3HADA

Biochemical characterization and structure determination of human heart short chain l-3-hydroxyacyl coa dehydrogenase provide insight into catalytic mechanism
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
293
structure length
293
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKRAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (L-3-HYDROXYACYL COA DEHYDROGENASE)
publication title Biochemical characterization and crystal structure determination of human heart short chain L-3-hydroxyacyl-CoA dehydrogenase provide insights into catalytic mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 117
structure length 293
sequence length 293
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 1998-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3hadA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hadA01
2D0IA 2X5OA 4Z0HO 4E13A 1PS0A 3HDHA 2Z1NA 1ZSYA 3OQ6A 4J1QA 2O3RA 4TMFA 2WE7A 2EHDA 5IZCA 4GWGA 1HYGA 4EEXA 1SB8A 2VNSA 3K92A 2PGLA 2PH5A 4BNZA 2ZYAA 1V6AA 2B37A 4RF2A 4B4UA 4A7PA 5LDGA 3OIGA 1E1LA 2OP0A 1YRLA 1GZ6A 1DOHA 2GZ1A 3F47A 1TEHA 1U4OA 2ET6A 4QFDA 4EYEA 1H94A 3JQFC 4ESOA 4R1NA 3W6ZA 1AUPA 3I4FA 4J49A 4W6ZA 4AJJA 4KUHA 3STHA 1EE2A 1EK6A 4XDZA 3GAZA 2JD1A 4NMHA 3FHLA 4BIIA 5L53A 2DFVA 3NTOA 3E9MA 4BNLA 1QYWA 2Q3EA 4MVJM 2GNAA 3DHNA 5IXYA 2OFPA 1X7DA 4YT2A 2OXIA 2OL4A 3JQEA 4XD2A 3DOCA 1RPNA 1XU9A 4GAEA 4UUMA 2V6BA 2VYVA 3AWDA 4OMUA 2CDAA 2WDZA 4LK3A 3GC6A 3O9ZA 1GCUA 1UZMA 2YUTA 2QRLA 3OSUA 4IDBA 4S1VA 4UVEA 4NDNE 3VVBA 2W90A 4JP3A 5DNAA 2X9VA 3EZLA 3MWDB 4LCJA 1NNUA 1T4DA 1BG6A 3GEGA 2I99A 2X0IA 1Z82A 4XR4A 2PZLA 2CY0A 2YDYA 4OSPA 4HWKA 1MXFA 4NBVA 4WK6A 3NKLA 4ZD6A 4PRKA 2O3SA 5CEJA 4ND2A 5CG2A 1V0JA 3KTDA 5C3MA 1IPEA 1H6DA 2EF1A 3WJAA 1QLHA 2GN9A 2Y0CA 1VPDA 1ZUD1 3JD2A 3AI1A 1QKIA 4RQTA 1DBVO 3HADA 3K31A 1YJQA 4DXHA 3KVOA 4RPHA 4MP3A 4BO9A 4ILKA 3I52A 4NIMA 2P68A 4BO3A 5KOIA 1HWYA 1OOEA 3BHJA 1ZK3A 1W6UA 4XIJA 5KVSA 5DBIA 1LC3A 1SO8A 3HNPA 5A9SB 5G4KA 3IDSA 3G17A 1LSUA 5JY6A 1B16A 4Y98A 2O2SA 4BKPA 2Q50A 3MJ4A 4NBRA 2X5JO 3CTVA 1X7GA 4Z6KA 1DJNA 1OZAA 2JAPA 4RPKA 3DMTA 1I30A 4OKNA 5DF1A 1U3TA 3HJAA 1B7GO 5ILGA 3B6ZA 4J4HA 3C1TA 1EDOA 2PA3A 3RUEA 3ADPA 4XB2A 2JJYA 3WGQA 4JNKA 2YY7A 2NVUA 2HKIA 4DYDA 1R4MB 3JYQA 4KDEA 3SEFA 1PL8A 3VTZA 4QO8A 1MXHA 1U3VA 1G0NA 5TX7A 2B5WA 4TKMA 3DFUA 4CM1A 3H9QA 3WTCA 3QHAA 1VJTA 1F17A 4GH5A 1XEAA 3CINA 1V8BA 3M2TA 3C8MA 3BMNB 1K6IA 1E1MA 4J90A 4NFYA 3GRPA 3UN1A 2XPCA 4MKZA 5BNTA 3KYCA 4N5NA 1VE9A 2XOXA 1N5DA 4DPMA 1Y81A 3WXBA 1GZ3A 1N8KA 2PTGA 1DLIA 1EFKA 1NM5A 4YT5A 3DBRB 4HV4A 4UREA 1O8CA 1KBZA 1U7HA 4CMHA 1QYVA 4R5HA 3INGA 4R51A 3KEQA 4ZQGA 5ER6A 3KM0A 2VWHA 4O0LA 4PVDA 2IYOA 3E6AA 2FPIA 2CFCA 2VRBA 3E18A 2C2XA 1XCBA 3DTTA 4L4XA 3OQ1A 2ZK7A 3DC2A 2HLPA 1ZEJA 4XX0A 4F46A 2X7HA 3INTA 3DOOA 1SEPA 1ZFNA 4I08A 3MOIA 2FHSA 2Q1SA 4NFSA 2O23A 1K3TA 4DLLA 1PL7A 4JX8A 2J3KA 3TL3A 1T2CA 4R3WA 4KMSA 1QXSA 3ZWBA 3ZWOA 3EC7A 3BIOA 5F1PA 4INAA 4BVAA 4J7UA 3RJ5A 4DBZA 3NAQA 1EBUA 4YB8A 2VYNA 4U6QA 3JQBA 3LU1A 3LC1O 5IDQA 2QG4A 2C7GA 4UVGA 4ND3A 5F1KA 3C24A 4FW8A 4E3ZA 1YB1A 1R4NA 3GUCA 2VQ3A 1Q0QA 2CZCA 3IC5A 3ONDA 4IQ0A 3PHGA 4R1TA 4IDAA 2GN6A 1E6UA 1WAMA 1H2BA 4WEQA 1AE1A 1QSGA 4FGWA 2V7PA 1TB4A 3GFBA 1XYGA 3L4BC 1NAIA 4UEJA 4XB1A 1PTJA 4PLPA 4HX5A 5KNLA 3BHIA 1LQTA 1R37A 3ZWWA 1KC1A 1NXQA 1PQWA 2ZJ1A 3JYNA 4Z0TA 5A3VA 1DDOA 3ZW9A 5K6AA 2JCYA 3Q2IA 1NQTA 4HNGA 1I3MA 1PJ4A 4DLAA 3SC4A 1ZCJA 3PLRA 1C0IA 3ZH2A 1V35A 3GNQA 1P1HA 4BGVA 4JIGA 5B4UA 3B1KA 4PLWA 2FWMX 1DC5A 5CDYA 3UUWA 4FDAA 2WWRA 1IZ9A 4BS9A 2PGJA 3D3WA 3IUPA 4B7CA 4EDFA 4DQXA 1P0CA 3ON5A 1PR9A 3WFIA 4BMNA 1M76A 4IIUA 8LDHA 1R12A 1F06A 2VUTA 2QIOA 1ADFA 3FI9A 4IDFA 5DT9A 1GADO 2OZPA 4BNNA 3WNVA 4CPDA 3GMSA 3ANMA 1W0CA 2CDBA 3RI3A 1EFLA 4I9NA 4NR0A 4QT0A 4BMSA 1JVBA 2J3JA 1E5LA 2GLXA 1UZNA 1DO8A 3FBGA 3E03A 3JD3A 2R2GA 1KEVA 1QRRA 1E3WA 1NWHA 5HA5A 4BB6A 2VHVA 2H6EA 5KKAA 4UVDA 2BFAA 2EWMA 4CQMA 3H9EO 4K28A 3G1TA 3OEYA 2AQKA 3DBVO 3E9QA 3KHUA 4B4OA 4KTVE 3UHAA 1Q7GA 2DTDA 2GR9A 4L4SA 3VH1A 2F00A 1E7MA 4MVJI 3QJ5A 3GA0A 3ENKA 4Z9FA 4A0SA 2YW9A 5A5FA 5CEFA 4EZBA 1S6YA 4YJHA 1C1XB 1PSDA 3DTYA 1YDWA 3GLQA 1DEHA 3FWZA 4FFLA 1H93A 3PPIA 3EVTA 4EJ0A 3EAGA 2O3UA 1DAOA 1YWGO 2WD8A 1ENYA 5JAIA 2HCTA 1I2BA 3V1UA 4IXTA 4RVSA 3ZWPA 1EVJA 1NPYA 3AM5A 4FFPA 2FRDA 1VRWA 3GY0A 2YV1A 3ST7A 3H5AA 3IOYA 3GT0A 1ENOA 1HSOA 4CMBA 2IODA 2Q2WA 1HEUA 2PKRA 4JBIA 2I9PA 2UV8A 5EIOA 4CM9A 2HJRA 5I8ZA 2EEZA 3UF0A 2DUWA 4NZ9A 2EERA 1MA0A 4AJ1A 4I5FA 5K9ZA 2AG8A 3KLPX 5L7YA 3ZNPA 3V1TC 3ZU4A 3GH3A 1SAYA 1T2AA 2OGUA 4P22A 4NHEA 3FWNA 1HSZA 4UEKA 1PJ2A 3NDIA 3HG7A 4OXNA 1E1NA 1WDKA 3IL2A 2DPGA 1P33A 3VZRA 1DRUA 1MP0A 4H15A 3RUDA 1I3KA 3TJRA 1AHHA 4WCFA 3ZV6A 3ZWNA 2R00C 5JE8A 1ADGA 2A35A 2PK3A 3O8QA 4TRJA 4BNKA 4CMIB 4PG8A 3DAPA 1Q7CA 4TKLA 5I7EA 3AFNA 3COSA 2VHYA 1IB6A 4A03A 3KOUA 4OQYA 4YQZA 5JXWA 3W8FA 4TQGA 5CFZA 4BNYA 2OBNA 3AW9A 3DXFA 2YHIA 4B4WA 3MTJA 2PH3A 4E0BA 1A9YA 3HB4X 1UP6A 4MDHA 4IDEA 3ROMA 2EKPA 3TF5A 1UDAA 3HFSA 1IULA 2VUUA 3WIEA 5A03A 1MGOA 5A04A 1UXKA 