3HAIA

Crystal structure of human pacsin1 f-bar domain (p21 lattice)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
TTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords human PACSIN1 F-BAR
publication title Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 112
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3haiA01
3SYVA 2RAKA 3HAIA 1ZWWA 3G9GA 1Y2OA 1X03A 3PLTA 2C08A 2EFKA 3OK8A 1WDZA 2Q12A 3ABHA 3M3WA 4NQIA 1URUA 2Q13A 2X3VA 2Z0OA 3Q0KA 4H8SA 3CAZA 3SOGA 4BNEA 1I4LA 1X04A 3LLLA 2RAJA 4WPCA 2RAIA 2X3XA 3ACOA 4NSWA 3HAJA 3QNIA 4AVMA 2D1LA 4DCNC 1I4DA 3Q84A 3DYTA 4AKVA 4DYLA 5C5BA 3QE6A 2X3WA 1I4TA 4ATMA 3QWEA 5C5BB 2ELBA 2V0OA 2YKTA 2Z0NA 3I2WA 4FZSA 4I1QA 1I49A 2FICA 3HAHA 2EFLA 4WPEA 2Z0VA 2D4CA
chains in the Genus database with same CATH superfamily
2F1BA 2YL9A 3G9GA 4G6QA 5FLEX 1WDZA 2WINM 2LXYA 4H8SA 3SOGA 4EZQA 3GI7A 4E3CA 4EZYA 4UDYX 2OBLA 2MI7A 4EZTA 4M0MA 1SU6A 4R5LA 1TQUA 2OO2A 2QXLA 2RAKA 3DPOA 2EFKA 1W9MA 3CV5A 2F7OA 4JL9A 3BUQA 1LQ7A 3BVXA 3BVWA 3RPMA 1O7DC 3T46A 3VEAA 4AZIA 3DX0A 4WPEA 2Z0VA 3LVTA 1GNTA 2YIAA 3HAIA 4JNFA 1X03A 3I01A 2F1AA 3D4ZA 3OK8A 3VEBA 3Q0KA 2X3VA 4BNEA 1X04A 4AZGA 3F7WA 2ND0A 4KIKB 3CKDA 3I2WA 2EFLA 2YI9A 2LM0A 4IWQA 3EJRA 2O0I1 2X5CA 3B51X 3EJTA 4DCNC 1JQKA 3QA8A 3D4YA 2OW7A 1SU7A 5TKYA 3EJUA 3OHXM 3RV0A 2F7RA 3ER9B 3O3MB 2YI8A 4JWDA 2N3KA 4AZBA 3ZEDA 3D52A 3D51A 2V0OA 4JWIA 2FICA 4EZVA 2YL5A 1Y2OA 4FZOA 4FZPA 3LLLA 4EZSA 3ACOA 3DX2A 4EZOA 1O7DB 1I4DA 3L3OM 3BLBA 3O3NB 2PY6A 4H6IA 4R5GA 2QFFA 3EJPA 4IWPA 4R5KA 2OW6A 2X3XA 1OAOA 2D1LA 4KIKA 2EWFA 2Z8YA 3EJQA 2RT6A 3KAVA 4I1QA 2NCZA 1I49A 4EZPA 3DX3A 2D4CA 4D8JA 2C08A 3T47A 3BVVA 2GF4A 3BUDA 2GAFD 1DKXA 2Z0OA 1I4LA 3QNIA 3DYTA 3QWEA 3RV1A 3B52X 3DX1A 2YLAA 2ALWA 3HAHA 3SYVA 1ZWWA 1HXKA 3PLTA 4AZ6A 3ER8C 4AZCB 3BVUA 3OWGA 2YL8A 3A98A 3T4AG 4AKVA 4HR1B 5KBPA 1MJGA 4EZRA 4AZ7A 4R5IA 1URUA 4EZZA 1TQVA 3L3PA 2F18A 1DKYA 1I4TA 5C5BB 2YIVX 2YIBA 4UDXX 4PO2A 3I39X 1TQTA 1TQSA 1U00A 4R5JA 2Q12A 3ABHA 4IM0A 2PMRA 4JWCA 2KHOA 3DX4A 3CAZA 4AZ5A 3BUIA 3QNJA 2EX3B 3QE6A 2QKWA 3D2FA 3EJSA 3UITA 1DKZA 1SU8A 1R5EA 4HY9A 3T48A 4HYBA 4NSWA 4JWEA 2FYVA 2YL6A 2X3WA 2ELBA 3ERCC 3KAWA 4AZCA 1ZYLA 4B9QA 1OA1A 3DDFA 3BVTA 4H6HA 4IW0A 1E2UA 1GNLA 4JN4A 2F7QA 2WYHA 1R34A 5E84A 4AVMA 3FD9A 5FIGA 3D2EA 1UPXA 2ZXQA 3I04A 4HR1A 3CZSA 4FZSA 3B53X 2OZNB 3CZNA 4IM3A 2Q13A 2ND1A 3CVRA 1E9VA 3Q84A 5C5BA 3D50A 1QX1A 3C7NA 2WYIA 3DPQA 3O3OB 3DPPA 4F00A 1TQWA 4E81A 2JNSA 1R33A 1HWWA 4EZNA 4IM2A 1QWNA 2RAJA 2RAIA 1E1DA 3T49A 2YLLA 4NPHA 3KDRA 4EZXA 2GA9D 3DDGA 4JNEA 4EZUA 1HTYA 1OA0A 4JLCA 3LMFA 1SUFA 3VKHA 1PS3A 1YWMA 3M3WA 4NQIA 2OBMA 4WPCA 1QWUA 3HAJA 4DYLA 4F01A 4ATMA 3BUBA 4IWOA 2YKTA 4EZWA 2Z0NA 4AZHA 2F7PA 2JNKA 4FM3A 1GN9A 3BUPA
