A 5JBIA 4BO3A 2I3GA 4W4TA 4L74A 4ND2A 2HLPA 5B12A 4DMLA 5T67A 4R1TA 4WKGA 3VZQA 4FBGA 1E1MA 4RDHA 2VHWA 3FRJA 5G0WA 4PCVA 3JQAB 5ER6A 2CDAA 2GN9A 1NQTA 4JBHA 3AI1A 2DBQA 1QRRA 1T25A 1ZK0A 4R3NA 1DLIA 3E18A 5DOVA 2D5AA 1AGNA 3RU9A 1P31A 5L7WA 2Q1TA 1YQGA 4IDDA 1A9YA 1O94A 1E1KA 2Q45A 2OBNA 5CDSA 3ASVA 3RKUA 3H9GA 3UGKA 4KQXA 3HN2A 1VJTA 4GWKA 4RL6A 1NHWA 2RH8A 4PLHA 3JYOA 4KDEA 3L07A 3ST7A 1I3KA 3RCBA 2X1HA 4PZCA 3ZNNA 1TLTA 1JU9A 5L7YA 2IE0A 3LYLA 3LDHA 4D0SA 1ZK4A 4XCVA 4UUNA 5LCXA 4NR0A 1R4NA 3DBHB 3LF1A 4DUPA 3I9JA 3D64A 2J5RA 2OP0A 5JO0A 4BKOA 2GN8A 1R0KA 4RVFA 4ZHSA 3FPCA 4LGVA 2GASA 1QSGA 3ROKA 1DC4A 4IDAA 3UXYA 3RKRA 1V3TA 3PHGA 2XAAA 2PH5A 1ISGA 1YWGO 4IQ0A 3WYBA 1K89A 2EIHA 5THQA 1E1NA 5DBFA 1IHYA 4OAQA 2DT5A 1SMKA 1YDWA 1QV7A 2AW5A 3DL2A 1LEHA 4BKRA 4NU5A 1YBVA 3K96A 4MIEA 1ISIA 3INGA 2AG5A 2OGUA 1E92A 4L8VA 1BXZA 3G49A 2X9VA 4DREA 4RZHA 3GEMA 1YQDA 4ID9A 3PDJA 1XWFA 3GF4A 1JKFA 5GY7A 4UUPA 4RPJA 3TN7A 3NYWA 2X0IA 3OEYA 4FSHA 2J5KA 1ZNQO 2EG9A 1ZBQA 3S55A 3UF0A 1AXEA 5DNAA 2NLOA 2C07A 4QFCA 4WLOA 4YRBA 2I5PO 2G82A 4Z9XA 5A4DA 2HJRA 1I0ZA 3I52A 3GVHA 4G5HA 1GZ4A 4W9NA 3EYWA 2NU8A 3WXBA 1JKIA 1ADGA 1DHRA 1YOVB 2H9IA 3JQBA 5KVSA 1DRUA 4RGBA 4B7CA 1E77A 1GU7A 4TZKA 1PJCA 4QO8A 5HM8A 3C7AA 2ZQYA 3WLEA 3D0OA 4L75A 1ZH8A 3ZU3A 3IQDB 3PYXA 4GQAA 3PHHA 3ZWNA 1PQWA 2GUGA 4WCFB 3OECA 5JAQA 1VRWA 1RWBA 1CETA 3AU8A 3RI3A 3UFXA 4ZQBA 5KIAA 4E5NA 3RJ9A 1S6YA 3A1NA 3L6EA 1NFQA 1MXHA 1DO8A 2Y67A 4DPLA 5TJHA 1DRVA 1YOVA 5I9MA 5DN9A 2LDXA 3GPIA 1ZMOA 3HHPA 4YPOA 3U4DA 5C7LO 1N8KA 2CD9A 5B4VA 4N54A 1M6HA 3KYDB 4QEDA 3GG2A 3WGTA 3DOOA 2P5UA 1R0LA 2BLLA 4RF4A 1U7TA 2BFOA 3RUIA 3S8MA 5J23A 1Q7CA 4IDFA 4GBJA 2I65A 3GEDA 5JO9A 2ZCUA 1ARZA 1IULA 4MVJF 2DPGA 5F1OA 1QMGA 3U3XA 4CMKA 1BHSA 3B70A 4OIMA 4U0KA 4U8GA 3U62A 1Y8QB 3EAGA 3DFUA 3DZBA 3Q9UA 2Y1OA 1E7YA 5IXYA 3LT1A 4YYZA 2CUKA 3DZJA 4C7KA 2GSDA 4XQEA 1EK5A 4CLEA 1T1SA 3L4BA 1LQTA 2VT3A 4FFMA 5C7OO 1WWKA 2EJWA 3LC1O 3JQ8B 3DZKA 4BNIA 4XR9A 3NX4A 3GY0A 3BTOA 4CQMB 4IJVA 4II2A 6LDHA 2B69A 2BKAA 4CJXA 2UAGA 4B7UA 3NTQA 2I76A 5BNFA 4II3A 2AQIA 2I66A 1MG0A 3W4JA 3WJ7A 1EK6A 1HF3A 4LCEA 2W4QA 4TKLA 4EZBA 3GAZA 4ND5A 4BO6A 1ONNA 4CUKA 5BSGA 3BTUA 1T24A 1P33A 2YFQA 3AOEA 4BO2A 5BSFA 1NQ5A 2C2XA 2JHGA 3R1IA 4E5PA 4D41A 1O6ZA 4EJMA 4B4VA 4OXNA 1MFPA 4J1QA 2HJSA 2P4QA 3SX2A 1PU2A 5GZ1A 4R16A 2P9EA 2DFVA 2B83A 3OJEA 2Z1NA 3IIEA 4LISA 2C54A 3TZHA 4NZ9A 1YBMA 1UDAA 5CHEA 4OSPA 3GH3A 3ICCA 4LMPA 1ZJYA 1NFFA 2POQX 1UAGA 4GMFA 2FY8A 3GK3A 1A27A 1U4SA 4O5OA 3RAJA 4YCAA 3CTMA 1AN9A 1PJ2A 3D1LA 1PZGA 4YQZA 3ZWOA 2A9FA 4K9DA 4C7JA 5ADHA 4CMJA 2UV8A 5TRTA 2HKIA 3VPHA 3SLGA 3PFWO 3WQRA 3G1UA 1ENYA 1GUZA 5TLSA 3KYCB 3E9MA 5A1TA 1IB6A 1NFRA 1NHGA 3R6DA 1KS9A 3RFTA 4MVJA 4W7IA 3FNHA 1GYRA 1LDBA 3ANNA 1FDWA 4MKRA 2IYPA 2OBYA 4UEKA 2ZTVA 2RBEA 3F6YA 3HE3A 1JVSA 5ITVA 4ZJUA 5U1PA 4ALKA 3G0OA 1WMBA 5TC4A 2Y1CA 1JWAB 5ICSA 3E9NA 2CF6A 3ASUA 2PFGA 1QV6A 2PKQO 1QORA 4PLGA 2NU9A 3IL2A 1Z73A 2H63A 5AYVA 1WXDA 1XLTA 3OQ1A 3DC2A 5C37A 1QR6A 4AJ1A 4DTIA 4PLPA 3TZCA 5GZ3A 2I6TA 4BNXA 4DC0A 3JYQA 1X1TA 4M49A 1HZJA 1RM3A 3FTNA 4OJNA 3CXRA 3LSYA 4CLOB 3A06A 3O4RA 2FPPA 2VWPA 3PJDA 3TPCA 3JQEA 2CVZA 3HDQA 4R54A 4O63O 1KVUA 3TWOA 2OORA 1YE3A 3EZYA 1NPDA 3K2EA 4EUFA 5G0VA 3ITDA 1ZZEA 3AK4A 1QYCA 1R15A 3JQ9C 1AHIA 1YB1A 3OHSX 3GG9A 5FI3A 1IL0A 4I1IA 5CDYA 3UVEA 3NDIA 4E2ZA 5L45A 1NQAO 4MP8A 2E4AA 2NQ8A 5KKAA 5JDIA 4RF2A 2J3KA 1LLUA 4NFYA 5L7TA 3GN2A 5JDCC 3UCFA 4E31A 4LCJA 1B2LA 4Q39A 3IMFA 3U4CA 1H9AA 1XDWA 3BHJA 3DONA 2C82A 1RM0A 2XXJA 4WNCA 4NFSA 5BSEA 1ZSVA 1NPTO 1I2BA 1YKFA 3WLFA 2UUOA 1Z82A 2O3SA 2JKVA 1PQUA 3PZRA 4BO5A 4QFDA 5A06A 2BFMA 1RPNA 1IUKA 5L95A 5KKCA 1P1IA 3GDOA 2D5CA 2IODA 2Z1MA 1IE3A 1HLPA 1WW8A 1U3WA 4A5OA 1VPDA 4YQYA 3RBXA 1PL7A 1ONPA 2P91A 1PEDA 3EVNA 3OSUA 3RASA 2PD6A 1B14A 2Q3EA 2YV2A 3CUKA 2HMUA 4J7CA 1XIVA 2FWMX 4GAEA 4WCDA 4KDFA 1XEAA 2Z95A 4U6QA 4G65A 3W8FA 3H5RA 4MOWA 3DZIA 3QW2A 3L4SO 1BVUA 8ADHA 4J1SA 4KZPA 4O59O 2PWZA 3NJ8A 3ORFA 4AG3A 2X9GA 3P5SA 4ALLA 5EL0A 2PGJA 5THKA 1BDBA 1F8FA 4CL3A 4AJEA 3AUSA 3QWHA 2GZ1A 2J5QA 4FDAA 4CQMD 4D43A 2VWHA 4PIVA 3ZWCA 1OI7A 1D8AA 1LC0A 1K2WA 1X7HA 2WD8A 1DIHA 4HKTA 1T4BA 1WPQA 3F5SA 1K0UA 3AFMA 4YAJA 4ZA2A 