3HADA

Biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
293
structure length
293
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKRAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical characterization and crystal structure determination of human heart short chain L-3-hydroxyacyl-CoA dehydrogenase provide insights into catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords PROTEIN (L-3-HYDROXYACYL COA DEHYDROGENASE)
total genus 117
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3hadA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hadA01
4XR4A 5JCJD 4XX0A 1AN9A 1GUYA 1XWFA 3GPDG 2UYYA 2BD0A 5JCJA 3BMQB 2HMSA 3QJ5A 5HA5A 2JFGA 1U4SA 3CH6A 3PVZA 4Q3NA 4U7WA 3RUFA 2I3GA 1J4AA 5TGDA 1B2LA 4O59O 3RUIA 4YYZA 3RJ5A 3KEOA 3BHIA 5G0UA 2EJWA 5L95A 1WDMA 5DT9A 3JD4A 1E6UA 4INAA 2X9VA 4CQMA 3GGPA 2WYVA 1NAHA 1E77A 2PK3A 3PLRA 3OJOA 1R15A 1P1FA 2CF5A 2SCUA 3BMQA 2HJSA 3GEDA 3ZHYA 4PVCA 2EWMA 4IZIA 5IN4A 4DWVA 2EW2A 2I9PA 4Q9NA 1WVGA 1A71A 3EMKA 3V1YA 1R4NB 5A5FA 1RM0A 2AG8A 2AQ8A 1JDJA 1PJ4A 4DPMA 4RO0A 1ZSNA 2AW5A 2LDBA 3C3XA 3TZHA 3A06A 3JQFA 4L75A 1M76A 3WWYA 4NPCA 3FSRA 5DDIP 4NNJA 3WQRA 1GU7A 1HE5A 3CTVA 4OYRA 3FR8A 1BW9B 2G5CA 3ZWPA 3ZHXA 5BSGA 1VRWA 3WYEA 3TZQA 1E7WA 2GO1A 3F1KA 4XGKA 2DBZA 1XKQA 2VYND 5DCYA 4RQUA 2AE1A 4WKGA 3RKUA 3ZU5A 5C37A 2NU8A 3U4IA 4CMIB 1GYRA 2B5VA 4D46A 3AOEC 4E5NA 2NUAA 3PWZA 4HWKA 2OP0A 3UVEA 3SLKA 2HLPA 1ZH8A 3VH3A 5H83A 3H9EO 3I9MA 1LDEA 3VPSA 4MVJP 1H6BA 5ES3A 3RUDA 3RAJA 4NG5A 2Y0EA 3V5NA 2X7HA 1R66A 1YRLA 2J6IA 3HFGA 3UOGA 1R4MA 4GX1A 4IS2A 2JD2A 1T4DA 1MG5A 4YAIA 1VC2A 1SBYA 4KDFA 2HJRA 3DR3A 2Q2VA 4XYMA 2WDZA 3ZDFA 2VTEA 1YB1A 2H5LA 3OEWA 2YFQA 2QRJA 4J4BA 1XQ1A 1Y8RB 2AMFA 4J43A 1Y8QA 4BHTA 3QVOA 3F47A 3A14A 2VUSA 2O23A 1ENYA 2GSDA 4URFA 4UVHA 3VTZA 2ZB8A 5I7VA 1UZLA 3I1JA 5AXAA 2VQ3A 4A26A 2OMEA 3HN7A 4CMEC 3P2YA 4BKOA 3RFTA 4TSKA 1MFPA 5CDSA 1WW8A 2JFHA 4K28A 1KVTA 3HHPA 2W2LA 1BDMA 4YJFB 1LDBA 1PL7A 2P68A 4IBOA 2ZK7A 4IJVA 3U3XA 3WG9A 4DIFA 2GDZA 4IS3A 1Y7TA 3QE3A 3MJCA 4GI2A 3IJPA 3PJGA 1L7EA 1HL3A 3PEFA 2FSVA 3FPCA 3I9LA 2Y1FA 3H65A 1AHHA 1UXHA 1E3LA 1WMAA 1HF3A 3GG9A 4BNVA 2Z1MA 3DO5A 4XYEA 4EZBA 3ASUA 4EJ0A 5B1YA 4ZJUA 4FOOA 2J5RA 5IDYA 1H2HA 1ISMA 4BGVA 1MXFA 2NU6A 4BNWA 4BO0A 2EW8A 3TSCA 1BTOA 3OBBA 1E6EA 5A02A 3V1UA 3GN2A 4R5HA 2GRAA 3KO8A 2H63A 3QVTA 2B4QA 4UVIA 5CHEA 4ND3A 1PZHA 2CUKA 4TRJA 5TC4A 1UJMA 3LF1A 4OXKA 2IXBA 3GPIA 1FXSA 1I2CA 2X0IA 1VSUA 1BXGB 2HQ1A 5A3VA 3ZWWA 1NQTA 3TNLA 2X9GA 1LRLA 5JY1A 3LLSA 1BRMA 2IXAA 4I5EA 4FC6A 1D3AA 2ZQYA 1UDBA 2PKRA 3R3SA 4UUOA 3PJEA 1YOVA 4YAKA 2Q2QA 3WBFA 1VJ0A 2HUNA 1QYDA 3D4NA 5CDUA 4LSMA 4E0BA 4ZQFA 1IL0A 2IE0A 1I3NA 3D1LA 4WNCA 3RCBA 1ZJYA 2R2GA 4IDDA 1P45A 4NJOA 1QMGA 1G1AA 4CM4B 3TQHA 4YAGA 4PG8A 3ETDA 3PJDA 3GVXA 2C20A 2EKLA 3C7AA 1E3WB 2Y66A 2JCXA 2G0TA 3QY9A 1QYXA 4O0LA 1IY8A 2UVDA 1P44A 4UAGA 5KWEA 3LVFO 4XDYA 3WFIA 1NWHA 1ULSA 1M6WA 1PJTA 1ONPA 2VOJA 3AM3A 3WJ7A 4B8ZA 3K92A 4OAQA 4FIZA 3AUAA 1ISJA 1M66A 1J49A 1XDWA 4J91A 3EAGA 5U9CA 2IZZA 2VRCA 3O8QA 4GL4A 4FSHA 4MVJA 1U4OA 4YJGA 4PLCA 3RFVA 1C3VA 1I30A 3PPIA 2YJZA 4KWHA 4XQGA 2VWPA 3DFZA 1EDZA 4RF2A 4LRTB 1BW9A 1TT5B 2GF2A 2V65A 2W90A 1C1XA 3OJFA 1P1IA 4P4LA 1DFIA 1I32A 4MP8A 1T1SA 1S6YA 3DQPA 2EP5A 4CJXA 4YXFA 1LQUA 4JBHA 5DF1A 3TJRA 4BOYA 1KS9A 1LI4A 1SCUA 4B8WA 2GNAA 3ADPA 1LTHR 2Y1GA 4J2OA 4FPXA 3V2GA 1LLUA 4YA6A 2ET6A 2AQIA 3GA0A 4CM8B 2RAFA 2X22A 4IQGA 2W4QA 1ARZA 3KHUA 1CQJA 1NTOA 4BVAA 2NVUB 3WR5A 3DZHA 3OJEA 3IKVA 3ZWYA 1C0PA 1MP0A 3ONDA 1NQOA 5J23A 2C82A 3IOYA 2C7GA 5JFOA 4CM9A 5F21A 3RC9A 4XRRA 4XRGA 5DN9A 2Y1CA 2NV6A 1C14A 1LX6A 4XIYA 3GUYA 1F17A 4JJIA 1SZJG 1WZEA 3JQCA 5THQA 1D7OA 2QRKA 3NDIA 3EUWA 4FN4A 1A9YA 4R9SA 1CJCA 1QYVA 3OEYA 4Y8VA 1IULA 2TMDA 3NTQA 3FN4A 4ALMA 5KCZA 3PHHA 3WYCA 3ZNQA 4YTEA 3ANMA 5JPIA 1E1MA 2QIOA 1ZSYA 5KJCA 3ANNA 3AOGA 3TFOA 1YB4A 3MWEB 4HY3A 4M87A 1DDOA 5CPBA 2X0JA 1D4FA 1XR3A 1ADFA 1LA2A 3DDNA 1YJQA 4PCVA 1N1GA 1B14A 1U1IA 4PG7A 4CM5A 1LSUA 3O4RA 5JDIA 2BFAA 4LW8A 4R41A 4YAJA 3IS3A 3LC1O 4CLHA 2ZTUA 2GD1O 1BXGA 3Q11A 2GYYA 3JQ9C 1E3SA 2W2KB 2AHRA 4I8XA 4CV3A 1DRUA 4KTTE 3TOZA 4AJNA 1Y6JA 2DFDA 1Q0QA 1SNYA 1PR3A 3G0OA 1ULUA 5A4DA 1Q0LA 4XWYA 5JYDA 3ICPA 3VDRA 2GN9A 1R12A 4A7PA 4DVJA 2OBNA 4GWKA 3D5TA 2WYUA 1A9ZA 5KVQA 4RLHA 1XYGA 3KETA 4YJHA 3GOHA 4QX6A 3ZNNA 1E1LA 5EL0A 1CWUA 1BSVA 4XJSA 2O7QA 1VJTA 2VHYA 3DMTA 2RBEA 2OBYA 1BG6A 3OMLA 5DCUA 3LC2O 3VOSA 1YKFA 4R9RA 4IIVA 4J0FA 5EIOA 1JAXA 7MDHA 1QLJA 2VT3A 3DBLA 1VL0A 3H2SA 4I08A 4JK3A 3ZV3A 4BL5A 3CINA 3JQ9A 3RUHA 1UP4A 4HV4A 5MGBA 4I9NA 5KKAA 1LBEA 3GMDA 4UVEA 4WGGA 2H1SA 4G65A 4GX5A 4M54A 4ZICA 3WXBA 3UUWA 3UF0A 2EXXA 4RVGA 5FYDA 5HS4A 3DFUA 4W4TA 5DBIA 5T67A 2B4TO 5TT1A 2PH3A 3LQFA 4IINA 1NYTA 1UXIA 1H9BA 3L4BC 3EGOA 3DZGA 4IGFA 1LRKA 3OA0A 3OQBA 3QVWA 3V2HA 2DLDA 3RC2A 4IJWA 5A9SB 1NFRA 3QQPA 4QUKA 3AFNA 3D64A 4P4GA 1LU9A 2P4HX 3Q9UA 1ZXLA 5L7TA 2C5AA 1X13A 3PYMA 3S2GA 1QORA 3RASA 2OOSA 5FI5A 1XU9A 1XG5A 4Y6SA 1HDGO 1PGJA 4NHEA 1LJ8A 3DXFA 3RBZA 1DOHA 