3HAIA

Crystal structure of human pacsin1 f-bar domain (p21 lattice)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
TTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
molecule keywords human PACSIN1 F-BAR
total genus 112
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3haiA01
2V0OA 3CAZA 2RAJA 3G9GA 2Z0NA 4I1QA 3DYTA 5C5BA 1I4LA 3Q0KA 3SOGA 1ZWWA 4NQIA 3LLLA 3PLTA 5C5BB 4NSWA 2Z0VA 4H8SA 1I4TA 3ACOA 3HAJA 1I4DA 4FZSA 1I49A 3I2WA 3Q84A 1X03A 2EFLA 2X3XA 4WPCA 2Z0OA 3OK8A 2D4CA 3HAIA 2X3VA 4DYLA 4AVMA 4WPEA 2Q12A 1Y2OA 3M3WA 3QNIA 3SYVA 2X3WA 3QE6A 1URUA 4AKVA 2YKTA 2Q13A 4ATMA 3QWEA 2RAIA 2RAKA 3ABHA 1X04A 2C08A 2ELBA 2D1LA 3HAHA 4DCNC 1WDZA 2FICA 2EFKA 4BNEA
chains in the Genus database with same CATH superfamily
4EZVA 4AZCB 2RAJA 1R34A 3T4AG 4EZZA 4KIKA 3FD9A 4AZBA 4R5KA 3B52X 3PLTA 3OHXM 2EWFA 4NSWA 2Z0VA 2YL8A 3DX0A 4R5GA 2ALWA 1I49A 1OA0A 2OW6A 3I2WA 3I39X 4IWOA 1SU7A 3HAIA 2OW7A 3VKHA 3C7NA 3DX1A 2OO2A 1JQKA 2Q12A 3BVTA 3M3WA 3O3NB 2Z8YA 4E81A 4EZYA 1PS3A 3KAVA 2GA9D 3QE6A 4AKVA 4F01A 3ER9B 2ND1A 3BVXA 5TKYA 2WYIA 3EJQA 2F7QA 4FZOA 1MJGA 2YLAA 1WDZA 3BUDA 3ZEDA 1W9MA 2FYVA 2F18A 2F7RA 2FICA 2YLLA 4BNEA 3BUIA 4EZSA 2Z0NA 4I1QA 5C5BA 3Q0KA 4AZ6A 2QXLA 4EZNA 3DX4A 2GAFD 1ZWWA 2X5CA 4UDYX 4EZQA 3DPPA 5C5BB 1UPXA 1LQ7A 2YIBA 2ZXQA 4H8SA 4HR1A 4R5IA 4UDXX 2QKWA 3HAJA 2GF4A 1I4DA 3RV0A 1DKZA 2PMRA 1E2UA 3CZSA 1X03A 3EJSA 2EFLA 3BUQA 4IWPA 1QX1A 4JN4A 4WPCA 2Z0OA 2F1BA 3OK8A 5E84A 4EZXA 5FLEX 4PO2A 4AVMA 4WPEA 2WINM 1DKYA 2YIVX 3EJUA 3O3MB 4R5JA 2JNSA 3BUPA 1R33A 1TQWA 2OBMA 2WYHA 4JNEA 1HTYA 5FIGA 2Q13A 3RV1A 4ATMA 4F00A 3VEAA 3ABHA 1SU6A 3D2EA 2C08A 3BVVA 3L3PA 3HAHA 4E3CA 4AZ7A 3EJRA 3I01A 4HR1B 3ER8C 2PY6A 2LM0A 3D51A 3VEBA 2ND0A 4AZHA 2EX3B 3D4YA 4HYBA 3T48A 1E1DA 2YI9A 3CAZA 3DX3A 4AZ5A 3A98A 3DYTA 1OAOA 4R5LA 4JLCA 2YL6A 4HY9A 3T47A 2OZNB 4FM3A 4KIKB 2F7PA 2O0I1 4EZRA 3I04A 4NQIA 2LXYA 2RT6A 3D52A 4AZIA 1TQTA 4FZSA 4AZGA 2N3KA 4NPHA 1QWNA 3LVTA 3D50A 2YI8A 3DX2A 3B53X 3T46A 2D4CA 3RPMA 2QFFA 4M0MA 1ZYLA 2X3VA 1O7DC 4DYLA 3BVUA 2MI7A 3F7WA 1DKXA 3ERCC 1YWMA 3DPQA 4FZPA 4JWEA 4D8JA 3T49A 1URUA 4EZUA 3GI7A 4H6HA 3QWEA 2RAKA 4IM2A 2YIAA 1GNLA 1SUFA 2ELBA 2D1LA 3BUBA 3D2FA 3CVRA 4G6QA 4JWDA 3EJTA 1TQVA 1I4LA 3OWGA 2V0OA 3BLBA 3G9GA 2NCZA 3L3OM 3SOGA 3D4ZA 3CV5A 4AZCA 1QWUA 3CKDA 3QNJA 3KDRA 1HWWA 2JNKA 3LLLA 1OA1A 2YL9A 4JWIA 4IW0A 3EJPA 1I4TA 3ACOA 3DDGA 4JWCA 3LMFA 3Q84A 2OBLA 2X3XA 4IWQA 1TQSA 2F1AA 4B9QA 1HXKA 4EZPA 4EZWA 3KAWA 3DDFA 4H6IA 1R5EA 1U00A 3CZNA 3O3OB 1O7DB 3DPOA 3B51X 3UITA 3QNIA 4IM3A 3SYVA 2X3WA 4JNFA 2YKTA 2RAIA 4EZTA 1X04A 3QA8A 4JL9A 2KHOA 1E9VA 2F7OA 2YL5A 4IM0A 1SU8A 3BVWA 4DCNC 4EZOA 1GNTA 5KBPA 1TQUA 1GN9A 1Y2OA 2EFKA