3ZV3A 3EY4A 1QV7A 1VL8A 4RPGA 4C7KA 1H2HA 2UVDA 4IDDA 5LC1A 3QVXA 4K6CA 3TQHA 4J9UE 1EK5A 3OA2A 4B3HA 3I4CA 4GSLA 4FFOA 2AMFA 3ROQA 2HK8A 2WD7A 5JO9A 3HWRA 3FNFA 3RAJA 3LT4A 3NGXA 4QO7A 3GNTA 5GY7A 5H83A 3V2HA 4HBGA 5THKA 3LT2A 5AXBA 1ZNQO 5KWEA 1DIBA 5CP8A 4IGEA 1HRDA 3DBHA 3DB2A 4KOAA 5EERA 3ZI0A 4DGSA 3H65A 4P4NA 1PWXA 4RPJA 3TZCA 3QVWA 4QTZA 1T26A 3SJ7A 1DIGA 5U9CA 7MDHA 2AEMA 3F4BA 4XEHA 2XF8A 1E6WA 3ABIA 3I5MA 3NDJA 4FJ2A 5AXAA 5J23A 3UCXA 4FFNA 1A7AA 2POQX 2O48X 3BTUA 4QXMA 3MCVA 5F3RA 2X0NA 3BMCA 3NYWA 4IQGA 4JK3A 2FR8A 3GZNA 4FIZA 2ZQYA 4WLFA 1NPTO 4L76A 1KOLA 1KVSA 3WSVA 4UEOA 2QZZA 3UICA 4OGWA 2O4UX 2Y1GA 1O0SA 3GVXA 4XYBA 4BNUA 1H6BA 2GN4A 4LSMA 3BMQA 3RASA 1GPDG 2B69A 4CODB 1P0FA 1PZGA 4EITA 4U8GA 4ND5A 4GPD1 5L7TA 2AEFA 4BO4A 3F3SA 5G4LA 1L1FA 1PJCA 3PYXA 3M6IA 4II2A 3T7CA 2BMAA 4DUPA 5THQA 1KEUA 1LJ8A 2RH4A 3T4XA 3EVNA 4BO8A 1VM6A 3F5QA 1YXMA 4L73A 4ND4A 4S3MA 4ID9A 4CLXA 3CSDA 4O6VA 3CE6A 4YVFA 1P3DA 8ADHA 5JO0A 3C7AA 1E3LA 1GY8A 3D3WB 4KUGA 4CM3A 4XRRA 1ZJYA 3PLNA 2AQHA 2DTXA 1YDEA 3CZRA 2OORA 2Q49A 4XCVA 1I33A 4WNIA 3GN2A 1U7TA 4XGIA 5TRTA 1P1JA 1DIHA 3WTBA 1I24A 3PHLA 5DOZA 3GUYA 1Z73A 3WSWA 4HADA 3WFJA 1ZK0A 1IPFA 4Q3AA 2IZZA 3HE3A 2V6FA 4GLOA 5ENDA 3K2EA 1YBAA 4BKQA 1F8GA 4R01A 5LCXA 1NVTA 1YKFA 1E3WB 1ISFA 4JQCA 1FMCA 3PK0A 4BQPA 3ZNQA 2SCUA 4A5OA 3WYBA 2ZCVA 1HE2A 2JAHA 2PD6A 2GCGA 4KZPA 4J7XA 1U8XX 2VHWA 3QA9A 3ROPA 1ENPA 1GD1O 1X0XA 1M2WA 4MINA 4OQZA 1WDMA 3A4VA 3FBTA 5JBIA 2RAFA 2Y68A 3NV9A 3OBBA 3WGGA 1ARZA 4BNJA 4D45A 4DVJA 2WJPA 2DU8A 4K9DA 3ZV5A 3PIDA 1PU2A 1PS9A 2BELA 2FPPA 2NWQA 3ZNOA 2IXBA 5HM8A 4HNHA 4YT4A 1J0XO 2Y1CA 5G0SA 1ZJZA 3RD5A 5HTOA 4L75A 2EV9A 4KWIA 3ORFA 1U28A 3C1OA 3I9KA 3RFTA 1CEQA 3A14A 2ZQZA 4DLBA 2X0JA 1VJ0A 2D5AA 1SBYA 3DMYA 4MVJE 1HDRA 4RF5A 4FGSA 1JWAB 3QP9A 1HETA 5I8WA 3D7LA 1O9BA 3ROKA 4ALKA 3W8EA 5BSEA 2FSSA 3F9IA 3DZFA 1RWBA 5JMWA 1HLPA 5TIIA 4GMGA 3WGOA 1GFSA 2NU9A 3FNHA 4E5MA 3P5SA 1GAEO 5IDYA 4JN6B 5BR7A 3TDKA 4G2NA 1D1SA 1GEEA 3RBXA 3NJ8A 4J6FA 4NU6A 2DKNA 3H7AA 4R68A 2C20A 1QP8A 5CDGA 1HKUA 1RYEA 3KYBA 3EYWA 4GGOA 2HJSA 3DWFA 3MOGA 4KDFA 3OFSA 1E7SA 4XYEA 2E48A 1IHYA 4A10A 3WMXA 1XLTA 2HMUA 3I9MA 1NX6A 5EQDA 1XR3A 2GDZA 4AVYA 5L40A 4ZVVA 3M1LA 1A72A 1EDZA 3CKYA 1H6AA 2B83A 3L4BA 3AM4A 2J8ZA 3RKUA 1VL6A 1E7WA 2I66A 3H5NA 4NBWA 4CLHA 2YFHA 3IP3A 4E5YA 4WLNA 3U09A 4WCFB 3PJFA 1M6HA 4QQRA 4AJ2A 2FSVA 4UUPA 4YYZA 1JQBA 3DZHA 4L0QA 2BFOA 2OMEA 4OHUA 2Z1MA 3E8XA 1OBFO 4XDYA 1TVEA 4AJOA 1HXHA 1CF2O 1SCUA 2BGLA 2VWQA 1HDXA 1WVGA 1BXGA 1YL7A 3E5MA 4YDRA 4MVJD 1LDYA 4P4LA 1BDMA 1ZH8A 2PFGA 5F5NA 3MJTA 4IS3A 2OOSA 5TSDA 3S8MA 4CUZA 5A3JA 1VC2A 1E7RA 3LC2O 4K1LA 2F1KA 5ENVA 2VHXA 4R4JA 4HY3A 1R15A 5B4TA 5I9LA 2EW8A 3OICA 2WD7B 1YO6A 4DA9A 4E5PA 1YVEI 4YT8A 1ZK1A 1E0DA 2Q1TA 3LF2A 2NSDA 2DM6A 4PG6A 4WLEA 1LTHR 2WYUA 1IUKA 5IZ4A 3KXDA 1WP4A 1IZ0A 3V8BA 2C07A 1GYQA 1X14A 3DBHB 5A1TA 2DUUA 4I1IA 4PZEA 1EQ2A 4D42A 1ENZA 3GK3A 1N2SA 2D3TA 1V3TA 3K8ZA 4H7PA 5FI3A 5JCJD 5KJFA 1O5IA 4AJLA 1A4IA 4DPKA 1ULUA 3L6EA 2I76A 1E3IA 3GEMA 2CMDA 5G0VA 5T64A 3T7EA 5I7VA 5F5LA 3F6YA 2X86A 1I3NA 5JAQA 1YB5A 3WR5A 3H2ZA 4BGUA 3PVZA 2AE1A 1EMDA 1LDEA 2HAEA 3G1UA 3GVPA 1VI2A 4BNTA 4I5DA 1M66A 3PQEA 2GPTA 2UAGA 4NK4A 1N92A 2Y1OA 4PIVA 3PDUA 1NTOA 1E3EA 5IXSA 2J3HA 1XWFA 4CM8B 3AU8A 3BMQB 5JDCC 1RM3A 1HDCA 3W8DA 1GPJA 4LVCA 3TZ6A 3IS3A 2FPGA 4L74A 2E82A 2VRCD 2E4AA 4MIOA 4WLUA 4NBUA 3U0BA 4AICA 1KVTA 4DQVA 1NAHA 4Q3CA 1ONNA 1LA2A 2OHXA 4M49A 5F21A 3VZPA 1Y5MA 2X6TA 2PGDA 4I9HA 4N54A 3A1NA 3RUHA 5JW6A 4OYRA 5A4DA 1ID1A 1P31A 1QYDA 3KYDB 4CMAA 4CMEA 4AJIA 3OM9A 4MKRA 4QEDA 4WOKA 3RUIA 4AJHA 3I3OA 3U49A 2Q1WA 5C5IA 1HYHA 4GGPA 1BW9A 1X1TA 1ZMTA 3S2FA 1G6KA 1D1TA 2CF6A 3P2OA 3PYLA 3R6DA 2Q4EA 4P8RA 2E49A 2VN8A 1X15A 1ZZEA 2R00A 2B5VA 2D5CA 5KTKA 4DL9A 4IZIA 2OBYA 1R0SA 1HTBA 1T2EA 3GHHA 4PFJA 4B8WA 2JD0A 1LEHA 5HS4A 1Y7TA 2QZ9A 2D4AA 4OSOA 4PGFA 1GU7A 3UH1A 2BI7A 3DHYA 4GLLA 2YV2A 1DFIA 1T4BA 1CDOA 1K5HA 2WYVA 3PI7A 3ZWVA 3GMDA 1K0UA 4A2CA 3QLJA 4RVHA 3OMLA 5JYEA 1K6XA 3QVOA 3VVCA 4LMPA 4Q39A 5TS3A 2PZKA 4IY1A 3B1JA 1LLUA 4B4VA 1LRLA 4ZU3A 1FDVA 4DPLA 3BA1A 5KVQA 1YQXA 2IEBA 1Y1PA 2ZB8A 4PZDA 3WICA 5BT9A 4J0FA 1RM4A 3LQFA 1GZ4A 3D4NA 1CQIA 3OF2A 4IDCA 2FOIA 2NTJA 2DLDA 4CJXA 4XKJA 2VWPA 4LN1A 3GVIA 3RBZA 2DBQA 3N58A 4YAGA 5FFFA 1B3BA 3ZHBA 1UR5A 4PZCA 4YQYA 5JNLA 4UVIA 1UP7A 3HDYA 4ZQEA 3CMMA 3AUTA 3AM3A 3PWSA 1T1SA 4J43A 3JQ7B 4PG7A 4CR6A 2VYVD 2QYTA 3D1LA 4YJGA 1LX6A 3B70A 2QQ5A 5K0ZA 3WGZA 1O6ZA 2BI8A 1VKOA 2P4HX 2FN7A 2VTDA 3EUWA 2WMDA 1GYPA 2Z5LA 2P9GA 2V6GA 1ISJA 3UGKA 1EUZA 1FK8A 2WM3A 1PZHA 5BNIA 1E6EA 1JU9A 4PLHA 3U4CA 4YXFA 1NWCA 3H9UA 5L4NA 4YJFA 4IJWA 3F1LA 2JKVA 1JKJA 3WIDA 2I3GA 3RFVA 2Q45A 1X0VA 2PY6A 2VWGA 3MZ0A 3WGYA 4BNHA 1WZIA 4M8SA 4WASA 3OQBA 3C7CB 3CIFA 4XR9A 4XWYA 4GVLA 1LDNA 2G5CA 3WYEA 1H9BA 4BO0A 4JCOA 2X9GA 1PL6A 1LRKA 3OJLA 1U2DA 1B8PA 1FDSA 3UKOA 3GVHA 4RDIA 4KTTE 3JD1A 1QG6A 1O95A 4Q3DA 4WLOA 3UFXA 1P1RA 1GUZA 2X58A 4D7AA 1TT7A 1V9LA 4NBTA 4OH1A 5B4VA 2O7QA 3QWFA 3DQPA 1D8AA 3RVDA 1BXGB 3DBLA 2YHUA 2AE2A 3GZ4A 