1XHLA 4OKNA 3U4CA 4AG3A 3E9MA 3E9QA 4E5KA 1RKXA 1IHXA 5HM8A 3W4KA 3K9QO 4L4RA 4Q39A 3NYWA 2QQ5A 4KUGA 2PA3A 3HWRA 3UGKA 3IL2A 1E7SA 4KWIA 2PD6A 3A28A 5ER9A 3BZUA 3WGQA 4FFNA 3NUGA 8LDHA 3JD1A 4TWRA 3VPFA 2C0CA 1P77A 1MC4A 5EERA 5CG1A 1GCUA 5ILOA 4I5GA 3E48A 4ND4A 1CYDA 3ROKA 3GVPA 2C7VA 2NNLD 4Q3BA 1G6KA 1GZ6A 2Y99A 3M1LA 1JAYA 1NQAO 5ADHA 5KIAA 1MC5A 5JO0A 1DJQA 1PZEA 3KUXA 3LT0A 2J3KA 3IP1A 3X2EA 3ULKA 1TLTA 1KEWA 2GUGA 5BSFA 3X2FA 4L4XA 1P1KA 3GC6A 4MIEA 2BRUA 3MWDB 4IM7A 1GADO 4PLGA 3V8BA 4BNIA 1MFZA 2RH4A 4XYBA 5L51A 4II3A 5ENVA 2Q46A 3GAZA 4JQCA 1NR1A 2EGGA 3RFXA 1C0IA 2UUPA 1B3BA 1Z45A 4P22A 3WYBA 3OF2A 4W82A 1MG0A 1EVYA 4WLUA 3UCXA 1OC2A 2NWQA 1I3MA 4MKXA 1VI2A 1YGYA 1NNUA 3S55A 5TS3A 4B7CA 4GLOA 3EW7A 4OJNA 2DUUA 2GZ1A 3EDMA 4ND1A 1EBUA 2VN8A 2JJYA 5GZ3A 4BNHA 1G0NA 1JKFA 2HCTA 3GQVA 3ADOA 1UXKA 1NX6A 3G49A 3VKVA 1XIVA 4JBIA 2EF1A 3AUUA 2NTVA 5T8KA 5BQFA 1A27A 2BI7A 1SOWA 4DTIA 3RUAA 5CG2A 3GRPA 4BNYA 2HK9A 2WEKA 3LT1A 1GEGA 1NVGA 3GLQA 1GEEA 5ITVA 1X0VA 2D2IA 5ER6A 2EP7A 5DNAA 1GPJA 1JWAB 1XEAA 5F1KA 5K9ZA 1NPDA 1P33A 5I7EA 4IJUA 5EESA 1KETA 5IG2A 4WPGA 3WSWA 5I8ZA 1ISHA 1JVSA 3PDJA 1JW9B 1DIBA 2FSSA 2BGMA 4E5MA 3RUCA 5JYEA 3SLGA 5L4LA 3SX2A 4UULA 4EGFA 3NT2A 1HZZA 1JU9A 1XQ6A 3EK2A 2X5OA 4Q3DA 2UUOA 3RKRA 4RLSA 1YE3A 4LISA 5FEUA 4HXYA 3FWNA 3NDRA 1NFQA 2VZ0A 1SAYA 4BKUA 2Y1EA 4FGWA 2JHFA 4EBFA 1ZNQO 5JY6A 4W7IA 2JKVA 5HWSA 1PX0A 5A9SA 1EFLA 5FI3A 4IQ8A 2Q1TA 2VNSA 4HNGA 4K6FA 4H16A 1B3RA 1HLPA 3GG2A 4GKBA 2CZCA 3GH3A 2ZKLA 3QP9A 4E31A 2RIRA 5ICSA 1X0XA 4PLWA 4XR9A 5T57A 3R3JA 4ZD6A 4DPLA 3K6JA 3JD2A 3FTPA 1R6DA 2PKQP 1E1NA 4F3YA 1VKNA 2Q49A 4FB5A 1P74A 2YZ7A 2PZMA 4R01A 3ZNPA 2P9GA 2YHIB 1U8FO 2OFPA 1DRVA 2O4UX 4ILKA 4RF3A 4XZ3A 4BO9A 3JV7A 3F4LA 4CLOB 1U9JA 4CLRB 3P5SA 1BDBA 3H8VA 4I9UA 1V3VA 3D4PA 4BS9A 2IZ0A 4GBJA 4LVUA 4WOJA 3ZWAA 1TEHA 5IN5A 4IIUA 2V6GA 3E8XA 5JAZA 4CV2A 1HRDA 1PJQA 4RV9A 3I5MA 1U2GA 2ZJ1A 4OMUA 2WJPA 3MCVA 3U9LA 4GWGA 3C8MA 3JQ8A 2EGHA 3KYCB 4NMHA 1NM5A 4BNUA 2BH9A 2B37A 4GKVA 5HRUA 5KJFA 4BNLA 2O3QA 4JN6B 1OAAA 4JX8A 5A9TA 1OOEA 4ND5A 1UP6A 3SC4A 3JYPA 2YFHA 3GGGA 4M89A 5AVOA 4NJMA 4WCFA 4NBRA 2W98A 1E3IA 1FMCA 3GF4A 1GYPA 3MJ4A 1V6AA 5LCXA 5TT0A 3SXPA 4DPKA 1A5ZA 2HO5A 3VVCA 3AUSA 2PR2A 2Y67A 4F46A 5IDQA 1H5QA 2O3SA 2OL4A 1K6XA 3TZ6A 3W8DA 3WTCA 1LNQA 4D3SA 1VM6A 2A94A 2QHXA 1K5HA 2OGUA 5BT9A 1U7TA 4NFYA 4I9HA 3G3EA 4TZKA 4YACA 4BNNA 5A5EA 4WLNA 1OMOA 3V1TC 3CSDA 3PFFA 4BO3A 4D42A 3S2FA 4DBZA 2J5KA 4MP6A 1ZJZA 1Y1PA 1FK8A 1T2FA 3ZU4A 3RU9A 1H2BA 5ILGA 1EFKA 2J3JA 2QYSA 1Z75A 3K96A 1KERA 4LK3A 1A4UA 1D1SA 2OXIA 5ENDA 2DC1A 3H9UA 1A7AA 1ONOA 5L40A 3K5PA 4OM8A 4JCOA 4PZDA 1TI7A 2ZJ0A 4FDAA 3WJAA 2DQ4A 5KVVA 2FN7A 3R0IA 2AG5A 2VT2A 2VNAA 4E5PA 1XLTA 2EIHA 3UCEA 3ZU2A 3PTZA 4GX2A 5TJ9A 4D44A 3AI2A 4ESOA 2DUWA 4WK6A 1T2CA 3KYDA 5IAAA 3B1FA 1LC0A 2X5KO 4OIMA 3LDHA 2NACA 4Z0TA 3UKOA 2CNBA 4TMFA 3R1IA 1YQDA 1DAPA 4NBUA 3ROPA 4A03A 2X4GA 1EQ2A 3O8QB 4PN3A 3ZU3A 2E49A 4BKPA 4D45A 2CFCA 1PS0A 1WDKA 4RVDA 4L9RA 1N7HA 1MV8A 2HRBA 4FR5A 2H9IA 5JAIA 4OHUA 2Q1UA 3P19A 1FDUA 2OP1A 3E9NA 4R3WA 3RIHA 1H93A 2HMTA 4YR9A 1PS8A 3L0DA 1ML3A 4R3NA 3W8EA 1CQIA 1UXGA 2XXJA 4NK4A 4ZQBA 3IKTA 4YT8A 3GEGA 4A0SA 2P5YA 2P2SA 4DYDA 3AUTA 2F00A 3UICA 2NVBA 2IDZA 4KZPA 2DKNA 4KUEA 3LLVA 4CLDA 3D4OA 3NJ4A 2Y0CA 9LDTA 4MDHA 4EITA 5B4UA 1HDRA 2DPGA 1GDHA 3ZWOA 3JQGB 4BGIA 1R16A 1I3LA 4GSKA 2YV3A 1DLIA 3FR7A 3GNQA 5A1TA 1X1EA 5JMWA 3OICA 1V8BA 1VL8A 4AJIA 1B26A 2Q1SA 3DEYX 3ENNA 2W2KA 3ITKA 5F1PA 3WB9A 1V3UA 3N7UA 1DIGA 3VPHA 4Y67A 2GN6A 2CVQA 3NJ8A 4OL9A 3GNSA 2PY6A 2Q3EA 3QRWA 3WGGA 1QV7A 3OH8A 3ZWXA 3EZYA 1GQYA 4W6ZA 4ALIA 4KQXA 4RDIA 5L3ZA 4YRAA 2VHZA 4UEKA 4YJDA 2B35A 4DUPA 3CZRA 5A03A 5JDIC 3A9WA 1I3KA 3JYQA 3WTBA 2AA3A 1EUZA 2FHSA 4K9DA 3I83A 5ITWA 4O1MA 2NM0A 4M8SA 3KRTA 3HJAA 1KC1A 3VVBA 2EV9A 2BFOA 2JHGA 3DL2A 1EVJA 1ZW1A 4M86A 3WLEA 4CR8A 3ON5A 1EBFA 5L4SA 1GYQA 3RUEA 3I6IA 1ADGA 3QVSA 4R1SA 4N7RA 4QO8A 4YQYA 4WLFA 3HZZA 4BO4A 2Y93A 4J1TA 5A06A 3TPCA 1YWGO 2QZZA 4YQZA 1HDXA 4KMSA 2HDHA 5KJEA 1E7QA 1HYHA 4N5MA 3ZWBA 3ZHBA 2CVOA 3L6OO 1X7HA 1V9LA 2VZ8A 3OQ1A 3AY7A 4CV0A 1O89A 1YH3A 2QRLA 1JWBB 1GQ2A 2PGDA 2YQ4A 1BWSA 4M49A 4PVDA 2FR1A 4W9NA 5AOVA 4LVCA 2GERA 2D5CA 4L8VA 1SOVA 1YBAA 3EVTA 5F3RA 5FF9A 4EEZA 1U28A 3H9QA 4R54A 5BSHA 4WLVA 4P4NA 2O2SA 2BKAA 1I10A 3TZCA 2HMWA 1PL6A 5JC1A 3BIOA 3U09A 1QV6A 3I23A 2GCGA 3RD5A 4YJFA 3DBHB 3JQAA 4DYVA 1IUKA 1LLCA 1JKJA 3JYOA 5JNLA 2AEMA 4R1NA 3QVXA 4HFRA 4J4TA 5EQFA 3CXRA 1EE9A 1JN0A 1U5AA 2ZCUA 3GZNA 1PS9A 3BMCB 1O6ZA 2HK8A 3OM9A 1XELA 3COSA 3RSHA 4DA9A 5KVCA 4K1LA 5JAQA 3JQAD 1T2AA 1J5PA 3VZQA 1K89A 1PWXA 2C07A 3AU8A 3F46A 3W8FA 1RYDA 4MVJF 1UUFA 3OETA 2O4CA 4HFMA 5EJ2A 1I8TA 3SC6A 5B4TA 1JQBA 4D0SA 3P7MA 4UUNA 2GN4A 1I0ZA 3KTDA 5CEEA 4HX5A 1AGNA 1KBZA 4BIIA 5B12A 2NTNA 4LRSB 3EVNA 4WJZA 3ZI0A 1O0SA 3PI7A 3DTYA 3UHAA 3PYLA 2AQKA 3WDSA 1R4MB 4ID9A 3WGYA 3BHJA 3LK7A 1FDSA 1E5LA 5I9NA 1ENPA 4DLLA 4TRRA 3ZWNA 4FFRA 2W2LD 4EUEA 5JCXA 1VPDA 1A72A 2DTDA 3PQFA 4XB2A 3TL2A 1PGPA 1RPNA 4ZQHA 