3HB0A

Structure of edeya2 complexed with bef3
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
274
structure length
259
Chain Sequence
b'SHMERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Eyes absent homolog 2 (Drosophila)
molecule tags Hydrolase
source organism Homo sapiens
publication title Crystal structure of ED-Eya2: insight into dual roles as a protein tyrosine phosphatase and a transcription factor
pubmed doi rcsb
total genus 97
structure length 259
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hb0A00
3HB1A 3GEBA 3HB0A 4EGCB
chains in the Genus database with same CATH superfamily
2D1YA 3WMXA 3RODA 1RZVA 1MZPA 3VO2A 1UK8A 2WD8A 2K2QB 2TMKA 3GFTA 4Q18A 1AT1A 2AG0A 4LX8A 4PX5A 4YDRA 3W1VA 1C8LA 4KAAA 5DIZA 1AZSC 1BW9A 1R8JA 4CDGA 4MV3A 3ZU4A 2A7XA 6ADHA 1PWHA 1TO2E 1BCSB 3HVUA 2Q4RA 4NECA 2VHZA 3K0KA 3IPRA 4IG9A 1YA6A 4P5DA 2GD1O 4FBMA 4DSTA 1FNMA 3R9WA 5CLHA 2IK8A 4J1NA 3MOGA 4GECA 4HAUA 4XWWA 5H3HA 2VPQA 1PTJC 3E7WA 1N8KA 1I7NA 1TVEA 2E4YA 3FZNA 3T34A 2NADA 4AF8A 2CT8A 1E5TA 3DP7A 4JBHA 1JQAA 3H9UA 4AMUA 1SUBA 4L6IA 5CVTA 3U3RA 1ORDA 1VCIA 4BCCA 3OZRA 1Z2OX 1ESNA 4JYZA 3NKVA 4X1IA 3CLHA 3M1IA 3EXIA 5KNCD 3U26A 1GAQA 1V11A 2OLEA 4EO4A 3DM5A 3RUFA 1Z0UA 3KEQA 4RTOA 4R1SA 3OZCA 5I9BA 2QD1A 5WRFA 2B36A 2EQ5A 2KQUA 1T6BY 1FLDA 2P2LA 1WXIA 1HLGA 4G1EB 4ZFNA 3GLUA 2DKNA 3RIMA 1F8FA 2C5AA 2XQIA 1GCUA 2V6IA 3L92A 3P71T 5JE8A 5LBTA 1SC3A 2HRRA 1FK8A 1YS1X 2WEKA 1ODCA 4B76A 2M98A 3BRWD 1YS7A 3Q0TA 3ENQA 1B8NA 4BPRA 1XQXA 5LR6A 3T94A 2GA8A 3I0ZA 5ALHA 3LMKA 1YHYA 2DPGA 3ECSA 4DDHA 2VZLA 3OTIA 2UDPA 3KIPA 3R3ZA 3FW1A 3WV5A 2C2YA 5CX1A 1T1SA 1SOMA 1XCOA 4Q15A 4UE2A 1HNNA 1NFFA 1Y3FE 4RKWA 1NSTA 3SDBA 1EX1A 2VAVA 1UC8A 4EF4A 5TMPA 4CKWB 1PS9A 2HBRA 1M5RA 1YZUA 3ER8A 1P6XA 4K5QA 1K8YB 1NXQA 3I61A 4Y9UA 3A32A 3B7WA 4FC7A 4ZMRA 4URVR 3OHSX 4JOQA 2H1CA 5AJXA 4EVIA 1G4HA 3T9BA 1FL9A 5FR1A 3E1SA 4X65B 1YVEI 2ZBVA 3URKA 4C21A 4GRDA 5AVTA 4KR3A 2QGFA 1I24A 5DX0A 4F2PA 4PX3A 1YR1A 1ZJZA 3DM9B 1E6CA 1C9MA 1SKUA 2NO5A 4P58A 1GAEO 1R74A 1WOYA 3CZRA 3N87A 1LA2A 1XN1A 3BUSA 1DOHA 3MJRA 3QTTA 2IYYA 4XLLA 1C7FA 5D84A 5DI3B 3ZKAA 1RMTA 2QTRA 2OV6A 1O3YA 1Z2AA 2VL7A 1XTIA 1RCUA 3LDFA 3N1UA 5CFRA 4UTVA 1IHPA 2FR1A 2HCRA 2X8JA 4IDNA 1E3TA 4UOZA 1HLFA 5CITA 3EJ6A 3GYGA 3BEDA 4M7OA 1GEGA 3GH3A 2HA0A 3S55A 4EITA 3EPHA 2PXXA 3R4CA 2JFVA 4PCAA 2JC3A 3P2MA 4ZXPA 4JNCA 5B12A 3WFIA 3SBEA 4B3XA 5I7RA 1B23P 4YX9A 4TZ0A 1WB4A 4KCGA 4CGYA 1MIHA 4KWTA 1K5DA 3IB6A 1A9QA 3E0XA 3VPHA 4B4DA 4P33A 4ZAFA 1YRLA 2J85A 3IOCA 4L08A 3KB8A 1K8RA 1KMNA 3K3PA 1ORTA 1SBNE 3AF4A 5BOVA 3RYIA 3ZWOA 3LDAA 1ZAKA 2DMRA 3COYA 2I8AA 2F64A 3AHDA 3LWZA 4YIKA 1RT9A 3BT7A 3H5WA 4D8XA 1Z17A 4NYMQ 1HEUA 2PIDA 3HKBB 3QPAA 4RIGA 1XHFA 1GL3A 4UHJA 5FI3A 4QTYA 1WJGA 3NU1A 1V1JA 1VG9B 5LWHA 2FB9A 3TGPA 3DLHA 5AJUA 4BNWA 4YAWA 3QX7A 5AKGA 2VQSA 3ZY2A 2YJGA 2D7JA 3DFKA 4A8JA 1X1SA 1VKJA 1RAIA 2DE0X 1YUMA 2DWPA 3ABOB 3F6BX 1GQYA 4XDHA 5KSZA 3F74A 2M6LA 1V8OA 4W6ZA 2HPAA 1YIDA 3B6EA 3WQSB 1I6WA 2REQB 3AR5A 3GJ7A 1FDRA 4OG2A 5ALDA 5FXMA 5KVQA 5JXHA 2VQEB 4YONB 3ZGLA 4JLWA 4PZYA 3T0GA 3G9XA 3PXBA 4TYPA 3UBTA 3KAKA 3DOOA 3BSSA 3IC5A 5F7JA 3OPNA 3PCXA 3R8CA 3L8CA 1SOVA 3D3NA 3WL7A 3TFOA 1R1DA 3PXAA 1O1YA 4NOJA 1GUFA 3R09A 4Y2YA 4OYYA 5JLJA 3C16C 2X0FA 3V97A 3AI2A 2C95A 4RAOA 2D1QA 4UHFA 3HO8A 1KAEA 4CLEA 2IXAA 2C2ZA 4IF6A 4ZK6A 1IXYA 2UVPB 4QYSA 3ZXSA 3DMDA 1RKVA 1E6UA 1X9HA 3Q3JB 3WLQA 2I6GA 1X94A 4KVFA 3ZHXA 5B7NA 4QTTB 5DHRA 4LAFA 5IN4A 5B3JC 1BS1A 3NEPX 4LOLA 4RH3A 4OJQA 2F43A 3P9NA 4H35A 4MWEA 1Q14A 5DN9A 1LWOA 3V8MA 3BXOA 4D80A 5G53C 1A95A 4D9CA 2NV2B 2OCPA 3AKEA 1G9SA 1PUJA 3PNMA 4QHSA 2VBIA 5EIBC 3WE7A 2CLEB 1E9CA 2FFAA 2JH9A 4GLLA 4XM0A 2G80A 2XUGA 4NCNA 4AJHA 2AR9A 4WERA 5JBNA 4WBNB 1VRCA 1NSFA 2KWIA 3GDWA 1T34A 4YAGA 5AM2A 1JB1A 3G5LA 3IJPA 4W1SA 2I7DA 1EGQA 5LBIA 5BWNA 2XW6A 4QFDA 1H4VB 4BIMA 2AOVA 3G02A 5JVDB 4P7KA 1NIPA 1PEAA 1AGPA 3CRZA 2B99A 4J0QA 4UNQA 4ZOLA 3I01A 3L4EA 4FYHA 1P2TA 1Y7LA 1Z6PA 5KSWB 2DR3A 4LWZA 4C03A 5A4JA 1SXQA 4F3TA 1CUAA 2ZAOA 1W9HA 3BYZA 5E4YA 2J3LA 1OT3A 4F1WA 1VLMA 4LRSB 3QU5A 1KE2A 2V6JA 1JHXA 3NHAA 1RYFA 4FW9A 3GAFA 2DBYA 3CPHA 3ZY5A 3SC2A 1V4VA 1W0KA 1Z0FA 5K4AA 4O29A 1EGVB 1XSEA 2HDHA 4MA4A 1HMPA 1YZGA 5E2AA 2J0UB 4X66B 3E8XA 2AXQA 2CCKA 3BGIA 3FPFA 5HR5A 2UVQA 3G2NA 3AL0C 1DPFA 2ERYA 2FHSA 3EARA 2H7CA 2Y1EA 4JEMA 1O9BA 2J46A 2ZRBA 4MUJA 5JYEA 1T9GR 4XFDA 3ETCA 4ZMSA 1BH2A 1DEKA 4AG3A 4LS3A 5AXCA 1HYQA 2PLWA 4M60A 1OOEA 5LQDA 5JHGB 3D6JA 4D9NA 3MZ0A 2I55A 4PM4A 4GZ3A 1P9NA 2QJTA 1T5TA 2GCOA 1OFUA 4K81B 1VYTA 1RP1A 1KMHA 4EX6A 3KJEA 5CT9A 1EBBA 1N7JA 1T8WA 1Z0KA 4FR0A 4HNHA 4KQXA 5FT9A 4ASUD 4BO9A 2ZS7A 3F3KA 1WP4A 3JSAA 2VDLB 1JEAA 2QJOA 1EJ2A 3A6GA 4CCWA 5CDFE 1X7GA 3KP1A 5KPDA 4IIGA 4XRGA 1QU3A 4S2UA 2ORWA 2AJTA 2NO9A 4NCAA 1G19A 3ROFA 5LLDA 2HSGA 4A16A 1QQAA 3RLIA 1A76A 1ZD9A 1O6ZA 1EP2B 2BKEA 2FPKA 5ILOA 2QG9A 4LHZA 2R4QA 3QNMA 3E5RA 2OA0A 3SJ7A 3OA2A 3TLEA 1J0XO 1QFMA 1OI4A 1S2GA 2CXHA 2PG3A 2PGDA 2TMYA 4FCCA 3U60B 2OBLA 1HRKA 1E6LA 2YIMA 3U49A 4FFDA 