5CAEA 3WWZA 4K26A 5AVOA 2CVZA 3JQ9C 2W2KA 1HZJA 2BHLA 4R1SA 1NVMB 3Q1LA 1WWKA 4RGBA 1N1EA 2ZJ0A 2IZ1A 3Q9NA 1YL6A 1Y5RA 4TRMA 4DC0A 4AJKA 4PLZA 1SOVA 1XHLA 1XA0A 1RKXA 3X2EA 4W7HA 4TRNA 3AFMA 3OP4A 2J6IA 3JQAA 3NDRA 3WGHA 4OO3A 1NYTA 4UULA 3NEPX 4KQXA 3B1FA 4D0SA 3WGIA 1ZBQA 5L7WA 1KY4A 1ZMOA 2X5KO 3D0OA 3PGJA 1HE3A 2G0TA 4R54A 2I65A 4EI2A 2O3JA 2Y99A 1LI4A 2G82A 4MO2A 3RC7A 2W4QA 4ZGWA 5KJCA 1NHGA 5T8KC 3NRCA 1T2DA 3RCBA 4E2XA 3FRJA 1GL3A 1N1GA 3WLFA 1V3VA 3K9QO 1NVGA 2BGKA 4GVXA 1M67A 2DAPA 4GBJA 3HSKA 3Q9UA 1HDYA 3CH6A 4D79A 6LDHA 3H6KA 5G2OA 3QWBA 2DFDA 1X7HA 1YL5A 3PP8A 1MV8A 4CMCA 4RCVA 4J0EA 5CDSA 3BHMA 3PWZA 2YDXA 2EXXA 3WQRA 2XXBA 1PJBA 3PEFA 4EBFA 4XYGA 1YOVA 2G1UA 4DTIA 4TZTA 3OJEA 4RV9A 1M6WA 3OHSX 4RDHA 3E1KA 4YBZA 4ALMA 3EDMA 4DYVA 4HFJA 1U5CA 4KP7A 1GQYA 4LCEA 1PZEA 3L0DA 1K6JA 2O2YA 4BNVA 2BD0A 1AHIA 4OJNA 3TL2A 1I0ZA 3ULKA 3L9XA 3ZHXA 2PV7A 5IN4A 1J6UA 1RYDA 5CG1A 1UDCA 3OA0A 1N7HA 2HMWA 3S2IA 4OM8A 3HDQA 3LC7O 3DHEA 4DWVA 2IE0A 4EUFA 1TXGA 1GDHA 5KVVA 2BFPA 5HBRA 4ALIA 4EUEA 4IBOA 1A71A 4LRSB 3IMFA 3GR6A 1R16A 4DIFA 1HDZA 5G4KB 5EJ2A 3ZNNA 1LSJA 4EUHA 3ITKA 5JDIA 3JTMA 3DR3A 4CL3A 2CSUA 2C2YA 1E77A 3WB9A 4UAGA 1KY5A 4O63O 5JCXA 5DZSA 1BW9B 2VYND 3BMOA 2J3IA 3RC2A 4CLRA 3BYZA 4I9UA 1P1KA 3GN1A 2W2LD 3M1AA 4OKIA 4FBGA 3RQSA 5DN9A 3TZHA 3WLEA 3KETA 3FPCA 2NUAA 1HE5A 4U0JA 5HWSA 2YQ5A 3WMWA 3V1YA 3RBVA 1Y6JA 3HN7A 4U6SA 2NVUB 2DVMA 4FOSA 3TWOA 3AOEC 4M87A 5GZ1A 3S1LA 1PS8A 1HDOA 1N7GA 2H1SA 2ZYGA 5IJZA 3EK2A 1W4ZA 1YQDA 1ZVMA 2B35A 4PVCA 2NU7A 5JLAA 2WTBA 3ZV4A 4ZQFA 4RJTA 5JYDA 4CV3A 3KEOA 3PDJA 1H6CA 1ZIDA 5A06A 4TSKA 3G3EA 5A05A 3KYCB 1KVUA 1I2ZA 4R69A 4BO5A 2GZ3A 3JQFA 2JCVA 5H81A 3S2GA 4RLSA 4GWKA 1TT5A 3MJSA 2A92A 4N7RA 4FD3A 4TROA 3DMTC 2C82A 1PQPA 1FDTA 1T2FA 4D3FA 4LW8A 5A9TA 2H9IA 4CM4A 4DIBA 5EL0A 3WOHA 3KZVA 4C7JA 4OXKA 1Y8RA 4CM7A 5ADHA 5GZ6A 2J5QA 4J4TA 2C54A 5IDXA 3W4JA 4B7XA 2RH8A 3WG9A 1F8FA 3O4RA 4YJGB 1EUDA 1HT0A 4W9NC 4B8ZA 2ZTLA 3UXYA 4OOFA 5KKCA 1BDBA 1B0AA 4CQMD 3FNGA 4Y8VA 2EIHA 4OXYA 3RFXA 3VPGA 4F3YA 1LNQA 2Q1UA 3PQDA 2A94A 1I32A 1L7DA 4E2ZA 2NV6A 5IAAA 3K30A 1MLDA 3LT1A 4RORA 4WGGA 4YJFB 4DREA 1MUUA 4D46A 4XYLA 4CM5A 3SVTA 2EGGA 4GX0A 3LLVA 1Y8QA 3EW7A 3ICCA 1MFPA 3LZ6A 3RJ9A 1D4FA 1UDBA 5B37A 4MP8A 3H8VA 3AUAA 3K6JA 5MDHA 1KEPA 1LRJA 1R4NB 2NVBA 4KUEA 4M1QA 4A26A 1QORA 2NTVA 3GDGA 4BKRA 4FB5A 1Q2XA 2W8ZA 2HK7A 3ENNA 4WECA 2EG9A 1XKQA 4XZ3A 4E12A 4XQCA 5ILOA 2BLLA 4IGFA 3MWEB 2Y0EA 1SZJG 1ZW1A 2IEDA 1KC3A 5B1YA 4OIMA 1FJHA 1A5ZA 3I6IA 4ALJA 4E21A 1EE9A 1Z75A 3ETEA 2Q4BA 2Q46A 4MPDA 3H3JA 3JQ6A 3D4OA 1B8VA 2W2KB 3S2EA 3K5PA 4RVDA 4CM9D 1XDWA 1I8TA 3BTVA 3C7DB 9LDTA 3AJRA 3DL2A 4MIYA 2X22A 3SC6A 2PKQO 4R1UA 3CZMA 5L3ZA 2I5PO 4ZQHA 4JXKA 3HUDA 5IFLA 1LC0A 2FZEA 4II3A 5ER9A 1HZZA 1W73A 2P4QA 2I67A 2QRKA 1UXGA 3IP1A 1H0KA 4R3NA 1B2LA 4CR7A 1CWUA 2GGSA 1KVRA 5DULA 3HDJA 3JQGA 2J5KA 4LVUA 1EUCA 4QUKA 2EKQA 1JVSA 2JFFA 4IQ8A 2HDHA 5CHEA 1ML3A 1Y9AA 5ITWA 2VT2A 3O38A 1XIVA 4J1NA 4YJDA 5TT1A 2ZYDA 5CDUA 5FF9A 1O89A 1R0KA 2GF2A 4Z3KA 4FN4A 1ZO8A 5TF4A 3K96A 5AYVA 3HB5X 1KEWA 4PLFA 1E7YA 1LDGA 2VUSA 4PRLA 4CQMB 1BWSA 2JCXA 4QFCA 4WJZA 3GPDG 1XG5A 3GG9A 4NI5A 1JN0A 3ZN2A 2YZ7A 3N7UA 1ZEMA 1JDJA 4IM7A 4E33A 2IRWA 3QY9A 3RU7A 1QYCA 4XA8A 1YOVB 3G79A 1OAAA 4YJHB 1NASA 2NADA 1LUAA 2NQTA 7ADHA 4W82A 1A4UA 1NQ5A 3Q0EA 4XIYA 3VPSA 2Y0DA 2D2IA 1WMAA 4EJ6A 2E6UX 3RUAA 2FMUA 4CLDA 3D3EA 5JSFA 4CV2A 1FF9A 2P91A 4EJMA 4IDGA 2B4QA 5COAA 2JFHA 4PLCA 1ZXLA 1NFQA 1T1RA 1C1DA 2NQ8A 1KERA 1PZFA 3AUSA 3I1JA 1R6DA 1AGNA 3Q2KA 4GKBA 4R16A 5JC1A 2AQIA 4CR8A 1AN9A 1XQ1A 2BH9A 2DTEA 3TOXA 3ASUA 3H4VA 1BXKA 3QV1A 2P5YA 5DCWA 1NBOA 3PJDA 4BL5A 3FR7A 1HLDA 2GYYA 4FFRA 4R9RA 5HRUA 3PHHA 4ALLA 3SLKA 4LMRA 1DB3A 1PGOA 4RL6A 1RJWA 1WPQA 4U0KA 3GGOA 2CDCA 3ETDA 2VNAA 3EGOA 3I9NA 1I36A 2YFQA 4D3DA 4G81A 3P7MA 2AG5A 4WKGA 4BUCA 4MOWA 5DDIP 4BGIA 4DMLA 1C0LA 5A02A 3W1VA 1NQOA 3EHEA 4AFNA 2OP1A 1YJ8A 4NK5A 1H5QA 3QIVA 1CERA 1R66A 3AUUA 4QECA 3L9WA 1Z74A 1KVQA 2EP7A 2I3AA 3BTSA 3KLMX 4TVOA 4CL8A 1DC3A 1DAPA 3PHJA 1B14A 3VH4A 3ZHZA 2HQ1A 1LLCA 2IZ0A 2AW5A 3GFGA 1VJ1A 3O8QB 4NFHA 4Y6PA 1JWBB 5LDHA 3L4SO 3VZSA 3HZZA 1BHSA 3JD0A 3NT2A 4RPLA 3GOHA 4LRTB 2LDXA 5TNXA 3ZGYA 1EZ4A 5JAMA 1E3SA 1EQUA 5ICMA 3R0IA 1PJSA 2YHIB 4Y6RA 5L9AA 2VZ8A 2PKQP 2P2SA 3KO8A 4D41A 4OL9A 5ICSA 2CVOA 4BOYA 3GQVA 1QV6A 3FPLA 3PIIA 2QW8A 2NU8A 4CM4B 1CJCA 2CD9A 1CIVA 1Y8RB 3QQPA 4PN3A 1ISMA 4UUNA 3A06A 3FCOA 5TQVA 3PZRA 2NU6A 4R5MA 1GQQA 3FF4A 1N9GA 3W6UA 3ETGA 1DFGA 3GPIA 4IMPA 3FNEA 4J1SA 4O1MA 4MKXA 3V2GA 4WLVA 4K6FA 1FXSA 4ZN6A 2ZTMA 3C3XA 4XQGA 3VPFA 5FI5A 5B12A 4O5OA 1I3LA 1GUFA 3V2UA 2PD4A 4BHTA 4WCFC 4NH4A 3FSRA 4R41A 3I9JA 4M86A 1XGKA 2GERA 4KWHA 3D64A 2NNLD 3PYMA 2GASA 1Q0LA 2DBRA 1FDWA 4GX1A 2ZB4A 3U5TA 4BNMA 1DXYA 1E5QA 1Y8QB 4MP6A 5TLSA 4HP8A 1ZK4A 4IZHA 5TC4A 1GV0A 3GG2A 1E1KA 3BMCB 3F46A 3LF1A 3JCZA 2B4RO 3PFFA 3GZNB 3GDOA 1SMKA 4I8XA 3SXPA 1J5PA 3O26A 3PFWO 3DZJA 1HDGO 4LISA 2ZATA 4E5NA 1MG5A 3GVCA 2UYYA 1IE3A 1OI7A 4PLTA 4NJOA 3HN2A 5G0WA 3Q11A 2AQ8A 1DJQA 1X13A 1BMDA 1E7QA 2PD3A 