1I36A 2VHVA 3ONEA 3P2OA 1SB8A 5TLSA 2A92A 3G1TA 4CM1A 3FNGA 3GVCA 3T4EA 1U3WA 1Y8QB 1ISFA 2C2YA 4GVXA 4R69A 4U0KA 2YHIA 3CMCO 3DOJA 2XAAA 1EK6A 4TQGA 1Z7BA 1GCOA 1W4ZA 2P9EA 3E6AA 3NT4A 3WIDA 5CDGA 3RU7A 3GVHA 3AU9A 4F6CA 5EINA 4MOWA 4WUVA 3HDQA 4MO2A 3ZH2A 1AXEA 3PLNA 3HQ4O 5K0ZA 4BO7A 4J0EA 4N5NA 4BKRA 3UW3A 2DTXA 4AJEA 1CIVA 2HMVA 3B1JA 2CMDA 4X54A 4WCFC 5B4VA 1P0FA 1DRWA 2GR9A 4AVYA 3TDKA 3LT4A 1KY5A 4WASA 3UN1A 4D7AA 2ZYGA 2H6EA 1S7CA 4ZA2A 2NLOA 4DQUA 4C7JA 3JYNA 4RL6A 3MTGA 1HDCA 4AICA 4AFNA 4H7PA 4E30A 1Z82A 2Q4EA 4E12A 1UR5A 2O50A 1X7GA 4NDNE 3HG7A 4J2HA 2Q1WA 4N54A 1R0SA 3C7CB 1F14A 4YBZA 4XYLA 4U8GA 3BMCA 4B4VA 5I7FA 5IZCA 4P8RA 1CETA 1QRRA 2QX7A 4FGSA 4K6CA 2X5JO 1GFSA 3K30A 5C3MA 2ZIZA 4RZIA 1E0DA 3CEAA 3CIFA 2Q50A 4NH4A 3BYZA 3INRA 3JQ8B 5TRTA 3DBHA 3O9ZA 3QA9A 2CDAA 3GHHA 1GTMA 1YL7A 4PG6A 5EQDA 3UXYA 1DFHA 1WNTA 1BXKA 1NR7A 2YV1A 4RORA 1HDOA 2PZJA 5F5NA 3EC7A 2CDBA 2DTEA 4FC7A 3DONA 2O3UA 3F6YA 4KTVE 3DZIA 4A5OA 1LSSA 3KM0A 2ZB7A 4BGUA 3FF4A 4NBTA 8ADHA 3D5QA 3DAGA 3JQ7A 4ZGWA 1P1RA 3H7AA 5G0VA 3PHLA 3WGHA 5L9AA 1GPDG 3JYLA 3WGIA 4CMKA 4OXYA 1FF9A 1QG6A 3I9KA 4ZQEA 4RQTA 5DOVA 3TWOA 4UEJA 5CP8A 2IRWA 5KJ1A 1GZ4A 5KJ6A 2WSBA 1PQWA 4JIGA 1IZ0A 3C85A 2NU9A 3VZPA 1XSEA 1XU7A 1B8UA 1V0JA 2VYVA 1ZMTA 4E32A 1U2DA 4BV9A 3T4XA 2XOXA 3MOIA 4B4OA 3W6UA 2I65A 1ZSVA 4E5YA 1M75A 2JD0A 4CLRA 2O3TA 5KKCA 3HSKA 2GZ2A 2NVWA 1ORRA 4EI2A 5CEFA 1PJ2A 1PTJA 2J3IA 3DWFA 5COQA 3JQGA 2B36A 1FDWA 5DCWA 2PLAA 2C5EA 3CTMA 3RJ9A 1SEPA 1PQPA 3IMFA 5A3JA 3DZKA 1ENZA 4BB6A 3VH2A 5JS6A 2RCYA 4HFNA 1VKOA 3E03A 1NBOA 4O6VA 3WICA 4JGBA 1TT5A 4MVJE 2VHXA 2JD1A 3PP8A 3WMWA 3M6IA 1DPGA 1LLQA 4J7CA 2QG4A 3QHAA 1ZMOA 4MVJM 5T8KC 2E6UX 4ND2A 4UREA 3RWBA 1P0CA 5TQVA 3SJUA 3BTOA 2P4QA 1QYWA 1QR6A 1PJSA 2DVMA 3BTUA 1MX3A 1JVBA 4IJKA 1DB3A 5CEJA 1DBVO 3F9IA 1DFGA 3AM4A 3KLMX 4MVJG 4D43A 1EE2A 1XGKA 4RVHA 3ZV6A 2AEJA 4E2YA 3W1VA 2ZYDA 3GFGA 1C1XB 4QECA 5CPFA 2IODA 3PGXA 4OSPA 2NSDA 3JD3A 3VHRA 1E3JA 3O26A 3I4FA 4PLYA 5CAEA 4MP3A 5TX7A 2JCYA 2BMAA 3IIEA 1U3UA 1ZXBA 2ZQZA 3BTVA 4Y6PA 1DHRA 3GMSA 1E7RA 4LN1A 4UUMA 4DIOA 5A04A 4BMVA 3K8ZA 4QQRA 3NGLA 5L53A 4PLPA 3QW2A 1DSSG 1L1FA 2VTDA 3ZWCA 1O9BA 5EN4A 1GV1A 1WPQA 1K6JA 3QV1A 3Q3CA 1I2BA 2G82A 4I1IA 2BF7A 4FFPA 2YHUA 4LGVA 1T4BA 4WE3A 4CR6A 2VRBA 4BO8A 4FJ0A 3B1KA 6LDHA 3NGXA 1E7MA 1KEVA 5BNIA 3LT2A 2P91A 2DBVO 4U6QA 1O94A 1YJ8A 3AJRA 4EDFA 2FZWA 5DZSA 4IQ0A 1OFGA 1PJ3A 3B20A 4Z0PA 3AI3A 3WLFA 3BA1A 5IDWA 4MINA 2C59A 2WWRA 4DXHA 2ILTA 1ZUD1 3I9JA 4U0JA 1HETA 4R5MA 5JBIA 3WMXA 5C7LO 3VC7A 5IZ4A 4EW6A 4RPHA 4FCCA 4UVGA 1ZFNA 3HDYA 1VL6A 4U6SA 2IYPA 1EMDA 2VWGA 4J90A 3BMNB 4FFLA 1N8KA 2OUIA 3FPLA 4FD3A 4IUYA 4XKJA 5FWNA 1NVMB 1W6UA 3DMYA 1ISIA 4IDCA 3QWHA 3H4VA 1A7KA 4Z9FA 5IXYA 4IXTA 4P38A 1NHGA 4R1TA 1C1DB 1ID1A 4CMJA 3VPXA 2VWQA 4MVJD 2E37A 3ICCA 1NHWA 1P3DA 5U4QA 2Q4BA 1T26A 1AHIA 4PFJA 3F5SA 4LMPA 1N9GA 5IF3A 3RBVA 4L0QA 1DHTA 4UUPA 3HDHA 4O5OA 3RI3A 1NPYA 1HSZA 1LDMA 1YXMA 5L7YA 5L7WA 2HU2A 4Z9XA 5GY7A 4B3IA 1DC4A 1CEQA 3C7DB 3A4VA 1QSGA 2VUUA 2A9FA 2E4AA 3L4BA 5COBA 5BNTA 1RYEA 4N18A 1IE3A 3H9GA 4AJ2A 1H6DA 4TRMA 2GGSA 3HFSA 3QWIA 3VTFA 5JMPA 4PRLA 3BAZA 5IJZA 5GZ1A 4CLOA 3N74A 3W4JA 2G76A 1XCBA 1IHYA 3CMMA 3Q9NA 1DC6A 1P1JA 3BMOB 4NI5A 4B7UA 1D8AA 1PJLA 3Q2IA 4J4HA 1C0KA 4RVSA 1SB9A 4DRYA 3UCFA 1PIWA 3I9OA 1B7GO 4PLTA 5H81A 1WXDA 1YQXA 2D5AA 3T7CA 3QLJA 3ZWVA 3U49A 3KEQA 3QWBA 2XXBA 3IDSA 3RVDA 3NAQA 1NQ5A 3CKYA 4O63O 4CL8A 3WWZA 4YRDA 1PJCA 3ZWMA 5I8WA 2B4RO 3B6ZA 2V6BA 3ASVA 2HKIA 2O3JA 4D79A 4EJMA 1YDWA 4FW8A 4LSWA 1U8XX 4CMIA 2A35A 2PD3A 4CMAA 2PKQO 1YS4A 3RC1A 3DOCA 4JP2A 5I7SA 3A1NA 1HYGA 4LCEA 4F45A 1CRWG 4XDZA 3IQDB 4NU6A 2Y68A 4BO5A 1X1TA 3KSUA 1DIRA 4R4JA 1GD1O 4HADA 1BVUA 5JDCC 4Z3DA 1W0CA 1KOLA 3GZNB 4J7XA 5THKA 2DPHA 4MPDA 1LDNA 5KNLA 1BVRA 1QYCA 3PYXA 4FS3A 2C2XA 1W8DA 3AY3A 3VZRA 4YRBA 1K6IA 1VJ1A 4MIOA 3F4BA 2VYNA 4DGSA 3FHLA 2IYOA 4OOFA 3IC5A 2V7PA 5IXSA 4B79A 1AE1A 2D3TA 4TRNA 3VH1A 4QT0A 3E82A 1RM4A 2BGLA 2AE2A 4MKZA 3PIDA 1NWCA 1ZK0A 1FJHA 4FBGA 1LRJA 4AJ4A 1JLLA 2FR0A 3BTSA 4PZEA 1MGOA 2D4AA 3KYDB 3AK4A 5EMHA 4BKQA 4Z9YA 3NDJA 1P31A 2J8ZA 2J5QA 3JQAB 4L73A 3U5TA 3S1LA 2I99A 3DBRB 5JDCA 3G17A 4ZVVA 5JSFA 3O38A 2PH5A 3DAFA 2AXQA 4PLHA 3VDQA 4CM8A 2ZB4A 1KVSA 5G0TA 5TSDA 4JBGA 3HB5X 3FD8A 2X0RA 2ZATA 3VPGA 4F6LA 5T5QA 4ZHSA 3GNTA 3KOUA 5JXWA 4DQVA 1L7DA 1XA0A 1WWKA 4BUCA 1NXQA 4N5LA 1R0KA 2DBRA 1VSVA 1BMDA 5C7IO 2AQHA 3FBTA 3Q6IA 2R6JA 3M2TA 4J6FA 2E82A 4ZU3A 4YWJA 4A10A 4BNTA 1KEUA 3WX0A 1AXGA 1SPXA 2D8AA 2B69A 1UXJA 1H94A 1B8PA 2X6TA 3H5AA 4ROSA 1T2EA 3FTNA 3JQDA 1Q7GA 1TB4A 3HE3A 4R68A 1YL5A 4LCJA 3T7EA 5JE8A 3AOEA 1LLDA 3C1AA 5CFZA 2CF6A 3PQDA 5L4NA 1YQGA 3TFQA 1LQTA 4TVBA 4XYGA 1NVTA 2F1KA 2PNFA 3JQBA 5JO9A 5DBGA 4PG5A 3VKUA 4CUJA 5GZ6A 3IUSA 1HDZA 2FMUA 3WGTA 4DL9A 2IZ1A 3Q2KA 3EZLA 2WYWA 4CQMD 3PZRA 4J7UA 2O48X 4NBWA 5HTOA 1MUUA 4ONEA 1YONA 2RH8A 5DULA 4ALJA 3FBGA 1PZGA 1M2WA 3H9JA 3W6ZA 3L9XA 1ZO8A 4AJHA 1F06A 3VAZA 4AJKA 4BGEA 4CM4A 3D3EA 3DZFA 4RPLA 1MB4A 3OJLA 2FY8A 1UAGA 