2GZ2A 2BI8A 1DRWA 4P4LA 4D79A 1PX0A 4F46A 4AJNA 1Z75A 1MFZA 3I6IA 1UP4A 1LDYA 2DBVO 3GNSA 3HNPA 3HZZA 3IC5A 4BO8A 3DWFA 3MWEB 4WASA 2QX7A 4YTEA 4BQRA 5JYEA 3AI3A 5I7FA 4XGNA 2VT2A 2HQ1A 2NV6A 3I3OA 4CLRA 3F9IA 1MP0A 1N1GA 4NQZA 2VHVA 1LQUA 3BHMA 3IUPA 1AE1A 3JQGB 1YONA 3BMQB 5AXAA 3T7EA 3CTVA 1EDOA 4M86A 4E0BA 3DQPA 4Z0TA 3E6AA 1N5DA 4FJ1A 1E6WA 2VNAA 4RVHA 1HT0A 3O9ZA 4TZTA 3X2FA 2DM6A 3CMMA 1WLYA 4CQMA 1VL6A 3LC7O 4Q3EA 1GCOA 3WNQA 3QSGA 4XYGA 3GGOA 5DBIA 5EPOA 1QLJA 4GL4A 1FXSA 4FOSA 4NFHA 1C0PA 4CQLA 4BMVA 4BKPA 3TFOA 5H82A 6ADHA 1FDUA 4M55A 4ROSA 4YA6A 3QP9A 2NADA 2QRJA 5TQVA 5H81A 1C1XA 3AY3A 1QKIA 5JYDA 3OA2A 3D3WA 1UAYA 1YQXA 3ROMA 3WGQA 1E3LA 4ZQEA 3ROQA 4JJGA 3PHJA 1PS0A 2AQHA 1VC2A 2FR1A 5DCYA 1C14A 2FPIA 4R9RA 1O5IA 4JIGA 4TMFA 4E5YA 3WX0A 4KUEA 5G4LA 4J90A 4Z0PA 3ETEA 2O3JA 2BFPA 3G1TA 3KEOA 4WNIA 3JQ9A 1H5QA 4EW6A 2JHFA 4QECA 1Z74A 4ZU3A 2AE1A 3OEWA 4IS3A 4F45A 2X6TA 3GRKA 2B37A 2IXBA 4TSKA 3TZKA 1HDGO 1N92A 3PQFA 3WBFA 2ZATA 4UEJA 4E2YA 4KMSA 1F8GA 1CERA 1DC6A 1D3AA 5L4NA 2D1YA 1OC2A 4JX8A 4E33A 2XXBA 3K6JA 3OQ6A 3IKTA 2ZTLA 4BV9A 4RVDA 2D2IA 1JKJA 1YB4A 4CM3A 4IDGA 4L76A 3FF4A 2QG4A 4Y6SA 3ZV3A 3M2TA 3EC7A 4RZIA 4DIFA 3GZNA 1BMDA 1EQ2A 1H94A 1OOEA 4FFNA 2O7SA 3M1AA 4GLLA 1GPJA 4XX0A 1P1HA 1YB5A 2EW8A 1DC5A 4ZVVA 3R0IA 3TJRA 1HDOA 1BRMA 3DTTA 3JCZA 3GNQA 3OJFA 3QVSA 4CM1A 5BNIA 1SNYA 2OUIA 2ZQZA 2GYYA 2HK8A 3EHEA 2E37A 2GR9A 1DBVO 3D3WB 3ADOA 1NR7A 2ZKLA 4A03A 3BMNB 3RBZA 4QTZA 1Q0QA 3GGGA 3FSRA 4YACA 5HA5A 3GDGA 4DVJA 3ZWVA 1Z7BA 2BGMA 2WD7A 3MJVA 4CMCA 4N18A 1H6AA 4CLRB 3GLQA 3EZLA 2JCYA 1G0NA 4E4YA 5A03A 4GH5A 4J9VA 1JW9B 2CNBA 3PLNA 3VH1A 2D0IA 3ETDA 3MWDB 4BNMA 3O8QB 1B8VA 3IDSA 3WIDA 2Q49A 5I9NA 4IGFA 3CPSA 3TOXA 1JN0A 4D42A 3BTSA 3EW7A 2Y1FA 2PKQP 1GQYA 3FHLA 3GVIA 5BSHA 2G76A 1LSJA 1C3VA 2EP7A 2JD0A 3VPXA 5JY6A 2Y0EA 4Y6PA 2JD1A 3MJSA 5TX7A 2DTEA 1U3TA 4NPCA 1M67A 2PZKA 2Y66A 2ZIZA 3QWAA 4A0SA 1BW9B 2O4CA 1DFIA 2DBZA 4RF3A 1CJCA 5LDGA 1HDCA 5FI5A 4CM8B 4RQTA 4LVCA 3ONFA 4DQUA 3JD3A 4MVJE 2B35A 4W82A 3AUUA 3HDYA 1JTVA 4FFLA 2D3TA 4B8ZA 1E5QA 1P1KA 3F4LA 2BD0A 3AJRA 1MC4A 4NJMA 4P4NA 3I9NA 5KTKA 4PG4A 3GHHA 1XU7A 2O3QA 4WJZA 5CP8A 3ZWPA 3DBLB 3NT2A 4HBGA 3JD0A 5CEJA 3WIEA 4PG7A 2J3JA 2HSDA 2PNFA 1L7EA 1J6UA 5JFOA 4EGFA 2X23A 2YQ4A 4IXWA 4LVUA 1N9GB 2GRAA 1XQ6A 2SCUA 2DQ4A 5JPIA 3ZNQA 1IHXA 1MG5A 1XELA 5BT9A 3F5QA 3NRCA 2WE7A 2OFPA 1LRJA 3JQFA 4MINA 3VKVA 2D8AA 1P9LA 2BRUA 4JNKA 2Y1EA 3GOHA 5IJZA 4ZICA 3WBBA 1LDMA 1T4DA 1SO8A 2VUUA 3GRPA 1F0YA 1NPYA 1ZJZA 4U7WA 1HSOA 1NQOA 3JYNA 3RSHA 3ZWWA 5FWNA 4DLAA 4YAIA 3MTGA 1XSEA 2J6IA 3Q3CA 4DYVA 5JDCA 1ZEMA 5KCZA 3WB9A 2AQ8A 4OSOA 1R4NB 3DBHA 3OIDA 1BXGB 2GPTA 1Y5MA 3HB5X 5DULA 4WEOA 3QWFA 4I9HA 1ADBA 1Y8QA 3ON5A 5G0UA 3GEGA 4CV0A 2A4KA 4JJIA 4EEXA 4MO2A 3PQDA 3UKOA 4IS2A 3EK2A 4CMGA 1TVEA 2X0NA 4PZDA 3L6OO 3IJRA 1W4ZA 4FJ0A 1TXGA 3QVTA 2FN7A 4RV9A 4DWVA 3BMNA 5JC8A 3Q1LA 3D5TA 3S2IA 3HDHA 4H15A 1PGQA 4E30A 4YAEA 4KUHA 1T1RA 3NAQA 4YJFB 2WDZA 3WDSA 1P45A 1P0FA 4EEZA 3E9QA 2XF8A 4IIUA 5A9SA 1O95A 5FF9A 4XJSA 1OBFO 2JJYA 1I3MA 5IDWA 1ZK1A 3WJAA 2GN6A 5IG2A 1RJWA 1PWXA 3S2FA 5IDXA 4R3WA 1JVBA 3K30A 5L51A 2C7VA 3UAGA 1U1IA 3WTCA 3U49A 1I10A 4TRRA 3F3SA 4YT5A 3ZHYA 5KJ1A 3JYLA 1DPGA 1DIGA 1J4AA 1SB9A 2GD1O 3B20A 5HS6A 5DOZA 4UVGA 1A72A 3K9QO 4YDRA 3W8EA 1R66A 1SB8A 3I4CA 3W6ZA 2NWQA 4K26A 4NBWA 4N5NA 3R3SA 1NXQA 1PS9A 1TI7A 1A9ZA 2B5WA 3H9QA 3KLMX 4WOKA 3D4OA 5IDYA 5KJFA 5CPBA 1GPDG 3AM4A 1I01A 1DIRA 4CM7A 4OM8A 1ML3A 4LW8A 3UCEA 1KY5A 1KC1A 2IEBA 4TVBA 4XJTA 5F21A 1NASA 4UEOA 1N1EA 2PD4A 4URFA 5A04A 4BVAA 1E3EA 2C59A 2AEFA 3FBGA 3GAFA 3PJGA 1F14A 3PGXA 2Q50A 3VH4A 3JQ6A 4WCFA 4DC1A 1E7SA 1KBZA 1P3DA 1PJ4A 4YAKA 1QYVA 3SJ7A 4DBZA 4U0JA 2FZEA 3VH2A 3ITKA 1DAOA 3QE3A 3ZWYA 1AHHA 1E7QA 2AHRA 2AEJA 5B4UA 3KO8A 1VLLA 1LBEA 2YDXA 4CR7A 1I3NA 1B8UA 4FOOA 4DRYA 5TSDA 3LT0A 4FW8A 1PJQA 3VC7A 1UJMA 3PK0A 5EMHA 1YDEA 3C8MA 3LU1A 4PLWA 2EKPA 3WTBA 4E5MA 3OICA 4Q3CA 3ZW9A 3FN4A 4XIJA 4RPHA 1NVGA 1OC4A 3VHRA 4C4OA 3OF2A 3AY6A 1M76A 1KERA 2DU8A 1K6JA 1U2GA 3PXXA 1S7CA 1EUCA 1ISFA 4GSKA 1P74A 5CG1A 1BXGA 1MXFA 4QX6A 5T5QA 1IPFA 3LF2A 3V5NA 5DBGA 2A92A 2Y1DA 4ZQGA 2BFAA 2GLXA 3DHYA 3I1JA 2AG8A 4B4UA 4CMEC 4F6LA 1H6DA 4KUGA 