3NDPA 5JWRA 1DBIA 2ZQZA 1FSPA 1GG9A 2LCFA 3OQJA 4D9FA 2BRUA 1R4AA 1FB5A 4QGGA 5EC8A 3RROA 4HN9A 5CT4A 2TSYB 4RTMA 5FLYA 3B6JA 4GOJA 4LPSA 2O8NA 4Q1BA 5TC4A 2FEOA 4AX4A 5A2QA 3D43A 2XXAA 4J4BA 2CE2X 3HV2A 4YJ3F 5KDDA 4C87A 4EENA 1VFNA 2VWGA 4J7CA 1CRZA 2YL2A 1JDBB 2PPLA 3MUOA 4PZZA 3HDYA 1P1JA 4BO6A 4BQIA 4KFSA 5EXDA 3G2MA 1ISSA 2YY5A 4MW5A 4NHEA 4EG5A 4IGFA 3U19A 2REQA 3NYRA 1NYLA 2V96A 2FG5A 4RFSB 3QLJA 1TVKA 1JAZA 4CU5A 2XCRB 5JSFA 4MJLA 4ES6A 2KYRA 4TXNA 5IXSA 3ROPA 3KSDO 2MYUA 5A02A 1INLA 1JU9A 2O2YA 3R5TA 3S29A 1DQSA 4PG5A 4WX2B 4ZCIA 3ZV4A 1QRTA 1MB2A 3JQ8A 1AQJA 4DWJA 2ZB4A 3TSOA 2IWHA 1ZLYA 2A3NA 2PAFA 3U3XA 2QW0X 4ENWA 3BE4A 3ECCA 3L8FA 5C81A 1ONBA 3OZDA 4L74A 2GN8A 4YREA 4CN8A 1DX9A 1MC5A 1PQ4A 2BGNA 4GBJA 5FORA 5SYMA 3ORHA 4ZZ3A 1BKSB 5FTJA 4ATNA 5KAPA 3C7KA 4IVQA 1W52X 3IQHX 3VHXB 3QVVA 3HEAA 3O7MA 1TYZA 4RAQA 3NTLA 4WIAA 3THYB 3R23A 3J81k 5A4IS 1OLSB 1ZOIA 4NMWA 4J90A 2J59A 1K8XB 3CCBA 3Q41A 5CGQB 2P4EA 2VXOA 2D59A 1FFCA 2ES4A 2O05A 3RQSA 3C6QA 5B58T 5DB4A 4X7RA 1FYEA 4HG2A 4IINA 2V7UA 2OCKA 4RLSA 4GBMA 4QOEA 3MB5A 1NF8A 4TOIA 1Z7BA 3ZVNA 4BNJA 5CCEA 1RU3A 2PKWA 2H51A 4TMKA 2QF7A 3KYIB 1OI3A 3M4NA 3JSXA 3B5JA 1CNFA 1P19A 1J39A 2VDUE 3W4IA 2C78A 1DC7A 4FHCA 2X76A 3A04A 2ZVPX 4R41A 4LQCA 2OO5A 2FXIA 2I99A 3JWGA 4RWZA 3WRYA 5IPFA 3KT8A 5DNUA 2GNPA 1FYDA 2ZJ3A 3VSCA 1CIJA 1U7WA 3G0DA 5BN1A 1M6NA 4EP1A 4UW9A 3S2GA 1X42A 2Q1WA 1SVKA 1LC0A 1UFKA 4DJEC 4JV5B 1NDQA 3PX3A 4Q1FA 1L7AA 2IIQA 2NXJA 3TLAA 4ZK2A 2ZT8A 4BNDB 2AKEA 2YVLA 1Z4PX 4IIHA 1SVMA 1DSSG 5EHNA 3I09A 2PUAA 1M9NA 3GLHB 2OPBA 5CLJA 4RIEA 4YAOA 1WDMA 3M2TA 3QE0A 1Y3IA 3EGWA 3O1JC 3VO9A 1BEUB 3BIFA 3LVRE 1FDUA 1YRYE 2I2BA 1SIUA 3RTGA 2Y67A 4OBBA 1GNLA 3EDOA 2HOQA 2WPDA 3HRIA 2BAGA 1V5WA 4MEJA 3WLAA 3ZE9A 1UKEA 4KYTA 4O08A 1M5UA 2VA8A 2ZRCA 4K86A 3KD2A 3FRHA 2WC1A 3OIDA 4GX0A 1A88A 1B6SA 1XZFA 2TMGA 4HB2A 1AA9A 2JGRA 3MS7A 4QFBA 1E1MA 1BE8A 4WZBE 5DGTA 1QP8A 3P2YA 4Q48A 4DLXA 2YNMA 2XGSA 3BKWA 4PC3A 2JFOA 3ON5A 5NLLA 1RTTA 1SB8A 4N3GA 1ZIXA 5K0LA 5I45A 2F9MA 2IEGA 2WSIA 4ZZIA 5B4TA 3C8HA 1LJ8A 1CUYA 3E9QA 3AIOA 3ELDA 5GTDA 2COUA 2XUJA 4KUGA 1AMOA 3DLBA 3ANSA 1ZRSA 3R44A 3C6XA 5MDHA 1W76A 2P8SA 3QG5A 4C0JA 4HY3A 3PRHA 1OLXA 2VYND 1M1YA 3CC8A 2HUPA 4FFVA 4PGMA 5KBYA 3U56A 3PR1A 3KZMA 3OMWA 4FYPA 4YFVA 4K6FA 1KY2A 1TA9A 5CB8A 3ABQB 4KV9A 3TOSA 2JW5A 3QMWA 1O95C 2VP9A 5FNZA 5FR2A 1RXIA 1TA4A 3EDRA 3LOQA 3U7GA 2IH2A 4IUCS 4DLLA 3RSGA 1ZK4A 2Z1NA 3R7NA 1KRHA 4YN3A 4XA8A 1YCHA 5FWYB 3PD7A 3ET4A 1H2FA 1ZMOA 1TQ4A 4CMJA 5K20A 1LBEA 3LPDA 2VTEA 5EN4A 2DR0A 3AL2A 3CEPB 5HA5A 2WWYA 1N2HA 1WZUA 3GB9A 1HM5A 4KUHA 1NUTA 2QX4A 3QOWA 4R3WA 1MXFA 1TKAA 1UF9A 2EL7A 2HU5A 2Q4OA 4KK4A 3RSHA 3RJZA 3V4PB 3B13B 2GRJA 4QJ3A 2RHTA 1ARZA 1WUKS 2G04A 1IQUA 4JUCA 4OCZA 3S2YA 3GLGE 5GP1A 1EK1A 1RVV1 3AHEA 5AXAA 1YT5A 4F5DA 3V1YA 5CEEA 5FFMA 4F6RA 2H85A 2QV0A 5JMPA 4EVQA 1EJBA 5DKFA 1J42A 1IONA 4PVDA 1VB3A 1L1RA 4WLEA 1CPYA 2LBPA 2ZJ6A 4KE6A 1L4LA 5H4HA 3W0LB 4CMGA 2PD6A 3MWJA 5IVIA 5IK2D 1LVUA 4MQMA 1MJ5A 3CEMA 3N2KB 2C96A 2DUWA 4N8EA 2OVFA 2I6TA 3L0IB 4PHHA 2CUKA 2Q3HA 3D8BA 4CIYA 4H3SA 3HCDA 4IQ8A 1Z6XA 4PAGA 4CM8B 4GF5A 3BMNB 1BQEA 4MS1B 1J1UA 3SP1A 1QBGA 1Z4LA 3EMVA 3FI9A 4DV0B 5ITVA 1WCWA 1TKCA 4LIPD 2ORVA 4REOA 3TEMA 2J33A 4EW2A 2XITA 5AW8A 2AA3A 1NI4A 3ME5A 3KRTA 1LLCA 4XAQA 5A5FA 1O96A 1P2UA 3DA8A 3OX1A 4O2AF 4AN4A 1KTIA 5CW2A 4FMDB 5LQMA 1BX3A 5ICGA 4LBYA 3Q0IA 3OU2A 4MUEA 2EDCA 5ES3A 1KAMA 2F00A 3A9TA 1VLHA 4UM5A 4P7JA 1XT6A 4WD3A 2EBHX 3DLAA 5F5XA 3OM8A 4KGDA 4ARSA 4TV8B 4M1OA 5AQ1A 4DGSA 2ZZMA 2BKVA 1UPCA 4XSGA 2H2WA 4G0MA 4NZPA 1AUVA 4FFRA 3SR0A 3GA0A 2CB9A 3H0CA 3HCAA 2QRGA 1NA5A 2NYRA 3PE6A 4TVBA 4TRRA 1K7EB 1QV7A 4BKPA 4CFSA 2E5WA 4HH3C 5I7FA 2GN4A 4M0DA 3NHUA 4NKRA 5JSQA 4BMDA 4DG5A 3LY9A 2NW6A 2YZ7A 5F76A 2ZAYA 4ENSA 1J49A 5C5CA 5LZ8A 1HYGA 4MI3A 1WZIA 3ZIDA 5FBLB 1O96B 3VNSA 1YL6A 2QUIA 3T99A 3B85A 4QYIB 1OXBB 3PGKA 2WLSA 2JD2A 4PGAA 1OH6A 1ZYUA 1ZGGA 4X1YB 4KAFA 1E5VA 4LRXA 2VPWA 4J91A 1L4HA 4G97A 2HU7A 1XMOB 3VPDA 4W8OA 1GPAA 1BU5A 4GM0A 3LQYA 4MYTA 2G9NA 4RWEA 3CF4G 5I9IA 1CQZA 4LZPA 5ECWA 2OC9A 3GPIA 2R6JA 1R88A 3G79A 3OQNA 2GZDA 4CKZA 4MNTA 2OYRA 1FDWA 1Z13A 2IHYA 1N7GA 1WU7A 1AXGA 1ZPDA 4LQLA 3RUEA 4E46A 4F7DA 1YZQA 1CUCA 4M8LA 5H8WA 3K0HA 5DW3A 2ONYA 3GRVA 1IHYA 4W7HA 1ZNXA 1LQ2A 3RC8A 2ATXA 1HBJA 2FZGA 1CEQA 5TNXA 4NYJR 5LA6B 1GP2A 2P1RA 2PS1A 3K4PA 4R8SA 2CLCX 4EA6A 2XUHA 1AJEA 1GZ5A 2C4WA 5HZHA 3QLUA 1PL8A 1WL8A 1Z36A 4D3ZA 1A9TA 2AI1A 2KLHA 4KPEC 2HT1A 3D5EA 1P1CA 2H5EA 3SMVA 2XTAA 1B41A 1I5OA 1PK8A 1BFKA 4OJTA 1K4KA 1T1RA 2FDRA 2AN9A 1TEVA 4JLPA 4L9AA 3RFFA 1C14A 3K0FB 3ZWCA 4OHPA 2F4NA 3OEEA 3VHQA 4EHIA 3ESCA 3L05A 3N53A 3KKZA 3NBZC 5JROA 1HDIA 1VM6A 1VJRA 2XYRA 4DNXA 1R0ZA 2O2HA 1CY0A 4RV9A 2HF7A 2OSVA 3TB6A 3WGUA 3ITDA 2JATA 1P8JA 4YBRA 1NBEA 2AOUB 2P1DA 1VE1A 2R11A 3TZEA 1KNXA 3ZY6A 2QOEA 3HCWA 1BVYF 2ZITA 3O9ZA 5E1BA 1P2BA 3JASA 3ORFA 3BK7A 4LQDA 1EFLA 2Z4TA 3Q6IA 4XB6B 2NLOA 4MW1A 2J48A 1LZLA 2AN1A 4HJRA 1C7EA 1I4LD 2QVLA 4XW2A 4BFYA 2P9BA 1E2QA 4G63A 3A3NA 5P21A 3M4JA 