1DIHA 4ZRNA 2UV8A 2POQX 5G4LA 3U4HA 4FFMA 1D1TA 4E2WA 3O03A 3GFBA 4D3DA 3QWFA 4OOEA 3RC7A 2CSUA 4OKIA 4E2ZA 4YCAA 1B0AA 2WTBA 1ADBA 4MVJI 1HE3A 3ZNOA 1X15A 3BMOA 2E48A 3S2IA 4J3FA 2YYYA 5AYVA 1W73A 3GVIA 1Q7CA 2FR8A 1U3TA 3JQBC 3K73O 3LF2A 1WP4A 2FPPA 3ABIA 2DM6A 1TVEA 3GEMA 1LC3A 4R16A 4BO6A 2R00A 1HXHA 1KIFA 3I6QA 3WFJA 3GR6A 3ZW8A 4E4YA 4E13A 2B5WA 2VWHA 4PGFA 2Q45A 1ZK3A 1EUCA 3AY6A 4G2NA 4D3FA 2ZTVA 5BNFA 1SEVA 3MOGA 1ONNA 1B8VA 4PG4A 1EUDA 2XF8A 3JQ7B 3DC2A 4YEDA 1YBVA 4I5DA 4R1UA 2Z5LA 1HEUA 2NU7A 1PZFA 3FI9A 4PLFA 4Z3KA 2X9NA 4CLEA 4ALNA 1C0LA 1T1RA 2HRZA 2EKQA 4CLXA 2D59A 3QIVA 4IDEA 4WEQA 4A27A 3BHMA 5DBFA 3E1KA 5A9RA 2NQTA 4NJMB 1DLJA 1KYQA 2DFVA 3Q0EA 3WQSB 4IMPA 1U5CA 4AJPA 3EY4A 1YVEI 3LYLA 3NEPX 1CF2O 3DZJA 4DMLA 1TT7A 2VCYA 2QW8A 1R4NA 7ADHA 3LZ6A 4RDHA 4Y6RA 4A73A 3PFWO 2YW9A 1Z7EA 3NKLA 4EUHA 1UP7A 3Q1LA 3KBOA 4ALLA 1I24A 2R00C 2D1YA 2RHRA 3L4SO 4IPTA 5AXBA 1R0LA 1YB5A 1YO6A 3TZKA 1P9LA 4J9UE 1K2WA 4BMSA 2GLXA 2O7SA 4KDEA 4YT4A 3JD0A 1YBMA 4H3VA 4IDFA 1IOLA 1KY4A 3M2PA 3L9WA 5K6AC 3FNEA 3HADA 1JKIA 2O3RA 4JNKA 4HP8A 4IY1A 4NFSA 3KB6A 3LU1A 4WOKA 1LSOA 3OHSX 3MJSA 2V6MA 1HYEA 5HS6A 2YDXA 1BHSA 4PIVA 1NP3A 5G0SA 3ZW9A 4MVJH 4FOSA 3E18A 3MJTA 3OFSA 1ZK2A 4AJJA 5F1OA 4E3ZA 1PU2A 4M1QA 5BSEA 4FFOA 5IDXA 5KVSA 5MDHA 4IXWA 2FP4A 4HKTA 3UAGA 3U0BA 2X8LA 4S1VA 4UVDA 2I67A 1KVRA 3OIDA 1PQUA 3WOHA 4TZTA 3C1TA 4GAEA 2VOEA 3OIGA 1QP8A 1MLDA 1GR0A 3HB4X 1DIAA 1RM3A 4B3JA 2FRDA 4GMFA 5KOIA 1PGOA 2UDPA 5JAMA 1N92A 3VH4A 1V3TA 3CUKA 4BO1A 4XIJA 3DZBA 3TL3A 5LDHA 3GGOA 1I33A 1M67A 2BELA 3S2EA 4DMMA 2G17A 2PGLA 2Y05A 3JTMA 3H2ZA 3GT0A 4XQCA 3STHA 2DT5A 2Q99A 3OJ0A 3JSAA 5BR7A 1Y81A 2CDCA 4QSMA 5IFLA 3GN1A 3QSGA 3D3WB 4IGEA 4LMRA 4RF5A 5AXDA 2P5UA 4DLBA 1B16A 1CDOA 3IJRA 4AL4A 1PR9A 4CQLA 1F0YA 3MZ0A 2Z95A 2DBQA 3WGZA 1M6HA 3ORFA 3KSZO 4II2A 4OSOA 4A2CA 3JCZA 3NRCA 3WIEA 4WEOA 4JJFA 1H6CA 3WNVA 4WLOA 2DAPA 3IP3A 4FQ8A 3ROQA 3ST7A 4CM6A 1GY8A 2EJVA 3TN7A 4MIYA 2I3AA 3IUPA 1UAYA 1QXSA 4E33A 4GX0A 5TIIA 4L74A 1LUAA 4L4SA 1EK5A 3K2EA 1Q7BA 3GDGA 3NV9A 4OQYA 4YJGB 3U62A 1UH5A 1H6AA 4IZHA 4DBVO 1IZ9A 3F1LA 4XGIA 1WZIA 4RZHA 2I6TA 2VRCD 2FPIA 4NBVA 4MKRA 4CUKA 1O8CA 2GN8A 1YOVB 4IDBA 4BMNA 3H3JA 4E6PA 4JROA 2JFFA 2TMGA 3RQSA 3GK3A 5TNXA 2PFGA 1E3WA 3HN2A 4C7KA 3RBXA 4EEXA 2C29D 4YB8A 4EJ6A 4B7XA 4E21A 2YDYA 3AI1A 1T25A 3GUCA 4J9VA 4CM3A 2W8ZA 4L76A 1EVZA 1GL3A 2LDXA 4TKLA 4CV1A 1J0XO 2X86A 4XGNA 4WECA 3K2BA 4EUFA 1PJBA 3LSYA 4NU5A 1IYZA 4AJLA 4PZCA 3KLPX 3DBLB 4RPJA 2JCVA 3E5MA 3DHNA 3W4IA 3LC7O 2EHDA 3TRIA 5CDYA 4K26A 2OO5A 2PTGA 2V6FA 1EDOA 4OXNA 5FFFA 3FCOA 2BLLA 1PEDA 1WAMA 3INGA 3WQQA 4YVFA 2D0IA 1IPEA 1YL6A 3OIFA 4QEDA 4BO2A 1GAEO 3MEQA 2CY0A 1VE9A 1DC5A 2WD7B 4CMBA 3L77A 2JAPA 3GY0A 5L45A 4G5HA 1IPFA 4J1QA 1N1EA 3WS7A 1X7DA 3ROMA 4IDAA 2FZEA 4D41A 2IEBA 1G0OA 2NVUA 4YDRA 4Y9DA 3AW9A 3I52A 4DLAA 4YT2A 1Y9AA 3OA2A 3C24A 3D0OA 5C7OO 1LSJA 1F8GA 2VHWA 1HSOA 2EKPA 4RPGA 1WMBA 3WBBA 4CMHA 4QXMA 3PJFA 4J49A 2BI8A 2GPTA 1HLDA 2PD4A 4BB5A 3DBVO 4CM9D 1P1HA 3DHEA 3GDOA 2PZKA 4FJ1A 4XB1A 5B37A 2OORA 5JLAA 2ZYAA 1JTVA 2X0NA 4RF4A 4B4WA 5HBRA 1CERA 3INTA 2QZ9A 3MJVA 1OZAA 1NASA 1GUFA 2Y1OA 4CM7A 5GMOA 1PGNA 4Y98A 3KVOA 3V2UA 1MA0A 4W9NC 4JP3A 2HSDA 2I66A 1BGVA 1SMKA 4E2XA 1Q1NA 2Y1DA 5F5LA 5U1PA 4GPD1 1QLHA 1NAIA 1QKIA 2WM3A 4GH5A 1DJNA 3AFMA 1ZBQA 3KZVA 1WLYA 2DU8A 5I9LA 4HUJA 2J3HA 3R6DA 1N2SA 3CZMA 1TXGA 2IEDA 3H5RA 1Z6ZA 4UEOA 1UDAA 3ZV4A 4R51A 1IB6A 9LDBA 1HDYA 5G4KB 5K6AA 3FNFA 4KUHA 4M55A 3AM5A 1H9AA 3ZZNA 1J6UA 1LXCA 1OBFO 4DREA 4C4OA 2UAGA 4XEHA 3FNHA 1UDCA 2X1HA 2WE8A 3DB2A 5LC1A 4IMRA 4ZRMA 2VZ9A 3H5NA 4Z0HO 2OHXA 5TF4A 4BNFA 3ANLA 1E5QA 1UZMA 1Z73A 5IZCC 4EYEA 3ONFA 4AJOA 1RWBA 1B15A 5KTKA 1ISGA 3C1OA 1PSDA 1MXHA 3G1UA 1KVQA 1O5IA 2NTJA 4DQXA 3SBOA 3JQ6A 2ZB3A 3PHJA 3D7LA 1HZJA 1V35A 1O95A 2VYVD 2BHLA 5AXCA 4TKMA 3OP4A 2PGJA 3EYWA 3OECA 4G81A 4BV8A 3ZHZA 1DXYA 1HT0A 3ITDA 4BQPA 4YJHB 2WMDA 1ZEJA 4Q3EA 3CE6A 3WNQA 4QFDA 4B3HA 4PLVA 1ZKMA 2JAHA 3DHYA 2WD7A 3HUDA 1GZ3A 1LDGA 4YPOA 1RM5A 4GSLA 1F8FA 5CDTA 4RPKA 3MTJA 2Y0DA 3L6DA 1EVIA 4ITUA 3TF5A 1Q0HA 4Z6KA 4RCVA 5JW6A 4JXKA 4XJTA 4U5QA 5G2OA 4CR7A 2WD8A 3S8MA 4CODB 4BNZA 5EPOA 3PHIA 1LDYA 4QTZA 4KQWA 1HE4A 1DEHA 1Q2XA 4GGPA 4HNHA 3CPSA 4TROA 3JQEA 3JQFC 1LEHA 4HBGA 2BGKA 2NADA 4XCVA 3HNPA 5T64A 5TJHA 1RJWA 1KVUA 3GAFA 3GZ4A 1Y5MA 2PV7A 2B0JA 3U4DA 3EHEA 4XA8A 4ALKA 4MJLA 2HK7A 1OI7A 1U7HA 1JA9A 1ENOA 3KSDO 4QFCA 3KYCA 2GZ3A 3ZCXA 4BNKA 4PRKA 5DP2A 2O2YA 2VUTA 3IAHA 3DOOA 4KP7A 3L6EA 1FDVA 5AQ1A 3I3OA 1ZK4A 1NFFA 3NX4A 2WE7A 1ZCJA 1Z74A 3N58A 4CMGA 2AEFA 3KXDA 4W7HA 1R37A 2NQ8A 4JLWA 4GGOA 3B70A 4IDGA 2HMUA 3PHGA 4FJ2A 3PIIA 1T24A 1BXZA 1K0UA 4RJTA 3M1AA 4W99A 5JC8A 1DAOA 2GASA 4J1SA 4XQ9A 3K31A 4CMEA 3RROA 1AUPA 3PRJA 1N5DA 3GHYA 4Q3CA 2X58A 1H0KA 3PZBA 2A4KA 2EG9A 2ZCVA 3ZN2A 4DIBA 3TOXA 4GQAA 3ENKA 1A4IA 1Y9EA 4BQRA 3HDJA 1KC3A 3QWAA 3L07A 2EEZA 2PZLA 4OQZA 3PK0A 4OGWA 4TVOA 2I5PO 3F3SA 3SVTA 1FDTA 2B83A 4CQLB 3DMTC 1WDLA 5I9MA 1I5RA 1ZVMA 3D3WA 1GUZA 4DC1A 4XD2A 4QO7A 1ADCA 