3HAIA

Crystal structure of human pacsin1 f-bar domain (p21 lattice)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
b'TTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords human PACSIN1 F-BAR
publication title Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 112
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3haiA01
1X03A 3I2WA 3CAZA 1I49A 2C08A 2Z0VA 3M3WA 1X04A 4NQIA 3ABHA 4FZSA 4BNEA 3ACOA 2RAJA 4H8SA 1I4LA 3HAJA 2ELBA 1Y2OA 2FICA 4DYLA 2Z0OA 3OK8A 1I4DA 5C5BB 2EFLA 2Q13A 3HAHA 4WPCA 3DYTA 3SYVA 3Q0KA 3HAIA 3QNIA 3PLTA 4AKVA 2X3XA 2X3VA 1I4TA 2D4CA 3LLLA 3QE6A 2V0OA 2Z0NA 3SOGA 3QWEA 3Q84A 5C5BA 4WPEA 1ZWWA 2YKTA 4I1QA 1WDZA 2X3WA 1URUA 2D1LA 2Q12A 2RAIA 3G9GA 2EFKA 2RAKA 4AVMA 4ATMA 4NSWA 4DCNC
chains in the Genus database with same CATH superfamily
4EZZA 4FZSA 3RPMA 2RAJA 4DYLA 3OHXM 1GN9A 3L3OM 3I01A 4F01A 4F00A 4JNEA 3O3MB 2F7QA 1I49A 4AZ6A 4H8SA 4EZPA 3HAJA 1Y2OA 4JLCA 4IW0A 2LM0A 2Z8YA 2X3XA 3LLLA 4PO2A 1QWUA 3QWEA 1QX1A 4HR1B 3D52A 3CV5A 3G9GA 2RAKA 3D51A 1TQUA 2GA9D 2NCZA 3EJQA 1OA0A 4AVMA 3T46A 4NQIA 1I4LA 1OA1A 3BUQA 3DX2A 2YLLA 4R5JA 1LQ7A 4NPHA 4FM3A 4EZXA 1SUFA 3BVXA 4AZGA 4NSWA 4DCNC 3I04A 3CZSA 2JNSA 3D2FA 2ZXQA 4EZNA 1I4DA 4KIKB 1TQTA 2F7OA 1I4TA 1GNTA 4AZ5A 4AZCB 4AZ7A 2OW6A 3EJPA 2YL8A 2D1LA 3DDGA 2WINM 4IWPA 3F7WA 3ER8C 3I2WA 2PY6A 2F1AA 2Z0VA 2GAFD 4JWCA 1HXKA 2OBLA 1SU7A 3L3PA 3EJUA 3ER9B 2YIVX 3DPPA 1OAOA 1W9MA 1O7DC 2FYVA 2YIBA 3QA8A 3ZEDA 1MJGA 2YL5A 2FICA 3CZNA 4EZYA 1SU8A 1GNLA 2YKTA 1U00A 5FLEX 3A98A 2F7RA 3DX4A 3DPOA 2F18A 2ALWA 2RT6A 2Q13A 4H6IA 2QFFA 3HAIA 3PLTA 2X3VA 1R5EA 2Z0NA 1YWMA 4JWEA 2EX3B 2OZNB 3FD9A 1HWWA 2X3WA 2Q12A 2RAIA 3RV1A 4EZRA 3GI7A 1E2UA 2EWFA 2YIAA 3DX0A 2C08A 1DKYA 4EZVA 4EZWA 1R34A 4AZBA 2D4CA 4UDXX 3SOGA 3BUBA 5C5BA 4JN4A 4R5KA 3B53X 1DKZA 1URUA 2F1BA 3KAVA 1PS3A 4M0MA 2GF4A 4EZUA 3QNIA 3DPQA 3QE6A 3D50A 2F7PA 4FZOA 4WPEA 1ZWWA 3O3NB 1TQSA 4H6HA 4AZIA 4R5LA 4BNEA 1E1DA 3BUDA 4IM2A 3BUPA 3KDRA 4HYBA 2V0OA 2WYHA 2N3KA 1O7DB 1QWNA 3EJSA 5FIGA 3BVVA 4I1QA 1WDZA 2QKWA 4JL9A 2QXLA 1HTYA 5KBPA 3BVUA 1X04A 2YL9A 4R5IA 3ACOA 4HR1A 1SU6A 4JWDA 3T49A 3LVTA 3BVTA 4E81A 2OW7A 5E84A 1DKXA 3Q84A 3BVWA 4EZOA 1TQWA 4G6QA 3CAZA 2ND0A 3D4YA 2YI9A 4WPCA 4EZSA 3CKDA 2WYIA 3UITA 4IWQA 4KIKA 3B52X 3OWGA 4HY9A 3DX3A 3EJTA 4JWIA 4AZCA 3LMFA 3OK8A 2EFLA 3HAHA 4IWOA 3Q0KA 2OO2A 3T47A 1E9VA 2OBMA 1R33A 1ZYLA 4E3CA 3EJRA 3T48A 2PMRA 3O3OB 1X03A 3VEBA 3RV0A 3VEAA 4EZTA 3DYTA 3D4ZA 1TQVA 4R5GA 2YL6A 2O0I1 4UDYX 3D2EA 2EFKA 3C7NA 4ATMA 4JNFA 3BUIA 3QNJA 3SYVA 2YI8A 4AZHA 3VKHA 4FZPA 3B51X 5TKYA 3DX1A 2LXYA 3T4AG 3ERCC 2ND1A 2X5CA 1JQKA 3M3WA 2MI7A 3ABHA 4IM0A 2ELBA 2YLAA 2Z0OA 5C5BB 2JNKA 4EZQA 4AKVA 3I39X 3KAWA 1UPXA 3BLBA 4B9QA 4IM3A 4D8JA 3DDFA 2KHOA 3CVRA