4NV0A 3QWFA 4RMGA 2PY6A 4JYBA 4L1KA 5IMBA 4LFCB 2I29A 4YRAA 1B0UA 4HWPA 5LUBA 5LQRA 2IHNA 5LUAA 4B8ZA 3IKLA 4DLPA 2NSHA 3P9CA 1CBUA 2JI4A 1R66A 4G9GA 4GPEA 4JMPA 3WICA 5JQGA 4ZEOA 4C05A 2QT9A 1SXPA 1MJNA 1N2ZA 2JCVA 2JG3A 4GPIB 2Q21A 3I12A 1LXCA 3GEEA 2V0GA 3UTDA 4YDHB 3JQPA 3HCOA 4JLOA 1OZ0A 4NPAA 3T5BA 4K87A 4G8DA 3QVKA 3N0VA 5LZ5A 3BK1A 3PWSA 1NYTA 3UAZA 2R4TA 4LJ4A 5K5EA 3FZYA 2R1UA 1T6ZA 2V7XA 3AC0A 1WMBA 1FEZA 3F9CA 4MYSA 4P6VF 3BWDD 3K5WA 5THQA 1DCTA 2RHDA 1J8FA 1G8MA 5B36A 1MENA 2C94A 3EAFA 2C0PA 2IOFK 2R7NA 1V16A 3FCOA 3KU4A 4RIHA 4Z9YA 4D96A 8OHMA 1KI8A 2PFSA 1JIJA 1M2OB 1QPBA 2R6ZA 4H4CA 1NR7A 1N6OA 4TV9F 1UZUA 3D6AA 4AY2A 1N2BA 5DWVA 5DCUA 5EEHA 4QBGB 5SYAA 3ZU2A 2WOOA 4X63A 3FBGA 2PTGA 4UUPA 4LJ9A 4FT2A 3AEYA 2O2IA 4Q7KA 2WWTA 3TQCA 5DM4A 5DO9A 2FZ5A 1XXHA 2OAQ1 4R0MA 3AINA 1AX9A 4JLMA 4GO1A 3TCKA 3JRXA 3H1PA 3N58A 4KN8A 1W36B 3HFGA 3MMNA 4MTCA 1N6PA 4IHKA 1SQSA 5A9TA 5A3SA 1NW5A 4A8JC 1G3UA 4XD2A 5B2ZA 5BMVA 4UDNA 3OOEA 1N3BA 2G5GX 4RK7A 1GY8A 5EWLB 4XGQA 4MZDA 4B35A 1JHVA 1UJMA 1RXEA 1ZRNA 2XB9A 4YJFB 4B5KA 3R9XA 2CYBA 2E1PA 1TECE 4TKUA 4TWAA 1F0KA 2IYQA 2A14A 2I6UA 3MK31 5BP7A 2XVYA 2QYSA 3K7EA 1H5UA 1COZA 3E3LA 4B6SA 2WSSD 2VWQA 4FMPA 4PG8A 4Q9KA 4PN3A 1T0JB 3NWPA 3UGTA 3E9RA 1D09A 1MU0A 1G5IA 3B9RA 4HLQB 1FXWF 5FFNA 3UJAA 1IZ7A 1JQEA 3EBLA 3E9NA 1MN6A 1T6NA 3CRRA 5CJJA 5CCDA 4YAJA 4I2NA 2C57A 4ZT3A 4C9BA 5AJWA 4NG5A 3FBTA 4RUKA 1NPDA 2ZSUA 3EZ2A 1YVPA 4IHJF 4MX8A 2J3KA 2WYHA 3HDTA 3VNVA 3FVWA 3LZDA 1TC2A 1WSWA 2HQOA 4KN9S 4YP6A 4BP3A 2GSDA 2R87A 1W73A 3TDNA 2HMUA 1YFZA 2X4IA 4UQOA 4CTJA 2CLKB 4J0GA 4A10A 2A9QA 1CRWG 1ZH2A 2NUBA 1PDOA 2VDMB 3K9CA 3TUJC 3H17A 4BGVA 4JQZA 3KOUA 4GHWA 3HA3A 4IDCA 1ZIOA 4B79A 4E15A 1W0CA 4R8MA 1MQ8B 1R4MA 1UPBA 4LJLA 3ZIAA 4JA2A 4X8OA 2WD7A 4NDZA 1RLUA 2GJ9A 3DEAA 2X5XA 3MBOA 4P4GA 1DC4A 3MOIA 2BEUA 3FNRA 8ATCA 1BDIA 1M10A 4BRWA 4ZN6A 4FM9A 2FN9A 2NP7A 2BUBA 3MXOA 5HUQA 3QBVA 4F5EA 1MCZA 1VKOA 1ZVJA 1RI3A 4CW7A 2V5UA 1U2EA 2PXHA 2V6BA 2JLQA 3RS4A 2ZKIA 3DXZA 2EW1A 3RVSA 1O6GA 4QPZA 4QO8A 4HPWA 2YWRA 4F72A 1PIWA 1HNZB 2ANBA 4GPZA 2PO5A 4E5NA 2QP3A 1Z25A 1XLVA 1G3QA 2WTAA 3NPAA 4FSHA 4R0VA 3ZHRA 3CVXA 3VZQA 3FTQA 1IH8A 4GOXA 2IVZA 1T43A 4FIDA 4Y2JA 1PJZA 3O31A 2R47A 4OL0A 1B74A 4P7FA 3OEED 3TRFA 2OHXA 1K68A 1NN3A 4JKOA 2HXYA 2G40A 2WD7B 4R68A 1WSBA 3K0FA 2V7PA 2IU0A 1MQSA 3IQEA 3ZK8A 3COSA 3OQIB 3S4YA 4XIFA 3RYIB 3PKJA 3WGJA 3KQLA 3GJ8A 4GYYA 5JMOA 2WHXA 1GZ6A 1TOAA 4ZANA 5JYCA 1Y1LA 2YC2C 4YRDA 5TY0A 2YV4A 4L5CA 4DDTA 4LFAB 2XE7A 3ASZA 4N0EA 4B17A 3PENA 4U2BA 1W2GA 3M70A 4NICA 1LSJA 4QDUA 5HIMA 3G8AA 1T26A 1KYXA 2CDRA 4YGYA 4DSZA 3HFSA 4HD8A 4ITVA 5GONF 3AWIA 3ZW9A 1T5IA 3OZXA 1CYDA 1E3QA 1A2QA 3IX7A 4KN5A 5AP9A 2W93A 1YFJA 1FC0A 2C5FA 4JB0A 5ARCA 1HK7A 5T4HA 3HQ4O 1BXRA 3NH9A 4UTPA 3GY0A 1ECCA 1G2QA 4DUYB 1RFGE 2E0IA 2W2XA 1VJCA 2R2GA 4GR9A 5IU6A 2QVYX 3C1TA 3RF6A 5AHXA 1YGPA 4GWLA 4WXEA 2NSLA 3EEIA 4ZHQA 4AWBA 2IUFA 1X1BA 5EE0A 3WYAA 1U3UA 4OGLA 4XQ0A 4H3KB 5JZOA 1J9EA 3KWMA 1LVGA 3PVCA 1H2WA 1M2VB 4HXGA 2CV1A 2E82A 2Q3DA 3RUIA 3VR2A 4DJJA 3IXMA 3QY0A 1YR2A 3VYVA 5TGZA 3OEYA 4K9OA 4ZT4A 4H60A 5IAJA 4PEVA 2VQDA 3T5AA 2LVBA 3PITA 4HRXA 3S2EA 4HFRA 2PKQO 2Y6UA 4IDDA 3M81A 1EZZA 1FRQA 1TE2A 3H5RA 2X8WA 2Z2JA 1NXVA 4GDFA 2AW3A 2EJCA 4HTFA 4KO1S 2IZ6A 1Y3DE 3RR2A 2YVAA 1RABA 3RVPA 1KI4A 3QLEA 2RH9B 3ETJA 4JVOA 5JO9A 3U9LA 4CDNA 5JJBA 3KHSA 4HZIA 5CB4B 2WUVA 1XQWA 1O4WA 3FCCA 3EOZA 2RGWA 4CM9D 2FK8A 3LO5A 5DI3A 2JLVA 2UAGA 2JIZD 2NAPA 3VPAA 1E9FA 3PD1A 3GVPA 4NK4A 4YXFA 3N2LA 4YJ2B 1RQ7A 3EGOA 4JJKA 3ZXXA 3JD2A 1HNWB 5FQNA 2I4OA 4QUAA 2Q2NA 2ZXUA 1N2GA 3LCRA 4Q37A 3EISA 4B3IA 3LQ1A 2BTQB 2RHLA 4QZVA 4ARIA 5DGCA 4FZVA 2Q49A 3K70B 4GMGA 1IM2A 3USZA 4EO9A 3TEJA 4XTRA 3WAGA 1EUQA 1SXHA 1PLJA 1Y42X 2FPOA 3TZHA 1ZZEA 1QO9A 3JQ9C 4OGKA 3ZH2A 1ZU4A 1FMLA 2W6MA 3ADCA 2P2CA 4QRHA 2ZTLA 4ANFA 2BGGA 2F8MA 3OE7A 5T3YA 2RAPA 3BPSA 4W7IA 1Z5UA 4F96A 4LJYA 3F78A 3P0IA 4ALIA 2ZIAA 4L9SA 3N6RA 2XRYA 1XK6A 4NBWA 3TDMA 3IQZA 4UMDA 1GCIA 3ZK7A 1MEEA 1JSZA 3C3KA 3HP1A 4KPUA 3L0BA 4B2PA 2XEDA 1FNNA 4J2OA 1EFUA 4FMBB 3DZKA 1U4SA 1MPTA 2C9MA 3OCVA 3NOQA 1KEZA 2GWRA 3CIOA 3ELYA 5AKYA 3UCXA 2WTUA 1CEYA 2N0SA 1S89A 1W6RA 4G5OA 2YW9A 1EDEA 3MCAA 4GS5A 3GDFA 1Z8FA 4AN1A 3RVQA 4KE9A 4R2IA 1E58A 3VYRB 1AG9A 2H1RA 5HQ3A 2VJMB 2WUEA 3GPBA 5HGXA 5AW3A 1V7ZA 1JFVA 1E2UA 3STVA 4BX3A 1RHRA 3CZ5A 4FOPA 3ZGNA 5EKSA 3EYAA 2QMZA 1QRRA 1WXGA 2I0FA 1VXRA 4U8GA 2JS7A 3E4CA 4OM7A 5K0TA 2X2PA 2O8CB 2QL5A 1F6DA 1HFJA 2PVSA 4GMHA 4KVAA 4AROA 3I9FA 4YR7A 5GIPE 3OF5A 5DXJA 5CXQA 2P3QA 2ZYIA 3AVPA 3BG5A 3E22B 4MCHA 2C54A 3RJ5A 3VVMA 1SNYA 2I4NA 3CTPA 2GZ1A 3EXHA 2OXCA 3PGJA 4QDZA 3HB0A 4R7GA 4MXDA 1E2FA 1GHTA 3OIVA 4FMDF 3I1FA 3Q7IA 1RIFA 5KX5B 1FVXA 2VBCA 4HLUC 4ZODA 4BX8A 4GYKA 3QPWA 4G36A 4RXUA 4ZCQA 1HZZC 4HO1X 4DV1B 1QHHA 1NOJA 1UDCA 1Y3BE 2QZSA 3B1VA 3UQYS 4C2AA 3RH0A 2L69A 4CIXA 4XCVA 1H2EA 1W85A 2BCEA 2G67A 4CM9A 4I19A 1K0UA 3W8FA 2CNKA 4TMTA 1VHLA 2ZJBA 4ITUA 4M8SA 3FA2A 4ILKA 3LPNA 3CJQA 4F06A 3FMIA 5IT4A 4YHHB 5JC1A 3KUUA 3DF9A 3KE8A 4O2LA 