1NPTO 1U3VA 2BFMA 1E7YA 4NQZA 4WNIA 1TA4A 1ZK1A 3PGJA 2HAEA 4BNMA 3DTTA 3KV3O 4Q3AA 4ZQGA 1PL8A 2BFPA 4NFHA 1I01A 3BXXA 4WCDA 1OC4A 3PDUA 3H3FA 4CL3A 3ZGYA 2FPGA 2P9CA 4H15A 2CD9A 3ETEA 4D0RA 1HWYA 5ICMA 3SJ7A 2X23A 4BNXA 2Z1NA 1GQQA 4ZN6A 1DC3A 1E1KA 1Y8RA 3GRKA 3NTRA 3WSVA 4BNGA 2YUTA 2CVZA 1VLLA 2OZPA 5A05A 1UZNA 1N7GA 3SEFA 4DC0A 2PWZA 3DAPA 3ETGA 3PXXA 1HE2A 1F12A 3KYBA 3UH1A 3I9NA 3OQ6A 4YAEA 3NT5A 3WGOA 1HKUA 1YDEA 3I4CA 2ZTLA 5G4KA 1DO8A 5G0WA 4RVUA 1KEPA 1I2ZA 2YY7A 2YQ5A 5H82A 4AJ1A 4CPDA 3ZV5A 3MJEA 3PWKA 1ZEMA 3UFXA 2XPCA 4NIMA 2YV2A 3E5RA 5DOZA 1E6WA 1HTBA 1PWZA 2ZTMA 3NTOA 4J1NA 4OH1A 1ZZEA 2C54A 4PLZA 3PQEA 4S3MA 2FWMX 2JL1A 3PWSA 5LDGA 3BMNA 1EZ4A 1E92A 1SO8A 4WLEA 1X14A 2RHCA 1N9GB 1Y5RA 2QYTA 2Q2WA 5C5IA 3FRJA 4CQMB 5DP1A 4B4UA 4NZ9A 1GV0A 4JJGA 4HFJA 4RVFA 4WCFB 4RGBA 1K3TA 1E3EA 1SC6A 1ZIDA 2EERA 3G79A 4KOAA 4XQEA 6ADHA 1EQUA 2G1UA 4NK5A 3DBRA 3H6KA 4GLLA 3OSUA 4GVLA 1C1DA 2I76A 5COAA 5T6BA 3FWZA 4I5FA 4CMCA 1EEHA 1PGQA 4BNJA 3VZSA 2FOIA 3AWDA 1T2DA 4J16A 4OO3A 3GDFA 3F5QA 4CUZA 4NR0A 4YT5A 4GMGA
chains in the Genus database with same CATH superfamily
3ABZA 1AN9A 1GUYA 2JPDA 2X1VA 3PJRA 3ZDQA 2BD0A 2IX9A 2JCGA 4FNMA 1Q77A 3BN3A 2O8VA 1L5SA 4O4JF 3RUFA 3CH6A 4IIXA 4U7WA 3PVZA 2WINI 2I3GA 2WMNB 1Y1SA 4M22A 3IFSA 5H59A 1XDDA 1RWPA 1T6YA 4L6IA 4DIMA 4IOLA 4YYZA 4OIFA 3RJ5A 2XKJE 4JC0A 5BP7A 2Y2VA 5LQRA 1LCIA 4RKQA 3B52X 4NCKA 2ACWA 3DT6A 5G0UA 1SUCA 5THXA 4DEYA 4F1WA 3U26A 1OI2A 2DJIA 5A7HA 1Y7IA 4K6OA 1H2YA 2F59A 4FLEA 3KZNA 3T7AA 2ZBDA 4Q7EA 2ZSJA 1JEAA 1GGVA 4D4GA 5JZBA 4PTYA 1T8TA 1E6UA 1W94A 4RSRA 4RW0A 1XZPA 4UARA 3UJ8A 4E51A 4KQIA 1XNRB 3COWA 3QLEA 1W46A 1C7RA 3EF0A 3OJOA 3WK4A 4GXNA 4NYJR 2XUIA 4JWKA 1MX1A 1CBUA 1L4MA 4MMZB 4AF6A 4HDNB 1GN9A 4TKVB 2V1XA 5FWXA 1PDOA 5FXMA 4YC7A 2I9PA 2RC5A 4Q7JB 1RR6A 3NASA 1WVGA 1E8NA 3O75A 3PGA1 3EMKA 2V0GA 1N6HA 1R4NB 4ETNA 2JLZA 3ENVA 3GLGE 2Y4NA 1G9XA 2ANCA 5E6RA 1FFEA 1HMPA 3IUQA 4IX9A 3A06A 4RM3A 2GK7A 1M76A 5ALRA 3WHKA 4NPCA 1JSXA 3IO5A 5DDIP 1N7IA 3RSQA 1QF9A 1HE5A 3DUWA 1N6LA 2P6UA 3FJYA 4FYPA 3TLGA 1N5JA 2C58A 2WIFA 3TLXA 1WMDA 1FTQA 1I9CA 2WWIA 5KYUB 3N8GA 4U00A 3U2QA 4F5YA 1D04A 4ZVPA 3FCXA 1XKQA 2QORA 1USKA 5DCYA 4G07A 4FCTA 3TR5A 4V39A 4KR3A 4HF7A 5K0BA 2X5XA 3I1FA 1E9DA 1JV2B 2ECKA 3FZYA 4PX2A 3E23A 1GYRA 5A71A 2HIHA 5JH7F 4JNCA 1EUDB 2JGEA 5E0KB 3FRHA 1L9XA 1G8JA 2G7MC 3ICQB 1ZH8A 3VH3A 1GCAA 2A0FA 2XBUA 3DZDA 3I9MA 4LWOA 1JHZA 1K7SN 1PV4A 5ES3A 5KYWB 3NBQA 2Y0EA 4JYPA 1TQHA 1J2TA 2J6IA 4PHCA 1BQ4A 2I1QA 2LUOA 2W6OA 3DV9A 4QSHA 4DXDA 2M1XA 2ZYTX 4GPBA 1QOZA 2YXDA 1ESMA 1TK2A 3FWHA 3K4PA 4EFNA 4FGUA 1A8SA 2C9DA 2JD2A 1T4DA 3MLBA 4G8BA 4L6AA 3SK0A 1I94B 4DIEA 3GXOA 4UHBA 2Q2VA 4PZZA 2O7VA 4HZUB 2FN4A 2ZRHA 2VTEA 2JH9A 3OEWA 2QRJA 821PA 2WM8A 1NU8A 1NXPA 3FMGA 4OGFA 1Y8RB 5AR1A 4RACA 5F7JA 2WHQA 4M0CA 4BHTA 4DIUA 1DXQA 4AX8A 3A14A 4AS2A 1Z17A 5SICE 1V7ZA 3LPLA 1IONA 3L0CA 4WUTA 2C42A 3FSGA 3IOBA 5TE9A 2ZDQA 1ENYA 1N6OA 4UVHA 2ZB8A 1B43A 5AXAA 2VQ3A 3KWFA 3NOXA 4EY6A 4RJKA 4JFAA 1P18A 4BKOA 2BHTA 3UYLA 3O4HA 5K0EA 1N2CE 3BGOS 1FTYA 4YMIA 1WW8A 3BH7A 4QNRA 2W37A 1R8JA 2ZYRA 3IXQA 1P0PA 4ND8A 3VO2A 1KVTA 1XTZA 5F73A 1BDMA 1EFPA 5FTJA 2OV2A 1LDBA 3ED5A 4GHWA 1ORHA 2I8LA 3NORA 1LPAB 3D0QA 2GDZA 4GRIA 1BCRB 1J8DA 2Y9ZA 1SJ9A 1Y7TA 3D8NA 1KK3A 3D7KA 2XRYA 3QE3A 4UTOA 2B9VA 5CNJA 4EHJA 4MGHA 1V4VA 2H4XA 5E9JA 4J0CA 4ME6A 1C4KA 5JCOA 1L7EA 3FETA 4YRSA 4K9NA 1DC7A 1GGJA 1KWKA 3FPCA 2QMHA 2Y1FA 3BGIA 3H65A 1AHHA 1BWQA 4D9EA 3GG9A 3HR4A 1HF3A 3EA0A 3P0IA 4BNVA 2UVQA 1W93A 3DF7A 1DNPA 4EZBA 3LIPA 4ZJUA 1SVLA 1JFVA 4DR6B 1L4NA 2ZLBA 5CNKA 1UBUS 4BFZA 4B5KA 3F8WA 1H2HA 2NSYA 4J6EA 3Q5GA 2IHZA 4BGVA 1GNRA 4ZT7A 4L27A 4UHFA 1CZOA 1JPNA 1TAGA 3TSCA 1BTOA 3OBBA 2VJCA 5IS2A 4RTOA 4KRGA 5GGYA 5JZOA 2B99A 1ULZA 2G80A 2H63A 4O3MA 2C9CA 4EG8A 3SIWA 1EK1A 2A5YB 4ND3A 4YYEA 4ZTBA 4BP1A 2YRWA 3AF3A 3B8HA 2FPRA 3WDKA 1OI3A 1RHKA 2L17A 2LRHA 2H1OA 3MHTA 2I6UA 3LQQA 1QTQA 2QX4A 3FHOA 3FCAA 4DT1B 3RGWS 3LF1A 4B87A 3HA5A 1KDZA 4C01A 4CBVA 4ZYUA 1CEEA 5C2JB 2XDYA 3KLBA 5CDSA 4XX0B 5EJAA 1PFKA 3TNLA 2HYIC 1JI0A 1TZ2A 5JY1A 1BRMA 4I5EA 1D3AA 2ZQYA 1FRNA 4EPVA 3MD0A 2G83A 4YAKA 5C5EA 3WBFA 1VJ0A 2QN7A 3AC0A 3MS7A 1QYDA 2C7PA 3S44A 5CDUA 3MCUA 1J99A 2QN8A 1X7WA 4ZQFA 1DDGA 1OVMA 1VJRA 2IE0A 5BV1A 2VP0A 2WWVD 5AM3A 1CJTC 1P6XA 3R0JA 3DHVA 4NCAA 1P45A 2PUTA 3O1HB 4NJOA 5F4BA 1Q83A 3WE7A 4CM4B 1X80A 4R2LA 3NWOA 2X19A 3PLAE 2Y66A 1NVUQ 1ZI9A 2JCXA 3HXOA 3DLBA 2G0TA 1VYTA 1G7SA 3NZEA 1IZYA 3KYJB 2QRQA 2WUVA 4O0LA 4P3XA 3ZE8A 2UVDA 2N75A 1T35A 3LVFO 3N6RA 3HYSA 3ZY5A 3WFIA 4GBGA 2YOFA 2VOJA 4HYQA 4Y1FA 2JGDB 5AI5A 1IHOA 3VBEA 3R6TA 3VOAA 3L4KA 3BULA 3IJEB 2CXHA 3QUBA 4AS3A 3WAKA 3U6BA 1UBLS 2FEMA 3LVBA 3M81A 5DYTA 3DH0A 1J49A 2FKAA 2GZHA 3N70A 5U9CA 4P98A 4ED9A 3U19A 1U1GA 2W70A 4QRIA 2H7CA 4TKZA 3Q10A 4FSHA 4TS4A 4M76B 2Q4DA 1JR3E 4QFMA 4LGYA 2GFQA 3EDRA 1I30A 3B89A 5KO2A 5G1OA 3DLIA 3QY0A 3CR7A 4XQGA 2AF4C 2M32A 4QUBA 4ZQEA 3C7TA 2FOLA 2VT7A 2WJ3A 1OYWA 4RF2A 1ORDA 2W90A 2CXRA 2IHJA 3DL4A 1PQYA 4R9NA 