2GCGA 3N74A 3BTVA 1QYXA 2YQ5A 5DCUA 2PGLA 3P2OA 2FR0A 1GTMA 2X0JA 4MVJD 5JAZA 4DLLA 1J5PA 3ABIA 3SLKA 9LDBA 1B7GO 1PS8A 4NHEA 2OZPA 4OO3A 3E8XA 3M2PA 4XR4A 3ZU4A 4RJTA 1DFGA 3TNLA 3V1UA 3SJUA 3P2YA 1U2DA 2X7HA 3D3EA 4YT8A 2Q4EA 3AOGA 3PHLA 3HFSA 5ENDA 7ADHA 4BO7A 3FI9A 4ND3A 2G1UA 3BXXA 2P9CA 2IDZA 3H6KA 4H3VA 1EZ4A 1Q7GA 2AQKA 4WPGA 3ZV5A 5AXBA 3E82A 2Y05A 3WWYA 2Q2VA 4GX1A 2ZK7A 4OMUA 1F17A 2VHYA 3DOJA 3AFNA 1LX6A 3AI2A 3PIDA 4PVDA 1HETA 2C5AA 1CQIA 4I8XA 2R6JA 3QVWA 4CLXA 4HFRA 4FR5A 1PR3A 4P38A 1HKUA 3W8DA 4QO7A 3KB6A 1Y5RA 1YL5A 1HTBA 5CAEA 1H9BA 4YAGA 4LN1A 1W0CA 3L0DA 2Y68A 4FIZA 2HO5A 4JBIA 1EFLA 4PG6A 3TDKA 1SCUA 1N7HA 3BMOA 4CM4B 3WICA 5K6AA 2Z5LA 3RJ5A 2RAFA 3ONEA 3I9KA 1D7OA 4BNJA 1P0CA 2ZTUA 2FRDA 3ZWAA 2V6MA 1GY8A 1ZCJA 4JXKA 2YV1A 5K0ZA 2PGDA 1D1TA 3KYCA 1L1FA 1Y8RB 2VUSA 1ZW1A 3H4VA 5I8ZA 3WSVA 3V1TC 4YXFA 5IAAA 2EERA 4B3JA 2HUNA 1W8DA 3VTFA 1ENOA 3RUHA 4ALNA 4ZN6A 4N5MA 4XD2A 4FJ2A 5G4KB 2VOJA 3H7AA 3G79A 5TGDA 1YJQA 3UICA 3CMCO 3WFJA 2QRKA 1SOVA 4BNUA 1DC3A 2W98A 4YR9A 3SC6A 2WYUA 1BG6A 2RH4A 3WFIA 4R69A 4L73A 4AVYA 3WS7A 1UP7A 1PGPA 3ZDFA 4P8RA 1HXHA 3DXFA 2Q1WA 5A9RA 3Q2KA 4RVSA 4UULA 3TF5A 1NVTA 2NU7A 4XQCA 3RFVA 1QP8A 1RM5A 4E21A 4BNFA 3NUGA 2Q4BA 4UUMA 3HSKA 3Q11A 5A9SB 4CV1A 1HE2A 4GVLA 2X9NA 4FC6A 1FF9A 3WWZA 2PK3A 2X5JO 5KJCA 1C0IA 4IZHA 5AXCA 1PJ3A 4EITA 3X2EA 1M75A 2OP1A 3FNGA 4GGOA 1EE9A 3GC6A 3EVTA 3PJEA 4JP3A 4DPKA 4PN3A 3DTYA 2YDYA 1XGKA 2JAPA 4R1SA 4Y67A 1M2WA 1LI4A 2DAPA 2RIRA 3WOHA 1UDBA 3WR5A 2W2KA 3ICPA 4RVGA 3IP3A 4HFNA 4CMIA 5EERA 4NIMA 2VZ8A 3VOSA 4WGGA 4OQYA 2VN8A 2YW9A 4WLFA 3WYCA 2C20A 2EGGA 1V9LA 3NKLA 4OH1A 3KM0A 2DBRA 4ZQFA 1MGOA 2O50A 4ZRNA 1WDLA 4PFJA 3RIHA 4BO9A 3COSA 3TSCA 3ONDA 3ZZNA 3ANLA 1Q0HA 3HJAA 2Q2WA 1WDKA 1HDXA 2OMEA 1CEQA 4M89A 2R00C 3DEYX 5AVOA 4JGBA 3WGZA 1E5LA 2EWMA 3HN7A 1KEWA 1C1DB 2O48X 1QYDA 1UH5A 3CZRA 5IN4A 1I2ZA 3H3JA 5CDTA 4FGWA 3ULKA 1ZMTA 2PA3A 1KEUA 4UVDA 4JQCA 1VKOA 3OH8A 4YJHB 2IZZA 3KYDA 2ZYGA 3DR3A 4J2HA 4Y98A 3VZRA 2BMAA 4PGFA 1LSOA 1U8XX 1DJQA 4WLVA 4MVJI 2HU2A 1YGYA 4NK5A 1TT5A 3BHIA 3KOUA 5JAMA 1K6XA 2QRLA 1DHTA 2F00A 1X14A 1HZZA 3WGGA 4OHUA 1U28A 1XKQA 3ENNA 3DOCA 3OP4A 3HQ4O 1PTJA 2VWGA 4AICA 2PV7A 3IP1A 3INTA 4NBTA 4ALIA 1E7RA 5JS6A 2V6FA 3KUXA 1WNTA 4IZIA 1P77A 1T2AA 4CMIB 1BSVA 4Q3DA 4K6CA 4M54A 1I30A 4Z3KA 1E1LA 1UP6A 2DTXA 4AJJA 4E12A 1HEUA 3O03A 1PWZA 3MJTA 1A4IA 3PVZA 5FFFA 1E3WB 3QV1A 1CQJA 2ZJ0A 1NM5A 2Y0CA 4XZ3A 1P1JA 4WLNA 1KVSA 1A4UA 3ZN2A 4J0EA 1G6KA 4NBUA 3ZWXA 1P1FA 2EHDA 4A2CA 5B4TA 4KTVE 2B5VA 1ULUA 3U9LA 2VCYA 5IDQA 1UUFA 1NTOA 3W1VA 4YT2A 2X22A 2UVDA 4TWRA 4R4JA 2ET6A 1E6UA 4ONEA 4J43A 4FGSA 5JCXA 1GAEO 2NVBA 4I08A 4PLYA 1NNUA 5G0TA 3WSWA 1BXKA 1YL6A 4ITUA 1F12A 4TROA 1Q0LA 2XOXA 1U9JA 3BIOA 4CMBA 3UW3A 2QW8A 4GX0A 1B3BA 1TT5B 2AXQA 2VRCD 3GVCA 5EESA 1PR9A 1V6AA 1ENZA 1V3UA 3ETGA 2QYTA 4PG5A 1IOLA 1G0OA 3GUYA 4IDBA 4XGKA 1H93A 1CWUA 4XQGA 3NGLA 1Y81A 5IZCC 2WYVA 3K8ZA 3DAGA 3PP8A 3BYZA 4ZQHA 4J16A 4BB6A 4OKIA 4XDYA 4D3FA 3KBOA 4D7AA 3G3EA 3UH1A 4DL9A 2IRWA 4WUVA 3KETA 4RVUA 3RUEA 4E13A 4YBZA 2I9PA 1LDEA 2WM3A 3AM5A 2J8ZA 5EIOA 1VL0A 4BNTA 3JTMA 4KTTE 3KV3O 3H2SA 5B37A 2VNSA 4HXYA 4TRNA 3QVOA 4RLSA 1I8TA 1ZK3A 3BAZA 4GVXA 5AQ1A 1K6IA 4NDNE 5A02A 1HDZA 4J4BA 1DIBA 1M66A 3LLSA 4PLVA 3KVOA 2O4UX 3CINA 4HNGA 3JQCA 1PJSA 3IUSA 1U4OA 4UAGA 3NTOA 3KEQA 4FPXA 4AJHA 1WMAA 2FZWA 3TZQA 3FNEA 3N7UA 2HAEA 4XYEA 1PQPA 1DSSG 5IZ4A 3HDJA 2GDZA 1UZLA 2PKRA 3RD5A 4JCOA 2FHSA 3DMTA 4QXMA 5A5FA 1OFGA 1VSUA 2Q46A 2B4QA 3TFQA 1HE4A 4CM4A 1EUDA 3A4VA 3SVTA 4B4WA 1XCBA 4LMRA 4I5EA 5CDUA 1T26A 4INAA 5K6AC 2HMWA 2VYND 5IF3A 4ZRMA 4UVHA 3PJFA 4BOYA 4A26A 3WGOA 1ZSNA 1J49A 4CPDA 3QIVA 1ISMA 1ZXLA 4WOJA 5IFLA 5G4KA 5GZ6A 1ZIDA 5ES3A 5TNXA 4B7XA 4DXHA 3H9JA 1H2BA 3QVXA 4OGWA 3ROPA 1QXSA 1FJHA 3DZGA 1ZFNA 1LSSA 3KHUA 4E2WA 5TJ9A 2ZTMA 2ZCVA 4XYLA 1PL6A 1SEPA 5HWSA 1UXKA 2EEZA 4HFMA 5TIIA 2PH3A 3ZU5A 3TL2A 1YRLA 4I5GA 1XHLA 4RDIA 5L40A 4CMHA 1A71A 4FQ8A 1X15A 3VPSA 3UCXA 3F46A 4R5MA 4FFRA 5I8WA 5A9TA 1SPXA 1VJ1A 1LLDA 2UDPA 2O3UA 1I24A 5JSFA 5MDHA 4NBVA 3T4XA 1KEVA 2EKQA 3H5AA 4CV2A 1EVYA 2H5LA 3HWRA 3OBBA 3TL3A 7MDHA 3O8QA 1NVMB 5CEFA 3AWDA 4KOAA 3GPDG 2VQ3A 2VYNA 2AEMA 1GEEA 4LSMA 4PLCA 