chains in the Genus database with same CATH topology
2V0OA 3CAZA 2RAJA 3G9GA 2Z0NA 4I1QA 3DYTA 5C5BA 1I4LA 3Q0KA 3SOGA 1ZWWA 4NQIA 3LLLA 3PLTA 5C5BB 4NSWA 2Z0VA 4H8SA 1I4TA 3ACOA 3HAJA 1I4DA 4FZSA 1I49A 3I2WA 3Q84A 1X03A 2EFLA 2X3XA 4WPCA 2Z0OA 3OK8A 2D4CA 3HAIA 2X3VA 4DYLA 4AVMA 4WPEA 2Q12A 1Y2OA 3M3WA 3QNIA 3SYVA 2X3WA 3QE6A 1URUA 4AKVA 2YKTA 2Q13A 4ATMA 3QWEA 2RAIA 2RAKA 3ABHA 1X04A 2C08A 2ELBA 2D1LA 3HAHA 4DCNC 1WDZA 2FICA 2EFKA 4BNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V0O A;  3CAZ A;  2RAJ A;  3G9G A;  2Z0N A;  4I1Q A;  3DYT A;  5C5B A;  1I4L A;  3Q0K A;  3SOG A;  1ZWW A;  4NQI A;  3LLL A;  3PLT A;  5C5B B;  4NSW A;  2Z0V A;  4H8S A;  1I4T A;  3ACO A;  3HAJ A;  1I4D A;  4FZS A;  1I49 A;  3I2W A;  3Q84 A;  1X03 A;  2EFL A;  2X3X A;  4WPC A;  2Z0O A;  3OK8 A;  2D4C A;  3HAI A;  2X3V A;  4DYL A;  4AVM A;  4WPE A;  2Q12 A;  1Y2O A;  3M3W A;  3QNI A;  3SYV A;  2X3W A;  3QE6 A;  1URU A;  4AKV A;  2YKT A;  2Q13 A;  4ATM A;  3QWE A;  2RAI A;  2RAK A;  3ABH A;  1X04 A;  2C08 A;  2ELB A;  2D1L A;  3HAH A;  4DCN C;  1WDZ A;  2FIC A;  2EFK A;  4BNE A; 
#chains in the Genus database with same CATH topology
 4EZV A;  4AZC B;  2RAJ A;  1R34 A;  3T4A G;  4EZZ A;  4KIK A;  3FD9 A;  4AZB A;  4R5K A;  3B52 X;  3PLT A;  3OHX M;  2EWF A;  4NSW A;  2Z0V A;  2YL8 A;  3DX0 A;  4R5G A;  2ALW A;  1I49 A;  1OA0 A;  2OW6 A;  3I2W A;  3I39 X;  4IWO A;  1SU7 A;  3HAI A;  2OW7 A;  3VKH A;  3C7N A;  3DX1 A;  2OO2 A;  1JQK A;  2Q12 A;  3BVT A;  3M3W A;  3O3N B;  2Z8Y A;  4E81 A;  4EZY A;  1PS3 A;  3KAV A;  2GA9 D;  3QE6 A;  4AKV A;  4F01 A;  3ER9 B;  2ND1 A;  3BVX A;  5TKY A;  2WYI A;  3EJQ A;  2F7Q A;  4FZO A;  1MJG A;  2YLA A;  1WDZ A;  3BUD A;  3ZED A;  1W9M A;  2FYV A;  2F18 A;  2F7R A;  2FIC A;  2YLL A;  4BNE A;  3BUI A;  4EZS A;  2Z0N A;  4I1Q A;  5C5B A;  3Q0K A;  4AZ6 A;  2QXL A;  4EZN A;  3DX4 A;  2GAF D;  1ZWW A;  2X5C A;  4UDY X;  4EZQ A;  3DPP A;  5C5B B;  1UPX A;  1LQ7 A;  2YIB A;  2ZXQ A;  4H8S A;  4HR1 A;  4R5I A;  4UDX X;  2QKW A;  3HAJ A;  2GF4 A;  1I4D A;  3RV0 A;  1DKZ A;  2PMR A;  1E2U A;  3CZS A;  1X03 A;  3EJS A;  2EFL A;  3BUQ A;  4IWP A;  1QX1 A;  4JN4 A;  4WPC A;  2Z0O A;  2F1B A;  3OK8 A;  5E84 A;  4EZX A;  5FLE X;  4PO2 A;  4AVM A;  4WPE A;  2WIN M;  1DKY A;  