5HILA 4EG0A 4OIFA 3O2NA 2CVOA 3SG0A 2A30A 2OK8A 3AFOA 2PSDA 3DPSA 5EIFA 1KQNA 1CJMA 3WRXC 4E5UA 2IOQA 4DKJA 2CXOA 2OBBA 2JJ8A 5JDCA 3H8JA 1ACLA 2NNWB 4RCZA 3DVLA 2J30A 2QKYA 2RGNC 2C31A 3GFFA 2OFFA 2WTBA 2IUEA 3ENVA 3IBCA 2Y68A 3W6UA 2JKZA 1D6NA 3L06A 2P9EA 2VKTA 3D1VA 1G7TA 4LCBA 5TS2A 4F11A 5G4KA 2ZSKA 4JL8A 4TMVA 3RRMA 5CBKA 1A0OA 1AUPA 2GKSA 3GG2A 4U7FA 3NRBA 4ARZB 3BE6A 4NCJA 1AKWA 2Z30A 2YS7A 3NETA 1YBHA 1QTNA 4UASA 2H5JA 5AKZA 3H6KA 3DLTA 4WUTA 4Q3AA 1I4TD 2Z58A 1E0DA 1PJQA 1NVVQ 3P32A 4I0WB 4V0NA 3TNYA 4EQ6B 5LU8A 2REBA 4IP0A 3BZBA 8AT1A 3CVYA 1RRPA 4BE4A 4C22A 1X1CA 3AVYA 5KMGB 1T13A 3B51X 3X44A 5A62A 1H69A 5IABA 3A36A 2EL9A 2BE9A 4PICA 3ES9A 3C4QA 1LUAA 1ZD1A 2I34A 3VMMA 1QDLB 3OJCA 3NIBA 4NZZA 4PQRA 4RLFA 5EE5B 5C4GB 4DT1B 3KQOA 3K92A 3TL3A 1C30B 3HP7A 3WHPA 4B43A 4CCYA 3IAEA 1QH1B 3BMCA 1EVIA 1BA2A 4JYAB 5JJKA 1D1TA 1H9AA 4ZCRA 3QXHA 3N59A 4DRYA 1EFKA 3MLBA 4Q4AB 1JXMA 4FLEA 1URPA 2EDAA 3OZTA 2Z56A 3M3PA 5BO5A 1Q3HA 5JS2A 1YK1A 3E61A 3F5QA 3E6AA 4UFNA 1JKJB 3H2JA 3HVHA 5KQSA 3N2IA 4F4UA 1DMSA 1VRWA 3LDUA 4C3UA 3UJ9A 4R7ZA 2RBEA 4AY3A 4DLTA 2O8DB 4P3PA 1PF7E 5B57C 3SR3A 5THXA 5BN5B 1KEVA 2WAMA 3H3XA 3N74A 1ETHA 4KODA 5BN4B 4G0WA 4OKIA 1LV7A 4NV1A 1T8UA 2WAOA 1EM8B 1D1SA 2B7CA 2Y66A 4XB2A 3RLFA 2BE7A 3KJGA 3PQFA 5EKUA 1X7ZA 3O4VA 1SU4A 5GONB 4MI9A 4C0HA 3I72A 2DCMA 1HFEL 3PDUA 5EP3A 4P22A 3L7JA 4R5HA 1DAHA 4Q9IA 4WY8A 4EO7A 1D8TA 1TAQA 4CF5A 4EPXA 1JQJC 4QICA 2GVNA 3PEVA 4D3XA 2RAUA 3KTAA 2IYAA 1Y8ZA 1EUYA 1VYHA 1XDZA 1FDOA 4MHOA 1J0BA 2G7ZA 3EXG1 4E5VA 2CC2A 3ETEA 2IF2A 2C77A 4KFRA 3RUHA 3OF3A 2C5GA 4D82A 2GM5A 3T1TA 1I94B 1XD2B 3QWHA 3QOXA 1V1MA 2R48A 2ZLBA 1RM0A 1C4XA 2XWBF 3CVWA 3DYIA 3DFZA 1TMGE 5M29A 4OXXA 1ZJWA 1SG6A 1CUFA 5HQJA 1V3TA 2Q62A 1HURA 1WDWB 1PSZA 3USCS 3NTOA 3CPJB 3DXXA 2WQ7A 4Y9DA 1D1PA 5BOSB 5I47A 5KNBH 5G2OA 4I2VA 1F2UA 3VNBA 3R75A 3UJCA 4D3SA 1U6JA 1NSYA 2H0QA 3E3NA 4D81A 2FN3A 3D6TB 3R5XA 1OJ7A 3TRDA 4MWCA 2BGKA 5HP4A 1C7IA 3DCYA 2ODBA 1TK3A 3V2GA 4M89A 1ZJ6A 2X2OA 3KZKA 1QOPB 1O0CA 4P5EA 2QRZA 4J1TC 2BOVA 1GZSA 1MOSA 2B5WA 1CC1S 1DV1A 3AUYA 4ZQCB 3UHAA 5BSRA 3HBLA 4U9HS 3OFJA 4HNVA 4OA5A 3EZYA 1VJTA 2XOKA 1REQA 2C07A 3D6UA 1N3LA 1U11A 2A1UA 3QSGA 4EI7A 3AVVA 3H2ZA 3DHYA 3RVNA 4LVCA 2WG2A 1US8B 4HX9A 5F4ZA 1G1MA 5T6MA 4DQVA 1S8OA 4X62B 2J7PA 3WL6A 4BMYA 5CIQA 1ES9A 1E4VA 1P0IA 5MF6A 3CJRA 1FP7A 2GILA 1C8BA 2ATEA 4MGZR 3FNBA 3B1YA 3EZLA 3O94A 4I7EA 5EI5A 5H80A 3SHFA 3FMFA 3M4XA 5H1YA 3AQIA 1C29B 1XLWA 5TPWB 1G5FA 3C5HA 2ILVA 5AVRA 2MSNA 3NLLA 3TW8B 5DOVA 3PGMA 4U7PB 1Y5MA 1XROA 3HWWA 4FJ0A 2R8PA 1QHHB 2P2DA 4PYNA 3SQDA 3F47A 4R7TA 3ETHA 1YQDA 3HZOA 4X91A 2MDTA 1UP7A 1TB4A 4DV3B 1DHRA 2OKCA 3BA6A 1ZP6A 4HWSA 1AQYA 3OTGA 4JYCA 2MIIA 2MR5A 3VR5A 1W4CA 1E89A 2EX1A 4UOQA 2BHTA 3GL9A 3SIRA 1XDGA 3OEWA 5JXIA 3CE6A 4CQMD 4EYKA 3X1XA 1XQVA 4NATA 5CLLA 3HXOA 5A5EA 5B1HA 5CW1A 1CFJA 4HSEA 4WY2A 2H8KA 2HGZA 1K8QA 1M1ZA 2VNHA 4YRFA 3C24A 3JRNA 3DDZX 3COJA 1RHQA 2PZKA 3BB3A 4L15A 5EXTA 1A1VA 2FUKA 3RT1A 4L6AA 1K88A 2EZ8A 3ZU6A 3O91A 4ARUA 4N7JA 1EYZA 3FGZA 3L84A 1GQFA 5B3AA 4PBSA 1JJVA 1MHTA 1XZGA 2PUEA 2C20A 2Y76A 1ORVA 1M34A 4M37A 4NR0A 4XYEA 1E63A 3G17A 4RVUA 3TQFA 2FPGB 5AT1A 2HK9A 3M33A 1HT1E 3LD9A 4QU0A 4UXIA 3GNTA 4YI5A 3Q4GA 1GGJA 2PD4A 3SU8A 3RREA 1PGQA 1RM4A 4IR7A 3W5BA 4C4TA 3PFKA 3FNHA 5JIBA 4B2LA 1U8EA 4KQFA 4YHBA 4JJ6A 1WHTA 2XVZA 1UFRA 1P9LA 1GNPA 1Z22A 3AUJB 3AY0A 3T5MA 4I5IA 5CB4A 1OX6A 1NFQA 4C4RA 1DRWA 1L7EA 1RWQA 3F2IA 4FQ5A 2RHBA 1RHJA 1QF7A 3O95A 4L5JA 4RD6A 4TMFA 2VSXA 4M7WA 4V39A 4UCFA 4E21A 2OQIA 1OFHA 2JIOA 3CX7A 4IWNA 4REQB 5E7MA 4GKKB 3OFSA 1EE9A 3L04A 4RKYA 3S70A 1UAYA 1IL0A 3O5AA 2EVWX 3W7BA 4CT0A 1QH1A 3BMCB 1P3Y1 1P6UA 4ZO9A 4A8TA 2GRAA 1ULZA 3CUVA 2HADA 3VX4A 2I66A 3GVXA 2B98A 3K09C 1DT5A 3K72B 4OQFA 2V7WA 4BHTA 3A4TA 3ZWDA 3AEQA 3IKTA 2V7QA 3BGOS 1T4BA 2BW0A 2ZREA 4RD1A 1D8AA 2JJ1A 4WKPA 3OM1A 2C97A 1FYXA 4HNAB 2RGEA 3TJMA 2W6JA 2WJ4A 3CNHA 1FDIA 4LXGA 1GAXA 5T67A 4MPDA 3ODPA 4I66A 4L2IA 1GPJA 2N47A 2FF5A 3VPFA 4RJTA 1UKYA 3FLAA 4JGIA 4JIMA 3AUKA 1JJAA 1JZSA 2QLNA 2ADMA 3K71B 3HU5A 5TT1A 4FGUA 3PX2A 4RPKA 4PQGA 4UCXA 4V0SA 1OWMA 2OOSA 5TPZD 2OPHA 2ONKA 2PHZA 2R6HA 2WILA 1T1JA 3NH6A 4IBOA 1QFSA 4X60A 2V6FA 3NP9A 2O3QA 2XXAB 1L5OA 2WU1A 3W90A 5L3SB 4S0ZA 3OOSA 1EVJA 4FZ3A 1A8SA 2PKCA 4MKZA 2PZAA 3W2TA 4EHFA 4QSHA 3TUIC 3GJ6A 4J75A 1SIOA 4TXLA 3LLCA 5C5DA 4JXZA 2PM8A 1PZNA 4WZBB 3ZQUA 1IUNA 2BL4A 3L7OA 3LYAA 5ALSA 4EJSB 5BSFA 3KAPA 2DTDA 4V02A 1X1RA 5AOAA 1H2BA 3ZXUB 3GP3A 2PYDA 5EXPA 3BGSA 1NV8A 4HMQA 4H7KA 1PR9A 4NYMR 3C48A 2OZPA 1G5PA 1XZJA 3L0SA 2HKIA 5EAIA 1IWOA 3EFBA 3KZVA 4NBTA 1T8YA 1FF9A 1T5BA 2XCOA 3I34X 2HQ1A 3OBBA 4MHSA 1PW5A 2GB4A 4UHCA 1XZHA 2X6RA 3SYKA 3V3TA 4AS3A 1PDWA 3HKBA 4L27A 1FFGA 2E4UA 4COKA 5HK9A 3V4FA 2XA2A 1FU8A 2FQXA 1D2HA 5DYWA 4A0FA 2NZYA 4MP8A 3GLTA 3JVUA 2VUTA 5IM5A 1WB9A 4UBKA 1QO0D 3IAM1 3TLGB 4BBAA 2F1KA 4B34A 2HWXA 1QZXA 2Y93A 1LF5A 1K08A 3DEZA 5EQJB 2O2JA 4TTRA 4EKEA 3PR3A 2Z2XA 2VJPA 4Z7NB 2ANCA 1J8DA 4PNHA 3WNVA 3GQBB 1USVA 1OH8A 2QJWA 3EEBA 2A3RA 3QV1A 