1XU9A 3EUWA 2CDCA 3PPIA 1RYDA 3E1KA 1LUAA 1NR1A 1ZEJA 5H83A 3ZI0A 2IZ0A 5I9LA 1O9BA 4E32A 3BMCB 3NDRA 2O2SA 4K6FA 1X7GA 1Y1PA 3FBTA 2CF5A 1I2CA 4W9NC 1KOLA 4IPTA 4DQVA 4IM7A 3IS3A 4YRAA 1WZIA 2ZYAA 1GD1O 3GT0A 1U5CA 4JBGA 1IPEA 3K92A 1Y9EA 4O0LA 3D5QA 5T57A 4CM8A 2PLAA 5DDIP 1CF2O 5JCJA 3JQDA 3QLJA 3ZNOA 1EMDA 2CDBA 1UZMA 1EVIA 3K2BA 4OXKA 1BWSA 3DB2A 3AY7A 2C29D 2X4GA 4YJGA 3KTDA 2NVWA 3I4FA 5T6BA 2E48A 3GVXA 3DBLA 3MZ0A 3E03A 4WE3A 1PJTA 3Q9NA 4CL8A 3VAZA 4CR6A 1TEHA 1DJNA 3PWZA 4PVCA 3SXPA 4D45A 1RM4A 1X13A 4RPGA 4BNYA 1FDSA 3WQSB 2I67A 4NU6A 4CMEA 1ONOA 4HFJA 5COBA 2HRZA 4MP3A 1IYZA 3FR8A 2DLDA 4MKZA 3GZ4A 4MPDA 3NDJA 2YFHA 4Q3NA 3L77A 4NG5A 5ENVA 5KVQA 2C0CA 1H6BA 2E49A 2AA3A 2DFDA 3QHAA 2HRBA 4EI2A 4J3FA 4NK4A 4R51A 2OHXA 4P4GA 3GQVA 3ZCXA 2FPGA 2R00A 1UXHA 1PJBA 1YBAA 1ORRA 1ZVMA 2AMFA 2DUUA 2IZ1A 3FR7A 4G81A 5A3VA 3U09A 3PHIA 2B4TO 4DIBA 2G0TA 2E82A 2ZJ1A 3HB4X 1FMCA 1P1RA 2EGHA 2PD3A 4HNHA 1E7WA 1GYQA 5G0SA 5JCJD 1A7AA 4BHTA 1PSDA 4TQGA 3GZNB 3V2GA 5JNLA 4IQGA 1G1AA 2NVUA 4Q9NA 3KXDA 3M1LA 5DP2A 1GADO 2A94A 4BGIA 2DKNA 3GVPA 1BVRA 4TKMA 4AJOA 4O6VA 4A27A 1Z6ZA 4BNKA 3AU9A 3LT2A 1E3SA 2FMUA 4HADA 3KZVA 3ZHXA 2O3TA 4N7RA 2HMTA 1RKXA 3OIFA 4XA8A 5TF4A 1UDCA 1ISJA 3VPFA 1EEHA 1TA4A 3DO5A 1DAPA 4BNVA 2CMDA 1KIFA 2VHZA 2X8LA 4DLBA 5HS4A 4S3MA 4UVIA 1R16A 3UOGA 1Y8RA 2V6GA 1X1EA 4MVJG 3PFFA 5CDGA 2IYOA 1U3UA 1ZUD1 2OOSA 4ESOA 3MJEA 1VM6A 3WQQA 4F6CA 1GFSA 4BO1A 1JAXA 4QT0A 3W4IA 2EJVA 3ZWMA 1IZ9A 2NTJA 2GZ3A 1X0VA 3MJCA 5DF1A 2D4AA 3I6QA 3FD8A 5JE8A 3QWIA 4BGVA 4AJKA 4D0RA 3C7CB 1HDYA 3MOIA 5BQFA 3QA9A 4IJKA 4PLZA 3TZ6A 4TRMA 4U5QA 5C5IA 2BI7A 3H65A 1UXGA 3RC1A 4WK6A 3H8VA 5L4SA 2YZ7A 1ENPA 2DUWA 2J3HA 3OA0A 5I7VA 1LXCA 1VI2A 1Q1NA 1SC6A 3Q6IA 1B15A 2YV3A 4RO0A 5L3ZA 4DA9A 3I9MA 3PYLA 5LDHA 3PGJA 2DTDA 4MP6A 3JD4A 1ZXBA 5LC1A 3DBRA 4Z3DA 3VPGA 4J9UE 3WMXA 1MX3A 2C2YA 1LU9A 5ILOA 5HTOA 3H9EO 2PTGA 4H7PA 2NM0A 4D44A 1R12A 1F06A 4DGSA 5JAIA 4YT4A 1T2DA 1I33A 4GMGA 4HV4A 2EKLA 1A5ZA 5JDIC 4IJUA 4DYDA 2UUPA 4D46A 1HYEA 1OZAA 4BUCA
chains in the Genus database with same CATH superfamily
1W5AA 5D5PA 2YVKA 1Z7EA 3EQ2A 2GKGA 1R8JA 3KFXA 2GEDA 1XMXA 4OHKA 4RX1A 4UU1A 4HS4A 2PRYA 4ZTBA 4FX2A 3ZDXB 4MW9A 1T8YA 4TYPA 5AVSA 4UHJA 3QE0A 4CQLB 3FSGA 4PFQA 1B0AA 4BL5A 2AOXA 4E3ZA 1H2AS 2JW5A 2QYSA 2H92A 4IMPA 4MQBA 3R9XA 3AERB 4M7WA 4WHMA 4X90A 4LSWA 5FR2A 1R3DA 2F62A 3O93A 5HIKA 5KOJA 3T7RA 3G7UA 1GQ2A 3VPAA 3VH3A 2P6PA 5KWEA 4GMKA 1KC3A 3DFZA 4RK6A 4EYEA 3T99A 1Y0BA 1HPLA 4NI5A 1V7PC 4XD7D 2INGX 4IIJB 4IFBA 4Q9JA 2IA5A 5KNDD 3RC2A 5I6DA 4RSRA 2DPHA 1CZOA 4B3SB 5I5EA 2QORA 5IANA 4KZKA 1FYWA 3WRXC 2QX8A 3ZD9A 1EFKA 1NBOA 4MUJA 2NZYA 3FFWA 4KAJA 4RAQA 2W6ID 3RTAA 4LXQA 1SD2A 2NU6B 2XX3A 1VJRA 2CEKA 3FDZB 5CJ2A 3DEFA 2I4RA 3HFGA 5DWVA 5L3VA 4EARA 4D25A 1KI2A 2X13A 2KI5A 2H52A 4RZXA 2XQIA 2PZJA 3EMKA 3D6UA 2OBBA 4P9NA 4TVSA 2K7ZA 5BR8B 4JXXA 1N32B 1K92A 2GBIA 4S2UA 3U7QA 2YIVX 2Y3IA 5FPPA 2QIPA 2LBPA 3ROXA 1J5XA 1I7DA 1D4FA 1LLCA 2W90A 3DYVA 3PT9A 4D99A 2DQZA 4ZGWA 5CFZA 1JILA 4EG0A 4GM0A 2V45A 3ZE9A 1XJ0A 2OOKA 3TIIA 4K28A 3W7AA 4TTVA 3Q8KA 5JMWA 2OO5A 1A9XB 3IVGA 2XQJA 4PWZA 4LQDA 1Q2XA 3O6VA 2XZDA 1HEYA 3NALA 1EE2A 2B4RO 2IIBA 3QKSA 4FC7A 4H16A 2MMCA 3EBLA 3OMLA 2PU5A 3C7KA 4OQXA 2XVXA 4DARA 2A88A 2GSWA 5EQDA 1EBFA 2A59A 2P4HX 3E7WA 3VJKA 4ALJA 2BGNA 4CCSA 4BO0A 4XSHA 4LXHA 3Q8MA 3EG9B 2GNPA 1KK3A 1HY3A 1CS0A 1U94A 1LBTA 1GILA 2NTVA 3BMCA 3M9LA 4EJSB 3AETB 4AULA 2QROA 3KU4A 4C5CA 3CVWA 4ZXPA 2IYNA 2HK7A 2VYCA 4KPFC 2QV0A 3C6KA 4J49A 4DUGD 1DUVG 4UZEA 5T3UA 4B8ZA 4DMKA 1R0SA 5I7RA 1FSGA 2XYQA 5EG5A 1WQ3A 1MZPA 2KM1A 4HDNB 5B1DA 2B21A 2CXUA 5HBRA 4B3IA 3U0VA 2GWRA 3NJRA 1M33A 2I54A 1M34E 3F8TA 4TSFA 1YACA 1XA0A 3IP7A 4JVNA 1CTQA 2WPDD 1RIIA 3Q7EA 2QMYA 2VNIA 3G2KA 4CYMA 4ZCTA 2OENG 3ZS8A 3OQNA 4FFDA 1J42A 4G1UC 1H2RS 4R41A 5FTWA 3LP6A 4YV7A 2GERA 1RJDA 1NWHA 4HVTA 3VTAA 3ZHRA 1BE6A 1W73A 1ZKMA 1MJNA 3ANTA 3KQOA 3N8HA 4KKXB 2YUTA 5DBHX 2DH6A 3QIAA 3C3YA 1P7YA 4N3AA 1K7EB 1KO8A 3MRSA 3SQXA 1ODLA 2E55A 4GZ6A 3U7FB 3EG9A 1R0XA 4CIYA 3LT5A 4DBVO 4EMSA 4OREX 5B7PA 3GMTA 2C4VA 4TL8A 1AKTA 3EIXA 3CSSA 5H02A 5IXSA 1OFCX 1G19A 2CJWA 3TQIA 2HZBA 1QU2A 1YRHA 2FP4A 2Z2XA 3PDCA 2IJGX 2WZQA 4LJ4A 