3HAIA

Crystal structure of human pacsin1 f-bar domain (p21 lattice)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
TTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords human PACSIN1 F-BAR
publication title Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 112
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3haiA01
2RAKA 3QNIA 1ZWWA 1I4TA 3OK8A 3QE6A 4NQIA 1WDZA 1X04A 2X3WA 3HAIA 4WPEA 2Z0VA 4WPCA 2EFLA 5C5BA 1I49A 3HAJA 4H8SA 2EFKA 2Z0OA 2D1LA 3QWEA 4ATMA 1URUA 3ACOA 2D4CA 4FZSA 2RAIA 2RAJA 1X03A 1I4LA 2X3XA 3Q0KA 3LLLA 4DCNC 2ELBA 2Q13A 4NSWA 3M3WA 2Q12A 4BNEA 3CAZA 5C5BB 4DYLA 3HAHA 3G9GA 3DYTA 3I2WA 1Y2OA 4I1QA 3ABHA 2C08A 4AVMA 3Q84A 1I4DA 2X3VA 2YKTA 3PLTA 3SYVA 4AKVA 2V0OA 3SOGA 2FICA 2Z0NA
chains in the Genus database with same CATH superfamily
3D4YA 1W9MA 2X3WA 3DPPA 3UITA 4KIKA 4EZQA 3ER8C 3Q0KA 4BNEA 4IWQA 2WYIA 3HAHA 4AVMA 3Q84A 3BVWA 2F18A 4EZWA 2ALWA 3HAJA 3DDFA 3ACOA 2RAIA 1X03A 3C7NA 3O3NB 2ELBA 2YL8A 4HR1A 1Y2OA 2X3VA 1UPXA 2YKTA 3SYVA 1MJGA 2PMRA 3T48A 4WPCA 3RPMA 4IM0A 2D4CA 2OW6A 1JQKA 3QNJA 2PY6A 5TKYA 1OA1A 1GN9A 4H6HA 2RAKA 4HY9A 3DPQA 1OAOA 4WPEA 1OA0A 3BVVA 3T49A 4R5LA 4JWIA 2RT6A 4R5GA 3CVRA 3I39X 4JWCA 1GNLA 2WYHA 4UDXX 4AZBA 3VKHA 4NQIA 1WDZA 2YIAA 3L3OM 3F7WA 2D1LA 3O3MB 4AZHA 4EZOA 4FZPA 2Q13A 1SU7A 1E9VA 3FD9A 2F1AA 3L3PA 4EZTA 2MI7A 3DYTA 4FZOA 3D51A 2FICA 2F7RA 2Z0NA 4E3CA 3HAIA 3B53X 4JN4A 2OW7A 3D2FA 1QWUA 4UDYX 2OBMA 3VEAA 3GI7A 2OZNB 3PLTA 4EZYA 2YL9A 4R5KA 3CKDA 2O0I1 1I49A 3BUBA 4EZNA 3ERCC 2Z0OA 3BVXA 3I04A 4R5JA 2YIBA 2X5CA 4DYLA 1SUFA 4EZZA 3RV0A 4R5IA 3EJPA 1HTYA 3DX1A 3BVUA 1TQVA 3EJSA 2GF4A 2F7OA 4F00A 4H8SA 3EJTA 3T4AG 2QXLA 3LLLA 4JLCA 3CV5A 3D52A 1TQWA 4G6QA 4AZCB 2C08A 2EX3B 4EZVA 3EJRA 4AKVA 2V0OA 2FYVA 4HYBA 3QNIA 1R5EA 3LVTA 5C5BA 3DX3A 1E1DA 3BUDA 3EJUA 4H6IA 4JNFA 4IM3A 4FZSA 3ZEDA 1TQSA 2LXYA 3D2EA 3CZNA 4E81A 3B52X 4IM2A 3D50A 3KAVA 1DKXA 4KIKB 1SU6A 1ZWWA 3T47A 3BUIA 3VEBA 3BVTA 1O7DB 4EZRA 1DKYA 3A98A 2YI8A 3O3OB 3BUPA 2N3KA 2WINM 4B9QA 3QA8A 4AZGA 1LQ7A 2GAFD 1R33A 3OK8A 3EJQA 1TQTA 4HR1B 1GNTA 4IWOA 3QWEA 2RAJA 1I4LA 4JWEA 3BUQA 2Q12A 3CAZA 4NPHA 3G9GA 3I2WA 4I1QA 2QKWA 3KDRA 3DX4A 4M0MA 2Z0VA 3DX2A 4JWDA 2JNSA 2YIVX 3I01A 1ZYLA 4AZ6A 2YI9A 5C5BB 4JL9A 3D4ZA 1HWWA 1HXKA 5FIGA 5KBPA 2YLAA 2Z8YA 3DX0A 3ER9B 2YL5A 1R34A 2ZXQA 2ND1A 2KHOA 3RV1A 2EFKA 2NCZA 4ATMA 2ND0A 1DKZA 4F01A 1YWMA 4AZIA 4AZ5A 4EZUA 1PS3A 3SOGA 5FLEX 1X04A 2YL6A 2YLLA 4JNEA 3OWGA 2GA9D 2OBLA 1SU8A 4FM3A 1URUA 4EZSA 2F7QA 4NSWA 2OO2A 1I4DA 2EWFA 3QE6A 4AZ7A 3LMFA 2F1BA 2X3XA 3T46A 4DCNC 2F7PA 2LM0A 3M3WA 1E2UA 3DPOA 3B51X 1QWNA 5E84A 1I4TA 4D8JA 3OHXM 3KAWA 2EFLA 4EZPA 4AZCA 2JNKA 1U00A 2QFFA 1O7DC 1TQUA 4IWPA 4EZXA 1QX1A 3ABHA 3DDGA 3BLBA 3CZSA 4IW0A 4PO2A