1P44A 4WEOA 4Y9DA 2ILTA 5T5QA 1PQUA 5I7SA 4GX2A 5TGDA 4D44A 1SB9A 1HF3A 3VH3A 3OJ0A 4PCVA 3TPCA 5KJ1A 4RZIA 4CMJA 3ONFA 4NPCA 1U3WA 2Z95A 3DZKA 4LSWA 5ES3A 4YAKA 1NQAO 2JD2A 1SOWA 3R1IA 5ITVA 1P9LA 5JC8A 4ZRNA 2A9FA 3RC1A 2HMVA 1WMBA 4RF4A 1I2CA 3U9LA 3WBFA 5EESA 2Y1FA 1ZK2A 4W99A 3V5NA 1C1XA 1P45A 2DBVO 3F4LA 1PIWA 3H3FA 3I83A 2ZKLA 1TA4A 1I01A 3CMCO 3AOEA 1YGYA 3JQGB 3R3JA 3ZU3A 3AOGA 5U4QA 2CNBA 4Z3DA 2WSBA 1U3UA 4HKTA 3JYOA 3PQFA 2RHCA 3BXXA 4TZKA 1XELA 4FPXA 2X1HA 2GO1A 1ULSA 3GF4A 4W4TA 4WCDA 4BO7A 3L6OO 1AXGA 4YACA 3FN4A 3T4EA 3W4KA 2H5LA 1PJ3A 3SLGA 4MVJF 4WE3A 5GZ3A 4E31A 1VSVA 2ZCUA 1I10A 5T6BA 4CQLA 3QRWA 1IHXA 3WQQA 4IIVA 1SNYA 4N5MA 2ZTUA 3PTZA 1WLYA 1NP3A 4M89A 5G0UA 4HFRA 2C7VA 1UP4A 3O03A 1Z45A 2UUPA 4ZICA 1P1FA 1GUYA 3ZDFA 5BSFA 3H9JA 4BKOA 3NTQA 3I9OA 2DC1A 5L4SA 1UAYA 1LLQA 1ZSNA 2BFMA 3NGLA 4MVJP 4Y6SA 5L51A 1JKFA 3VHRA 1TI7A 4L4RA 5I9NA 1ISIA 3ZU5A 5KJ6A 3KBOA 4W9NA 4DQUA 1OC4A 4GSKA 1C1DB 3H5RA 1SPXA 4RF3A 2X0RA 3OJOA 4RVUA 4XGNA 4YRBA 1KIFA 2G76A 3WDSA 4Q9NA 4CMIA 5KIAA 4R9SA 4WNCA 4FC6A 4IMRA 4FQ8A 1YBMA 5EN4A 5MGBA 4JLWA 3ZU2A 1M75A 1MG0A 1B26A 1DLJA 4YAEA 3CUKA 3IKVA 3PJGA 1P1IA 1EVYA 3DO5A 4HXYA 2LDBA 1WZEA 1C14A 3LLSA 4MVJG 4ZQBA 3ZCXA 3CEAA 1ORRA 2O50A 1ZSVA 3UVEA 1DIRA 1P77A 4A73A 3DAFA 1EVZA 3AY7A 3EMKA 1SC6A 3OIDA 4CV1A 3P19A 4J1TA 3QWIA 3MEQA 1HL3A 2ZB3A 1B15A 4G5HA 3GGPA 2RHRA 3P2YA 5G0TA 3I6QA 4KQWA 4E32A 2WEKA 3KB6A 1DRWA 3IIEA 1YB4A 3U4DA 3LK7A 5T57A 2G17A 4H16A 5I7FA 5BSHA 3JQDA 3ZWXA 2JHGA 2V65A 2V6MA 1GQ2A 4JJIA 3RWBA 2PNFA 4GKVA 2X23A 3VPHA 1PR3A 2JFGA 4L8VA 5DBGA 3GEDA 2NVWA 4P4GA 1LU9A 2Y66A 4YR9A 3FTNA 4NU5A 3DFZA 4ND1A 3VKVA 3F1KA 4F45A 4YRAA 2IDZA 1VL0A 5FWNA 1Z7BA 1C0PA 4JROA 1I5RA 4OAQA 3OEWA 4IPTA 3JYPA 1GCOA 2QHXA 4TRRA 1C0KA 2W2LA 1P74A 1J49A 2QYSA 3TNLA 3TOZA 5H82A 1UZLA 2FY8A 2GRAA 5KJEA 2DPHA 1YONA 2YV3A 3LYLA 4I5EA 1L7EA 3UW3A 3JQ8A 3IJRA 1N9GB 2FR1A 3JD4A 3KRTA 4B7UA 3ANLA 3WGTA 1B3RA 1MX3A 4A27A 5IG2A 3FTPA 5AOVA 1BTOA 4FR5A 2AEJA 4Z9XA 3RKRA 1NFFA 1PGQA 1Q1NA 1Z7EA 3ZHYA 3HQ4O 3U4IA 2ZB7A 4EGFA 2Q2QA 3I9LA 3KSDO 4YRDA 3TSCA 1GYRA 4DC1A 1K2WA 4E2YA 3JQCA 3ZWMA 3MTGA 5IF3A 2RBEA 5A5EA 3I23A 3NUGA 1QYXA 2VTEA 3ASVA 4BQRA 4FC7A 1PEDA 3VZQA 4BKUA 3OECA 5IZCC 4IS2A 3MJCA 5L95A 1BGVA 1A9ZA 2HUNA 3DZBA 3RIHA 4ROSA 2VHZA 4NJMA 5FYDA 1UJMA 3JSAA 4IXWA 2EP5A 2W98A 1D7OA 3EZYA 3E82A 4J7CA 2B36A 3BTOA 3LVFO 5CPBA 5JS6A 1WNTA 4GMFA 5JPIA 4FFMA 3D4PA 1XQ6A 5JMPA 4CLOA 4IJVA 2BGMA 1OFGA 1IL0A 3VH2A 2WYWA 4J16A 1E3JA 2CVQA 1EBFA 4B79A 1E92A 2JL1A 2NLOA 4Q3BA 4FS3A 5A9RA 3GRKA 3NTRA 4YPOA 2IXAA 1JTVA 3ZWYA 2OO5A 2GD1O 1Z6ZA 1MFZA 1JAXA 3U3XA 1UXJA 1KETA 1LXCA 4CV0A 4N5LA 4XQ9A 3AY3A 2D1YA 3UOGA 5C37A 5EMHA 4BNIA 4FJ1A 2UUOA 3LDHA 2DBZA 1PGJA 2VOEA 4D0RA 3RROA 2EKLA 3GHYA 4J91A 9LDBA 1QR6A 1LSOA 3GDFA 2TMGA 1LDBA 4Z0PA 4DRYA 4BNXA 6ADHA 3IUSA 3QSGA 4QX6A 4XRGA 4FOOA 4PG5A 1GV1A 5C7OO 1LDMA 5TJHA 3PGXA 4DMMA 5EQFA 4CUJA 2VCYA 2Q99A 3CXRA 5AXDA 3LSYA 2GN8A 2Q2VA 3DEYX 4LGVA 2C59A 2NTNA 1NR1A 4P38A 2ZTVA 5BNFA 2P9EA 4MJLA 2C5AA 3ONEA 2VT3A 2VZ0A 4J2HA 4Q3NA 3TZQA 2BRUA 3WYCA 4CQLB 2X4GA 4WOJA 1FDUA 5KVCA 5CPFA 1RM5A 3OIFA 3S55A 4ZRMA 3JV7A 4JGBA 3VAZA 3W4IA 4EW6A 2PZMA 2D59A 3Q6IA 1F14A 3AI2A 4DIOA 3U62A 3RC9A 3WWYA 2O7SA 3WX0A 1T24A 2Y67A 4E4YA 4CMEC 3K2BA 4M54A 5EINA 4FJ0A 1DC6A 2PZJA 2UDPA 3PJEA 1HYEA 2B4TO 2NM0A 3C1AA 3C85A 4AJNA 1LBEA 3RUFA 1LQUA 3N74A 1NPDA 2HU2A 3JQAD 4YAIA 3WQSB 1DC4A 4AJEA 4BO2A 1A27A 2PWZA 2YJZA 1J4AA 1LLDA 4WPGA 1SEVA 4N18A 2J5RA 3L6DA 1BRMA 4AG3A 1U9JA 4HFNA 3B20A 3KSUA 4YEDA 5DCUA 3OJFA 5DCYA 1YQGA 2GSDA 1IYZA 3NT5A 4FCCA 4RLHA 3RSHA 1UH5A 2NACA 2DT5A 2HRBA 3FD8A 4U5QA 2CF5A 1JLLA 4HFMA 3L07A 2HRZA 4XJSA 4CMGA 3TRIA 4JJGA 5IN5A 3ICPA 4IUYA 5TJ9A 4BGEA 1CQJA 1MB4A 2P9CA 2PLAA 2B0JA 4FSHA 2HK9A 4YWJA 4G65A 3UCFA 4BMVA 3SBOA 1DIAA 1GR0A 1ZKMA 1VLLA 2O3QA 1PJLA 1YE3A 4W7IA 4NQZA 5FEUA 1YS4A 2AHRA 1U4SA 1HE4A 4J3FA 3ITDA 2Y1EA 3M2PA 5JY1A 5JDCA 1DHTA 1YBVA 2HMSA 1JKIA 2XAAA 2YQ4A 4BB5A 5BSGA 3DZGA 1EEHA 1QMGA 3BAZA 4X54A 4CM6A 1DHRA 5JFOA 4UVHA 2I6TA 3DDNA 4XYMA 4I5GA 3ANNA 4ITUA 5I9MA 4BO1A 3DOJA 1BXZA 1W8DA 5COQA 2O4CA 1U1IA 1U5AA 4JBGA 3PXXA 1F0YA 4URFA 3D5QA 1UUFA 3FR8A 4XJTA 1CETA 1KYQA 4XQEA 1D3AA 5L45A 3IJPA 2DQ4A 2AA3A 3LT0A 3VOSA 4EEZA 4E30A 3TFQA 3DBLB 4YTEA 1U2GA 2R6JA 5COBA 4H3VA 4Y67A 3IQDB 3WS7A 2XXJA 4GI2A 3ZZNA 1TLTA 3QWHA 3QVSA 1BVUA 4B3JA 3ZWCA 3QE3A 3GNSA 1WXDA 2EJVA 2QRJA 2D8AA 3JQ8B 3PRJA 4J9VA 4NNJA 4MIEA 3TN7A 4JBHA 3GGGA 3INRA 1VKNA 1Y9EA 4JJFA 5DP1A 4CM8A 4CMKA 2BF7A 1UXHA 3JQAB 5KCZA 3AK4A 4BO6A 5EPOA 3RU9A 1V3UA 3R3SA 4U7WA 3MJEA 5DBFA 3JQBC 4BV9A 4F6LA 3A9WA 3H2SA 4JP2A 4TWRA 4CUKA 4PLYA 1GTMA 4J2OA 3CPSA 3JYLA 4PLGA 4ZA2A 2HO5A 1XU7A 3QW2A 1MC5A 1NFRA 2OUIA 4E6PA 3KSZO 4CLEA 5BQFA 1A7KA 1OMOA 2GZ2A 1NHWA 1U8FO 3KYDA 2P5UA 3PWKA 4F6CA 2JHFA 1LSSA 4GX5A 5IDWA 3DONA 3DZIA 2Y05A 1ADBA 4NJMB 3AI3A 5A9SA 4PLVA 2E37A 4ONEA 4ALNA 1NR7A 3ADOA 1JAYA 5K6AC 1DPGA 2C0CA 4MVJA 3PZBA 3F5SA 1JA9A 2X9NA 2AXQA 2QX7A 3ZWAA 5DP2A 2FZWA 3DAGA 1CRWG 5TT0A 3KUXA 1RM0A 3K73O 4AJPA 3L77A 3E48A 