chains in the Genus database with same CATH topology
3SYVA 2RAKA 3HAIA 1ZWWA 3G9GA 1Y2OA 1X03A 3PLTA 2C08A 2EFKA 3OK8A 1WDZA 2Q12A 3ABHA 3M3WA 4NQIA 1URUA 2Q13A 2X3VA 2Z0OA 3Q0KA 4H8SA 3CAZA 3SOGA 4BNEA 1I4LA 1X04A 3LLLA 2RAJA 4WPCA 2RAIA 2X3XA 3ACOA 4NSWA 3HAJA 3QNIA 4AVMA 2D1LA 4DCNC 1I4DA 3Q84A 3DYTA 4AKVA 4DYLA 5C5BA 3QE6A 2X3WA 1I4TA 4ATMA 3QWEA 5C5BB 2ELBA 2V0OA 2YKTA 2Z0NA 3I2WA 4FZSA 4I1QA 1I49A 2FICA 3HAHA 2EFLA 4WPEA 2Z0VA 2D4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYV A;  2RAK A;  3HAI A;  1ZWW A;  3G9G A;  1Y2O A;  1X03 A;  3PLT A;  2C08 A;  2EFK A;  3OK8 A;  1WDZ A;  2Q12 A;  3ABH A;  3M3W A;  4NQI A;  1URU A;  2Q13 A;  2X3V A;  2Z0O A;  3Q0K A;  4H8S A;  3CAZ A;  3SOG A;  4BNE A;  1I4L A;  1X04 A;  3LLL A;  2RAJ A;  4WPC A;  2RAI A;  2X3X A;  3ACO A;  4NSW A;  3HAJ A;  3QNI A;  4AVM A;  2D1L A;  4DCN C;  1I4D A;  3Q84 A;  3DYT A;  4AKV A;  4DYL A;  5C5B A;  3QE6 A;  2X3W A;  1I4T A;  4ATM A;  3QWE A;  5C5B B;  2ELB A;  2V0O A;  2YKT A;  2Z0N A;  3I2W A;  4FZS A;  4I1Q A;  1I49 A;  2FIC A;  3HAH A;  2EFL A;  4WPE A;  2Z0V A;  2D4C A; 
#chains in the Genus database with same CATH topology
 2F1B A;  2YL9 A;  3G9G A;  4G6Q A;  5FLE X;  1WDZ A;  2WIN M;  2LXY A;  4H8S A;  3SOG A;  4EZQ A;  3GI7 A;  4E3C A;  4EZY A;  4UDY X;  2OBL A;  2MI7 A;  4EZT A;  4M0M A;  1SU6 A;  4R5L A;  1TQU A;  2OO2 A;  2QXL A;  2RAK A;  3DPO A;  2EFK A;  1W9M A;  3CV5 A;  2F7O A;  4JL9 A;  3BUQ A;  1LQ7 A;  3BVX A;  3BVW A;  3RPM A;  1O7D C;  3T46 A;  3VEA A;  4AZI A;  3DX0 A;  4WPE A;  2Z0V A;  3LVT A;  1GNT A;  2YIA A;  3HAI A;  4JNF A;  1X03 A;  3I01 A;  2F1A A;  3D4Z A;  3OK8 A;  3VEB A;  3Q0K A;  2X3V A;  4BNE A;  1X04 A;  4AZG A;  3F7W A;  2ND0 A;  4KIK B;  3CKD A;  3I2W A;  2EFL A;  2YI9 A;  2LM0 A;  4IWQ A;  3EJR A;  2O0I 1;  2X5C A;  3B51 X;  3EJT A;  4DCN C;  1JQK A;  3QA8 A;  3D4Y A;  2OW7 A;  1SU7 A;  5TKY A;  3EJU A;  3OHX M;  3RV0 A;  2F7R A;  3ER9 B;  3O3M B;  2YI8 A;  4JWD A;  2N3K A;  4AZB A;  3ZED A;  3D52 A;  3D51 A;  2V0O A;  4JWI A;  2FIC A;  4EZV A;  2YL5 A;  1Y2O A;  4FZO A;  4FZP A;  3LLL A;  4EZS A;  3ACO A;  3DX2 A;  4EZO A;  1O7D B;  1I4D A;  3L3O M;  3BLB A;  3O3N B;  2PY6 A;  4H6I A;  4R5G A;  2QFF A;  3EJP A;  4IWP A;  4R5K A;  2OW6 