2YIV X;  3EJU A;  3O3M B;  4R5J A;  2JNS A;  3BUP A;  1R33 A;  1TQW A;  2OBM A;  2WYH A;  4JNE A;  1HTY A;  5FIG A;  2Q13 A;  3RV1 A;  4ATM A;  4F00 A;  3VEA A;  3ABH A;  1SU6 A;  3D2E A;  2C08 A;  3BVV A;  3L3P A;  3HAH A;  4E3C A;  4AZ7 A;  3EJR A;  3I01 A;  4HR1 B;  3ER8 C;  2PY6 A;  2LM0 A;  3D51 A;  3VEB A;  2ND0 A;  4AZH A;  2EX3 B;  3D4Y A;  4HYB A;  3T48 A;  1E1D A;  2YI9 A;  3CAZ A;  3DX3 A;  4AZ5 A;  3A98 A;  3DYT A;  1OAO A;  4R5L A;  4JLC A;  2YL6 A;  4HY9 A;  3T47 A;  2OZN B;  4FM3 A;  4KIK B;  2F7P A;  2O0I 1;  4EZR A;  3I04 A;  4NQI A;  2LXY A;  2RT6 A;  3D52 A;  4AZI A;  1TQT A;  4FZS A;  4AZG A;  2N3K A;  4NPH A;  1QWN A;  3LVT A;  3D50 A;  2YI8 A;  3DX2 A;  3B53 X;  3T46 A;  2D4C A;  3RPM A;  2QFF A;  4M0M A;  1ZYL A;  2X3V A;  1O7D C;  4DYL A;  3BVU A;  2MI7 A;  3F7W A;  1DKX A;  3ERC C;  1YWM A;  3DPQ A;  4FZP A;  4JWE A;  4D8J A;  3T49 A;  1URU A;  4EZU A;  3GI7 A;  4H6H A;  3QWE A;  2RAK A;  4IM2 A;  2YIA A;  1GNL A;  1SUF A;  2ELB A;  2D1L A;  3BUB A;  3D2F A;  3CVR A;  4G6Q A;  4JWD A;  3EJT A;  1TQV A;  1I4L A;  3OWG A;  2V0O A;  3BLB A;  3G9G A;  2NCZ A;  3L3O M;  3SOG A;  3D4Z A;  3CV5 A;  4AZC A;  1QWU A;  3CKD A;  3QNJ A;  3KDR A;  1HWW A;  2JNK A;  3LLL A;  1OA1 A;  2YL9 A;  4JWI A;  4IW0 A;  3EJP A;  1I4T A;  3ACO A;  3DDG A;  4JWC A;  3LMF A;  3Q84 A;  2OBL A;  2X3X A;  4IWQ A;  1TQS A;  2F1A A;  4B9Q A;  1HXK A;  4EZP A;  4EZW A;  3KAW A;  3DDF A;  4H6I A;  1R5E A;  1U00 A;  3CZN A;  3O3O B;  1O7D B;  3DPO A;  3B51 X;  3UIT A;  3QNI A;  4IM3 A;  3SYV A;  2X3W A;  4JNF A;  2YKT A;  2RAI A;  4EZT A;  1X04 A;  3QA8 A;  4JL9 A;  2KHO A;  1E9V A;  2F7O A;  2YL5 A;  4IM0 A;  1SU8 A;  3BVW A;  4DCN C;  4EZO A;  1GNT A;  5KBP A;  1TQU A;  1GN9 A;  1Y2O A;  2EFK A; 
#chains in the Genus database with same CATH homology
 2V0O A;  3CAZ A;  2RAJ A;  3G9G A;  2Z0N A;  4I1Q A;  3DYT A;  5C5B A;  1I4L A;  3Q0K A;  3SOG A;  1ZWW A;  4NQI A;  3LLL A;  3PLT A;  5C5B B;  4NSW A;  2Z0V A;  4H8S A;  1I4T A;  3ACO A;  3HAJ A;  1I4D A;  4FZS A;  1I49 A;  3I2W A;  3Q84 A;  1X03 A;  2EFL A;  2X3X A;  4WPC A;  2Z0O A;  3OK8 A;  2D4C A;  3HAI A;  2X3V A;  4DYL A;  4AVM A;  4WPE A;  2Q12 A;  1Y2O A;  3M3W A;  3QNI A;  3SYV A;  2X3W A;  3QE6 A;  1URU A;  4AKV A;  2YKT A;  2Q13 A;  4ATM A;  3QWE A;  2RAI A;  2RAK A;  3ABH A;  1X04 A;  2C08 A;  2ELB A;  2D1L A;  3HAH A;  4DCN C;  1WDZ A;  2FIC A;  2EFK A;  4BNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...