3TFOA 3G0OA 1S7CA 4CLOB 4E2WA 3H9GA 2Y1DA 1PJQA 4AJ4A 2RIRA 4ZHSA 3CTMA 1ONOA 2H63A 4Q3EA 3TZKA 3KV3O 4GL4A 5GMOA 2EW2A 3OETA 1PX0A 4BV8A 5CDTA 1WW8A 5AXCA 4BNWA 1R4MA 1XSEA 4C4OA 1EVIA 3MJVA 1AXEA 1BVRA 1Q7BA 2Y93A 1DSSG 2ZIZA 3VC7A 3IKTA 1ISHA 1UXIA 4XGKA 2CUKA 4O59O 3AU9A 3BZUA 4BNFA 2YYYA 3AY6A 4MVJH 4RVGA 2FP4A 3UAGA 1PGPA 5DOVA 1ADCA 2FR0A 3VDRA 1O94A 3IAHA 5JCJA 5C7IO 2A4KA 4L9RA 2C29D 4QSMA 3VTFA 1C3VA 3BMNA 3VPXA 4IJKA 1X1EA 4B3IA 1YH3A 1OC2A 1CYDA 1WDLA 3QWAA 3ZW8A 3NT4A 3BMOB 1DFHA 1G1AA 4CLRB 1MC4A 3GAFA 3G49A 4RZHA 4D3SA 4E5KA 1Q0HA 1IY8A 3OH8A 3QVTA 3DBRA 4NG5A 4RVFA 4OOEA 5JAZA 3E5RA 3PHIA 4YA6A 3X2FA 4TVBA 3E9NA 5T67A 3WBBA 3U4HA 2BKAA 2VRCA 3WJ7A 5AQ1A 3HHPA 5HS6A 1BSVA 2EJWA 3A28A 4DBVO 5C7LO 4D43A 3JQ7A 2VOJA 2VZ9A 1PWZA 2C5EA 2IYPA 1B8UA 3RUCA 2EGHA 2O3TA 2PR2A 1K89A 1UAGA 4HUJA 1R0LA 2HMTA 4IINA 4PG4A 3JQ9A 1QLJA 1VSUA 1ONPA 2GUGA 2X8LA 4AL4A 3Q3CA 5U1PA 1IOLA 4RQUA 4YCAA 3NX4A 4ZJUA 1DRVA 4WUVA 3WNQA 2TMDA 4BNGA 5F1OA 5JDIC 1T25A 1ZXBA 1ISGA 2RCYA 1H9AA 4YAJA 3SJUA 2HSDA 3UCEA 3HFGA 2WE8A 1PJTA 1GEGA 1TT5B 3SX2A 4J4BA 3VDQA 1G0OA 3VKUA 4IJUA 1JW9B 3NJ4A 5CEEA 5L4LA 3D5TA 1F12A 4RO0A 1KS9A 1PGNA 4M55A 4Z9YA 4UUOA 4GQAA 5T8KA
chains in the Genus database with same CATH superfamily
5FAXA 2ZRJA 2X5OA 3V1LA 3EJWA 2Q2OA 1PS0A 4N7JA 2ERYA 2PL3A 2Z1NA 2PT5A 3HBFA 1P2GA 1UIMA 3STWA 2GPYA 1U2QA 5B2FA 3H1EA 2WE7A 3AMVA 4H1WA 1VDMA 2ZRFA 2A0WA 4ENUA 1WOMA 1CPYA 4DGQA 1DZ3A 1MB2A 1OIXA 1SU7A 1P17A 1RQPA 5JJIA 2FW1A 4EFMA 1OASA 4G5SA 1AKMA 1Y3IA 3TQTA 4QYWA 4NMLA 4AQYB 1NXXA 3CT6A 2GHIA 1I9CA 1XXHA 2C92A 2DH5A 3C6QA 4RF2A 4A7PA 2MMGA 3QYAA 1YRLA 1GZ6A 1DOHA 2QE6A 2GZ1A 3F47A 4Y6OA 1U4OA 5FYQA 3WGNA 2HHCA 2W5UA 3ETNA 3QNMA 5FAKA 1D4AA 1OE0A 3BRQA 3VR2A 1W19A 4ESOA 3L1IA 5K99A 1L5WA 3HCNA 1F6WA 2M9MA 3IKTA 3HCFA 3OO1A 4JP5A 5I5EA 1WF6A 3N6RA 4KR3A 1ECCA 1ZITA 2WBLC 4MYUA 4KUHA 3WRXC 3FTEA 2R62A 1SKYE 1TPZA 2FWIA 1DAFA 5BMVF 3ZCQA 3COWA 2VFAA 5IUJC 3E9MA 1BCSA 1TYZA 2ID7A 3CNOA 4G9GA 4BNLA 1AQIA 1QYWA 4YJ2F 4PV7A 2GNAA 3KOOA 2G5TA 5BR4A 5IXYA 1OGIA 3VSCA 1K68A 3PXCX 4YT2A 4RL4A 3E22B 5LYJA 2EQAA 3JQEA 3DOCA 3QXSA 1E62A 1XU9A 1DAIA 3BF8A 4UUMA 2P2LA 4OMUA 4RVCA 4D74A 2CDAA 3LCCA 4NPAA 2WDZA 3M6MD 3Q3VA 2I54A 2WU8A 4Q24A 4LV8B 3PT9A 1EQAA 1JZQA 3OSUA 4OB6A 4QHYA 5TGTA 3R75A 3VNUA 4IHJA 1Z2AA 3VVBA 3CKMA 3P9ZA 4JP3A 2X9VA 1AKUA 2FE4A 5CB4A 4Q03A 1T4DA 2LTAA 5BSTA 2EDCA 2XMDA 4NECA 5LA6B 2X19A 4C0HA 4HL6A 4GPZA 4LQ4A 3NFRA 4LOLA 2W6QA 2E4XA 5ALNA 2CY0A 1YJBA 3O3CA 2XODA 1W0JD 4NNOA 2XNKA 1OA0A 4PFSA 5A4AA 3HM9A 2IDJA 3E3NA 5AVTA 2OXCA 4ZD6A 3SHQA 5JI3E 2XUKA 1Y3DE 2VDWB 4PRKA 1SUIA 2ID9A 3K1YA 2ZIVB 2OO3A 4E5DA 4F1JA 1IPEA 2EF1A 1EUCB 1OQAA 5J3JA 1ZUD1 3JD2A 4A82A 1ULHA 1YJQA 2UZ1A 3GYBA 4L1KA 3OCWA 1SHJA 4RPHA 2ESRA 3P32A 4MP3A 3I52A 3A36A 4QE3A 2P68A 4PSDA 4BO3A 1CDDA 5KOIA 1YCGA 5BSWA 1OOEA 3BHJA 1ZK3A 3EEIA 4WW0A 2IP1A 4ZIRA 1KQ3A 3RK1A 5H4GA 3EPKA 3NYIA 3I2KA 3V7NA 1L4EA 3GJ5A 4YRLA 2IV3A 1RSZA 1ZGBA 5JVDB 2OSVA 1LLFA 2QPTA 3VV3A 4O4IF 3AR2A 5DK4A 5JZMA 2WKRA 4YRZA 5IULC 1XTQA 3MJ4A 4NBRA 4OCZA 4EFLA 1U3DA 2PT7A 4I0WB 3CHYA 3KJFA 5KSYA 5CVEA 1KO4A 5EMJA 4ZO9A 4I50F 1R8QA 1LPMA 5DF1A 4D81A 3FYUB 4I1PA 3HJAA 4GOKA 2YJ4A 1QFMA 3B6ZA 4ROTA 1E20A 2BE7A 4YDSA 4E94A 2JCSA 2PA3A 3KZ1E 1K8RA 3FKJA 3OCCA 2ANBA 4JNKA 1MJHA 2XXAA 3NPMA 1IAQA 2NVUA 3VUEA 2VP5A 3C4QA 4RX1A 2V7QD 4URUR 3JYQA 3G0IA 5BWNA 2F4NA 2COKA 3R5JA 2Q5QA 1ST2A 5CGQB 4PNPA 4NENA 1KRWA 1ZJ6A 3W5IA 1P1BA 5IT4A 1QPGA 5TX7A 3LTNC 1TK2A 3H9QA 5CLHA 1C41A 4X6XA 5M2QA 1VJTA 1TPYA 4D0GA 4F6RB 4AS2A 4KE9A 5KYWB 2N9UA 3IKJA 3ED1A 1XEAA 3CINA 3EW9A 4HH4A 5ARCA 1HG1A 3ND7A 2ATVA 1N5MA 3JAWB 1K6IA 1E1MA 2HM7A 4BP8A 1YSCA 2Q07A 4Y2TA 3GRPA 2AK3A 2R8ZA 4X1KA 1II0A 3L7AA 1NBMD 2FQQA 5BNTA 4KKXB 1GARA 1W2GA 1F8UA 3H86A 4DPMA 3D3NA 3I64A 3P8ZA 4UOZA 5JSKA 3WXBA 2I34A 4ECAA 3PX7A 2Z8ZA 1V5FA 1W1IA 1DLIA 3T7IA 4GMXA 4HJXA 2QZSA 2VYFA 5K0BA 5DHUA 3WLTA 2H57A 1DV2A 4EGSA 3QJGA 2XMBA 1QYVA 3ETJA 3P5BA 1WQ3A 4R51A 5AFSA 4MLDA 3NOOA 3W06A 2W42A 5FJIA 1R9NA 1N3YA 1A9QA 4TQ9A 2R8XA 2VRBA 2P6PA 1LTQA 3M34A 2BTEA 1FP2A 1L1RA 1T5IA 1RBZA 1XCBA 5H1YA 1W30A 2QRNA 3OQ1A 4L4XA 5K3BA 10MHA 3DC2A 5CURA 4XX0A 3QE9Y 2CL6X 3LY9A 2FMTA 1J8FA 5JQGF 1R8YA 2G40A 2C2MA 1SEPA 3L7LA 2BFDA 1ZFNA 3UHPA 1H5NA 2GZRA 4HPWA 3DQQA 4JOSA 1EGVB 2BEWA 2XE7A 4V3CA 4NXMB 1POWA 2Q1SA 4TV8B 4UM9B 4DLLA 4JI1B 3BJRA 4F4DA 1T2CA 2FW6A 4GP9A 1VA4A 2W8BB 2WJ6A 1H0SA 3CCBA 1E96A 3WMEA 1OLSB 3K8QA 3N2NA 2WY2D 2RB5A 2JFQA 2ZJ7A 3CN7A 3EF3A 4BFSA 4Q9LA 1A8UA 2EGUA 3D8UA 4DBZA 2FF5A 2WHQA 2XW6A 3ZJ5A 1H2EA 1K6EA 5H5JA 4ZANA 1V37A 1U9ZA 3LU1A 1EINA 3RVKA 5IDQA 1KFCB 5F9HA 3FAKA 1CB0A 1QZTA 2EG5A 2O2JA 1OT5A 4MLZA 4FW8A 2I87A 5A7HA 4IMJB 1G9TA 3D1JA 3QPVA 1R4NA 4HLUC 4M0CA 4Y7DA 4AY4A 1NE2A 1SUFA 3IC5A 5JYEA 2OKCA 3EFBA 4G1EB 2GN6A 4YUAA 1E6UA 3JZFA 2O0KA 3LDGA 4ZEWA 3L0BA 2UZAA 3ABOB 2GD2A 1AE1A 3EUAA 3F78A 1E64A 2V7PA 3GFBA 1XYGA 1PFWA 2OD2A 3ESCA 1O7JA 2ZIFA 1OH8A 4MUHA 3WZ2A 1A8IA 2RCNA 5AKKA 3RYHA 5KNLA 1OI3A 1N9ZA 3BHIA 4C7XA 1LQTA 3SYMA 5LQAA 4ANFA 4WY8A 3KP1A 