chains in the Genus database with same CATH topology
1X03A 3I2WA 3CAZA 1I49A 2C08A 2Z0VA 3M3WA 1X04A 4NQIA 3ABHA 4FZSA 4BNEA 3ACOA 2RAJA 4H8SA 1I4LA 3HAJA 2ELBA 1Y2OA 2FICA 4DYLA 2Z0OA 3OK8A 1I4DA 5C5BB 2EFLA 2Q13A 3HAHA 4WPCA 3DYTA 3SYVA 3Q0KA 3HAIA 3QNIA 3PLTA 4AKVA 2X3XA 2X3VA 1I4TA 2D4CA 3LLLA 3QE6A 2V0OA 2Z0NA 3SOGA 3QWEA 3Q84A 5C5BA 4WPEA 1ZWWA 2YKTA 4I1QA 1WDZA 2X3WA 1URUA 2D1LA 2Q12A 2RAIA 3G9GA 2EFKA 2RAKA 4AVMA 4ATMA 4NSWA 4DCNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X03 A;  3I2W A;  3CAZ A;  1I49 A;  2C08 A;  2Z0V A;  3M3W A;  1X04 A;  4NQI A;  3ABH A;  4FZS A;  4BNE A;  3ACO A;  2RAJ A;  4H8S A;  1I4L A;  3HAJ A;  2ELB A;  1Y2O A;  2FIC A;  4DYL A;  2Z0O A;  3OK8 A;  1I4D A;  5C5B B;  2EFL A;  2Q13 A;  3HAH A;  4WPC A;  3DYT A;  3SYV A;  3Q0K A;  3HAI A;  3QNI A;  3PLT A;  4AKV A;  2X3X A;  2X3V A;  1I4T A;  2D4C A;  3LLL A;  3QE6 A;  2V0O A;  2Z0N A;  3SOG A;  3QWE A;  3Q84 A;  5C5B A;  4WPE A;  1ZWW A;  2YKT A;  4I1Q A;  1WDZ A;  2X3W A;  1URU A;  2D1L A;  2Q12 A;  2RAI A;  3G9G A;  2EFK A;  2RAK A;  4AVM A;  4ATM A;  4NSW A;  4DCN C; 
#chains in the Genus database with same CATH topology
 4EZZ A;  4FZS A;  3RPM A;  2RAJ A;  4DYL A;  3OHX M;  1GN9 A;  3L3O M;  3I01 A;  4F01 A;  4F00 A;  4JNE A;  3O3M B;  2F7Q A;  1I49 A;  4AZ6 A;  4H8S A;  4EZP A;  3HAJ A;  1Y2O A;  4JLC A;  4IW0 A;  2LM0 A;  2Z8Y A;  2X3X A;  3LLL A;  4PO2 A;  1QWU A;  3QWE A;  1QX1 A;  4HR1 B;  3D52 A;  3CV5 A;  3G9G A;  2RAK A;  3D51 A;  1TQU A;  2GA9 D;  2NCZ A;  3EJQ A;  1OA0 A;  4AVM A;  3T46 A;  4NQI A;  1I4L A;  1OA1 A;  3BUQ A;  3DX2 A;  2YLL A;  4R5J A;  1LQ7 A;  4NPH A;  4FM3 A;  4EZX A;  1SUF A;  3BVX A;  4AZG A;  4NSW A;  4DCN C;  3I04 A;  3CZS A;  2JNS A;  3D2F A;  2ZXQ A;  4EZN A;  1I4D A;  4KIK B;  1TQT A;  2F7O A;  1I4T A;  1GNT A;  4AZ5 A;  4AZC B;  4AZ7 A;  2OW6 A;  3EJP A;  2YL8 A;  2D1L A;  3DDG A;  2WIN M;  4IWP A;  3F7W A;  3ER8 C;  3I2W A;  2PY6 A;  2F1A A;  2Z0V A;  2GAF D;  4JWC A;  1HXK A;  2OBL A;  1SU7 A;  3L3P A;  3EJU A;  3ER9 B;  2YIV X;  3DPP A;  1OAO A;  1W9M A;  1O7D C;  2FYV A;  2YIB A;  3QA8 A;  3ZED A;  1MJG A;  2YL5 A;  2FIC A;  3CZN A;  4EZY A;  1SU8 A;  1GNL A;  2YKT A;  1U00 A;  5FLE X;  3A98 A;  2F7R A;  3DX4 A;  3DPO A;  2F18 