1E3QA 1E9FA 3LQKA 3ZHOA 5K6RA 1L8LA 1ZO8A 2C4HA 2C88A 1NP7A 3Q7QA 4J0CA 4NCJA 5EE9A 3WAJA 1O89A 4W7HA 1WA5A 4I5FA 4UM7A 3OCYA 4B1FA 5HNKA 1JVNA 3P19A 4IQ4A 4BNZA 2QMEA 2J5BA 3NANA 2B0CA 2DLCX 1P5JA 2WYWA 3EVDA 4KKVA 2OXTA 4WESB 3A27A 3HJCA 4OHZA 1LNQA 2FR8A 1E0AA 4HEQA 4A10A 3C3XA 1JSCA 1XTUA 2R4QA 3F1KA 3I4LA 3NEPX 5F1PA 2WNIA 3CZMA 1OBHA 3HM2A 3HLTA 4GVPA 2HDHA 1FNCA 1ZQ1A 3B36A 3NG1A 3OJLA 1LW7A 3HU1A 4FFPA 4GC9A 4QYTA 3FGZA 5AP9A 5HUHA 1M6YA 1J0XO 3HVJA 4B2IA 5CLIA 4EQ6B 2W4MA 4V0MA 3LHIA 3JQFC 2Y99A 2F8SA 3PENA 2QRZA 1FCJA 2J45A 2OB2A 1Z07A 3OIGA 2F1IA 3FPFA 4I5DA 2VDQB 2JLXA 5BT8A 5BWBA 4J29A 1US8A 3D3NA 4RKYA 1VE1A 3RSFA 1XNHA 4AJIA 4BNHA 1I1HA 4OU5A 5EP4A 5AIBA 4CLHA 1RTKA 1W581 1DTWA 2GH1A 4DMMA 2UZ4A 3PQ3A 4DJFC 2ILTA 4NAUA 3RVJA 1UM9B 2CN1A 4RF5A 5J5AA 4HDCA 5SYAA 4BGEA 1WKCA 2WHQA 3GR6A 4ARIA 1SAYA 3TQSA 4AJPA 1KPHA 2PUHA 4GEKA 5CVDA 4UHBA 2VDMB 1L4EA 1VIAA 1WXEA 4JI6B 1CT9A 4UQPA 3EGVA 1ACMA 1MAAA 2FLWA 4DMCA 2PXCA 4ZAWA 3ZWWA 3KTOA 4DCVA 1KI6B 1SUSA 4NENA 1TAQA 2DE0X 1NJ2A 4TTQA 4IYRA 4G84A 4OOEA 4DR3B 2GF0A 4KXVA 4HDMA 3IKVA 1AT1A 1KPGA 3H3FA 3B6IA 4IO0A 1RBYA 4Q05A 4YPFA 2Y0DA 1ZH6A 4JKOA 4JYMA 3HG7A 4YRRA 1XZDA 5D87A 4MDHA 1FL9A 1N7IA 1OVMA 5G53C 5DLDA 1MC5A 3ZU6A 3REQB 1S2IA 2BHLA 3ZJUA 3FNFA 3LD9A 4NOJA 3VVCA 2C5EA 3TJZA 4U2CA 4BYGA 1DBQA 4QAQA 3RBVA 1M9NA 2Z5VA 2VLBA 2VRCA 3BEDA 3GP5A 3H9UA 4I50F 4AF8A 3ORRA 1OXVA 3OUZA 2ZRCA 2Y2UA 3FMPB 4RK1A 4X54A 3WG9A 3GLFB 4I3FA 3BZUA 1ZKDA 2XUGA 5IJ0B 2CV0A 2COUA 2QN6A 3QELA 4LY9A 1NMZA 2YYYA 2QTMA 3NNNA 2X2OA 3VZSA 4M98A 4OM7A 4C05A 1G7CA 4J0GA 1R0ZA 3LPNA 3CV3A 3MRVA 3WNCA 4I55B 3I6MA 3EDMA 1PFGA 4X7RA 2AK2A 3UA4A 5AW4A 3VGPA 1JSRA 2IW3A 3ONWA 1JB9A 1GV1A 4G1BA 1PFQA 2PS9A 3B1YA 3T7SA 1MQ9A 1R5BA 3GEEA 3B1KA 3STUA 2ZWAA 3C98A 3M82A 4ZAVA 1SCUB 4ASUA 1G7SA 3D4PA 3E7FA 4NV3A 2C9CA 4JLWA 5T64A 4ZZ0A 4Y18A 4W5NA 4D98A 3FFBA 1WDTA 4LYJA 1YC5A 1NXWA 4GQBA 4Y7CA 3A14A 2AB0A 2OBLA 3B9BA 3IAHA 5CX1B 4AYXA 5IYZB 2B20A 2PL5A 4GM4A 1BCRA 3BWBA 2PG3A 3FZEA 4GUDA 5AOCA 1VKNA 4DC9A 4EDHA 2GRJA 2F2TA 2X3FA 3SYRA 1A4XA 2G4VA 5L53A 2YN4A 3EH1A 3AESA 4HAIA 1D6NA 1ADJA 2ATVA 1X38A 2G1JA 3GH1A 3QJYA 4J0JA 1HV8A 4LBWA 5DI3B 4BO4A 1WPXA 3RUCA 2VHXA 2F8TA 5DCLA 1FP4A 1NVVR 1O97D 1WSWA 4HX5A 1Q11A 1W1WA 1IN6A 1Y3HA 4QSMA 5JFGA 3ISTA 5E4JA 1EKXA 2OAEA 3DBRB 4RL4A 2JLZA 4BPRA 4GWGA 4AYWA 4G0PA 4JENA 3RAPR 1H0KA 4DPMA 5DSZA 1T5SA 4ILEA 1ZOOA 4DIOA 3HJGA 4RQUA 1U7HA 1Z68A 2B7LA 2GHRA 4LVNA 3RUFA 3T7CA 4L02A 3I5XA 4DUYB 3UTCA 3BSYA 3AL3A 3N75A 3SZUA 4ZHQA 2O7RA 4GGPA 1M2NA 1QFMA 3F47A 3WYEA 4KCGA 4KPEC 4FI3C 3TLMA 2B2XA 2Z6AA 4QNMA 3DLCA 1AV6A 3VJLA 5ICMA 4L0QA 3W5IA 1O0BA 5EEGA 1T9DA 4RACA 5AKLA 5JXIA 4WX2B 4J7AA 1YR7A 4BVBA 3OWOA 4YUXA 3TOSA 1EB9A 4Z53A 3CX7A 4KQWA 5MFZA 1YAJA 2O3RA 4HH3C 1VJ0A 2PVPA 1X8JA 1NW9B 1HL3A 5CT8A 3ETHA 4AZ3A 3DBVO 3DMNA 4GFDA 2W2KB 2V3CC 3O8BA 4GKJB 4RPLA 4OQFA 1VCIA 3VDQA 1UT6A 4ECAA 5IZCA 2PSJA 3G2IA 1M8PA 3ETCA 2FFQA 4BE4A 1E2MA 4DF3A 1CRLA 4IJQA 1D2NA 1L7DA 3N87A 4RIFA 1X39A 1PNOA 3V2IA 4L4UA 4QYIA 1NG1A 1JJBA 1NP6A 2FEOA 2GKSA 2J3IA 4A8JC 2HXYA 3U4IA 1JQAA 1FPQA 3EY4A 4KGZA 3ONVA 3EWAA 2WMDA 3TX2A 5CPFA 1QUFA 2PRSA 5GMOA 3SKYA 5KNBD 2ZSJA 1IK4A 1FQKA 2ZZKA 4QM6A 4CUZA 4ZAFA 5FUBA 1XZCA 1JTFA 2ZVDA 5AIAA 4MDFA 4R2JA 3EDRA 3FPLA 3LW8A 5IEJA 3URMA 1ISSA 4UMEA 1E79A 5KYWA 2CSUA 3HCBA 2D1SA 2FX3A 4QG7A 1GPH1 4D4HA 3A04A 3L9WA 2O8FA 1SFRA 1OMOA 1EFHA 1TC1A 1QUEA 3L79A 1GGVA 2ZBUA 4J3JA 1FNBA 621PA 2X5KO 2HREA 3L7BA 1GG9A 2YY7A 2PMKA 4RJ2A 4CW7A 3OIVA 4AO8A 3TQHA 4J0FA 4MCIA 4IHJA 1SHLA 5DCWA 2V9PA 3LZDA 4IHQA 3VR5D 4HYEA 3VKHA 4XXHA 1I5EA 1V9SA 4B35A 4RY2A 4KIFA 3WYAA 4HO1X 1IN5A 2RHCA 4Y6RA 3UAWA 2H85A 1PNVA 4UUQA 5LU8A 2IQIA 3AVUA 5TV2A 3HCWA 4PLFA 4IOKA 4MYCA 5GOTA 1D2EA 2NO6A 3OZXA 3S44A 3L8DA 3CCBA 1C9YA 3LC2O 1SQSA 2VDWA 4UUAA 1QDUA 2QX4A 3B5JA 1PBNA 4Q7EA 4TXMA 4YRIA 4K6HA 4LK2A 2O8EB 3TOZA 3BF8A 2CDNA 2GK6A 1EHYA 2YUIA 3PWKA 4R2MA 3V33A 2R7KA 4UPDA 5NULA 4ZHQF 4IJWA 4P2GA 3RUAA 4OQLA 2W6JD 1IQ0A 4OG2A 3WGHA 3FRIA 4RCVA 2LCIA 5EUBA 1ZD2P 2XOKD 2JI4A 5G41A 2YYZA 1CEXA 4P08A 2ZXUA 4RSGA 4BQOA 5KPDA 5F73A 2EAUA 1K3TA 4G41A 1XLTC 3T8YA 4JP2A 1J24A 4MS1B 3D4NA 5BXYA 2QE7D 4URXR 1DQYA 3EZ7A 4OHCA 4CM9D 