3OJFA 2I80A 1DFIA 4M0LA 1I32A 1W2WB 1T1SA 2OFWA 1CT9A 3AR7A 5EXXA 1ANKA 3V3TA 1ZQ1A 1G4UR 4DLNA 1DZ3A 4M21A 4MWCA 1V8DA 1F6BA 3F49S 5GOTA 2ZI3A 4Y2HA 4B8WA 3MRXA 5C3UA 3GLFB 3MT0A 4UHJA 5TQJA 2JJ2A 1II8A 4FPXA 4G0QA 4MROA 3F97A 3HL4A 2IH2A 4K5QA 3HXLA 5FOXA 2AI2A 3DE3X 1G3IA 1W1UA 3C6KA 3OLWA 4YDSA 5JUWA 5KOHB 1YSCA 1JQAA 5K8VA 2HIMA 2ET6A 1YE5A 4G1EB 2IUUA 4AIRA 3WIUA 4CM8B 2W4QA 1RPZA 5LZ4A 1CQJA 4GL2A 3OIYA 1NTOA 1YC2A 2PZGA 4RZUA 1J20A 1LI7A 3UTCA 5B2FA 3B53X 3UJ7A 1BFUA 2F6RA 3M4JA 2HHHB 2ASEA 1CUGA 3R2JA 3ZWYA 1SBCA 4ZCIA 2AC7A 1CQIB 3G9ZA 1S8FA 1NQOA 2RAUA 2NUPB 2XMBA 5J23A 3CEMA 3IOYA 5JFOA 1NT2A 4Z1OA 5F21A 3RC9A 2FZKA 3N7TA 3ZDEA 1GNPA 4XRRA 4AD8A 1QHNA 2Z8YA 3UYKA 2A5LA 2X2OA 2WSMA 3JS5A 4PU0A 4UJ5A 1SH7A 4XIYA 3IAS6 4ZKDA 2HJ9A 1QLWA 4JJIA 5MFZA 5THQA 1S96A 2FCRA 2QRKA 4C3ZA 2QXYA 4PBSA 4FN4A 2Q9BA 4TT3D 1G8GA 3OEYA 4P83A 1J1UA 2D1SA 1J2RA 2YS6A 5NLLA 3F74A 3N8DA 4F3RA 2C9ZA 5KCZA 1FOEB 3P9ZA 1KRXA 3PHHA 3ZNQA 4I1PA 4YTEA 2KLBA 3ANMA 1Q16A 4HPXB 4QJ3A 3FOBA 1E1MA 2QIOA 3FBWA 2ZJZA 4OB7A 5KJCA 2HF2A 2I2FA 5T4FA 5KHLB 3TFOA 3Q3VA 1QGED 3MWEB 2LWIA 1KSJA 3B6MA 1DDOA 5CPBA 3SZMA 3TQQA 5EWJB 1EVLA 2IH5A 1XR3A 1CW2B 3H2HA 5JNSA 1ZI8A 2DRIA 4E1AA 1T4CB 1FU8A 1EJ6A 2H4JA 3DDNA 3QMMA 5KYNA 2OCGA 4UM7A 3G2QA 1TM4E 3D6AA 2WYHA 2MYTA 1GHTA 2YXLA 3D2BA 4GM4A 4CM5A 3KQKA 3FUCA 4HZGA 2BFAA 4OQNA 4YAJA 1YMUA 3T41A 1W4RA 2DQZA 2XTAA 3PEWA 1BXGA 1ZAKA 1L7XA 1IM2A 2GYYA 1H2EA 2CT8A 1SIBE 4Q24A 4I8XA 1XO1A 2QWXA 1L9KA 4FMBB 1FP6A 1RC1A 3D02A 2WVAA 2IGTA 4REQA 4AJNA 2LIVA 2TS1A 1OU0A 1RBQA 2CCJA 1AURA 1XKXA 4PSKA 3LBHA 2JFZA 1ZPDA 3O92A 3ZY6A 2I4TA 3SC3A 4QDXA 1JWLA 3ICPA 3VDRA 4AMZA 1L5WA 4M37A 4A7PA 4C0BA 4OBXA 2OBNA 1DX6A 1UCFA 3LDGA 3TJMA 2WYUA 1A9ZA 2D00A 1Y3IA 1XYGA 4JZYA 1VPWA 3TG2A 2C9YA 1FYEA 3QXJA 2BBOA 3A4LA 5HFNA 1NURA 4TZ6A 3C8ZA 3WIOA 3ZNNA 2SBTA 1E1LA 5EL0A 2OD7A 3OM1A 3OZVA 1YZUA 3UUEA 3T95A 1OV4A 4YCCA 1UMBA 2RBEA 4EFKA 3TQFA 9ATCA 5DCUA 3GD7A 4BKMA 4QLAA 1WU7A 5HRAA 4IIVA 4FQ7A 3OJCA 5EIOA 4ZVKA 1RXWA 1RYFA 2H1HA 2OM2A 2VT3A 1HI9A 2LW7A 4KN9S 1DAHA 1VHQA 2JFBA 5FWYB 1MJGM 3ZV3A 5LN1A 1Y6QA 4US0R 3V55A 3LX6A 1QDEA 1UP4A 4IVRA 2I6XA 3NTVA 1XZ8A 1QYRA 3AR5A 3RYCB 2A3RA 2BBSA 1VGRA 4G65A 1RSZA 1BKYA 5AKZA 3UUWA 1WZNA 3UMVA 1UFVA 1XVUA 2VPXA 2X0DA 3DCYA 1AG9A 3DFUA 2EFJA 2H2FA 2OWDA 4UPVA 1CUXA 1NBEA 2KQUA 3IAM6 1P5RA 3L18A 5EWLB 3UOWA 4CT0A 3L4BC 1XAHA 1Y7LA 3EGOA 2GT1A 3KFXA 4WINA 3OA0A 3V2HA 3VUFA 2YN4A 2I33A 2CLIB 1C7FA 1YB7A 3ZGLA 5A9SB 3FPKA 1OVGA 1T8SA 3DLTA 4QUKA 1RQ2A 4EWLA 1UJNA 1LU9A 5L3SB 1FZTA 3VR2A 5L7TA 4KO3S 4NONA 1M33A 1X13A 2BEKA 3LA6A 2OXTA 2XRZA 3IVCA 4S1TA 4ER0A 2ODTX 2BOVA 2HSWA 3OE7D 3S2GA 3SX0A 5FI5A 3CVWA 1XG5A 2H06A 2QQGA 4CRWB 5ALLA 3SBEA 1FFDA 3G9XA 4IH1A 3DXFA 5EUQB 3G5LA 1J42A 5DI3A 3RBZA 1JLSA 3U4CA 2VDRB 3GWZA 4E6EA 4KMRA 2H11A 2G28A 1HM5A 4PIMA 4HVLA 1IHXA 1AKMA 1QH8A 5HM8A 5SV2A 4LA4A 1KRWA 1OIVA 4JLDA 4MAFA 2JNWA 3K8OE 1JEOA 1XZLA 3IVMA 1QIMA 1I0IA 1DKPA 4YP7A 1IUOA 1DBRA 1UKVY 1E7SA 2ZJFA 2ZJ4A 4JLPA 3A28A 5C8VA 1ESNA 1NVVQ 2DJ5A 3BZUA 3A3KA 3WGQA 2BEUA 1XEWX 4ZPXA 2P75A 1BA2A 2C0CA 4JSTA 5FNZA 4PE5B 1FVFA 5EERA 1TX4B 3O4VA 2HTFA 5D5HA 1ISPA 3K16A 5CRIA 3E48A 5FUYA 5ILOA 1W25A 3TUJC 5KNBA 4NCNA 1CYDA 4HDAA 4O33A 1DBSA 3GVPA 2C7VA 2NNLD 4UDYX 1GZ6A 4RULA 1CCWA 3CPHA 1JAYA 4UZEA 4ZAXA 5ADHA 5ICCA 3IDFA 2EQBA 3LGAA 3JWIA 1TIPA 3OTIA 4JGIA 4TQAA 4OB6A 3IKMB 1ZG3A 4ENRA 2A84A 4DADA 2A1IA 2QMYA 1N5RA 1IZZA 4IM7A 1Z25A 1SRRA 4TV9A 1G5FA 1KOFA 1ZOPA 1U3FA 3DB1A 4BNIA 1MFZA 3DKRA 4K9OA 3CJQA 5D51S 4D9BA 3WLAA 2NUBA 5K8UA 5TQ2B 4P7GA 2F48A 1XTVA 4K6GA 3V80A 1FW8A 1RWOA 4JQCA 4MGIR 3T61A 3DOHA 4JQZA 4C03A 2EGGA 1MB3A 1C0IA 2V8BA 4V0SA 3RFXA 3H2IA 3ECAA 4PSUA 4JV5B 2O2EA 1B1CA 1KYVA 1Q0UA 2OCLA 4V38A 4W82A 3DEHA 3UJCA 3WYBA 4WLUA 5DH9A 3C5HA 3LI2A 3TGLA 1G7CA 2JI8A 5F1YA 5M34A 3LS2A 3HCDA 4EUKA 1H5UA 4KVAA 5TQ0A 5LYJF 2EP8A 5ELXA 3ZVLA 2QU7A 4NCJA 16PKA 2IV3A 1T3GA 2DUUA 2P3LA 4AMBA 1QP7A 2IS4A 4HDRB 4MS4A 2IC5A 5GZ3A 1G0NA 1JKFA 3C2QA 1TTHA 1NX6A 1V1RA 3W6PA 4JBIA 2EF1A 5FNVA 3K9BA 3RYFA 1BH6A 3A2MA 1NJSA 2NTVA 1COWD 5EY5B 5IDVA 3EF1A 4C7BA 5FD8A 2WHPA 2WV9A 1XF9A 1UBMS 2K6GA 1OKKD 3KHSA 3EGWA 2F90A 1SOWA 4DTIA 3RUAA 5CM8B 4ZOCA 1PT9A 4BNYA 1MAHA 2WEKA 3LT1A 3IUYA 2HLDD 3AEXA 1EX1A 3R6WA 5LXTA 1CRQA 3F3MA 3QXCA 5CVJA 3V32A 3I5YA 1RPJA 2HHAA 1BMTA 1GEEA 2O8CB 1X0VA 3U37A 3LZCA 4E11A 1GPJA 1JWAB 5GONB 5KDLA 1XDBA 1NPDA 5C5CA 5I7EA 1GGEA 1OZ0A 2Y1KA 3FPSA 1KETA 4LBYA 4HWRA 4QARA 3ZHUA 2FPGB 1H4QA 1Q2UA 5IJ0B 1CIJA 4TVKA 1EFRD 3VVLA 3WKDA 2R8BA 1JVSA 1L7AA 3B2NA 4QDJA 1N0VC 1DKUA 3OWXA 1DIBA 2FSSA 4C2BA 5BUSA 3GLFE 2XZDA 2ZS9A 3SLGA 5L4LA 2DETA 3KD3A 4DCCA 3IHTA 4UULA 3CRQA 1XZKA 3V4VB 3EK2A 1KZHA 4MR9A 1ZKDA 3DDHA 2GN0A 2GQ0A 1RAAA 5F78A 5JRZA 1M1YE 2G8NA 1T2NA 4GRAA 3U7RA 2CNOA 4GIBA 4HXYA 4TLLB 1NFQA 4RIEA 4BRWA 3MMSA 2POCA 4JC5A 3EX7C 1IUPA 3UQYS 4N8SA 4EMUA 4Z4QA 1ZNQO 5JY6A 4W7IA 2FETA 1M1UA 3TXXA 1YI0A 4X00A 2CFOA 2Q1TA 3D4LA 3IP7A 3VU0A 1I0LA 4H16A 2GEVA 3UH0A 3EAFA 4U9UA 2NZYA 3AKDA 2QZJA 