4QOSA 3N8GA 2BEUB 4EG7A 3BXPA 3E22A 1AN9A 3KAQA 4PLPA 3QKRA 2OESA 4JQCA 4WZAA 4XOIA 5HFJA 4Y6OA 2ZT6A 2PWAA 3GRUA 1BGXT 4GQBA 4BBJA 3KQSA 2JAXA 3SJUA 3U0VA 5CJ2A 1U0RA 3L0PA 3FM9A 5AQEA 1EM6A 3EY4A 1Z2PX 3GT7A 3EPLA 1U9IA 4OQYA 4DJAA 4UHEA 4EUNA 3EEFA 3LAWA 3O83A 5KPJA 4LNAA 1XMVA 5CH8A 2EKLA 3T7EA 2ZRHA 2CL0X 4KRYA 3DWEX 3A4YA 3CZPA 1N34B 4BZQA 1ID8A 4Q3LA 1AV7A 3MT7A 3HJUA 2OGUA 2M6KA 3GN1A 3UUEA 1ADYA 2KHZA 1X13A 5FJJA 4KREA 3IPLA 5EUCA 5AHRA 4M76B 3HUUA 1XEWX 5EWJB 3CLSC 3E1GA 3IAM6 4MI6A 3GD7A 4KPUB 4QTZA 3A2KA 1LDYA 2PUJA 2YY7A 4UHHA 5ETJA 2FPUA 2QN2A 2ZJ7A 4UHBA 5NULA 2GEDA 1BXKA 1ZD2P 1P2FA 1CY6A 3T7RA 1QQBA 4IJ5A 3DMTA 3VGJA 2JGFA 4DMLA 2VBGA 1NAIA 4H1VA 4EECA 5KTKA 2JFGA 1GA4A 5K3FB 1LJLA 5EJ9A 1UWCA 2F3UA 2WHQA 1VKNA 4IS3A 1R10A 1RBZA 4S2EA 9LDTA 3DEKA 4ZTZB 2H63A 2JGDB 2WIJA 4M98A 3UBMA 2GEBA 3H9CA 2W6IA 1B1AA 1YI8A 3ESQA 3LL4A 4HDRB 2B2NA 2INGX 1U4OA 2WA1A 1ML4A 3B8EA 4Z0HO 1UL1X 3JQAB 3F71A 4EMSA 5LLTA 1P0CA 3EF1A 4MW2A 3HTXA 1KDYA 3G2LA 2R96A 2JCBA 2IW1A 3O92A 2I9KA 3BL5A 3GUVA 3QWIA 4C4AA 2HQSA 5I9TA 1M34B 2B4RO 4Q3OA 1NXSA 3QWAA 3N6VA 4KDEA 2VYNA 5KZMB 1ZVVA 4BWGA 4ERNA 5JMTA 1YONA 4EFMA 4X8HA 5A06A 1X7WA 4WOBA 2VHYA 4CMAA 3QEOA 2YCLA 1ZJJA 2ICAA 1P4HA 1KEPA 3LFHA 5DX8A 1F8XA 2FW6A 3NV9A 2CEAA 4R9VA 4ZYLA 2Q2OA 5E6UA 2P9ZA 2B1RA 3VR4H 2ZW9A 2SNIE 3V8PA 3B36A 3I45A 4U7GA 2B34A 2C8VA 2Z2YA 2VJYA 3IERA 5U1PA 1VE5A 4MO2A 2VP2A 1EXVA 4YR9A 2OCLA 2G0TA 1VPDA 1D6SA 3IELA 1SUIA 4M8KA 1R8XA 2VNAA 3VZPA 3SC3A 1NVWQ 3ZS9A 1BYUA 4RHYA 4PLWA 1DJLA 3SQMA 2PUDA 2QMHA 4NARA 2C7GA 4HATA 3BD7A 2HTEA 4ZREA 2X86A 4TSFA 2BFPA 2AK3A 4LJ8A 1M7BA 2EC5A 2ZS9A 3RWMB 4EFNA 2ZIFA 4HDAA 3EAQA 4IEFB 3LUJA 1P72A 4DDMA 1PTJA 4C7BA 1M2OA 5EP1A 2Q6OA 5J2TB 3LHDA 4C43A 2VHCA 3ZJYA 4EPYA 3R7WB 2Q4TA 3O8QB 4TZTA 2GD2A 3DBLB 4A8PA 4FQ7A 4BFXA 4EI8A 2I7TA 3P27A 2Q1XA 4XFKA 1YJAA 1ECPA 2BHRA 2QZ9A 3EFEA 4HMPA 2JH3A 1FTYA 2HBZA 1ZNZA 3C39A 3L1IA 4MRSA 2WWHA 4C4PA 1QQ6A 2VJBA 4GYJA 1N1DA 5EG5A 5KKAA 3W6PA 1YS2X 5IKEA 2GCNA 1KZYC 2G07A 1VMAA 3GN2A 2ZETA 2GO7A 4RFVA 2XJ4A 5GZ3A 1P81A 2Y1OA 3IPAA 3MT9A 4C5BA 2QSJA 4FHGA 1SG9A 3ASUA 3I9V6 2PK3A 1XLUA 4X1OA 1PS8A 1PT5A 2JGEA 4MUBA 5C8ZA 1KEKA 1ATZA 1U9CA 2PX6A 1ODIA 3FCAA 3JAKA 4YV2A 2PUWA 2P9FA 4O0LA 1AO3A 1UPAA 1PK7A 4M49A 2G9RA 4GW3A 2QTVA 3QLTA 1QAQA 3NBFA 4LY0A 3ZWAA 2GK7A 3FTDA 3P2JA 4M99A 3T5PA 2YYYA 4HNQA 1PFYA 5C2JB 2HMSA 1NKSA 5KREA 5CB4F 2FGKA 2CUTA 1E7MA 2YV2A 3IDAA 5DSZA 1DQPA 1A2BA 1OBCA 1YZLA 3IT0A 3X3HA 2XB8A 2QTMA 1WCV1 1MO5A 3IDQA 1BNCA 1PKEA 4QM7A 4IO0A 2VPXA 4J03A 4FXOA 3AOEC 1R6AA 3GLKA 3H4IA 2UUCB 5F9MA 3UF0A 3TRKA 3FOBA 3REFA 2VRCA 4QBTA 5F9HA 1H2ZA 1OVMA 1SGWA 1UJ6A 1VSQA 2JZOA 3BN3A 3Q2OA 4RD3A 1TCCA 3EZ9A 3BEOA 2RFLA 2RHMA 1OYVA 4MV0A 4YO8A 5IBCA 4LF7B 3ZE7A 2XWPA 4HAWA 3KTOA 3O2SB 4A6DA 1T5HX 4QU9A 1Y6FA 3DL0A 1EHIA 3L6EA 3TZLA 4E33A 4F56A 3MINA 3R2JA 4INPA 4S1OA 4IMRA 3VOSA 1EJ6A 1QLJA 4GBED 3ZDXB 1E59A 4CQMB 4D1YA 4M1YA 3FOZA 4IV5A 1DLJA 4LK2A 2O5CA 3DAFA 1OA0A 5A7HA 1V6AA 1EZ4A 2ZSEA 4K9QA 1Y5IA 3HR4A 1Y3CE 3GDOA 3MTJA 1IZ9A 1JYSA 3FYDA 1OREA 3ZD9A 3VTAA 1JUDA 3DTVB 3JYHA 3QX3A 5C1DA 5CH3A 4LV8B 4C0LA 2CEKA 3PLAE 4EWLA 3TR0A 4ZYTA 3AR7A 3KQHA 5GV7A 2IUUA 1IN7A 5LWQA 2RE8A 3KXLA 1V2GA 3HXLA 4X6LA 1J70A 4L51A 2WJPA 4I14A 4U0KA 5A5VA 1ZD5A 3PYMA 4BP1A 3FOAA 3IQFA 4MYCA 1ZVQA 1HOTA 4QDJA 2J1LA 1YMUA 2X22A 3IAS6 4R3NA 2F8LA 4XJTA 1VBMA 3ZJ5A 1U02A 1UADA 3K05A 1SBYA 4IDEA 3TTTA 4EJ2A 1L8AA 5C5IA 2X15A 3SDSA 4MGYR 4O5OA 5ELXA 3MWYW 4JX8A 5ECDA 1DOZA 3R0IA 3GLIB 3O9MA 4OMFG 5FWXB 1G8GA 4QUBA 4YVFA 2DQZA 2P4UA 3FG9A 4YPOA 2I1VB 1OB2A 3V8QA 1RXVA 1II8B 2OCBA 3PE3A 2ISSD 1XZ8A 2C3PA 2IDJA 2NMVA 3P7MA 3HK2A 4PS1A 5K3BA 1MAVA 1B0ZA 1KZ7B 3AIKA 3PQ5A 4M3NA 1KFBB 1MHPA 2RHWA 1UBKS 3Q10A 1KI1A 1HSZA 3FGPA 1YB5A 1FS5A 1ZGBA 3IDFA 1FMFA 1JLHA 4LY9A 5LJIA 1L3CA 1L8XA 2JIRA 3N7AA 1OLUB 2QPTA 2QJRA 3PDIB 3OPYA 3RIGA 3TWOA 4AZTA 4URZR 3V8BA 5KDOA 3DL4A 3STWA 1E3EA 4JL6A 2YWDA 3LE8A 3CONA 3ZE1B 3AF3A 4TYQA 2EOAA 3KZNA 3PFHA 3OT1B 4KLAA 2GPWA 2YN4A 2REOA 3BS4A 1LBHA 1OWOA 1TYAE 4Y6RA 1JYEA 2D13A 1EQUA 1MABB 2O1WA 1T4DA 1XDWA 3H1FA 3PHHA 4TUYA 2Q5JA 3QQPA 2W6OA 4D9GA 4DJFC 1YJBA 4HGZA 3SVZA 3DFUA 3R6WA 1L4FA 1XRSB 3FLMA 4AJ2A 1PWXA 1G1AA 3PWTA 3FF4A 4JQOA 4YV1A 1DB3A 3ZI4A 3FFWA 4CKCA 4DLKA 4EMTA 4CEHA 2DR2A 4FUQA 2XE4A 2AZ4A 2NGRA 2ECOA 3NBMA 4V1CB 4U6NA 3NV7A 1H93A 2ZJ5A 5KWVA 2PBFA 1OT5A 4N7BA 1M8KA 2LWIA 4CM4A 4CR7A 1W8DA 2VHUA 3B5EA 3N86A 4AUEA 4E94A 1KJQA 4G4SP 4DW8A 4DIFA 2JBWA 2OCXA 2NPOA 4YRNA 3K70C 1Q0LA 2G5PA 1BMFA 1ZXLA 3EFHA 4XRRA 1N0IA 5DP2A 4N1AA 2C2OA 4CM3A 1FU7A 1PGNA 4ZVRA 5F52A 5ADWA 5CA1F 1MGPA 1ZJ4A 2V6MA 1F2TA 1J1ZA 2VOJA 3MOSA 4NH0A 4ENRA 1JIVA 4W7SA 4UVIA 2G25A 1KEEA 4I1UA 4IDGA 1QZUA 1PJSA 2B5OA 2H3HA 2H8GA 1ZA2A 3O0DA 4OMUA 2GN6A 4OL9A 1F9AA 3A0UA 1SULA 1NBME 3V1NA 5B37A 4BQEA 4LECA 3ONNA 4B4UA 4XGNA 3OF2A 2DWUA 1GL7A 2W58A 2FFBA 2NO6A 3FSRA 4CL2A 2CXXA 2W6ZA 3GLVA 3WDKA 3AFHA 2QVGA 3PFNA 4EEXA 5ICEA 3H2BA 4WLFA 4XIIA 3PU6A 4GL2A 1QQTA 2E3JA 1CQXA 4JY7A 4RZ2A 1APBA 5C32A 3HR8A 3PNOA 3UHOA 