3QEBZ 2QUZA 2JD2A 5LKAA 4RTRA 5KJEA 2BM1A 2ZGVA 4EI7A 4MVJH 1ICEA 1U0TA 4GQIA 1I4EB 3AH8A 1TKCA 1N2XA 2DGDA 4OJTA 3ZV4A 4CM5A 4XRRA 3V7WA 2VO1A 1E2GA 5EA2A 3GA0A 4BS9A 2PJZA 1U6IA 1Y9DA 2X4DA 3H13A 3UEOA 5ADWA 1K7YA 4OFZA 3EFBA 2X58A 1IJEA 3HR7A 3LA6A 5JMTA 4CLOA 1TE2A 2QZZA 5FBZA 1F8XA 4YMUA 4QJ4A 4YJHA 2HIAA 2WWXA 3C3JA 4QEZA 5EPUA 4IHJB 2QUHA 1X77A 5T4BA 4BIIA 3ZDBA 5FBVB 1HE1C 5JBQA 5DGHA 2C8LA 1K98A 3RVDA 4BRSA 1M2HA 2EL9A 4NBLA 1T2VA 2FHPA 3N8DA 5FYDA 5CXQA 3BVPA 2NZ8A 2JGRA 5K20A 1Z88A 1YH3A 5J2TA 4HJXA 1N6OA 1BE1A 4LDNA 4M3NA 2X40A 4D8YA 4MAAA 2PKWA 1Q21A 4ODIA 1MENA 1MX1A 1V8OA 2OV2A 4J94A 1L0BA 3OZBA 3CU5A 3MWKA 3KWJA 3T94A 1I7NA 2Q41A 2JHAA 4FTWA 4AURA 1PO7A 4YC7A 1ZINA 3GNTA 4Z9FA 4D8XA 2X5OA 2NNLD 1Q7BA 3R3WA 3ZV6A 4A1OA 3SC2A 5F9HA 4FMDB 2F6RA 3U31A 2I2CA 3EE6A 4A0GA 1J2EA 4GPD1 1YT5A 2YIMA 2P5YA 2H4JA 3EUAA 4Z7OB 4FEYA 1T3GA 2GNAA 4HAUA 1AS3A 2W6CX 4C30A 5EIBC 5IN5A 4ARSA 4DWOA 4HAOA 5JH7B 4ZRDA 4BEWA 1OLXB 4XVCA 1USKA 1GUYA 1GUFA 4OKNA 4QE3A 2WJGA 1C4XA 1TF5A 1O58A 2B1RA 2NTNA 2ZU6A 1TU3A 5JFTA 3UT0A 2B4AA 4GU5A 2JB9A 3KZNA 3G17A 5EZYA 4U2EA 2QVLA 1CCWA 3GDFA 1PL8A 1UIMA 2ZREA 4EGSA 1JL3A 4HUTA 2BC9A 1XMSA 3KLNA 3PS9A 2HRRA 2ZUVA 3GJRA 3H9CA 2YNMD 1SC9A 1ZLYA 2W43A 4NHOA 4X84A 4RULA 5J4LA 3PICA 4HGQA 5DTEA 2QLLA 5KQRA 2QSJA 3EF1A 3SCZA 1HRDA 2ZB4A 4XVUA 3CO0S 2ZYDA 4IJ5A 4UTOA 3U0BA 3FOWA 1DBWA 1RBZA 1IQRA 4AU1A 1GZUA 1JHAA 1ZRNA 3EQ9A 2QK4A 3OLQA 2FZKA 1X2EA 1AS2A 4ZD6A 5DZSA 2UZ1B 3SHFA 3O1IC 5HCUA 2RFLA 4CKWB 3OIYA 3TMYA 1NI4B 3M6IA 2AXEA 4Z3OA 1T0BA 2JGNA 1Z6XA 1XZJA 4WZAE 1YJ8A 3OFJA 3STYA 1QPZA 1KKLA 4V0OA 3ZCPA 3PSHA 3QKSB 2QTFA 1SCDA 2EF1A 1B3RA 1TMOA 2RHWA 4OJKA 2K5UA 2ZJFA 2V1XA 3R3HA 4KWHA 1KETA 2W4IA 1D1SA 1EAYA 2YWXA 3CH6A 1SOUA 1L5FA 3C7DB 5FXMA 4E09A 4E11A 1GPYA 1RYBA 1KFBB 2EG5A 5MGBA 3HBMA 4H60A 2Q3BA 1EI9A 4OHRA 5EE1A 1KI4A 3PCTA 5EJAA 1RQNA 1MUUA 5DWDA 2D2EA 1R37A 1RHMA 1W6UA 3ADBA 3KUDA 1M1XB 3E27A 3EVBA 4UTXA 2CL6X 2AZ4A 3QQPA 2P9HA 3QH4A 4QUKA 2XZOA 1UXJA 5F5LA 1QO0A 1Z0SA 3DVAB 1J23A 4I66A 1BDMA 4NJOA 1ULSA 1EAMA 4RHCA 4ZEXA 4QLBA 4F5YA 4X6XA 3RQSA 2ODBA 1PR5A 4RPKA 1N0IA 2BKXA 3HFJA 3R7AA 4BO3A 5JBIA 4QUDA 2Z56A 2Y6VA 3EAFA 3DTVA 4IUCS 3IJ5A 4ND2A 4G6ZA 4L3WA 3V48A 1L2TA 2OM6A 2QR2A 4KQIA 4Q3OA 1P1CA 3U26A 4DMLA 1BU5A 4L8GA 1W94A 4WKGA 2FG6C 3VZQA 4EB0A 4HNRA 3HM9A 1T9GS 2BJHA 3PXAA 4PCVA 1SXJC 3PXCX 2J59A 3JQAB 3PNKA 2W5UA 4PQRA 4QYXA 1OB5A 4FR2A 2G7ZA 1DKUA 4JBHA 4GPZA 4ND7A 1T25A 4FYIA 3E18A 5E9JA 4OB6A 2D5AA 1XTIA 1XOIA 1YRWA 3LL7A 4O4LF 1WETA 1GGEA 1VBFA 2Q1TA 1NN0A 5EEHA 2B8EA 1WEKA 1X92A 2CJWB 1YNSA 4FCWA 4Z8XA 1IZ8A 1I0LA 3ASVA 3W79A 1XWWA 5EJ8A 5FL3A 3VR6A 3HN2A 2CZGA 1USGA 3GQBB 4QQFA 4GWKA 4RL6A 1NHWA 2BLNA 2XWJI 3EH2A 4PYKA 3VNRA 3PFNA 4FLEA 3GLRA 3RRMA 3NWPA 2R8XA 4LEIA 1I3KA 4QQ8A 3DFIA 3ST7A 2OLKA 1JU9A 1QO7A 4FS8A 5DIZA 5DMXA 5FWDA 3TD9A 3U48A 3LYLA 3AUXA 2W7TA 1MX5A 3DNMA 1XRSB 1ZK4A 1TUBA 2ODPA 3OZRA 4JYPA 4U9IS 5FDFA 3H8WA 2BTQA 2DQSA 2IF0A 3OVMA 4FNAA 5IVPA 2L0XA 3JSXA 2AI2A 4Q3LA 3NYQA 4DR1B 4C2TA 3EF0A 3O8OB 2HBRA 4EGQA 2ON6A 4DUPA 1FTQA 3HZHA 5KMGA 4YRKA 2IV2X 2J9YB 1EEXB 1ICIA 4BKOA 1C1HA 2GN8A 3M89A 1E2UA 1R0KA 2PCJA 3D2CA 3O82A 1HFKA 1GZSA 2GASA 1QSGA 4LI3X 2VT7A 4KXQA 2FZ4A 5J4KA 1ILWA 4IDAA 4O4IA 3X44A 4OB8A 1R27A 2J9XB 3WNDA 3ZDEA 2PH5A 1J0AA 1J90A 2NZVG 4ZVSA 1TEZA 2EL7A 1U2QA 3BXGA 4UKDA 1E1NA 1R5NA 1OGYA 2BKUA 2BM8A 2VCEA 1QAOA 3MQ2A 3QBEA 4LGYA 1NBHA 4E22A 4WJKB 3DL2A 4INZA 2N46A 3CG0A 1VGRA 2AI1A 2P11A 2PAFA 1QH8B 2WT8A 3D4BA 4FKMA 4NU5A 5FWAA 3OO1A 4HZUB 5LBTA 4KMOA 1Z15A 4MV8A 3INGA 2OD2A 2TMYA 1RHQA 3O94A 3AHGA 2AG5A 3QFRA 4ZARA 1G3RA 3BQMB 3LUHA 5BYBA 1D9ZA 4L6IA 4UD6A 1BXZA 3FKSA 3T3IA 4RHYA 1WMSA 4ZT3A 1YAHA 4TV8B 2JBAB 3OBIA 3W5VA 3RIMA 3VZDA 2LGJA 1OIVA 2WWHA 1WIWA 5EIFA 2B1QA 4RPJA 4UBKA 1G17A 2QAJA 1A8QA 4UOQA 3OEYA 2XSZD 1W1IA 4FSHA 1ZNQO 2QQFA 3JWPA 3KIPA 1JG3A 2F3PA 3UF0A 3GEHA 3CX8A 5GIPE 1IN4A 3OT5A 3GRRA 3T0GA 1IAQA 2P6UA 4WLOA 3T54A 3THXB 3WKEA 2I5PO 2Z2KA 4YCDA 1ZXXA 5E9QA 2ZCJA 3GJ4A 3DF9A 2ZDGA 2XGSA 4CGZA 1I0ZA 1ZNZA 1M6VB 2J31A 2OG1A 2SECE 1A88A 4MR8B 1JKIA 1G291 3DDCA 1ADGA 4GP7A 2OWEA 4BP9A 1YOVB 2OQRA 3IEVA 4FSDA 3DVRX 2MU1A 4G09A 4A0HA 4D9EA 2HH9A 2J7PD 3RWMB 4RK0A 