1SUSA 2QPAA 2XB9A 1PQWA 2OV6A 2DQKA 2ZRKA 5TMBA 3U9TA 3CY6A 3JYNA 4JJ4A 4Z0TA 5K6AA 5DEIA 2JCYA 5KMGA 2WMYA 1I3MA 4PHTA 1J00A 3Q41A 5ALQA 1VLMA 1ZCJA 1EZZA 4ZK2A 1MOSA 1OKKD 1Z0ZA 1V35A 1ZRNA 2GCEA 4UHHA 2BVNA 3UWSA 4BGVA 4JIGA 5B4UA 1P6XA 3KJNA 2H5IA 3B1KA 1VI6A 3HY6A 4DG8A 2UXCB 2VDMB 3MMSA 3V8QA 5CDYA 1ETUA 1M1NB 4FYVA 2V7TA 1M0TA 2WWRA 2XJ9A 3H2KA 3V8RA 3I05A 4BASA 4JXXA 5U4XA 2XHEA 4PC7A 5BW8A 2O8DB 3BMXA 3AX6A 3SMVA 4D5EA 1M76A 4FXPA 4UE3S 1BFDA 4E14A 1R12A 2XGOA 1F06A 1C8VB 1JB9A 3CX7A 4CTKA 1MO3A 3MOSA 1G9SA 2VUTA 4IUDS 1RE1A 1ADFA 5DT9A 2C4KA 3CW9A 4FU0A 4FLEA 4FDTA 4ZTBA 4KN9S 1H85A 1QFSA 3ZIUA 4BNNA 5JHGB 4X6YA 3ANMA 1WXEA 1ONSA 1W0CA 1WUHS 3OI7A 1UFRA 4ZXFA 3T3DA 4PSUA 5DTEA 4BMSA 3VNAA 1JVBA 3IDZA 5BQXA 1E5LA 1UZNA 1WB6A 3E03A 3LFHA 1KEVA 2BGJA 2G4LA 3FCSB 1E3WA 4JOCA 5KKAA 5J5CA 1TDJA 1KL7A 2Q8NA 1QIHA 1TJPB 2I62A 2EWMA 4CQMA 4I1RA 3H9EO 4LDAA 4LY3A 4TYMA 3LT5A 1B93A 2NZJA 3DDCA 3BFXA 3E9QA 4JB0A 4BWYA 5DB4A 3PA6A 2DXIA 1NUPA 2FRVA 1Q7GA 2DTDA 2SKEA 1P7YA 4EUKA 2VP0A 4QOSA 2F00A 1E7MA 4PU0A 3GA0A 3ENKA 4Z9FA 4A0SA 4N0EA 1EFAA 4EZBA 3DTYA 3OLVA 4R2LA 1N2GA 5CBKA 5KNBD 1P4HA 2H11A 1WABA 2AOTB 4W5TA 5K0FA 2GM4A 1MO6A 3J7TA 2R8OA 3R7NA 4EOGA 1SCAA 1GA6A 4BP9A 1HOXA 1DQPA 2VDQB 3EAGA 5IH3A 3D0KA 4DWJA 4EUNA 1RXWA 1YWGO 2PL9A 5DHQA 1GZDA 3SS7X 3U6BA 4QUIA 3P20A 4RVSA 4XEUA 4EGFA 1OT3A 1P5HA 4WADA 4OGKA 2O0HA 4QYIA 4B34A 2CWWA 4RJIA 4WXRA 2Y92A 2FRDA 1NUAA 5ALIA 1NXWA 2LV8A 2IY7A 3QFRA 5GINE 4KQHA 2YV1A 2WNSA 2RG1A 3JU3A 1OZHA 4JXJA 3ZYZA 3VUFA 4Y2HA 3H5AA 4HQ6A 4TTVA 1G20A 4WK0B 3RVPA 4AN4A 3HA5A 3GT0A 4BLOA 3BKXA 3ZZ1A 1HSOA 4CMBA 1T34A 4HDMA 4KN8A 1TE2A 2Q2WA 3K0AB 4NL4H 4ZVQA 3N5CA 4EJSB 1D1QA 1HEUA 4M99A 2F62A 2ZW9A 3K9FC 4LF7B 2ZIGA 2I9PA 1NQXA 2IF0A 5TVKA 3A04A 3C97A 4G1FA 1H3EA 2VDVE 1MQ8B 1VL5A 2WYOA 2ATCA 4UHCA 3HNOA 1GPWB 2F8LA 5IKOA 4UBOA 3CEHA 4DCVA 1F8XA 2GFQA 2J4FA 4QDKA 2EERA 4D9KA 3U44B 5K9ZA 2AG8A 2ROQA 3GIWA 3KLPX 3MIZA 2YHSA 3OOWA 1E0AA 4BBAA 4P22A 4X64B 3FWNA 4X1OA 3JATA 3W04A 3O9VA 4M36A 4CYMA 4L0MA 2QMUA 2VXOA 1I2MA 2JI4A 4MWGA 4UEKA 4QU8A 3TEJA 1JTFA 2P6MA 1PJ2A 2QL5A 3QLUA 1PFUA 2GMWA 4R81A 1X1RA 2Y27A 3NDIA 5DI3B 1I4TD 5LMUB 5AVQA 3MGKA 3H16A 2RGNA 4DV7B 1NZJA 3FPHA 4B6GA 3T99A 3LCJA 2GEDA 1JU4A 1T91A 1VBNA 3E9EA 3HC7A 3OX4A 3IL2A 1MZPA 3VZRA 1DRUA 4H15A 5BNZA 1ADGA 4PIMA 2MYTA 4PG8A 3DAPA 3EG5A 4DDMA 4IFTA 4PSCA 1IUOA 1PLLA 4CCYA 5E6UB 3AFNA 3GDWA 3RSOA 3OQOA 3AEQA 3A6FA 1RNLA 3COSA 3I2HA 4FW9A 4HZUB 4N01A 4PC6A 3DUFA 4OQYA 2QSZA 2CBGA 3ZD8A 5JNUA 1TZCA 3EZXA 3NANA 4TQGA 2CV1A 5EE0A 2CUTA 1FFHA 4M22A 4UHJA 3EPPA 4B4WA 4EGCB 1DAHA 5CXQA 1UP6A 3DEJA 4MDHA 2PX6A 1F2UB 3HFSA 2GAFA 4HQOA 5EJ4A 5A04A 4TTIA 3RYIB 1GGFA 3DULA 1NV8A 2BDEA 3RBAA 4Y18A 3GRRA 1RPTA 1U8ZA 4F5DA 3K0HA 5CA0F 2GZSA 1H2HA 4IDDA 4JLSA 5CXSA 4K6CA 3TQHA 3INNA 2O8VA 4J9UE 2BEUB 2WKWA 3OA2A 4RSMA 4EMUA 4DB2A 3REFA 4M9ZA 1DOZA 4BIMA 2WD7A 4MW1A 3OWOA 1VLVA 1J5XA 1YIDA 1PHRA 2ENWA 3O8DA 3MW8A 1N5LA 2QJTA 3RODA 1G17A 4PYNA 2HXSA 2P3OA 3NGXA 4OHKA 4LMAA 5MN5A 3OCJA 2FETA 2Z83A 2UZIR 4HBGA 3MNFA 2ZYTX 3D6VA 4JLBA 4GMDA 2D7CA 2OY0A 3BXHA 4D3ZA 3IH5A 2FE1A 3JVIA 4JU9A 4PICA 4F04A 2R6DA 1BYUA 1UJNA 3DBHA 2P27A 2Z8XA 2QVZX 3AUXA 3D4IA 3H65A 3OZIA 4NG4A 4M0DA 5IC4A 4IHQA 3OAAD 3U4AA 2OHHA 4QTZA 4BEVA 3WLHA 2WC1A 2YY5A 1SXJE 2C2WA 4WRRA 1OWPA 2WAAA 3S3TA 2ZREA 1XROA 2XF8A 4O2AB 4XEHA 1E6WA 3CEPB 2HPHA 1TADA 3PNMA 2QU8A 3QA3E 1A7AA 2IPOA 3BTUA 2WV7A 2Q5FA 2ZQ5A 3PE3A 4N65A 1QYRA 1V47A 3FRIA 2I9KA 3NYWA 2G09A 3D43A 3H04A 5DIZA 1SBCA 4R6WA 1ZH2A 3TSOA 2G88A 3I01A 1NPTO 4D8UA 4Z4EA 1KVSA 3DVLA 4UEOA 3UICA 1K4MA 4J1TC 4MS3A 3NIDB 4OGWA 4HAYA 1CV2A 2EBFX 2YQZA 4H1VA 1H6BA 4LWQA 3IUQA 4C9BA 4EL0A 5C1BA 4FWTA 1JE1A 1GQRA 2B69A 4CODB 2WWYA 4EITA 3UIEA 5GJWC 4ND5A 4GPD1 4ZAXA 2D2XA 1YZLA 5E7QA 2PUFA 4IQFA 5DM4A 1LPSA 3A9CA 1RI3A 4MK4A 4BDTA 4Z7OB 1J2RA 5I51A 2BMAA 3H1GA 4DUPA 3O3MB 4UZEA 4C4XA 3AZQA 1Z0AA 4I1VA 1DQNA 4H4CA 3P45A 3N59A 1N6HA 1GAJA 2BOVA 2X14A 4GPAA 3VR3A 3K35A 4BO8A 2V0NA 4DARA 4Q9HA 4WZAA 1KMIY 2EWWA 1YXMA 3F5QA 4GFDA 4F06A 4CXMA 4ON9A 3W6PA 1SH7A 1LD3A 4ASUA 4BMDA 5HKBA 2ZE7A 8ADHA 2XMPA 4CM3A 4ER3A 4MQBA 1Y42X 3I2YX 3OJXA 4IYRA 3AR6A 1EWYA 3ECCA 4RACA 2OORA 2Q49A 1I7DA 5DU2A 3GLFE 4WNIA 3B78A 3RF6A 4CEIB 1DIHA 1L6RA 1N6OA 4Q00A 3BB4A 3DP7A 4ARIA 3H8SA 3BX1A 2A1UB 3G85A 3PHLA 4IEIA 1Z73A 2PUDA 2IYTA 4Q34A 3WSWA 4D3XA 1A88A 3BFJA 3IV7A 3ZDCA 2V7UA 1OLUA 2J1LA 1AQNA 3HE3A 3OC0A 1L4KA 1CB7A 2R4TA 3KZCA 2PZFA 3Q12A 4IDPA 4N76A 3LGSA 5JPCA 3FOCA 3D4BA 1ZVKA 2VXCA 4GIBA 1FMCA 2VXBA 3L8DA 3PK0A 4CFZA 3HBJA 5AJWA 3VHQA 1PV4A 3K9HA 3QA9A 1KO5A 1RPZA 4URVR 3U7IA 1KQFA 4CDRA 4B80A 1Z56C 4Q7QA 3RAFC 4GF5A 4OQZA 4D80A 1WDMA 4ID3A 4A0FA 1T5DX 3R3YA 3WGGA 3VYUB 4JBNA 5FTWA 1Z35A 1SD5A 4DVJA 1RJGA 2Z08A 4ZVTA 2OHGA 1PU2A 2BISA 4YQEA 2RJOA 3EZFA 1O6GA 2NWQA 4AURA 3GCXA 5HTOA 2XB4A 1C9DB 1NGSA 2XGMA 3OU7A 3T3HA 4BBZA 2QRHA 2WSSA 2DFPA 5IAKA 4NOLA 4UU0A 4Q9DA 3SXUA 1KAOA 3DR5A 1C4XA 5JZSA 2RGWA 3A14A 4BCBA 2ZQZA 3KQHA 4DLBA 3EPJA 1WCYA 4Y1FA 1XNJA 5CT9A 5FV7A 1VJ0A 4YJKA 1YZ3A 3KOWA 