A;  2ALW A;  2RT6 A;  2Q13 A;  4H6I A;  2QFF A;  3HAI A;  3PLT A;  2X3V A;  1R5E A;  2Z0N A;  1YWM A;  4JWE A;  2EX3 B;  2OZN B;  3FD9 A;  1HWW A;  2X3W A;  2Q12 A;  2RAI A;  3RV1 A;  4EZR A;  3GI7 A;  1E2U A;  2EWF A;  2YIA A;  3DX0 A;  2C08 A;  1DKY A;  4EZV A;  4EZW A;  1R34 A;  4AZB A;  2D4C A;  4UDX X;  3SOG A;  3BUB A;  5C5B A;  4JN4 A;  4R5K A;  3B53 X;  1DKZ A;  1URU A;  2F1B A;  3KAV A;  1PS3 A;  4M0M A;  2GF4 A;  4EZU A;  3QNI A;  3DPQ A;  3QE6 A;  3D50 A;  2F7P A;  4FZO A;  4WPE A;  1ZWW A;  3O3N B;  1TQS A;  4H6H A;  4AZI A;  4R5L A;  4BNE A;  1E1D A;  3BUD A;  4IM2 A;  3BUP A;  3KDR A;  4HYB A;  2V0O A;  2WYH A;  2N3K A;  1O7D B;  1QWN A;  3EJS A;  5FIG A;  3BVV A;  4I1Q A;  1WDZ A;  2QKW A;  4JL9 A;  2QXL A;  1HTY A;  5KBP A;  3BVU A;  1X04 A;  2YL9 A;  4R5I A;  3ACO A;  4HR1 A;  1SU6 A;  4JWD A;  3T49 A;  3LVT A;  3BVT A;  4E81 A;  2OW7 A;  5E84 A;  1DKX A;  3Q84 A;  3BVW A;  4EZO A;  1TQW A;  4G6Q A;  3CAZ A;  2ND0 A;  3D4Y A;  2YI9 A;  4WPC A;  4EZS A;  3CKD A;  2WYI A;  3UIT A;  4IWQ A;  4KIK A;  3B52 X;  3OWG A;  4HY9 A;  3DX3 A;  3EJT A;  4JWI A;  4AZC A;  3LMF A;  3OK8 A;  2EFL A;  3HAH A;  4IWO A;  3Q0K A;  2OO2 A;  3T47 A;  1E9V A;  2OBM A;  1R33 A;  1ZYL A;  4E3C A;  3EJR A;  3T48 A;  2PMR A;  3O3O B;  1X03 A;  3VEB A;  3RV0 A;  3VEA A;  4EZT A;  3DYT A;  3D4Z A;  1TQV A;  4R5G A;  2YL6 A;  2O0I 1;  4UDY X;  3D2E A;  2EFK A;  3C7N A;  4ATM A;  4JNF A;  3BUI A;  3QNJ A;  3SYV A;  2YI8 A;  4AZH A;  3VKH A;  4FZP A;  3B51 X;  5TKY A;  3DX1 A;  2LXY A;  3T4A G;  3ERC C;  2ND1 A;  2X5C A;  1JQK A;  3M3W A;  2MI7 A;  3ABH A;  4IM0 A;  2ELB A;  2YLA A;  2Z0O A;  5C5B B;  2JNK A;  4EZQ A;  4AKV A;  3I39 X;  3KAW A;  1UPX A;  3BLB A;  4B9Q A;  4IM3 A;  4D8J A;  3DDF A;  2KHO A;  3CVR A; 
#chains in the Genus database with same CATH homology
 1X03 A;  3I2W A;  3CAZ A;  1I49 A;  2C08 A;  2Z0V A;  3M3W A;  1X04 A;  4NQI A;  3ABH A;  4FZS A;  4BNE A;  3ACO A;  2RAJ A;  4H8S A;  1I4L A;  3HAJ A;  2ELB A;  1Y2O A;  2FIC A;  4DYL A;  2Z0O A;  3OK8 A;  1I4D A;  5C5B B;  2EFL A;  2Q13 A;  3HAH A;  4WPC A;  3DYT A;  3SYV A;  3Q0K A;  3HAI A;  3QNI A;  3PLT A;  4AKV A;  2X3X A;  2X3V A;  1I4T A;  2D4C A;  3LLL A;  3QE6 A;  2V0O A;  2Z0N A;  3SOG A;  3QWE A;  3Q84 A;  5C5B A;  4WPE A;  1ZWW A;  2YKT A;  4I1Q A;  1WDZ A;  2X3W A;  1URU A;  2D1L A;  2Q12 A;  2RAI A;  3G9G A;  2EFK A;  2RAK A;  4AVM A;  4ATM A;  4NSW A;  4DCN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...