1ZUNB 1EUQA 2IU6A 4IEFB 3FCUB 4RGBA 1GU7A 4B7CA 5AW2A 1SQ6A 1PJCA 4KH0A 5HM8A 3UMYA 3L1HA 3VDMA 3E2PA 3LQYA 4G0OA 1TF2A 3UK7A 1BYUA 3PDIA 1JMVA 4CXMA 4CDGA 3TLKA 3D0OA 2Y4OA 7AT1A 2W8BB 3BRWA 2PTHA 2QYOA 3IQDB 1L7BA 4O1IA 5AKEA 1P2BA 1BHJA 5SZJA 3AUYA 3CNLA 3RRZA 1KJWA 2GUGA 1HGXA 4WCFB 5ECGC 5JAQA 1CETA 1L8OA 5KQGA 3UFXA 2P8JA 4FQ5A 2NVOA 1CK4A 3NFYA 4QPJC 2GAOA 4E5NA 2LTAA 3K0SA 1W25A 2BGUA 3BCHA 3L0ZA 2G3YA 2VF2A 3A1NA 2EFGA 1QYIA 4QXPA 1MXHA 2B34A 4FK8A 3FHOA 4DPLA 1QVAA 3IDFA 1AKYA 3NHWA 3OESA 3REGA 5BVGB 1RFGE 5L6MB 1DRVA 1GAXA 3KC2A 4U8HA 1M0SA 1S3FA 4G5RA 2HLNA 5LP1A 4YAOA 4C0QC 1PRYA 1SKBA 2ZTSA 3IH5A 4O4HF 2ZUEA 2FAXA 4N54A 1T43A 2FPIB 4KDRA 4EG4A 4FW9A 3WGTA 1XYVA 4IVQA 2Z9CA 2CNOA 4ZVRA 4K03A 2WDPA 3C14C 2PO5A 4WN9B 4NYJQ 4B71A 5DHRA 2GAFA 5AVKA 1Q7CA 3S8MA 2PX8A 3CLKA 1OUMA 5ICFA 3UUGA 2QD2A 1IULA 1XZKA 3D02A 3WK9A 4EY5A 3W04A 2CW5A 4YLEA 4OIMA 1W9MA 2BEWB 3QFSA 3U62A 2FW7A 4KV7A 2EQ5A 3DZBA 2DZDA 1LD3A 1YIDA 2VJYA 2PE5A 4OLBA 2CMKA 2VA8A 2AMJA 5D6OA 3EQ7A 5FI0B 4YYZA 1ZVVA 2GSDA 4HG2A 3CH4B 4L8YA 2I4TA 2VT3A 4FFMA 1K2VN 4PQGA 4YYEA 2G5PA 1WWKA 1K8QA 1ZC3A 2Z5GA 2EJWA 4Y2PA 3JQ8B 2ZIVB 3DPSA 1KJZA 2C1XA 3ROTA 3T5AA 1QGZA 3NX4A 2ZR7A 3KT8A 4KL8S 1KMIY 1T8SA 5EGNA 2B69A 2BKAA 3QOFA 2UAGA 4D9KA 3NTQA 4JI3B 3P9IA 3ZV7A 4GPTA 4L8WB 4PTYA 1BDHA 2I66A 1V37A 4C7OA 1HF3A 4LCEA 2OHJA 2W4QA 5HOQA 2GVDC 4BGVA 1MH1A 4QOFA 4Y2JA 1H1LB 4M1KA 1NLFA 2O59A 5E0KB 2CCJA 1AX9A 4JR2A 4KFRA 4TL7A 4UBLA 3UXHA 2GCEA 3K05A 1P33A 4EB8A 1BMTA 1M72A 2BUAA 4I7EA 1JR2A 5BWCA 3I76A 2GTHA 2Q0QA 2VI5A 3R1IA 1O6ZA 3RLIA 5IHXA 3H17A 3DZDA 2G5GX 3PUXA 4TQAA 5C46F 8GPBA 4IUBS 4PZYA 1HFJA 2E7ZA 4J1QA 3MAAC 1OWMA 4OQNA 4PWYA 3SX2A 1L3BA 4ROTA 1PU2A 3RW9A 4CL2A 1M2OB 2WSLA 4WK2B 3EJWA 4D9HA 2P9EA 3OJEA 4Q02A 3N2IA 3IIEA 1JPVA 3IVMA 5BO5A 2J4FA 1FMJA 1V7CA 3O8DA 4LISA 1EP2B 1RMYA 2JLYA 3GPLA 3DZCA 4BX3A 1XPRA 3ICCA 4LMPA 5DX8A 1O54A 2POQX 1VECA 4IOJA 3G9XA 2FY8A 1J1UA 1YRQA 2QSYA 4R1OA 2ZJ6A 1U4SA 4JUBA 3W78A 4G4IA 4X6LA 3RAJA 3HB7A 2XE7A 1JF8A 2XRYA 1AN9A 2QMUA 4S1OA 1PJ2A 3JWIA 5EFZA 5I8PA 3ZWOA 3SM9A 5ADHA 3VPCA 13PKA 1OXUA 3DAYA 1RE1A 3BRSA 5I48A 2A1TR 4NMWA 1ZMXA 1TZBA 2G8LA 2A58A 2C58A 3CB2A 2CVFA 4RD3A 3A2KA 2EBUA 3CNOA 4NMLA 3M33A 2VJNA 4MWGA 5A1TA 1THGA 3PNMA 2PX2A 3UTDA 1CY4A 2ANCA 1IB6A 1AKNA 1AZWA 1T4GA 1V5WA 3UO8B 3S3TA 4DDVA 2I3BA 4P5EA 4ZCMA 2GHTA 2GZSA 1H4QA 2YY5A 1LDBA 1UKBA 4CL0A 3LLMA 4MKRA 1MO5A 2QZ4A 5JASA 1IWPB 5DYGA 1TFRA 3I3SR 3OI7A 4CG3A 3R6GA 3U44A 1L4UA 2A5GA 2X7JA 1MT0A 2ZIUB 5I7WA 1LZLA 4LDPA 1NV8A 5DGXA 5DFAA 1TCVA 1YMQA 3I09A 1P62B 5U1PA 5ITVA 1F2UB 2XMGA 3REQA 1WMBA 1QU3A 1Y37A 5ICSA 1DQRA 3PA8A 4XVRA 1DARA 2PFGA 4D9GA 1GNQA 2BTQB 1WPGA 4KR9A 2PKQO 1TUBB 3D8TA 1QORA 3NATA 2NU9A 1YZLA 3OQ1A 2HNAA 3I5YA 3H04A 3T3PB 3IA2A 4WDRA 4WN3A 4K86A 1FMFA 2VJMB 3LNCA 3TLXA 1V11A 5CA0B 4OXIA 1D2CA 3BJMA 3TLGA 2R1ZA 4TYNA 3A10A 3JYQA 4RS3A 3ZY3A 1E1YA 5F5XA 3VC1A 1RM3A 1WB6A 2ETVA 3DE1X 3PQ5A 2J6CA 1XEXA 5IH7A 5GPBA 3O4RA 5FHRA 1I1OA 1U6JA 2FPPA 2VK4A 1IOVA 3JQEA 3R4CA 3DTVB 1EXDA 3M9XA 2IW1A 2BYTA 2XBMA 1JFVA 3THOA 5BN1A 4NMXB 1N6LA 1QH1B 3D31A 2WYIA 1YE3A 2Y9YA 3EZYA 1RI5A 2IYXA 1TUIA 3K2EA 1YSCA 3ITDA 4X1YB 5AKGA 1R15A 2RG7A 4DM7A 2YXLA 3OHSX 2V5AA 3GG9A 3LHSA 1IL0A 2GCPA 4C3ZA 3NOVA 1C3LA 5AI8A 1Y7HA 3C5VA 1K08A 2RONA 1NQAO 3G0GA 3QVMA 5FULA 3UVEA 5JVDA 4N65A 2PV0A 2XGJA 3QVJA 2WHPA 1OJLA 4HDAA 4BYMA 5L51A 3MXOA 2YCBA 1CPYA 1BN6A 1YA8A 2JIOA 3ZGXA 3BFKA 3UXMA 5J43A 5JXGA 1BFDA 1N5KA 5JDCC 1RRGA 3WL3A 3OQHA 4S1WA 1Q20A 3SIPA 5BURA 1B2LA 2D13A 1EU1A 1XDWA 3DONA 2H0RA 3SWWA 2GPBA 3Q8LA 4UAJA 1JA0A 3KOYA 2ZXEA 3G59A 4NFSA 3U19A 1NPTO 1E9RA 4YNBA 3QG1A 1YKFA 3WLFA 3LQ1A 4YQFA 2NSJA 4QFDA 2BFMA 3A2MA 8ATCA 3CC8A 1IUKA 2CNDA 1KKUA 2AF4C 3IR6A 1N33B 1SKYE 3UWDA 1Q0PA 4OD0A 3KCQA 4TQUS 4K2AA 3V34A 5AQEA 1VPDA 2GX6A 5A7GA 2C5BA 2VZEA 1ZD5A 1DKPA 3S2ZA 4EPTA 2P91A 4I1PA 4GR5A 2GXSA 5E3IA 4Q4CA 2P2NA 1E9AA 3NP7A 3HUTA 5FOXA 3OSUA 2BMJA 2XOKA 2RGWA 4LWOA 4RVCA 2O8EA 1XIVA 3IUJA 2FWMX 1SCNE 4GAEA 3BFPA 1X1BA 1N0VC 2Z95A 3L02A 2CXXA 3H5RA 3MELA 4MOWA 1AU9A 3SQDA 4CBVA 1AMUA 1W76A 4ZU1X 1UQUA 5J58A 3MINB 4CU2A 4HEA6 4K40A 1Y4ZA 1JFRA 1YCDA 2XYRA 4QLAA 8ADHA 5KTPA 4YMSA 2X9GA 3P5SA 3CRRA 