4GKBA 3AHDA 4R81A 3V6MA 1Y1KE 2FVYA 5JFTA 1A95A 1OAKA 1N1MA 2ZKLA 1JSLA 3NIDB 1RTTA 4WKPA 4JB8A 1EB9A 2MT9A 2RIRA 2GLUA 1FTNA 3H5OA 2A9QA 2XE6A 4PLWA 4WJKB 4BTVA 2ZRNA 4Z8YA 4KYVA 2HA7A 2WFLA 2VJKA 3AR2A 4OLFA 1GPH1 1SELA 3WL3A 4HO1X 1U1DA 1IMJA 4L1KA 1U2ZA 1P74A 4QT4A 2RB5A 3W5VA 4R01A 5AP9A 4RQBA 5D8DA 3ZNPA 2JLRA 1XFAA 1R8QA 3TX2A 1EWVA 4KV7A 2W6ID 5IVPA 2YHIB 1C7QA 1F2TA 1IG0A 4W5TA 4G4GA 4ILKA 2V3CC 2WKPA 3JV7A 3NFYA 4PC6A 2O20A 3USCS 3QYPA 1PQ4A 4XEUA 3H8VA 5H9VA 4EPRA 3D4PA 3PX7A 1O1YA 2JFOA 2XMSA 1PYOA 3H1GA 3E8XA 2OC4A 4X6XA 5JAZA 1YVRA 4E22A 1HRDA 4FW9A 4L3WA 2D2EA 3LYAA 2YZMA 4R3UC 1OH8A 3I5MA 1U2GA 2K2QB 4Y9UA 3FSJX 5EIBC 3CEJA 4DMUB 2RGUA 4OMUA 4HBZA 2CFIA 3U4GA 4GWGA 3BIFA 3JQ8A 1TLFA 2I1VB 3FUWA 3A6JA 5HRUA 4QPCA 3EXAA 5KJFA 2Z83A 3VDNB 4A8PA 4ARVA 2RE8A 1NLYA 3AUXA 1ATZA 3JYPA 3RK1A 4M89A 1ZIXA 2C83A 2W98A 3MERA 4QUDA 2QX8A 1X19A 4AI6A 1V11A 2C99A 2ACEA 2CHUA 1X7XB 3U7IA 3K05A 2VH2A 2I3ZA 1A5BB 4JVNA 3K32A 4R2IA 3AERB 4D5EA 4F46A 5M2QA 2PX6A 3H05A 2VI5A 3HEBA 4O1HA 1P2FA 2ZUUA 1H2XA 2XUKA 3KUKA 4Z1MA 3U7QB 5TMDA 1SUDA 1UIMA 2WW8A 4MPJA 1U7TA 5A5EA 1UAAA 4YO8A 1CY1A 4HDSB 4BNNA 1RLJA 3V1TC 2JW5A 4JJEA 2COKA 4O4LA 4YJ2B 5ALWA 4D42A 3NHLA 3V46A 4JR1A 2AZ4A 1KQGA 3VSEA 1N36B 1DO0A 3W5DA 1XMPA 4Q1VA 3GPLA 3ZIAD 3RU9A 2JGNA 4LDNA 2F1RA 4URWR 2J3JA 3DTVA 5BPFA 3GBSA 3K96A 1KERA 4RV4A 2OHGA 1A4UA 1VCNA 1D1SA 4P08A 5JOQA 4C7VA 1D0IA 3RTCA 1A7AA 1ONOA 1UPUA 3K5PA 4OM8A 4IHJB 4NEGA 1V47A 1NV8A 3KJFA 4V1CB 1LBQA 1YZQA 2ZJ0A 1IBSA 2DQ4A 3EEFA 2KE5A 4XVQA 3OCVA 2Z9BA 4QPJC 3ZLJA 3H5TA 5FTLA 2VNAA 2VIIA 3F98A 3FGNA 1MQ8B 2CE7A 1FCJA 3PTZA 1MF7A 1WPXA 3FMPB 4PF1A 4D44A 5KPDA 3AI2A 2HU7A 3BMXA 4B6OA 4NOLA 1T2CA 3FWYA 5IAAA 1GRCA 1R9NA 3B1FA 1LC0A 1YI8A 1KPIA 2ZYUX 3BK1A 3IQHX 4RANA 3UKOA 2GD0A 4TMFA 2WIAA 1U7UA 3FMFA 3GARA 4X92A 1HFWA 3R3VA 4L07A 4A2QA 1XMQB 1DJPA 1EQ2A 4IKEA 1L1RA 2CZGA 2BSQA 1WV0A 1PT8A 1E79A 4EG0A 2WUFA 1OXKB 4D45A 3HPQA 4YJ2F 1KAHA 1PS0A 3GJTA 4L9RA 4GC5A 3O8CA 3D81A 4W5JA 1RAFA 2H9IA 3GLIA 1U2SA 1RJEA 2KHZA 3L7KA 1ISRA 2W8BA 3IHWA 1QQ6A 4QU8A 1PUIA 4IJ5A 1PS8A 1DQYA 1ML3A 1FFCA 3W8EA 1A69A 5AQEA 1YZLA 5LWHA 5C52B 4RADA 3EIUA 1W29A 3AUTA 3E3MA 3OAAD 1IZ8A 1NJ5A 2QBYA 1ECJA 3TK1A 4Q4CA 4KUEA 1MBZA 3UHFA 3D4OA 2ZSDA 1XD2B 2HHCA 3H0CA 4AZ0B 2Y0CA 3O4FA 4MDHA 3SF8A 3KJQA 1HDRA 1N2BA 1QH1A 1YA4A 2F3SA 2FUG6 1X7WB 2DPGA 3L8MA 4AKHA 2Q8QA 3I58A 3V1NA 2GJKA 5JMWA 1SWWA 3T0GA 1J70A 3GJYA 2CB0A 2GTIA 2Q1SA 3DEYX 3ITNA 1M72A 1FLAA 2CMFA 2W2KA 3ITKA 5F1PA 8OHMA 3IKLA 1VL5A 1YRQA 1K92A 4X7RA 3NIBA 1XRJA 1CY6A 2OZLA 4HMPA 4PM4A 2PY6A 4MV1A 4FEEA 3ZWXA 2W9XA 3VRHA 4PC3A 4E07A 4RDIA 5L3ZA 1HURA 1KJZA 1RYZA 2B35A 4FBLA 3CZRA 4UEKA 1V2GA 4ACBA 2A9PA 5A03A 1YA8A 5JDIC 2XCOA 1T6ZA 1JLMA 2R25B 3QPWA 3JYQA 3K15A 2FHSA 1RYYA 1RC0A 4JJ7A 3AF5A 1DXOA 2UXCB 2HF9A 3TL6A 2W8BB 2FI1A 3KRTA 3HJAA 4HDRA 2EV9A 1PDVA 2DFTA 4O5AA 1B76A 3T9FA 2AXPA 5B1HA 2J9XB 5CA1A 4CR8A 1B73A 1EVJA 1GZ7A 3K53A 4I55A 2WTAA 5FBWB 1R4ZA 1Y1LA 4Y6QA 3MGAA 1AQIA 3RDPA 4R1SA 4N7RA 1JG6A 1VQ1A 4YQYA 2OV6A 1ESDA 2QZZA 1M1YA 1L1QA 2VP6A 3CM0A 4KMSA 4YR7A 1J25A 4N5MA 3KEFA 3L6OO 2HBZA 2VZ8A 4MAMA 4NENB 4RQAA 3ZUGA 4DIKA 1WCWA 1YH3A 1ID8A 2GK6A 3L7JA 5BYKA 1ULTA 4Z99A 3DC7A 3I0NA 2QENA 5KKNB 3ICVA 3DTNA 4MWEA 1I7PA 1KO1A 2QVCA 5AOVA 1Z0SA 1Y42X 3N2YA 3ANYB 4GQBA 4MW2A 2GERA 3O73A 2D5CA 1TYZA 4HMOA 3QVLA 1PDWA 3FNIA 3V8MA 1SQGA 3UXHA 2YHAA 3OUUA 1A7JA 3JWJA 2VA8A 4O4IF 1SCKA 1IY9A 3L3BA 3JWPA 2WU3A 1X7XA 4K9KA 4KPGA 5FEMA 1VHLA 1II9A 2BKAA 5AW9A 3GP5A 4F3YA 4OMFG 3GLUA 2Q29A 3BIOA 1RXCA 3U09A 4X24A 2ZXEA 1QV6A 4W5QA 4EHKA 3AIOA 1SQ5A 3HV2A 3UB2A 2BSAA 4L50A 4JBYA 2N47A 3W78A 1A8HA 3FW1A 1Q3TA 1TF7A 3O4IA 1NOJA 4X60A 1YZTA 2WFMA 1E2PA 2O6LA 5AVTA 4R1NA 2PWBA 3QBTA 2OCBA 1MPXA 3TKYA 1U3DA 4HFRA 4PWYA 2HA0A 3BZWA 3HS3A 4YP9A 3VJRA 2ZCUA 3ZZTA 4ZAGA 3GZNA 3BMCB 2FPUA 4G5YA 5KU7A 1AKNA 1Q7RA 2SHKA 2XIQA 2UZ1B 1PK8A 1ODCA 4KSYA 5ALGA 2C98A 1NJGA 4KXMA 4O4JB 4KOEC 3S99A 1Z2PX 1T2AA 1Z22A 3IHLA 2Q7XA 1NA5A 4DDHA 1PK7A 1GIAA 4POAA 3TCNA 4R83A 4MVJF 3UMMA 5I5EA 2WJGA 4TWZA 4QLOA 3LBIA 4MYTA 3WB1A 4ZREA 3DE6X 1AKYA 2A0KA 3D7SA 3GEIA 1GG2A 1KFKB 1KBOA 2P6MA 3I8SA 4HVCA 4G0PA 1FRQA 5CEEA 5EZYF 3P2MA 1QAQA 1KBZA 4I4LA 4Q9AA 5B12A 1RLTA 1SY7A 2PYIA 4JWTA 4A6EA 5M3BA 4B47A 4FGLA 4WJZA 1O0SA 1ECBA 2FMXA 3C70A 3MBOA 2AQKA 1X1BA 3PYLA 2QTNA 2XLBA 3R40A 3WGYA 4ADSG 1RBYA 3ESXA 2WJ4A 3VTKA 5E6SB 4QPZA 4DTCA 3E5NA 1ENPA 4X9XA 5I9NA 4JXXA 4QOHA 4M60A 2UZ3A 3ZWNA 2W2LD 1Y6RA 1ILEA 2FPSA 1VPDA 2DTDA 1SCJA 4XB2A 3V7YA 2IYWA 1Y4SA 1X42A 1PGPA 4RWEA 1US8A 1I36A 5IK2D 4WKNA 1U0JA 1EGMB 4LDQA 3MMNA 5FTMA 3STUA 5TLSA 4P35A 1LBSA 3KZMA 2J1LA 2I8AA 2WQ7A 3EUAA 5LJIA 4Q37A 1RWQA 1ISFA 3VZDA 2C2YA 1RWXA 4GVXA 4B2PA 4R69A 4YP0A 5KQPA 2YHIA 2O2HA 1DWUA 5KYYB 2XAAA 1NRXA 1T3LA 2VAMA 1Z7BA 3HMKA 2M98A 4RK6A 4R84A 1W4ZA 1CRLA 2P9EA 3Q1KA 4WZAE 5EJ6A 1J8FA 3S29A 2CFSA 1RLOA 5C8DA 3AU9A 4HH0A 4F6CA 2H2HA 4YBRA 1PV1A 3D0RA 2W6IA 3IB3A 2VDVE 4ZT3A 3HR8A 3K6SB 4MO2A 5KPJA 4MZDA 1AXEA 3PLNA 3HQ4O 1L8OA 4BO7A 