4BMZA 1ZOIA 4GP7A 1SBYA 3QE4A 4IUBS 3DMYA 4MWBA 1HDRA 3JWPA 1IVSA 3IEUA 4KI7A 1SY7A 2Z3VA 1IONA 3TZBA 1JECA 1GO2A 3PXDA 3ROKA 1JHAA 3ZZUA 2F4VB 5AM3A 3F9IA 4IOKA 2IV7A 1DRJA 1VRVA 3QU7A 3UPTA 5L6LB 2ZBDA 1Y7PA 3JAKA 1LBHA 2JEYA 1SVUA 3BE5A 3CZCA 1P62B 1GFSA 3EXHB 3FNHA 3OZXA 4HYEA 3NWOA 3R6WA 1GAEO 2AGVA 3AXTA 4UNSA 3OLWA 1RQNA 1D1SA 2NTEA 3LKBA 4G2NA 1SUAA 2X8JA 4J6FA 3AV3A 3RBXA 1F6BA 4EZIA 3BT7A 5JJCA 3LBIA 4IWNA 2ODPA 3PPYA 4DV4B 1RYEA 2AF4C 3KYBA 4A6XA 1ZM9A 4PZZA 1EP1B 2JIBA 3MOGA 3EYWA 5F7XA 3OFSA 2NO0A 1IHYA 2QUAA 3V7WA 1GZ7A 3D7KA 1XLTA 3V97A 4HI0E 3O0TA 3I9MA 1NX6A 4ZYLA 2XNSA 5LZ9A 3A3OA 4Z8YA 2GDZA 3PKJA 2Z6AA 4ZVVA 2XE4A 1EDZA 4X1IA 1BOFA 3HU3A 2B83A 3IR7A 1U1FA 4OH7A 4ARSA 3AM4A 3RKUA 4C4SA 4G5RA 3DE7X 4LZWA 2PEYA 2O5RA 3R9IA 1QGOA 1W5SA 2GM9A 3IP3A 4E5YA 1A97A 4FHFA 3U09A 4EO9A 4WCFB 3DEHA 1FFWA 4ZYUA 3TAHA 2AX3A 2Z2YA 4HAIA 1NLZA 1PUIA 4QQKA 4KR9A 5FWDA 4CKXA 1ZMXA 2VA8A 2H0QA 1IHPA 3I01M 2XVAA 1E89A 3C87A 1JQLB 2XB6A 3E8XA 4KYIB 4U7PB 1ORVA 3BN3A 6PFKA 3A8TA 5FNZA 1JR2A 1NIJA 3I0ZA 1VKHA 2PN1A 1Z25A 2BGLA 4DKJA 1XD8A 2GHRA 3EVFA 4DMGA 1ZD3A 3A6HA 3DLPX 3WI7A 1GKUB 1LDYA 2ZI3A 1BDMA 2FJPA 4PR0A 3DMHA 2F90A 2MSWA 2QUIA 3UT5A 5ICGA 1QRTA 1ZH8A 2PFGA 4Q4AB 2JGRA 2KM1A 4N3NA 2PPVA 5HKOA 4IS3A 4B40A 1EB9A 1EI9A 1QFZA 4N0QA 2WYIA 4PX9A 3WC4A 3FMFA 5ENVA 5HQTA 1Q22A 4RA9A 5B4TA 1R15A 3LA8A 2IHJA 1L7PA 4R9VA 5JS2A 4JODA 3FX2A 5FKJA 5A3RA 2FF7A 3JYHA 4QXQA 3EXIA 3I12A 1Z6GA 2FCRA 4MWZA 4YV0A 1ZK1A 4WOPA 4EA6A 1ULAA 1J24A 1T15A 4EABA 3A6DA 4J2TA 3DLCA 4QUJA 4UEWA 4XDGA 3A6LA 5TF0A 4Y2XA 4RIEA 2WYUA 3D4LA 1X42A 3NH9A 3KT6A 3S81A 4XW2A 3ZU6A 1F0NA 1N2CB 1X14A 1GPUA 2DUUA 3R44A 4HHEA 1Z5GA 2P69A 3K8ZA 5JXJA 1DBRA 4H7PA 5JCJD 5KJFA 3WJ1A 4AJLA 1ULUA 2CYBA 4HDNA 2J9RA 3B3FA 2YHAA 1V1MA 3C3PA 3TB4A 4X8HA 1ODSA 2CXOA 3F6YA 1L4FA 1I3NA 5J5AA 3WR5A 7AT1A 5B6JA 4MQMA 1JI3A 4B71A 2AE1A 1MGPA 1NSTA 1KU0A 3ZCTA 4M1WA 3YASA 1ZZGA 1J0CA 1M66A 1TJ3A 2GA9A 2Q29A 1JZSA 2UAGA 3I5UA 4RMIA 2B8WA 3FKSD 3Q85A 4NK4A 2NV0A 3NHBA 1OIVA 4EY5A 3QKTA 1FFXB 3CZQA 4MJXA 1WY7A 2W6CX 3U3RA 1ZHHA 2JGEA 3BMQB 3M4JA 1HDCA 4LVCA 5DM1A 4X3CA 4DC9A 3KALA 1XXHE 1TTQB 3IS3A 2FPGA 4RSHA 1WXGA 1TQ2A 2GD6A 2E82A 1GRQA 4UDOA 5HMMA 2R1TB 1XP8A 4WLUA 3UK2A 4C7BA 1FQKA 3KAJA 4LYAA 2VLIA 1HURA 3P71T 3VNSA 2MJLA 1ONNA 1KAEA 1LA2A 1P61B 2OHXA 3W77A 1FS5A 1JTEA 4MTLA 3FZNA 4MQ5A 1HA3A 1OI2A 2YJTD 1VECA 4OUDA 5I3ZA 2B9VA 1NY5A 1EFRA 1N5RA 1ID1A 1QHNA 4Q47A 5A4DA 3ZLVA 5BVHB 2Y1WA 3CNEA 3KYDB 3R4VA 4LRYA 1CULC 2A5JA 2QTTA 4CMEA 1XHFA 4LKOA 5H0IA 4KJXA 2ACVA 4LWPA 4DIDA 2WSLA 4TLDA 1WA5A 1Y48E 1YU6A 3DV2A 1HNNA 4QYTA 1C3JA 4LF5B 4WVFA 2R4QA 4QTXA 2Q3BA 3IEMA 5G1NA 1QVVA 3FPSA 3ICVA 5FJJA 3KAKA 2A9VA 4OUKX 4EFNA 5H3CA 2ACEA 3G9TA 3WIUA 3WIVA 4MYTA 2GQ0A 2PMKA 2Q4EA 3H0KA 2R7KA 2B5VA 2R8YA 1AUOA 3C3WA 4DL9A 5GPBA 1ECGA 1T2EA 2VZLA 4PFJA 3PNQA 2HF9A 2JD0A 3FA2A 3M89A 1HQKA 4MPRA 4OMFG 4Y9RA 5DTJA 2A9KA 1N6NA 5DNEA 1UBCA 1X1DA 1S2IA 3NHYA 3NM5A 2OWEA 1DMSA 2D4AA 4L4YA 4OSOA 1GU7A 1V2HE 3K6KA 1IZZA 3SKXA 3DHYA 2QL9A 2CV2A 4ENPA 3RVMA 2W6OA 4ZZ3A 2JFZA 1SULA 2XSZD 2O2GA 3KOMA 2JRCA 3P9XA 4RSGA 1USGA 4A2CA 3QLJA 1P4SA 4LF8B 4NZNA 1HDEA 3TBHA 2BM1A 3QLEA 3A1SA 4N3CA 2JBAB 4GPIB 5BUSA 3EXEA 4IF6A 2BC9A 2VBFA 1MPTA 3EASA 2O0JA 4MS1B 4QD3A 4XB6B 5ESXA 4DPLA 1OTXA 2PLFA 2BIFA 2MSKA 1P5RA 3JWHA 4XWKA 4J0FA 1A0OA 3LQFA 3PR2B 4YP9A 4DZRA 1EFPA 3LMKA 2J3LA 3OF2A 4LY9A 4WL0A 5AW6A 3IXMA 3UT6A 1V95A 1VB3A 2NTJA 3C39A 4BMPB 3K0SA 4XKJA 2CDRA 2WB4A 2VWPA 4TUYB 4V0KA 2KPOA 2WZDA 1WXXA 3GVIA 1P2SA 1COZA 1UPTA 4YAGA 3O8NA 2P7IA 5C34B 3H2JA 1BH6A 1UR5A 2CXXA 4PZCA 1LPPA 1Q6ZA 1CEXA 1K75A 5L3QA 4RZQA 4HB4A 2A0FA 1E98A 3AUTA 3DCIA 2JAQA 4M0EA 3SNKA 2KSQA 1G38A 3PGVA 1CR1A 1T1SA 1Y6GA 3P0RA 1ZXXA 3DBOB 3KJQA 1G6HA 2ALJA 2VYVD 4ZOLB 2E4YA 5AHWA 4CR6A 1P8JA 3NAMA 3B70A 2E1PA 4RTNA 1NW3A 2CJFA 5K0ZA 3UJHA 3K15A 4ZZ2A 2P4HX 2BI8A 4OJQA 3HYSA 3OJWA 5F2KA 3SZGA 4IWXA 4GE0A 1RHJA 4JL8A 4BATA 1KA9H 3VU9A 1WLSA 2BCGY 3PRKE 2RGBA 1EUZA 2Q6KA 2WM3A 1PZHA 4RENA 3O8OB 2LW7A 1JU9A 1S3GA 3TX6A 4YXFA 1NWCA 2FNAA 2XWQA 4UZSA 5AW1A 3H9UA 4AF8A 3UJNA 2A5FA 4IJWA 2OFWA 4F4CA 3DMGA 4YASA 1JKJA 3WIDA 2A2ZA 4U2GA 5JWHA 3I9V1 1SK9A 2PY6A 4EVSA 2XMCA 3H7IA 2MCFA 1IN7A 3AR9A 4F8YA 3LUHA 3AB8A 2TECE 5CJ2A 4DCGA 1CR4A 4KMRA 1A5TA 3QELA 5D3MA 4XWYA 4MR8A 3VR0A 4GVLA 2IOFK 2OKGA 1S0UA 3WYEA 1VYVA 1WV1A 1PR6A 1PJRA 3MMPA 5J1TB 1NN5A 4OBWA 2DULA 3OE7A 5MN4A 1XVLA 1GKKA 4RDIA 4KTTE 4XJVA 3R3ZA 4R0MA 1QG6A 1GUZA 1VG9B 1TT7A 4OH1A 4N5HX 2YWFA 3QEMB 5LMCA 2D06A 3TRHA 3HFJA 4AN1A 2O7QA 1Z0DA 1SCUB 1FE8A 3HCEA 2ZAOA 2QORA 3Q9SA 1D8AA 5FOUA 1BXGB 1NBHA 2SICE 3W5HA 5KDLA 5GONA 4AX8A 3ILYA 2FK7A 2F64A 2JLRA 1G2PA 2CUZA 2CVZA 2QX6A 3KVNA 1HZJA 3NIGB 3OURA 2BHLA 3S1AB 3VQTA 4WGFA 1CUWA 4LS3A 4RGBA 3W90A 1N1EA 4ZI7F 2IZ1A 1IRIA 1ZH0A 4DLNA 1YL6A 4YMLA 4HDAA 4TS4A 3NVAA 4HDRB 3GFQA 1Z06A 3E35A 4AJKA 5DM70 3EXFA 5E8RA 2XDAA 3U3MA 3DLHA 1XA0A 4TKUA 4W7HA 4GOMD 4TRNA 4DILA 5JSHA 1JIUA 3W2EA 1JDVA 4KO1S 3WGHA 5HVNA 1ZI9A 1PR5A 4P3XA 3E15A 5AKLA 3WGIA 1IXRC 1JUDA 1KY4A 4H27A 5GOZA 