chains in the Genus database with same CATH topology
2RAKA 3QNIA 1ZWWA 1I4TA 3OK8A 3QE6A 4NQIA 1WDZA 1X04A 2X3WA 3HAIA 4WPEA 2Z0VA 4WPCA 2EFLA 5C5BA 1I49A 3HAJA 4H8SA 2EFKA 2Z0OA 2D1LA 3QWEA 4ATMA 1URUA 3ACOA 2D4CA 4FZSA 2RAIA 2RAJA 1X03A 1I4LA 2X3XA 3Q0KA 3LLLA 4DCNC 2ELBA 2Q13A 4NSWA 3M3WA 2Q12A 4BNEA 3CAZA 5C5BB 4DYLA 3HAHA 3G9GA 3DYTA 3I2WA 1Y2OA 4I1QA 3ABHA 2C08A 4AVMA 3Q84A 1I4DA 2X3VA 2YKTA 3PLTA 3SYVA 4AKVA 2V0OA 3SOGA 2FICA 2Z0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAK A;  3QNI A;  1ZWW A;  1I4T A;  3OK8 A;  3QE6 A;  4NQI A;  1WDZ A;  1X04 A;  2X3W A;  3HAI A;  4WPE A;  2Z0V A;  4WPC A;  2EFL A;  5C5B A;  1I49 A;  3HAJ A;  4H8S A;  2EFK A;  2Z0O A;  2D1L A;  3QWE A;  4ATM A;  1URU A;  3ACO A;  2D4C A;  4FZS A;  2RAI A;  2RAJ A;  1X03 A;  1I4L A;  2X3X A;  3Q0K A;  3LLL A;  4DCN C;  2ELB A;  2Q13 A;  4NSW A;  3M3W A;  2Q12 A;  4BNE A;  3CAZ A;  5C5B B;  4DYL A;  3HAH A;  3G9G A;  3DYT A;  3I2W A;  1Y2O A;  4I1Q A;  3ABH A;  2C08 A;  4AVM A;  3Q84 A;  1I4D A;  2X3V A;  2YKT A;  3PLT A;  3SYV A;  4AKV A;  2V0O A;  3SOG A;  2FIC A;  2Z0N A; 
#chains in the Genus database with same CATH topology
 3D4Y A;  1W9M A;  2X3W A;  3DPP A;  3UIT A;  4KIK A;  4EZQ A;  3ER8 C;  3Q0K A;  4BNE A;  4IWQ A;  2WYI A;  3HAH A;  4AVM A;  3Q84 A;  3BVW A;  2F18 A;  4EZW A;  2ALW A;  3HAJ A;  3DDF A;  3ACO A;  2RAI A;  1X03 A;  3C7N A;  3O3N B;  2ELB A;  2YL8 A;  4HR1 A;  1Y2O A;  2X3V A;  1UPX A;  2YKT A;  3SYV A;  1MJG A;  2PMR A;  3T48 A;  4WPC A;  3RPM A;  4IM0 A;  2D4C A;  2OW6 A;  1JQK A;  3QNJ A;  2PY6 A;  5TKY A;  1OA1 A;  1GN9 A;  4H6H A;  2RAK A;  4HY9 A;  3DPQ A;  1OAO A;  4WPE A;  1OA0 A;  3BVV A;  3T49 A;  4R5L A;  4JWI A;  2RT6 A;  4R5G A;  3CVR A;  3I39 X;  4JWC A;  1GNL A;  2WYH A;  4UDX X;  4AZB A;  3VKH A;  4NQI A;  1WDZ A;  2YIA A;  3L3O M;  3F7W A;  2D1L A;  3O3M B;  4AZH A;  4EZO A;  4FZP A;  2Q13 A;  1SU7 A;  1E9V A;  3FD9 A;  2F1A A;  3L3P A;  4EZT A;  2MI7 A;  3DYT A;  4FZO A;  3D51 A;  2FIC A;  2F7R A;  2Z0N A;  4E3C A;  3HAI A;  3B53 X;  4JN4 A;  2OW7 A;  3D2F A;  1QWU A;  4UDY X;  2OBM A;  3VEA A;  3GI7 A;  2OZN B;  3PLT A;  4EZY A;  2YL9 A;  4R5K A;  3CKD A;  2O0I 1;  1I49 A;  3BUB A;  4EZN A;  3ERC C;  2Z0O A;  3BVX A;  3I04 A;  4R5J