2PSSA 3O8BA 3TLMA 1J97A 1YASA 2OORC 4P34A 4RXTA 5SYNA 3V6MA 2A4KA 4I9HA 1L7MA 3PDJA 4JLVA 1NN5A 3AYZB 4YFYA 4DA9A 6ABPA 1UKAA 2C5EA 2WSBA 2FWPA 4Z9XA 2H48A 2QBYA 3DS8A 3CNEA 4C76A 1PEDA 2VP6A 2FSUA 4TXHA 4MV8A 2D4HA 3D0RA 2J9FB 3M8KA 4V1CA 3M0EA 4QUEA 2AVDA 1L5LA 1Y1KE 1M73E 3H11A 4MDHA 1C7ZA 1T24A 2OZEA 2QRUA 5KYYB 5I3CA 3VU3A 1L5FA 2Q29A 3QBTA 3RJTA 3VTKA 2IL1A 2P0YA 5AW9A 3V34A 3THXA 1U2QA 1OLOA 3GZJA 2EKZA 1RLJA 3HB5X 3NOOA 2VG8A 4BO7A 5EHIA 1CERA 5JZBA 2D7CA 1CR2A 1WZCA 5KTTA 4M36A 4QEZA 4EAAA 1VC2A 2NXCA 4KI7A 1N3IA 1Z37A 4QC2A 3RE1A 1QNLA 5K1ZA 2R6DA 2OV4A 4OEHA 1GZ3A 4YECA 3ZZTA 4QGHA 2XI4A 3AZOA 1UOPA 2NUAA 3AP3A 4Z3DA 2R00C 1H4TA 4HZUB 2FPSA 2Z9BA 2ZWMA 1S96A 4QX6A 1DG9A 2XWQA 4IIDA 2VF5X 4U7DA 3ZOZA 2ZVQX 4JJZA 2CHVA 1OLUA 1ZM9A 2PBZA 3QYJA 1JQLB 3RSCA 4EA8A 3LPLA 3NDIA 3JQ9A 4MMXB 3UMMA 1LSUA 2GHIA 2RJOA 1YQWA 3MCVA 3NONA 1QGYA 3QTBA 4IL5A 1FZQA 1L4GA 3RS9A 4ND7A 5EQFA 2N1BA 2D06A 3WAJA 1QFYA 3DHVA 5KYKA 1SXGA 1LRLA 3D59A 4X9XA 3HLTA 1PS0A 4LOKA 2O8EA 2AV6A 1II8A 2P77A 3G2KA 4I1YA 3HBJA 2HMTA 3RUAA 4DNFA 3MPUA 2IHJA 4AS2A 4WL0A 4D57A 4MQ5A 2NZVG 4GWKA 5FPTA 1A4IA 3STTA 1Q7GA 3K32A 3VJMA 1OR8A 1T0IA 1QG0A 3H19A 5JECA 1XL0A 1DIHA 2ZPAA 3DV2A 5KYGA 1ULAA 3IL2A 3TLJA 2E9SA 1SD5A 3OURA 7REQA 1IEQA 3ML1A 2AN3A 1G6HA 2X5OA 2IW3A 1EA5A 1PJ3A 1SU8A 2OV2A 3BL8A 1L4NA 3ND6A 5CVVA 1QGDA 2OE2A 4L72A 1P4SA 4OHBA 5TV2A 5LNK6 2PS0A 2CD7A 2D5LA 2WWRA 4EQZA 4F2WA 1WM1A 3C5EA 4X24A 4K2HA 3F6SA 5CM9C 1CUHA 1V37A 2ZYTX 1QAOA 5EE1A 5J4LA 1XKQA 2M1XA 1RI5A 1ZX1A 1U9YA 2RK6A 3MUEA 1T25A 3NNSA 4FDMA 5MGBA 2O0KA 2FU5C 1MP0A 1AKVA 2WFLA 4MVJD 3U31A 4DIOA 2GD0A 3ZHUA 1CIPA 3R3SA 4FSXA 1MW8X 2MINB 3DO5A 4JEHA 2VQ3A 1BHSA 5FL3A 1AHIA 1JIKA 1KFKB 3VR1A 3CH4B 2BF4A 3PRJA 3REOA 1Y7PA 2PV0A 5LU9A 3R7BA 1N2EA 4MPRA 2GLTA 3LDHA 2YMLA 4JJEA 4DIEA 5EOVA 2W11A 2OXIA 3GGPA 4KYVA 1N7IA 3TI9A 2CW5A 2JBAB 3W9YA 2CDCA 2ONZA 4B9EA 2QGNA 1RC8A 3BWXA 5HIJA 4BMPB 4I46A 1XOIA 3U7FB 3RYFB 1EP3B 1KRXA 5DLYA 1EXDA 2Y4OA 3PEUA 2XUFA 3HVRA 3JAMA 1ZXBA 3H2SA 4FE4A 4ID3A 5LBUA 2H5LA 1AK2A 3QH4A 4I9FA 2KLBA 4UD2A 2IFTA 1FUUA 3K0AB 2JRLA 3TVYA 1S7CA 4G1BA 4GMKA 1CW2B 2QYOA 4MAMA 2Q0SA 2GPSA 1P5RA 2PANA 2AWOA 2BMEA 4E4TA 2YNMC 2PJZA 3JZFA 2R0QC 1L4YA 3QVMA 4H7IA 4KQIA 1Q7RA 5CDUA 5EHZA 2BC9A 3TQRA 1SB9A 2UUOA 5A3JA 4K9SA 3SKYA 2W71A 2QXTA 1H65A 5AFSA 2O7VA 4G5YA 3AHIA 3P9RA 3ZDYB 5ER6A 5BYJA 1TD1A 2QY6A 5DXAA 5IJ9A 2GAAA 2ARKA 3IO5A 3Q9NA 1E2BA 1CY4A 2HREA 3HR7A 3PEEA 4M1EA 4R1LA 4EX7A 1QVAA 1HXHA 2G9UA 4I1OA 3N70A 4JUAA 4KWCA 4DILA 5BNFA 1KARA 1QLWA 2VWHA 3HV0A 3CB2A 4F46A 1TUBA 1Z06A 5GOTA 4GIBA 1R8QA 3IESA 2A58A 1GTJ1 1N2OA 4XUEA 3T5GA 3T1HB 2Q9UA 1T5SA 1HT0A 4CM6A 2IXBA 4JSYA 1Z4IA 9LDBA 5KNBA 3DLIA 2EF1A 3KOZA 4XX1A 1GPYA 3U81A 1K27A 3RRXA 4PHCA 2AC2A 2DQSA 5CIYA 3F5SA 3JPWA 4P35A 3HCBA 2WSLA 3E53A 2GPBA 2VNKA 2XMGA 4HDQB 4L4ZA 4N82A 2XR1A 4Z86A 3IRVA 1GQQA 1V1RA 2R8EA 3W3AH 2DHEA 3WNQA 3BD8A 2AN4A 2JLAA 3SN6A 4C6SA 4OAOA 3ICOA 1KMMA 4G41A 3ZD7A 3JARA 1WLSA 1EFPB 3DEJA 3JWPA 3C7TA 4AP5A 3ETGA 4PO9A 2G71A 5CLQA 1VFPA 4DY4A 4JU8A 3IBFA 3A6DA 3D4LA 3FPLA 4C89A 1GU0A 4UEKA 3L8EA 3MQFA 4M0KA 2TYSB 3F67A 4QYWA 3VSBA 5CVDA 2B82A 5K8VA 4DV7B 2QMYA 2WZQA 1JJ7A 3AB8A 3HBAA 3MMZA 3N07A 3V7YA 1TM3E 3ZHQA 1P45A 2YY6A 3GJ0A 4F5ZA 3U4HA 4LVUA 3V8NA 3NFYA 3CB4A 4OREX 5JH7B 1SBHA 1FUIA 1K97A 2YIJA 2ZYWX 3WWEA 1P61B 4Q4AA 5YASA 5BR4A 3V55A 4RULA 1SZPA 1W36C 5G02A 3UANA 3ZHOA 2QN3A 4F9TA 3PC4A 2XCSB 1DTWA 3GIWA 3Q3CA 1JALA 1R6XA 1C0LA 2E55A 3A6KA 3L7MA 1IWPB 1XZPA 2BVNA 3KLOA 4LCJA 3QP9A 1TM5E 3NUGA 4AKIA 1JILA 1ZISA 1A97A 2R8OA 2YXNA 4A5OA 2NTNA 2Q2QA 1DEXA 3EZ7A 3L6RA 2UXBB 1RYDA 4L4UA 1WE2A 4WESA 5DNVA 2J87A 1U8YA 3B20A 4D41A 1GG8A 1GITA 1XALA 1X39A 3HJFA 3SJBA 1WUHS 2ORED 1N5RA 3GDHA 3AJEA 4CEJA 1SVNA 2NACA 1OB5A 2A9PA 5KNCH 1S2IA 2NO7A 1Z08A 4AM8A 5D00A 4L7VA 1NQ5A 4YRIA 2AC4A 4OBXA 1JAXA 3AWDA 1YFLA 4JCCA 1RXUA 3AETA 3IB3A 2CNBA 1ICIA 3KR9A 1K7XB 1LK7A 1N5LA 3ESYA 5BV8A 3DH0A 3J7TA 5EIAA 4P0PB 3EGDB 1H2AS 3DVAB 3ND9A 5PGMA 4BN4A 5CA0F 5I7VA 3H0KA 3WA7A 4XVCA 1RLOA 2K7FA 1KL7A 5A7FA 3OFNA 3OU7A 1E3IA 4B2YA 1ZMRA 2OWDA 3BILA 3H1EA 4OU5A 1LK0A 1JLKA 2V8OA 1RRKA 1ZD3A 2BM9A 1FTQA 4FDUA 2Q3EA 5L4SA 1A8HA 1BJRE 4UM7A 3ZWXA 1Y7IA 1PX0A 2LKDA 4QBFA 1G7SA 3HABA 4UM8B 5CIWA 1H5NA 4ZC8A 3VC3A 3HP4A 2WJJA 4ABYA 5A4MS 2A0XA 1KIAA 4JUFA 1B42A 4EVSA 2SHKA 2VF8A 4MV4A 1GEEA 4QQKA 4X41A 4DXHA 1YE3A 3WV4A 4INAA 2HHCA 5EJFA 4PZ9A 2XBMA 5FUXA 3CLSD 3G5AA 3WA6A 3A28A 1L7NA 4D46A 4L02A 3DVAA 4B6PA 5FAKA 2DJ5A 1HWYA 5HKOA 4MEAA 2VSQA 2PEYA 2YXDA 3U7EB 3R3YA 2V74B 3T38A 2RHCA 3GCGA 4IEEA 5KHAA 1OW3B 3U7HB 2W90A 4JQSA 3INYA 2QN8A 2WV7A 2ZR8A 4WNAB 3SY8A 3TAHA 3VUFA 4DHWA 4JK3A 3CNNA 5ITZA 5KUTA 5EIEA 4DB4A 3SIWA 3U9TA 5L3SA 2QQ0A 5K6RA 2J4DA 1OZGA 2NVUA 1TK9A 1B2RA 2O48X 1U3VA 4YY3B 2QW1A 4MRMA 1J8MF 4N03A 3RK0A 3A1SA 1W34A 1NR1A 3IEVA 3CHYA 1MC4A 1E8DA 4FB5A 1VL0A 4YCBA 4F0JA 3PJGA 4RORA 3HLKA 4AKEA 1EXNA 1ODTC 2W83A 4QGFA 3U44A 1SVLA 2WMDA 2XGGA 3HVIA 4JB2A 1V8PA 2BHLA 2I6FA 2P69A 5K4GA 4Q3DA 3FB4A 4O1IA 1VLJA 