4KQEA 4J0EA 1XTSA 2E4UA 1ND5A 4N5NA 1BCSB 4BKRA 3C3PA 2GPAA 1DUIA 2EGUA 1CIVA 1O5TA 1YZYA 3B1JA 2CMDA 4X54A 4DDWA 2VP5A 3K0AB 3SKVA 4ZARA 4HN9A 2BP7B 1VHTA 4Q7KA 5JT1A 4NCBA 4CI0B 1LF0A 3Q7IA 3DVAA 1IVNA 1AKQA 1R5NA 2NZVG 2NLOA 4J1TC 3K9WA 1PBNA 1JZTA 3OCJA 3JYNA 4PS0A 2QTLA 4PFKA 4FT2A 3O83A 2G9UA 4H7PA 1CZHA 1EESA 4KFRA 2J0EA 2IS1A 4QHYA 2Q4EA 4IEIA 3JAKB 1X7GA 2HSEA 3I2IA 4EIWA 4R71A 3HCAA 4N54A 1JJIA 1ORTA 3C7CB 1F14A 2WHPB 2Y0BA 3L0BA 1QFZA 3B6KA 4KSBA 4B4VA 1HEIA 1CETA 2BCJQ 2RHTA 1PL0A 1QR2A 4KNVA 4E14A 2R7AA 3VI3B 5C1PA 3I42A 1GFSA 3LVRE 3K30A 5ESDA 4POOA 4UFOA 3GFFA 4RZIA 1T4CA 1EX9A 3CIFA 4RHUA 3EQ9A 1N4DA 4FI3C 4NRDA 1W88B 2GPJA 1JX6A 1M6VA 2BBWA 2FK8A 3FDZA 5BQXA 4V0KA 3O9ZA 4C4YA 4EFMA 2CDAA 1HR0B 3GHHA 1YL7A 3AFOA 4DUZB 2O19A 4PG6A 2DZDA 2ZIWB 3FJ1A 5L6MB 5ALDA 2IGBA 3UXYA 1UZUA 4FHFA 5LKAA 1WNTA 2WG2A 1VLMA 4KO1S 1HDOA 2PZJA 3WISA 3X1MA 3EC7A 4BLOA 5BOVA 4FC7A 1K3UB 3DZIA 1X74A 1LSSA 1TDJA 1SVWA 4GPAA 2ZB7A 3KV1A 1XRNA 4P81A 1JJ7A 3EXHA 3A11A 3GRFA 3M3DA 4OHKA 3S4YA 3KELA 2ZQ5A 3WGHA 4DJ5X 4HQRA 4MZXA 4RE5A 3WGIA 1T4MA 1U0SY 2O9JA 5CP8A 5KJ6A 4OQ4A 2AK3A 3N2LA 8MHTA 2O0LA 2NU9A 4LF9B 3GROA 3D8SA 1WMSA 3GT4A 1RHQA 4ZAFA 1O95D 5E0OA 2DFKB 4DV4B 1U7ZA 4FSXA 2WYIA 2JLXA 3LY7A 4MJ7A 5JNTA 3F8SA 4B4OA 1FY2A 3W6UA 4K87A 5KC8A 1J7KA 1DKLA 5FA6A 3A26A 1ZSVA 3W9UA 2ZM6B 4CU5A 2JFPA 3GCGA 3T3GA 2W93A 3X1ZA 4EJSA 3W3AH 2IOYA 4FE7A 4MQEB 3ZZ0A 1XZEA 2E2WA 2O3TA 1KOJA 3PDWA 1TJ3A 3TEJA 3QBEA 3U7EB 3B1ZA 1ORRA 3B1XA 3BWXA 1DCMA 3I2JA 3RNLA 2VPPA 4PZUA 3CUYA 3UFXB 4ZYWA 1ZGGA 1SCDA 4B3TB 1JYFA 2B36A 2QT9A 2XZPA 3EPKA 5AESA 3GEHA 2PLAA 3PNYA 2XYVA 1GO2A 1SEPA 4IJMA 4H7JA 3VH2A 2RCYA 2AWNA 2M2IA 3S5UA 1VPTA 3OPYA 4JLVA 3WICA 2ZIUB 2CWDA 4HXGA 4MVJE 2H07A 3KAPA 4Z9AA 4G0OA 2LPMA 1E20A 3QV2A 3UMSA 4N0QA 3B1WA 4UD6A 5B3AA 4J7CA 2QG4A 4BFUA 1SCQA 3QHAA 4MVJM 4E09A 1CVLA 4ND2A 4U2KA 4UREA 3LOPA 5JZSA 1QVRA 1MAWA 4PNHA 3HCNA 4XLLA 3BTOA 3O31A 2OLJA 1QR6A 4GNKA 1E5TA 1PJSA 2HGSA 5C4MA 2DVMA 5C5DA 4JZKA 4LCBA 4YP1A 1PSWA 4GM1A 5BYJA 1JH9A 3AVVA 4CIBA 1N2CB 3ETJA 1DFGA 4KXYA 3AM4A 1E4YA 3ZDXB 2CN1A 3JZDA 1XGKA 3DNMA 4RVHA 2AEJA 3R5KA 3ZV6A 4E2YA 1PR2A 4L02A 3LX4A 3GFGA 2QSJA 2ZWPA 4QECA 1CUAA 1B2RA 1JIQA 5CLIA 7YASA 5EJ9A 5IUJC 2NSDA 1WVIA 2AG6A 2YN2A 2G4CA 1P9WA 1NBAA 3AUFA 1E3JA 4HS4A 3VHRA 1N77A 3QBDA 4YI3A 1VPLA 5CAEA 3FXAA 2OUKA 2ZPTX 3KPYA 2JCYA 3QI7A 2IQ5A 4S05A 5GONF 3I61A 1U63A 3VYRB 3BTVA 1BIFA 4NC9A 4AQYB 4UUMA 4RLQA 2B4YA 5ESRA 4QZVA 4IV8A 1F2UB 4YMHA 3KQVA 1HEYA 521PA 4DF3A 1G3QA 3EFBA 4PLPA 2RCNA 4D4KA 4LV5B 4MV5A 1DG3A 2W2XA 3F6CA 1FL9A 4ZDIA 4UBOA 2CL7X 2B61A 2Q5EA 1DU4A 2XBMA 3H99A 1CJBA 3EIXA 3WZMA 2O8CA 1I2BA 1U2GC 1SXHA 1A3CA 1U9YA 2BF7A 1V5GA 2G82A 3D2LA 3MIZA 2YHUA 4LGVA 4A4DA 4CDRA 4J0JA 1E1QA 1E2NA 1ZNZA 4KH1A 4L5JA 1II0A 3ZV7A 1KEVA 5EPEA 1PRYA 4GOLD 5BNIA 2P91A 2JFNA 3B5IA 2BEWB 3I6BA 3T3EA 4WW0A 1E96A 2W83A 5CLHA 4DDMA 1W88A 1GN8A 1PJ3A 1ZOIA 4FXOA 3MS4A 3REQA 3TSWA 3MCTA 1QGDA 3WLFA 3PS9A 1RMYA 5GADl 4DXAA 1W1WA 1YR6A 4I1OA 4WT7A 1X7YB 5CYFA 3RS4A 4U0JA 3QEOA 1MAUA 4TYMA 4P5PA 1GPLA 1RQXA 2QI9C 2H1VA 2HHLA 2IYFA 4DBLC 5LOVA 4GZMA 2ZIGA 1G21E 1MORA 5TQ0B 3VJMA 3GJ4A 2EQ5A 2PFSA 3BKWA 3W7AA 4DJTA 2YBDA 2IYPA 3IHKA 1EIWA 3MD9A 2ZBPA 1P17A 1DBWA 1H66A 2OUIA 1TUEA 4W63A 3PENA 1IVSA 3D8HA 4PBTA 4KDCA 3GLGB 2GN2A 3T5MA 4Q9IA 1B6GA 2QD3A 4IDCA 3H4VA 4CG0A 4LF7B 1A7KA 4C6TA 2WWYA 2AV6A 2WZQA 5KWVA 2ZR7A 2JANA 1Y98A 2A5JA 2Z9CA 4P38A 3VU9A 1SOAA 1JKJB 1KJYA 3EZNA 3LIIA 4JI8B 5LQCA 1C1DB 3SIXA 1CF9A 1XDZA 4DNOA 2QT0A 4KLNA 3VPXA 3BCHA 3IIJA 2GHTA 3OZIA 1NHWA 3NTUA 4REQB 1KARA 2HPAA 2I22A 4XI9A 5IPFA 5EE9A 3GD5A 2WC1A 3V4ZA 3VR0A 5DM70 2REQA 2AKYA 3CZ5A 3IYLW 2NT3A 1JHQA 4A0HA 1CY0A 4IH9A 5ECYA 3OPXA 5IF3A 5DM2A 2VPZA 2JRCA 3FKSD 3M6LA 2BH2A 4EZIA 1G8PA 3GFTA 4O5OA 3RI3A 2I9KA 1FX1A 1HSZA 2J7PD 5L7WA 1XZAA 4KIUA 3VSAA 4AW9A 4D9JA 1L4EA 1IK4A 2PX0A 2WF8A 3BB3A 5GY7A 5C53B 4W9MC 4A15A 2VYQA 3FE2A 3K9LA 4MW4A 3I0MA 4G8DA 3G8BA 1EGQA 4BVFA 1RYEA 1GWNA 1Z2DA 3H9GA 2R6AA 3WHPA 3PWTA 1QH8B 3DM5A 4WZAB 5JMPA 1JZQA 1QX3A 4C87A 1TEVA 4F6RA 3COJA 4AYXA 2HCJB 3S1SA 1NJFA 1RBMA 4C5AA 3K09C 1IAQA 3W4JA 2H4YA 3UB3A 4JYBA 3M4NA 5BW4A 5F52A 5I9BA 3MLAA 4OI1A 2DFLA 3ZJTA 4NI5A 3W9YA 1YS7A 1E2EA 3E3OA 5EUBA 4B7UA 4D9MA 3ZVNA 2R44A 1PJLA 2MIIA 4PS1A 1YT5A 3IPCA 1LVHA 2DWQA 2NZXA 3Q2IA 4TX1A 2IH4A 1C0KA 2R2AA 4IV0A 3LW7A 2P41A 1ZR4A 5EZYB 4HPJB 3I9OA 5H81A 3UCFA 5WRFA 1MW9X 4M9SA 5IKXA 4KXVA 4R7ZA 2ADMA 2D5AA 4WZAA 2IZOA 2IDMA 2YWJA 3QLJA 3U49A 3KEQA 2IOQA 1G7RA 2WFZA 4D9CA 3KQQA 3CKYA 4RETA 2OQRA 2VAPA 4H4CA 1J5XA 5GJBA 2VUHB 4CCWA 5BWBA 1IG3A 3EG5A 3B6ZA 6PFKA 5JXIA 5D6NA 2QDKA 3N59A 1BNCA 1YDWA 1BVHA 2NU8B 5B1EA 5J4HA 4BY9E 2PD3A 2YBEA 3LRXA 2QYOA 3P9NA 4MUFA 3U4MA 3RC1A 2HLHA 4BEJA 3P0RA 3A1NA 2BEVA 3CX6A 3FRIA 4LCEA 4QELA 4ZO7A 5H68A 3C6ZA 3R8CA 2X42A 3UG7A 3W06A 3GAMA 4IIDA 3IQDB 3J80A 4KXWA 4G1BA 3ZOZA 3KQLA 4AMGA 3Q8KA 5DLYA 1JGTA 1TCBA 1U31A 3AIKA 4UUQA 1Z5ZA 3DDOA 3WK5A 2R6GA 3EBOA 4WOBA 5AW4A 1QRAA 2C2BA 4BE7B 3PUVA 5AVJA 2NXJA 3RBAA