A;  2YIB A;  2X5C A;  4DYL A;  1SUF A;  4EZZ A;  3RV0 A;  4R5I A;  3EJP A;  1HTY A;  3DX1 A;  3BVU A;  1TQV A;  3EJS A;  2GF4 A;  2F7O A;  4F00 A;  4H8S A;  3EJT A;  3T4A G;  2QXL A;  3LLL A;  4JLC A;  3CV5 A;  3D52 A;  1TQW A;  4G6Q A;  4AZC B;  2C08 A;  2EX3 B;  4EZV A;  3EJR A;  4AKV A;  2V0O A;  2FYV A;  4HYB A;  3QNI A;  1R5E A;  3LVT A;  5C5B A;  3DX3 A;  1E1D A;  3BUD A;  3EJU A;  4H6I A;  4JNF A;  4IM3 A;  4FZS A;  3ZED A;  1TQS A;  2LXY A;  3D2E A;  3CZN A;  4E81 A;  3B52 X;  4IM2 A;  3D50 A;  3KAV A;  1DKX A;  4KIK B;  1SU6 A;  1ZWW A;  3T47 A;  3BUI A;  3VEB A;  3BVT A;  1O7D B;  4EZR A;  1DKY A;  3A98 A;  2YI8 A;  3O3O B;  3BUP A;  2N3K A;  2WIN M;  4B9Q A;  3QA8 A;  4AZG A;  1LQ7 A;  2GAF D;  1R33 A;  3OK8 A;  3EJQ A;  1TQT A;  4HR1 B;  1GNT A;  4IWO A;  3QWE A;  2RAJ A;  1I4L A;  4JWE A;  3BUQ A;  2Q12 A;  3CAZ A;  4NPH A;  3G9G A;  3I2W A;  4I1Q A;  2QKW A;  3KDR A;  3DX4 A;  4M0M A;  2Z0V A;  3DX2 A;  4JWD A;  2JNS A;  2YIV X;  3I01 A;  1ZYL A;  4AZ6 A;  2YI9 A;  5C5B B;  4JL9 A;  3D4Z A;  1HWW A;  1HXK A;  5FIG A;  5KBP A;  2YLA A;  2Z8Y A;  3DX0 A;  3ER9 B;  2YL5 A;  1R34 A;  2ZXQ A;  2ND1 A;  2KHO A;  3RV1 A;  2EFK A;  2NCZ A;  4ATM A;  2ND0 A;  1DKZ A;  4F01 A;  1YWM A;  4AZI A;  4AZ5 A;  4EZU A;  1PS3 A;  3SOG A;  5FLE X;  1X04 A;  2YL6 A;  2YLL A;  4JNE A;  3OWG A;  2GA9 D;  2OBL A;  1SU8 A;  4FM3 A;  1URU A;  4EZS A;  2F7Q A;  4NSW A;  2OO2 A;  1I4D A;  2EWF A;  3QE6 A;  4AZ7 A;  3LMF A;  2F1B A;  2X3X A;  3T46 A;  4DCN C;  2F7P A;  2LM0 A;  3M3W A;  1E2U A;  3DPO A;  3B51 X;  1QWN A;  5E84 A;  1I4T A;  4D8J A;  3OHX M;  3KAW A;  2EFL A;  4EZP A;  4AZC A;  2JNK A;  1U00 A;  2QFF A;  1O7D C;  1TQU A;  4IWP A;  4EZX A;  1QX1 A;  3ABH A;  3DDG A;  3BLB A;  3CZS A;  4IW0 A;  4PO2 A; 
#chains in the Genus database with same CATH homology
 2RAK A;  3QNI A;  1ZWW A;  1I4T A;  3OK8 A;  3QE6 A;  4NQI A;  1WDZ A;  1X04 A;  2X3W A;  3HAI A;  4WPE A;  2Z0V A;  4WPC A;  2EFL A;  5C5B A;  1I49 A;  3HAJ A;  4H8S A;  2EFK A;  2Z0O A;  2D1L A;  3QWE A;  4ATM A;  1URU A;  3ACO A;  2D4C A;  4FZS A;  2RAI A;  2RAJ A;  1X03 A;  1I4L A;  2X3X A;  3Q0K A;  3LLL A;  4DCN C;  2ELB A;  2Q13 A;  4NSW A;  3M3W A;  2Q12 A;  4BNE A;  3CAZ A;  5C5B B;  4DYL A;  3HAH A;  3G9G A;  3DYT A;  3I2W A;  1Y2O A;  4I1Q A;  3ABH A;  2C08 A;  4AVM A;  3Q84 A;  1I4D A;  2X3V A;  2YKT A;  3PLT A;  3SYV A;  4AKV A;  2V0O A;  3SOG A;  2FIC A;  2Z0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...