1N6NA 2FFHA 2WPDD 4TUYF 1VL5A 3AI7A 1GPUA 3CX4A 4NNJA 1U8ZA 1R9GA 3AEQB 1FPQA 1KJZA 5CEFA 1VIDA 2BR3A 3HKCB 3SXUA 1TAUA 2YWBA 2EWVA 2PD3A 4E08A 5EWLA 2X3YA 3QUSA 2EEZA 2FW9A 3BQMB 3ESXA 4BV8A 3BGVA 4ZRDA 3QELB 4AQYB 4WFJA 2Q1YA 3REQA 1BDMA 1WPQA 5TRTA 3FPBA 3ICQB 2WM8A 2BT4A 3HDVA 1UMDA 2Q2VA 3C2QA 4XPIA 5KU7A 3TPFA 1CP3A 4FFBA 1HEIA 4JENA 3AJDA 5EPEA 5HRUA 4XUGB 1VPTA 3GBVA 4WH0A 4J8PA 2HJRA 3RBVA 1DRUA 4KGXA 4Q02A 4B4OA 4IVRA 3UK0A 4RTJA 1V1RB 4PQYA 2R25B 3JQFA 4WT7A 4RPIA 3DEIA 5ALOA 4ADSG 1CUIA 3DOCA 4RDXA 1RC1A 2P6MA 2XQFA 1N0WA 2CKMA 5BYKA 1XD9A 5M34A 3CVOA 4B6RA 1PE0A 5T7BA 4H77A 4FE7A 2QUJA 4RCYA 2GXQA 2GN0A 1UK7A 1ZWLA 4ZI7F 3A9SA 1QKJA 1VGRA 4XSHA 3WZLA 3WYBA 4D5GA 3WJ7A 3LRTA 1YQQA 2RH5A 1GFIA 4LSMA 3TCXB 3UV3A 3ZW8A 4Z7OB 1ENOA 1OFIA 1M3SA 4PR3A 3GEPA 2BEJA 2YZMA 4J6FA 5A0FA 2BBOA 5TGDA 4EYSA 2PMDA 2RCYA 3HBFA 5DW0A 1GV1A 4OATA 1RCTE 3O4GA 1LFDB 2JK1A 2QQGA 1TUGA 2ZP1A 4DEVA 1RZ3A 1W29A 1Y48E 2EFHB 4PPQA 2HEIA 3F7MA 4EELA 1XYGA 3EQ6A 4E5YA 1OXVA 2QQ5A 4UU1A 5CT8A 3S7ZA 2UYQA 3LU1A 4AZSA 4O5AA 2BMFA 3C4VA 5LYJB 3ZLBA 2JCGA 2QXUA 2ECFA 5KB3A 1PWYE 3EVGA 1JR3A 3PA6A 4MEBA 5J63A 3HN2A 5H02A 5CFQA 4NI5A 1RAFA 5M7EA 4DBLC 4OSEA 1CK4A 2BZ1A 3PNVA 2VT7A 3V7WA 4G4JA 3AGPA 1YB6A 3CBGA 5K2MA 2I7CA 5UKDA 5JFTA 4OYLA 3BOSA 4OLJA 1TQDA 1O03A 3BCRA 4L3OA 2GBLC 3DTYA 2I3BA 4LN1A 4R1MA 3IRUA 3DMYA 3CX6A 3D4NA 1BXRB 3NM4A 3RYFA 2ODWA 4Z4GA 2DLNA 3Q2KA 1SOAA 2R66A 3IXQA 1EWTA 1UBFA 3JALA 2REXB 1Z5ZA 1PJBA 1U7UA 4MUIA 2WJWA 2VWPA 1ENYA 1JDVA 2ODNA 1TAHA 4HFNA 3VO1A 1QE0A 2E4ZA 5GVSA 2IOYA 4K6GA 4EAQA 2A0FA 4JGBA 4HQOA 3DW3X 1BMTA 3GJ3A 3BE5A 1CY1A 1HOXA 3EGXA 3MNFA 3FKSA 1U5AA 2CNOA 4AB1A 1AKNA 1JTEA 4LA4A 1F1BA 1E7SA 3JD0A 5C9ZA 4YJ2A 1T3HA 1OLXB 3S27A 2GDZA 3DHEA 2IDZA 4E2FA 3SGLA 1GSOA 4J0CA 2HF2A 3TTSA 1YQEA 2VJAA 4GP6A 3RK4A 3LHKA 4POAA 4QNRA 2ESRA 3RYTC 4C1NA 1NXWA 2JLXA 4EY4A 1QHNA 1NX6A 1X8XA 2QUBA 2G8LA 3N0RA 1JLRA 4JXKA 2FWRA 3ZC3A 1RWKA 1SK8A 4PLYA 1I6MA 1OFUX 2ECKA 3IOMA 4PZLA 5H16A 1H42A 3UW1A 3V7UA 3ZDZB 4EB6A 4F3KA 2H06A 1P73A 3A3PA 2X0IA 4LPKA 3KQWA 3LVQE 1J4AA 1OFVA 4JVLA 5AM0A 1GZ4A 2Q5IA 3NM5A 1OZAA 3DPIA 4LOIA 1O8CA 2R1ZA 4GUAA 2QP9X 3CO5A 3ZS8A 3OCYA 4O25A 3U6BA 3L79A 3WIVA 5EHXA 5CDSA 1CQIA 4GI5A 4DL9A 2R4UA 3HYRA 3KXKA 4IX1A 1QOQB 5JDCC 2OR3A 3SHQA 4RTPA 1I3LA 1CHNA 2X1HA 2DZDA 3UO8B 5HIKA 5EZYB 2GCEA 2AKYA 3OH8A 3PX7A 2V58A 3KTAB 2WAYA 2ID4A 4RQUA 1UXJA 2NT4A 6REQA 4MQFA 5TXGA 2A88A 4R1NA 3K6SB 2OQVA 3QVTA 1J2RA 1R6TA 3HWX1 2ZI3A 5FB3A 4WOCA 3TIXB 3U3MA 3AMVA 2AE1A 1ZCFA 1FUEA 2B6NA 2C9OA 2G09A 2LDBA 3L93A 3OIYA 4HWKA 1SD1A 4NYIR 3LRPA 1YRAA 2XMPA 4MMYB 5A4FS 1WCIA 2A9JA 2G77B 2AI2A 1K4YA 3E23A 5BN3B 3N8KA 3GK3A 4Z4QA 4UULA 4L0DA 1RMQA 2C3UA 4DCOA 3CF4A 4CZ2A 5COBA 1NOKA 3K31A 4PONA 3ZBPA 5KHOC 1Y4UA 4S04A 2AFVA 4R9SA 5LZ7A 3OFVA 1NURA 4RL6A 1P4AA 3VISA 4BO5A 1JPNA 3ZEIA 3I05A 1RLIA 4IIUA 1G21E 4YYZA 1BROA 1VHWA 1XCJA 3DBOB 2YWXA 1QIKA 3JAKB 1JSXA 4UHDA 3IQXA 2G9QA 2ZSAA 3A11A 3DKKA 5AYVA 1RJ9A 3SPXA 1SCNE 2C29D 5EYPA 3AUXA 5K01A 3J7AC 1XEAA 5LP1A 2X4DA 3MD9A 5E3JA 2VDWA 3ONWA 1HTTA 1UBMS 2J9FA 2PL3A 2R5WA 2HB6A 3ETDA 2Q9AA 1T91A 3A4NA 3FHOA 3V1MA 1I33A 4RABA 2IS6A 3W2EA 5K6AC 2WKWA 2OBNA 2BGWA 2WG0A 1IDOA 3RFCA 1HTWA 1O94A 3GCXA 4Q1VA 4TTJA 3BREA 4XVRA 4Y3UA 5BN4A 4HXFB 3A1VA 1BCSA 3TECE 1EP1B 1NVAA 1OLSA 1Q3KA 3NVDA 4NEHB 5G1PA 4RH1A 3JYOA 3CF6R 5TQVA 3B60A 3G5MA 3B9QA 2YWCA 4QASA 2DTXA 4KQJA 1KJNA 1JLLA 2C98A 2HY7A 2P0AA 4UARA 4JUDX 1DAEA 5ECYA 2WYUA 3SKVA 4BNXA 4O4LF 4CKEA 2L19A 5BW8A 5LKAA 2JLZA 2VHTA 3MM4A 4TKMA 1EWKA 3KV1A 4KO8A 1ZHOA 1YZHA 3TW8A 5E8JA 3V80A 3NHKA 1KU6A 3KR0A 4ZVVA 2JJ2A 4RY2A 3VC7A 3KXDA 3I5UA 3CX3A 4FS3A 5SZKB 3PQ7A 3N2GA 3THRA 5BN3A 3SNHA 1UIMA 4L76A 1U1EA 4MQBA 4J0KA 4TWRA 2O14A 3ZE6A 2ZM6B 4RD0A 4UNPA 5B3KA 1IZ8A 3BDVA 4H1WA 2GUGA 3E82A 1DDIA 1NF2A 5EEGA 1RPJA 4BFLA 2VAPA 3EXEA 1IC6A 3JD4A 3K1TA 2JGMA 2M1ZA 2PR2A 2RBGA 2VJDA 2Y1LA 3I3OA 4JASB 4N5IX 4XGKA 2F59A 4FD2A 1U7TA 4HWTA 3DBVO 3G1WA 4UBMA 3RS5A 1V7CA 2QRKA 4LTNA 1M74A 2YMMA 4A27A 4D8VA 3EF3A 2O5EA 3U80A 1QGUA 3GLQA 4B3JA 1QIFA 3B38A 4URYR 1YTLA 3BTOA 3KTFA 2AX3A 4JBNA 4CL3A 2J0EA 4EMBA 1XIVA 1C9NA 1EFCA 2VUIB 3LKDA 5IZCA 1ULBA 2Y1GA 3SIPA 4CETA 4BUZA 3BMOA 5HKKA 2IELA 5TVGA 2VYVD 1IWBB 1AKTA 2ADFA 3VZBA 1PVVA 1GU1A 2M2IA 3CBQA 4RD4A 4XYMA 3GOHA 3U9SA 2ZZNA 1IZZA 2P9GA 5E2BA 3FTNA 2BZ0A 4Q93A 1DJQA 4R3UC 2AOUA 4BBZA 3PE4A 1O5OA 1XXHB 3BGWA 1HDCA 2G08A 2PAAA 3Q7EA 1I1NA 3MTBA 4M83A 1LTQA 4XWTA 5D3MB 4Q4JA 1ZUNA 3ZQKA 4UNRA 1NG9A 1VKZA 1M75A 4M46A 3RT9A 3TDKA 4G5QA 4NU5A 3CW9A 5HF8A 3K5HA 2BRUC 5CTJA 3RYHB 4E88A 5ES4B 5C18A 2HV8A 3GCDA 4M87A 3SE7A 4NFYA 1N75A 1HYBA 3OKAA 1R5BA 5ERXA 5DHSA 1TZMA 4R2KA 4FR5A 4YK7A 5EMNA 2DAPA 2J3HA 2HCBA 3HJRA 4WXHA 2MT9A 4XWYA 4D8WA 4U2GA 3UUFA 3UWOA 3T9FA 2BIFA 3VR4A 4BGDA 3H86A 5H9WA 1BDHA 1NUUA 4JLDA 3WWZA 4RK5A 4CLXA 1BWQA 1Q6ZA 4LUCA 3DOUA 3SSNA 5JJCA 4UTNA 2H4XA 1G42A 2NU7B 3HNRA 4R1PA 3B3AA 2ZBRA 5LP6A 4CPDA 2O7SA 3IV7A 1OVGA 5FWXA 1WU8A 1JJBA 3D8TA 1XRQA 1V3QE 3FSGD 5DNDA 3VAAA 4UPEA 1CR6A 3OZWA 4CKCB 