1P2SA 2PGJA 5CGZA 1BDBA 4D3XA 1SIOA 3IUYA 1NBIA 5DX0A 4AJEA 4CL3A 3V8EA 3AUSA 3LKDA 3CPHA 2PUCA 2GZ1A 4CQMD 4D43A 2LKDA 3NOOA 3RF7A 2RGCA 4J0QA 5IKEA 2RD2A 2WHPB 2VJKA 4V02A 3P2JA 4Y3UA 3ZBQA 1D8AA 1LC0A 2X6QA 2Z9BA 4HI0E 3RYFB 1JDBB 1X7HA 4HKTA 4NZYA 5CLGA 3F5SA 3NASA 4G9GA 1IY2A 4X20A 4N40A 4YAJA 4ZA2A 2GZ2A 1DRWA 4JL6A 1J2RA 4P4LA 3HYNA 2YINC 1PX0A 5AKYA 1C8KA 1MMFB 5EUQB 4BC1A 1JLLB 3PX2A 1LDYA 4AN4A 1V48A 3ETJA 4ZI5A 3D6FA 2IYWA 3DWFA 5IWAB 4IVNA 1WHTA 5JYEA 1W52X 2ZYRA 2FSHA 3AI3A 3LIPA 3UBTA 3Q3EA 4PANA 1V39A 1H3FA 3I3OA 2NV6A 1MVOA 4QD3A 1COZA 2O0KA 4P84A 2UZ0A 4UBNA 1UBRS 4OI1A 5C5DA 3SQNA 1LQUA 1MAUA 4I55A 2X41A 4URYR 4QVKA 5J1SB 1OF1A 4JA2A 3EDYA 1TTTA 1OFVA 2G9RA 4B3FX 4DLYA 2ZIXA 3CTVA 3MWFA 4MWTA 4L5YA 3LUFA 5FT9A 3VKFA 4E0BA 1VIMA 1MAVA 1YZVA 1BWRA 1FRQA 1K68A 3BIWA 3E6AA 4FDMA 4Z0TA 3UMBA 1PV4A 2VNAA 3G9UA 3GARA 3LUKA 1NYRA 4L0DA 3GW8A 4GXNA 2BHSA 5DX1A 2HTFA 2EKZA 2DM6A 4MWZA 1WLYA 4AF6A 2Q6VA 4ID3A 2V5UA 3ZE1B 4D4JA 1BEZA 4Z54A 2OHHA 2CB0A 1P29A 1VL6A 1U7UA 2XTMA 5K0FA 1L9XA 4F1JA 1G63A 1F6DA 2XH8A 3GGOA 3LPLA 1F0KA 2NX2A 1S2LA 5JWOA 1C2YA 2RGXA 2V7QA 2JIMA 4CQLA 3Q5EA 3QYFA 1RC1A 3CJQA 4JJAA 3SOPA 4G9BA 4BKPA 3S8YA 4M6WA 3MCTA 5H7XA 2YNMA 1UKCA 3IQZA 4MKFA 4YA6A 4ZT2A 3QP9A 3EQ8A 3BIXA 4MB6A 3UZUA 1EVQA 2I4OA 2I3DA 5LP6C 4AMZA 4HUQA 1YQXA 2FZCA 2VYFA 2FPKA 3PHJA 1AGPA 1NY6A 2AQHA 4TZ0A 1G2QA 1C14A 4R9RA 4JIGA 4UM8B 1HMPA 2R5NA 3YASA 4KUEA 3PKJA 1XZNA 1JNYA 3KOMA 3PFKA 1AHPA 1OLOA 1S1MA 1TAUA 3E05A 4MCHA 5IVKA 4G8CA 4LOIA 3ETEA 5F52A 3QA3E 1XD2B 1Y3CE 1Y8CA 2ADFA 2B8TA 2BFPA 2G80A 3CCFA 4WNIA 1QTIA 4N0EA 4QECA 3PNQA 2XA1A 2HGSA 2QZJA 2H2HA 1N77A 4YV0A 1MHPA 2MDTA 2X6TA 4F45A 1WQ4A 2F1HA 2B37A 1XZMA 2NGRA 2W58A 4D26A 3WBFA 1N92A 3SS9X 1MH9A 3F5DA 5EYPA 2YJ6A 1E2KA 1L5YA 2V98A 2AOVA 1DC6A 2JF0A 1OC2A 2JLBA 4JX8A 1QC5B 1QZ3A 2G40A 3G5TA 4KQ9A 4REQB 3V6MA 3K6JA 2AJDA 1GARA 3IKTA 2W2QA 4FDTA 4YRGA 3RYHB 2CJFA 1INLA 4QOHA 1OKKA 4QGFA 4V0QA 1QHFA 5JS8A 2D2IA 3E58A 4CM3A 4L76A 4DA6A 3DDUA 3FF4A 3A37A 3AQ4A 3ZV3A 3M2TA 4DIFA 5A4FS 1W6RA 5LQMA 2BGRA 4FBMA 4RMHA 4F4FA 2Z6QA 1AK2A 1H94A 3AEKB 4UW9A 4FFNA 2WUWE 5AJVB 2Y9ZA 1KGSA 1J8DA 3M6FA 5JHGB 1SG0A 1CP3A 3O31A 3ZE0B 2WIGA 2VYQA 1HDOA 5K0JA 4CM1A 4DSAA 2GVNA 3QVSA 4TV8F 1M6VA 1TM7E 1UKEA 5BNIA 3UWMA 2OUIA 2ZQZA 4CTKA 3D0KA 3W2FA 4PYOA 4L57A 1D9XA 5ESXA 3GT7A 2E37A 3VPDA 1DBVO 1DUSA 1CR0A 1SUPA 2ZKLA 4A03A 4BVLA 3RBZA 1XEFA 3J7AC 1CEEA 4G3XA 4HT3B 1CUSA 4DY4A 4RMJA 4EHLA 1X80A 2L82A 3AFIA 1UBFA 2BGMA 2WD7A 3MJVA 1Q74A 5HKOA 2PUEA 3RWOA 1IFXA 4HNUA 4JSRA 3GLQA 4C7MA 2JCYA 1ZGCA 4P4UA 5A03A 2Z0MA 4OHYA 1CULC 1JNXX 1LPPA 5AW3A 3EVGA 1Z6PA 1IM8A 1F5SA 3N2GB 2XQGA 2F1RA 4M8NE 1FFHA 4BNMA 2EEPA 4TLMB 1KMHB 2ZIWB 4EKNB 2GT1A 3IGFA 3WIDA 1VLQA 2M32A 4AMVA 5KPJA 2Q49A 1KWGA 2FWBA 1DEKA 1L8XA 1RQLA 2D1QA 4PX2A 1U0OC 3P9SA 4R31A 2AMYA 1L7MA 1SVSA 5KYYB 3FHLA 2PKQP 1CUGA 2R3SA 4TWAA 2IX3A 2EP7A 3QPCA 5JY6A 3M81A 4PYQA 4O3MA 2YCLA 1EP9A 2JD1A 2Z43A 4V2UA 2QG9A 1FW8A 5A3RA 4UE6A 4D0LB 1U3TA 3GRYA 2XMQA 2PWBA 4NPCA 4HNVA 1NRJB 1M67A 3QWAA 4A0SA 1SM4A 2OG2A 2QL9A 4Z4FA 1KR5A 1BW9B 1E3MA 1DFIA 4QGBA 4GEGA 3L7JA 4AWXA 1NVBA 1U7ZA 5BV8A 1ZGHA 3UV6A 2HXGA 5L3SA 1HDCA 2ODAA 3D4IA 1JHYA 4RQTA 4CM8B 1XUOA 4KJZA 1XI2A 4I50B 1C9NA 1JHOA 5LB2A 3HUUA 4MVJE 4W82A 2RH9B 3OZSA 5AJHA 1JTVA 2FPWA 2NUTB 1E5QA 1ABFA 3V9PA 3F4LA 1WO8A 1UDXA 2QN1A 3F74A 4TKVB 2ZW9A 3CF4A 3TBFA 5FD8A 4B7AA 5E4YA 1XU7A 5CP8A 1XP5A 4TKVA 3HTXA 3G8DA 3AZPA 1EVKA 3G5LA 5CEJA 2A5YB 2O1XA 1GNLA 1J09A 4JR0A 4F84A 1EZZA 2F8MA 2JGKA 3GFVA 2DG2A 1ZMBA 1L7EA 2MSLA 2PNFA 3BS4A 3N3BC 3BERA 2O06A 3I9FA 1HOXA 3T3HA 4UBOA 2OGSA 4XLZA 4DMUB 1NBWB 4X93A 2HDOA 2HYDA 3QKRA 3O7WA 5JPIA 4TWBA 1WSAA 2D5LA 4ARUA 3TQOA 5C8VA 1MG5A 1KRHA 5BT9A 3F5QA 1QB7A 3MJDA 4IWXA 4EMBA 5EXEA 4KG7A 5C31A 1LRJA 1A9PA 3VKVA 1HE8B 5FKJA 3A3OA 1HT3A 3PCRB 3HK2A 4JNKA 3WLHA 5LZ9A 3OU7A 1KQPA 1P6UA 4JKYA 1WEHA 3FLEA 4R7GA 4KOEC 3WK5A 4ZICA 1LDMA 2VUUA 3TXXA 2X8BA 2A9KA 2HSJA 2HRCA 2YX1A 3Q98A 4U7WA 1NPYA 1ZJZA 2HSEA 3JYNA 4M7RA 4DLAA 1Q16A 2HV8A 4ZIRA 1N4AA 4DZRA 1MGPA 1K1EA 3AG5A 4R40A 1E9DA 1W85A 4O4LA 5JDCA 2W9XA 1B6TA 1GQOA 2MCFA 1PJRA 3SG0A 3WB9A 2AQ8A 3BB4A 3G2JA 3KEMA 1X7WB 2O14A 2IUUA 3VX4A 3T5GA