3PXUA 3QVKA 2X5KO 5J1SB 3D0OA 1YCFA 2Y99A 3N75A 1TJ4A 2QMZA 5EIAA 3T5GA 4MO2A 1IEVA 2W4QA 2QVYX 4FFDA 4ZGWA 5KWIA 3RCBA 3FRJA 3VJRA 4RYLA 1N1GA 1USKA 4MWSA 4NCAA 3K9QO 3EHDA 4B8YA 4MUAA 5AHOA 2BGKA 4FMCF 4RUKA 5KU1A 2RHHA 1CZUA 2ZEJA 3KBBA 4GECA 3U39A 3IAAA 3HSKA 4ETNA 1M2OA 1N3BA 3ZCPA 5GAJA 2O2DA 4QKQA 3FVWA 2UVPA 1SBTA 6LDHA 3O4VA 3S40A 4ZPJA 1Q0TA 1GXSB 1P8AA 5C4GB 2DFDA 4TLBA 1OZ0A 4IV5A 4FSDA 1DT5A 1LI5A 1SUWA 4BNDA 4CMCA 1LS6A 5IDVA 1RQ7A 2ASEA 3GJXC 4ARZA 1LPNA 3C2QA 5CDSA 3PWZA 3ER9A 2YDXA 3RTDA 3WQRA 3L7YA 1MX9A 1Z18A 1WZNA 1MMFB 4KE8A 4LHXA 4MITA 3CWCA 2QS9A 3OJEA 2P4EA 3FB4A 3G8YA 3OHSX 2FQ1A 4I4NA 4RHEA 1E0KA 4RV9A 3EDMA 3HRIA 4W8HA 3E1SA 4ALMA 4JVSB 3L43A 2WWTA 5IYZA 1GQYA 2W2PA 5EPEA 3QF7A 1K6JA 2YZKA 5AM5A 2YICA 4NPHA 4QRIA 4MO9A 2C3PA 2C5BA 5FTNA 3A31A 4AYTA 5IN4A 2F43A 1A9SA 2W6ID 1J6UA 3GLKA 4UMFA 5CNMA 2DKOA 3GUUA 4UD6A 4C4PA 1PZXA 2CHVA 3S2IA 3V46A 2FXIA 2HJHA 3HDQA 3GRYA 4LG1A 4WACA 2FQXA 3LC7O 1DZIA 2POCA 3CNHA 5D2CA 3AYXB 1P29A 4HPJB 1VYHA 5CCDA 4EUFA 5KVVA 2YNMA 5GGYA 1SHKA 3MIIA 4EX7A 1WV0A 3FFWA 3W1WA 1U8EA 4HBZA 4QUHA 4KQ6A 1R16A 1E2HA 2OV8A 5F33A 5G4KB 2JW5A 2MU1A 5EJ2A 3VX3A 4FILA 4EUHA 2DJIA 2ZUVA 3ITKA 5JDIA 4QG3A 3JTMA 2XADA 2ECKA 3CGWA 3EGXB 2CSUA 4UAGA 3VM6A 2HA2A 5JCXA 1YT5A 1Z47A 4ZCMA 1QK5A 3NHWA 5JJLA 5JTTA 2OYCA 1W2WB 3V3KA 4ZGBA 1HY3A 3ZBPA 1P1KA 2IPNA 3KQLA 3ITNA 2VA9A 2QD4A 2JJQA 4Y2UA 5C2JB 2WUGA 4LXUA 1EG2A 3NUQA 4I55F 4XUGB 1T1GA 3WRVA 1HE1C 3CONA 4UJ5A 2H5JA 2Y6UA 2J7KA 2Y6VA 3AVPA 2D2EA 2IXGA 1OYYA 2QTMA 1EGHA 3OZRA 4RZ2A 1QONA 1ZC3A 2ZYHA 3BSYA 2C7RA 1OXMA 3S1LA 1PS8A 1HDOA 4LYFA 3ZBUA 1SPBS 4LMBA 4CKCA 1N7GA 1OREA 2D4HA 4GZLA 4TX1A 5IJZA 2WMOB 3OHPA 5FUWA 2V0CA 1ZVMA 2O9JA 2W4IA 1E66A 2B35A 3IXQA 3LL7A 3BGWA 3HYCA 5AT1A 4B6RA 2FSGA 2AKYA 3E8SA 3NIBA 4CTNA 4EHFA 5JYDA 5ETJA 1EX9A 4KYUA 4CV3A 3KEOA 3HBNA 2IHZA 2WU4A 4KR2A 1U0TA 1HQDA 3PDJA 1H6CA 3G5AA 5A06A 3BL8A 3OKPA 5EWMA 1KVUA 1BRTA 4BO5A 3KZKA 1KNXA 4G4GA 2I2CA 1QYIA 3O2NA 2HWWA 2OBXA 4GGMX 3M6FA 4M1YA 3OQIB 1ECLA 3UK1A 3FDJA 2V5UA 4BKMA 3L49A 2VNKA 1ZUNB 1G20E 1T8WA 2PGNA 2QL6A 4Q1EA 3MSCA 4FD3A 2VCHA 3DMTC 2X2EA 5C1OA 3TLZA 1W36B 3F74A 3M6UA 1HFKA 2VHTA 5HK9A 1Z63A 3GJZA 2XZDA 5EL0A 2H48A 3AR3A 3PCRB 1STOA 4Q0MA 1KE1A 5FPKA 4UAJA 5IKPA 1E5DA 1K98A 2OM6A 2ZVPX 1Q92A 4CM7A 2V7XA 3EGDB 2FPIB 5EWLB 4J4TA 1F51E 3BDAA 2GS9A 2IDKA 1N57A 4NCIA 5IDXA 3U1VA 2B61A 4HAOA 3TS1A 2SBTA 4LBZA 1Z0JA 4DEVA 1T2UA 2VTVA 3FZQA 4ZQCB 4YJGB 1P0MA 1TVKA 2EBWA 3MRVA 4HS4A 4W9NC 1NJ6A 4YO8A 1TYCA 3OEEA 1CRLA 3HM2A 1VL1A 5KKCA 5AKIA 4BX8A 3O92A 2AV6A 4Y8VA 3H1AA 1I0IA 1VL2A 4F3YA 3QW4B 2GJSA 1VCOA 2V59A 1OX5A 2PLNA 5F4ZA 4ZARA 4JNCA 3PQDA 3WRYC 4BQEA 2A94A 1V11B 3GFOA 2OECA 5HJ7A 4EHHA 5K0CA 2B21A 3ACDA 3K30A 1ADYA 4TXHA 1MLDA 2GSWA 1CZNA 4NFLA 4Q1VA 4RY9A 2HIHA 3CH4B 4WGGA 3Q3JB 5F78A 4K6KA 2HV8A 1KHHA 4LXXA 4MUGA 1A7JA 2WPDA 4KQKA 4TZ6A 5YASA 4AM8A 1U3CA 3CR3C 1Y8QA 3LLVA 4BVJA 3V4VB 4CNBA 2SKDA 4WK4B 5E4JA 2CFRA 4DJDC 4MGEA 3ZY6A 1PHPA 1NM5C 2AK2A 2W2VA 3AERA 3GYGA 1BA3A 2FMIA 3BIJA 1D6JA 3PNLA 6REQA 3WHKA 4FHDA 3DYIA 1NT2A 3SYRA 4CIBA 1ID8A 2PRSA 2W2MA 1Z13A 4E12A 4ZYVA 3OY7A 1Y9ZA 3AUYA 3N0XA 3MWEB 2Y0EA 4IGFA 1SZJG 1ZW1A 5B1YA 3PXEA 4WI1A 3ROTA 2BFBB 5HCIA 4LJYA 3U13A 3EIFA 4ALJA 2HRCA 3CUSA 1P0QA 1EE9A 1PD0A 1Y6ZA 2QAGC 2YMPA 3JW8A 4OFXA 4ZDKA 2PM8A 4YMIA 4ZOQI 2A67A 5D3ZA 4C6TB 4QU0A 2AN5A 5CAEB 5KSWB 5F98A 5AJTA 5D01A 3D4OA 1B8VA 4ZTUB 1BNCA 3EA5A 1DBSA 3NPAA 4XLZA 3HB7A 3SJBA 1X7WB 3AQIA 3ZIAD 5JSYA 1OBVA 1ZGJA 2VSNA 4DR4B 2X22A 1M0SA 2ZSKA 3SC6A 1TA9A 1U8UA 1VJ5A 2CLMB 3KHTA 3JARB 2F67A 2I5PO 3AC0A 5HILA 5JNWA 4NABA 1LBSA 1CY1A 3RREA 4ZKDA 3HWSA 4KCGA 1EWQA 4II3A 1NVKA 5ER9A 2MIIA 2FJ0A 1XLUA 2QRKA 3MILA 3OCXA 4Q6BA 1UXGA 2OQIA 2C7OA 4C6RA 1B2LA 4GRIA 1TU0A 1SG9A 5ELXA 2HDNB 2VDWA 3C6BA 3OO0A 2P77A 3T7AA 3V2IA 1CP2A 1B73A 1Y3HA 1TA0A 1J0AA 2P41A 2HLNA 2ZI4A 3HDJA 4BFLA 5LXTF 1EUCA 1QIFA 4HLNA 4W8OA 3UJ8A 3K70D 3FDZB 3LIIA 4HUJA 5KYXB 4DLYA 6CHYA 3EIXA 3FCUB 5CHEA 3PDCA 1ML3A 5AI5A 4QA9A 4YRRA 3AVTA 1Z2CA 4EMBA 1ZICA 2ZWPA 1XIVA 4KXLA 3HDGA 4MQEB 4YJDA 4UZFA 3ZS9A 1ZAYA 1GVNB 1W76A 4YRQA 5FF9A 4NZMA 2X76A 5TF4A 4EPTA 2GDJA 1ABBA 5FD8A 1RLIA 4B2LA 2WYHA 1YRBA 1OAOC 3UM9A 3WWPA 1GNTA 5DGDA 3LLCA 4TZTA 4HQLA 3HKEB 1BWSA 1QHHA 2JCXA 4U2EA 4WJZA 1ZJ4A 3GG9A 1Q0ZA 3UHJA 4AP9A 2XDYA 3N7UA 3NEAA 4RETA 3ZV7A 1XLVA 3GFFA 4E33A 2YVAA 2IRWA 2PJRA 3RU7A 3RPEA 4FTWA 3CRQA 3THRA 2ZE6A 3G02A 4ZALA 1L0BA 2EBHX 3EXG1 1WZ2A 3B38A 4EQ6B 1RZVA 4RTKA 2LP4Y 1G5PA 7ADHA 1G5FA 2H4XA 3RUAA 2FMUA 1N3IA 4CLDA 1JJBA 5EP1A 3I9FA 5HIMA 5A3SA 4BQOA 4E70A 5ALYA 4NEQA 3WE7A 4AZTA 2VZEA 2P91A 1FBTA 1ZAKA 4EJMA 1WU7A 5BSVA 1ZI8A 2FVYA 4TWZA 5IM5A 3ZXUB 2IU0A 4TWIA 2FGKA 1C1HA 4P82A 3BK7A 2O14A 1YE5A 5HIIA 5I7HA 1KERA 1PZFA 1ETHA 3AUSA 1R6DA 1AGNA 2WPNA 4F6RA 1DKOA 4HX9A 4I4CA 4CR8A 5KYWA 5IM4A 3SQWA 2PGOA 2VDNB 5J2TF 2BH9A 4L4ZA 3WGKA 1YZGA 2ZE5A 3L7JA 3JAWA 5ULLA 2K2WA 2JIZA 2RKBA 3KKEA 3TR6A 2YFYA 1Z7YA 3U4GA 3WKDA 3X2SA 3SQXA 5ITZA 1HLDA 3F8SA 1L9XA 1GP2A 2GYYA 4KXMA 1X7YB 5JZBA 1R10A 5HRUA 4KWTA 4M8LA