1V3VA 4GMXA 1RZRD 2RARA 4Q4HB 5HF5A 3S5JA 1D07A 3FFAA 4HEA1 1JLMA 1SEPA 4XZ3A 2X42A 3E3OA 2W2OA 3R8XA 4F04A 4I4NA 1EK0A 4KMOA 3TIIA 1W4AA 3PS9A 4DLYA 1WHSB 5CCXA 1G20B 3DMFA 2AGVA 1KF0A 1TIBA 3HJHA 1YR8A 2XKBA 4HRAA 4IFIA 1I13A 2FPIA 4U6QA 4ZJZA 1X7ZB 3H5IA 1IBLB 1Y8CA 2C2BA 1YF3A 1ISFA 2VATA 3SYLA 1GPDG 2KE5A 4OKSA 4AJ9A 2X9QA 1TL7C 4TXMA 2VRWA 2X7JA 4BVFA 3THWB 1MJGM 2D5CA 2PEZA 3CLTD 4LTDA 3VA7A 1Z15A 3OWOA 2WG1A 4IRUB 2VAWA 2Z0MA 4JN6B 1T9HA 3EZ6A 1LCIA 2GF2A 4G0QA 1U3FA 1D2MA 2WINI 1FFHA 1I7QB 1Q6YA 4DYVA 2XE6A 1PN3A 4B9AA 1XXLA 4P4UA 2BGIA 5AUOB 2BDEA 1OYWA 3AUTA 1EVLA 1R9JA 2FLWA 2G36A 3GGCA 1XTSA 4ZYXA 4ENPA 3U39A 4D0LB 3NBAA 4BQQA 5ECGC 5CDHA 4BXOB 1GN8A 5TR9A 5KYUB 3QE9Y 2G3YA 4WZBA 2HFKA 5KNCA 4ZT2A 1GQRA 4JKIA 3BHJA 3U1BA 3CKMA 3QU2A 5EPUA 4AJIA 4GQAA 1Z5VA 3PXCX 2NZ2A 5HTKA 3SWWA 1HYEA 4WAUA 1TQ8A 2DKOA 2HV9A 4MAFA 3FI0A 3QI7A 4DV2B 4RE5A 1OAOC 2A4MA 4DGQA 3BWVA 3NJRA 1WY7A 2C7QA 2X40A 1RM3A 3T0IA 5JMWA 5KQGA 1BH6A 2O57A 2BGMA 1RP7A 3OC0A 4WUVA 5TQ2A 1GG2A 4EY5A 1JR6A 1KC3A 3RS7A 2CYCA 4QWMA 1GNSA 2K6GA 4MKRA 4KW7A 5KYXA 1QHSA 3EULA 5EWMA 3KJXA 1R9NA 3DGFC 3C4JA 2V0NA 3JY6A 1YOVB 2XSZA 1MVNA 2PJUA 2HIMA 5CYPA 2IYTA 2H1LA 4RSHA 2W48A 4E6EA 1T8PA 3TI7A 4ZTUB 3PFBA 4I8DA 4W5OA 5D01A 5KWIA 4BYGA 1KVUA 4PF1A 3HY4A 4U2KA 3T3MB 2PCLA 3V4OA 2Y8EA 1EHCA 1XRRA 4ND3A 4NL4H 4BZPA 4CT4B 1WSAA 1DX6A 2WAXA 3NT2A 3NALA 2ZFUA 4HVCA 4ZHQB 4BBPA 1OAOA 5IZ4A 3EG5A 3X1YA 1KYQA 4J1TA 4E11A 4WBNF 5AESA 4HN2A 4I9UA 4MARA 3T5DA 2AHRA 2GEFA 2WT9A 4PG6A 2HU2A 3WGIA 1NXPA 3G6KA 3FYTA 1B3BA 1KEUA 1MFZA 1E9SA 1R0LA 2PKXA 1NULA 1G41A 1SXJB 3BRSA 3BXZA 1SHTX 3E8SA 1Q1BA 1QDEA 4JLKA 3UUGA 1FX1A 3OZBA 1EX9A 3H9JA 3CR8A 3COPA 3HYNA 1N2CB 1UT5A 3W3AA 2L2QA 4K7JA 2H59A 1X1EA 1NT2A 2VYFA 1UWVA 1AUQA 1PYOA 2PGLA 3A37A 5AH0A 3WIBA 2FFJA 1UP6A 3INTA 4MWOA 4H31A 1C4KA 1RAGA 2PRJA 4BWVA 1IXSB 3U0BA 1M2EA 5KQPA 2RHOA 4J0FA 1CF9A 1GSHA 2RB5A 1TEXA 3NYWA 1WW2A 1ABFA 4US0R 3U4IA 3R3WA 3RT7A 3GMSA 4CBVA 3CT6A 3F98A 5FJIA 2FFQA 4MGHA 2DH5A 5DTEA 1U0BB 2UYYA 4BN5A 2FOIA 1EWYA 1PZEA 2IOFA 2JFWA 3IUQA 3M82A 3ZJTA 3I01M 3GARA 3AF5A 4E1BA 4MQUA 2EQAA 3LP6A 3KSUA 1U0SY 3FHTA 4A2WA 4AKHA 1CF2O 4HH0A 5HFAA 1E0AA 4MLCA 1QE3A 4WMLA 4B6OA 2ZJ1A 4J29A 4GX1A 4XWGA 4NMLA 2ZRLA 2JI6A 3MTIA 1T5OA 4WNYA 1G59A 2RKWA 1OGIA 1R3DA 1UBLS 1UZNA 1UMBA 4WJZA 2FZKA 3DAYA 3FJOA 5HNKA 4HKTA 4CWAA 1XRLA 1KS9A 1QJCA 4KHPB 1JMYA 5EFOA 4DV5B 4R1OA 5G0WA 1M6HA 3MBIA 3B1FA 3D1LA 3OM0A 3NRJA 4JR0A 4MR9A 5DM2A 4DMRA 2QR3A 3EOBI 5J47A 1V43A 3QRWA 1OCEA 1UQTA 2Z4RA 3B1WA 3TRHA 1L7XA 1UQUA 2VJLA 1KYVA 1NVXQ 3UUWA 5B7QA 2DFLA 1WMAA 1RZRA 1OKKD 3EMBA 3BBPA 3PQ4A 1L5QA 1SBIA 1KK1A 3A0RB 4U9IS 1O08A 4XEUA 4CV0A 4E2YA 1ZK2A 4KQHA 5JZSA 2OKGA 3IPXA 5FUYA 2Y9MB 3VKWA 3G2JA 3L43A 1TGYA 3FPSA 5DBEX 5C52B 5EGNA 2ZZKA 5G1NA 3RPEA 3SF8A 3IP5A 2CVZA 1E9DA 2VTVA 4U2EA 4NESA 1NPTO 1WLYA 5JZMA 3MS4A 2EP7A 1I3KA 2WHEA 1JEYA 1BQ4A 1D5WA 2P7HA 2YN2A 1Q83A 1N77A 5F9FA 2XMZA 2O52A 1PTKA 5BV2P 4CU2A 5ER9A 2KBEA 1QYDA 2VAXA 3NTQA 2NOAA 2JFXA 4PCVA 3F7NA 8MHTA 1HRDA 2BJVA 2OCAA 3WQRA 4RO0A 1PHPA 1W1WA 3EXIB 4FK8A 5A0VA 3BXEA 3QKTA 1EQ2A 2DETA 4ID9A 4U6SA 2H0AA 3IFSA 4RE6A 2A9FA 3BIXA 2NU8A 3D64A 3BJIC 3PICA 3RAPR 4W5WA 4B71A 5G4LA 1RI2A 2ZB2A 3O8CA 1U3WA 4Q21A 3VR5H 2OBXA 3GJXC 3KNZA 1KDVA 1SQ6A 3QEAZ 2QLLA 4ND4A 1L9XA 2WQ6A 4L22A 3I5MA 1A3CA 3T7TA 2I3ZA 4EG6A 2AFIA 2OHFA 1AS2A 2CFCA 1KNQA 3EYWA 3ZCPA 3GMDA 1HL7A 1S6YA 3M2PA 5I9NA 1Y4SA 1MKYA 2FEMA 1XD2A 1E6MA 2BH9A 2CLLB 3C3XA 3HKEA 1W30A 1M0WA 1QCZA 3KJFA 4IIYA 2CXQA 2WJIA 3RS0A 2X5JO 2YKGA 1GD1O 2GH1A 1Z4NA 2F9FA 4ETMA 3LLMA 5KS2A 1WULS 1NW9B 3PEFA 2W22A 3DG9A 5FTKA 2AB0A 2EBUA 4KAJA 4V0QA 1H4SA 2WHPA 1JI0A 1JXOA 2EXXA 5A7GA 3F2VA 1PFKA 4IQFA 4BATA 4RNCA 1ESMA 1AKUA 1O94D 1DBWA 1IULA 1K7CA 2V7VA 4U7HA 3BH7A 3WLKX 3OLWA 4J07A 1FSZA 3L1VA 3BJEA 3UHFA 2APJA 3C41J 2Z2KA 3EG9B 4M1WA 3SHTA 3AFIA 5A5DA 4ZTBA 1U1GA 2PIAA 2WVHA 3ZGOA 1MG5A 2ZXFA 1FP4A 2GZ2A 1M2FA 4RBNA 4ECEA 3P2EA 4M2LA 4EZIA 2WYIA 3HHPA 4D4LA 1ZM2A 4DFDA 5U9CA 3OVMA 2HM7A 4U3JA 5JQGB 4DE5A 4HLCA 1JH8A 1F8YA 3EZNA 3HU3A 4V0MA 4CEIA 3GRKA 3KJNA 1Z0ZA 4CQLB 1IJFA 1IHUA 5L9AA 4LMPA 2D3WA 2PSFA 3QXCA 5K0GA 1BC5A 3HJCA 5I8ZA 2ZBFA 2ZCVA 4YRTA 5JCXA 3UY4A 1OTXA 2O5VA 3K0AA 2XHEA 5IKPA 3GZNA 3D3KA 3B2EA 4GRAA 4LDQA 3ZIUA 4XI9A 4WSOA 1JHRA 2QN1A 3OHMA 4C0KA 4ZO6A 4ISCA 3ILXA 4B47A 1X6VA 1TMYA 5ALVA 3GEIA 5KVVA 1CUGA 1LB1B 4G9EA 3TM4A 2CNDA 3EVAA 2OHIA 3PC6A 4EHHA 2XNHA 1SIBE 1R0RE 1SHKA 5TJHA 4GQIA 3P4YA 1Z4OA 3DZFA 4BO3A 3O2QB 3Q12A 4MV5A 4JD5A 5DH9A 4N6GA 5KOJA 2QTAA 3WLEA 2IWRA 2YV3A 4E51A 2DT5A 1F4PA 1B8PA 1S3SA 2H9AA 2P3SA 4UUBA 4QOIA 2V45A 3LCVB 1IUOA 1BOFA 2QX7A 4G8CA 3UYLA 2DU8A 5JOQA 1QHYA 4FFSA 3UYKA 4EGJA 1XNJA 2AF4C 3CZQA 4HGQA 3W3ZB 4UBLA 4Q7QA 2VXYA 1Z5GA 4KV7A 2V9CA 5BQFA 1Q22A 1QAMA 3U5ZB 2KMLA 1NQWA 4UPDA 3M4ZA 5LA6A 4DA0A 5GJCA 4YXWD 3A6EA 3PUHA 4UOEA 1J5XA 3O03A 4BS9A 2WWGA 3EGEA 4EB6B 4PY2A 4BVEA 3EXFB 3BJMA 2JAPA 3STUA 2VHWA 2FY8A 3KOXA 1V5IA 3L7YA 3M6XA 4NENB 2J3EA 3AU9A 2VCHA 3NTXA 1N6HA 4PZ0A 2GO1A 4RJIA 1NMZA