A;  2X3X A;  1OAO A;  2D1L A;  4KIK A;  2EWF A;  2Z8Y A;  3EJQ A;  2RT6 A;  3KAV A;  4I1Q A;  2NCZ A;  1I49 A;  4EZP A;  3DX3 A;  2D4C A;  4D8J A;  2C08 A;  3T47 A;  3BVV A;  2GF4 A;  3BUD A;  2GAF D;  1DKX A;  2Z0O A;  1I4L A;  3QNI A;  3DYT A;  3QWE A;  3RV1 A;  3B52 X;  3DX1 A;  2YLA A;  2ALW A;  3HAH A;  3SYV A;  1ZWW A;  1HXK A;  3PLT A;  4AZ6 A;  3ER8 C;  4AZC B;  3BVU A;  3OWG A;  2YL8 A;  3A98 A;  3T4A G;  4AKV A;  4HR1 B;  5KBP A;  1MJG A;  4EZR A;  4AZ7 A;  4R5I A;  1URU A;  4EZZ A;  1TQV A;  3L3P A;  2F18 A;  1DKY A;  1I4T A;  5C5B B;  2YIV X;  2YIB A;  4UDX X;  4PO2 A;  3I39 X;  1TQT A;  1TQS A;  1U00 A;  4R5J A;  2Q12 A;  3ABH A;  4IM0 A;  2PMR A;  4JWC A;  2KHO A;  3DX4 A;  3CAZ A;  4AZ5 A;  3BUI A;  3QNJ A;  2EX3 B;  3QE6 A;  2QKW A;  3D2F A;  3EJS A;  3UIT A;  1DKZ A;  1SU8 A;  1R5E A;  4HY9 A;  3T48 A;  4HYB A;  4NSW A;  4JWE A;  2FYV A;  2YL6 A;  2X3W A;  2ELB A;  3ERC C;  3KAW A;  4AZC A;  1ZYL A;  4B9Q A;  1OA1 A;  3DDF A;  3BVT A;  4H6H A;  4IW0 A;  1E2U A;  1GNL A;  4JN4 A;  2F7Q A;  2WYH A;  1R34 A;  5E84 A;  4AVM A;  3FD9 A;  5FIG A;  3D2E A;  1UPX A;  2ZXQ A;  3I04 A;  4HR1 A;  3CZS A;  4FZS A;  3B53 X;  2OZN B;  3CZN A;  4IM3 A;  2Q13 A;  2ND1 A;  3CVR A;  1E9V A;  3Q84 A;  5C5B A;  3D50 A;  1QX1 A;  3C7N A;  2WYI A;  3DPQ A;  3O3O B;  3DPP A;  4F00 A;  1TQW A;  4E81 A;  2JNS A;  1R33 A;  1HWW A;  4EZN A;  4IM2 A;  1QWN A;  2RAJ A;  2RAI A;  1E1D A;  3T49 A;  2YLL A;  4NPH A;  3KDR A;  4EZX A;  2GA9 D;  3DDG A;  4JNE A;  4EZU A;  1HTY A;  1OA0 A;  4JLC A;  3LMF A;  1SUF A;  3VKH A;  1PS3 A;  1YWM A;  3M3W A;  4NQI A;  2OBM A;  4WPC A;  1QWU A;  3HAJ A;  4DYL A;  4F01 A;  4ATM A;  3BUB A;  4IWO A;  2YKT A;  4EZW A;  2Z0N A;  4AZH A;  2F7P A;  2JNK A;  4FM3 A;  1GN9 A;  3BUP A; 
#chains in the Genus database with same CATH homology
 3SYV A;  2RAK A;  3HAI A;  1ZWW A;  3G9G A;  1Y2O A;  1X03 A;  3PLT A;  2C08 A;  2EFK A;  3OK8 A;  1WDZ A;  2Q12 A;  3ABH A;  3M3W A;  4NQI A;  1URU A;  2Q13 A;  2X3V A;  2Z0O A;  3Q0K A;  4H8S A;  3CAZ A;  3SOG A;  4BNE A;  1I4L A;  1X04 A;  3LLL A;  2RAJ A;  4WPC A;  2RAI A;  2X3X A;  3ACO A;  4NSW A;  3HAJ A;  3QNI A;  4AVM A;  2D1L A;  4DCN C;  1I4D A;  3Q84 A;  3DYT A;  4AKV A;  4DYL A;  5C5B A;  3QE6 A;  2X3W A;  1I4T A;  4ATM A;  3QWE A;  5C5B B;  2ELB A;  2V0O A;  2YKT A;  2Z0N A;  3I2W A;  4FZS A;  4I1Q A;  1I49 A;  2FIC A;  3HAH A;  2EFL A;  4WPE A;  2Z0V A;  2D4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...