3HB0A

Structure of edeya2 complexed with bef3
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
274
structure length
259
Chain Sequence
SHMERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of ED-Eya2: insight into dual roles as a protein tyrosine phosphatase and a transcription factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Eyes absent homolog 2 (Drosophila)
total genus 97
structure length 259
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2009-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hb0A00
3HB1A 3HB0A 4EGCB 3GEBA
chains in the Genus database with same CATH superfamily
1H8EA 2BSAA 3AR6A 1CF4A 2RARA 3GFFA 4QODA 1R4MB 3A6GA 4XPIB 3IEXA 1QGED 3ZXSA 4BNGA 1Z2DA 3QBDA 4MWZA 2GF9A 2FDCA 2NUAA 4PZDA 2J5XA 4DLKA 1GL7A 3QMPA 1L5KA 3ZI0A 1VBFA 3W6ZA 3OZIA 1YRWA 4QFDA 4ALMA 2IQIA 4CMEA 1IPFA 1IWPB 3I39X 1RIIA 4OCZA 1LS6A 1ND5A 2IEGA 1QHSA 5L7WA 1UKZA 4IPTA 3A4IA 3IKLA 5G3ZA 3VQTA 3T7IA 2FX2A 4KO8A 1UDAA 5TR9A 2V7GA 4OOEA 4IQ4A 5FR1A 3B3QA 4H59A 3JX9A 1V0JA 2FZVA 2WRZA 3BCUA 1SRQA 4FX5A 4Y9TA 4QTYA 1YFJA 3GEBA 4U0JA 4Z2YA 3EWIA 4P3NA 2VKQA 1XNJA 2IPOA 2WW8A 1U5CA 3A14A 3TS1A 4ZOBA 1T8UA 4P82A 2Q9AA 1FYFA 4TLEA 1KQOA 3CSDA 1COWA 1H5UA 1AX9A 4TM7A 4DWOA 4E22A 3T6KA 1RRGA 1PT7A 2B21A 1USKA 3AEKB 1HOXA 4RDIA 3T61A 3WLIA 3WLKX 4B7UA 4YREA 1R0ZA 1PR3A 4JOBA 2VJNA 1O96A 1S2DA 1A69A 2NPIA 4INPA 4M1YA 4WK0B 1I6KA 1QV9A 3ADPA 4HYTA 2ZWAA 1F2UB 2I8CA 4IIJA 4LRSB 2JHGA 3E9YA 4WTOA 4ZCPA 4CM3A 4JMPA 1Z0IA 4TL7A 3QWIA 3O38A 5HKKD 1WXXA 3BDIA 3DMYA 1OFUX 2IYNA 3LUDA 4IIVA 2N75A 4N0EA 3E5NA 3HZHA 7GPBA 2UUBB 1SKYB 2VWHA 1I30A 3TTWA 4EG3A 1P2TA 2DSNA 2P4HX 1HYEA 3A6EA 4HVTA 4G0VA 2O2YA 2YJNA 5DTEA 4QREA 5BSMA 5BN4B 3AYXB 3DCNA 3LYUA 3V7UA 2PEYA 5FUYA 4MO9A 4JI6B 2A1UA 2H57A 2IOYA 4NZOA 5I9MA 4A10A 1LBHA 4BY9E 4G0WA 2FXIA 1MPTA 4OQQA 2VPQA 5CJ2A 4YPOA 4Z7QB 2RI0A 4A0GA 1ZWLA 2W71A 1RRKA 1EKXA 5A4MS 1XZQA 2XQVA 1JWBB 3LDFA 1FDOA 3N3BC 4LFBB 1NNSA 1KZ1A 4AUMA 4RLFA 2CYBA 3G59A 1YCGA 4ENSA 4KAAA 1YJAA 4YP9A 5BNFA 3AVPA 1BX0A 3V4LA 3BS4A 5FHQA 4BQRA 4CQMD 4B3FX 4PIMA 1IEVA 1XTZA 4G24A 1RW4A 2CUZA 5DW0A 5E4TA 4U02A 4JI8B 1YK0A 3OT5A 3WL5A 3ZVRA 1P39A 2VTKA 1L5FA 3CUWA 4PC2A 2X9GA 1UXOA 1BFDA 2VYCA 2XT6A 3COSA 1EFPB 1EUDA 2JLCA 1WJGA 5KAPA 3X1YA 4AZ3A 1ZXLA 3EQ6A 2D1RA 4B3HA 2BFAA 4P0TA 4B3TB 2OM2A 3K9QO 1LLDA 2H1LA 5DNDA 1JDJA 3PKIA 4RMGA 1KEEB 1DOHA 3TTUA 5IZCC 5K6AC 5L4LA 2HQOA 2JLRA 4G2NA 3UPTA 3TXXA 5F78A 2Q62A 1UJ5A 4BU0A 1S6YA 1CF2O 2JL1A 2LXNA 1Q6ZA 4ZJYA 3SFZA 4WKNA 3VO1A 1ZCFA 2YVAA 4QWMA 5A0TA 3LXUX 4MH0R 1SFRA 3H99A 2YQ5A 4GDFA 1R9JA 1W0CA 2OTCA 4OLJA 5BMVF 4XJSA 4E4RA 1T35A 3OQ1A 1ZGHA 4ZCLA 1NOJA 4O4LF 1TW2A 4PAOA 3EG9B 3NDPA 4JLVA 5LOVF 2CSUA 5KTYA 4BGVA 3PEUA 4MCHA 1W1IA 4D8XA 4JVOA 4YUZA 4D0RA 4BP8A 1Q6YA 1U0NA 4C0LA 3TRJA 3C0KA 3NVAA 2UXCB 3KOMA 3QEMB 4HWTA 1EDDA 4PGHA 2K2QB 3H17A 1FUIA 1QB8A 3FNEA 3JARB 1MORA 1SD1A 2FOXA 1NXSA 2OQVA 4YCBA 1L5YA 1A9SA 3HJHA 4MA0A 4QHTA 4KXUA 4MDFA 3KXIA 4TOIA 3FUCA 1UQUA 4JLSA 4ND6A 4QQFA 5D3MA 5CVUA 1OLSB 2AUNA 2ZYDA 1Z75A 3HI4A 2PQ0A 3HY4A 1E9DA 1NGSA 1NOIA 2JFFA 1U8CB 2OEPA 4MINA 4QJBA 3ER8A 1FLNA 3RTEA 3H2BA 1Q7RA 3EF1A 1Z7YA 4D41A 5JCOC 2I1WA 2YXEA 2ZDHA 4IAOA 2B5OA 3KVRA 4PLZA 5T57A 4TVOA 5HKLA 1AMOA 1ISSA 3ADDA 2XGSA 1AN9A 2WSLA 4HV4A 1CZNA 1NJ1A 4L4ZA 3JU3A 1Y8RB 4IDQA 5KQPA 4FUTA 4LQCA 7ABPA 2HF8A 3KVYA 1J39A 1JBEA 5HIIA 4FYWA 2FHSA 3O2JA 4O0MA 4P4UA 1H1LA 1IDN1 1F17A 5DHPA 5E4YA 5LA6F 3RHFA 4ZI3A 5IDWA 4TMXA 3LHSA 3CX3A 1N5RA 2GKOA 5COAA 3AG6A 4DLWA 5C7OO 5E7IA 2AW3A 4L8LA 4TWJA 1T2AA 4GT1A 5TGTA 1NW4A 3ZWVA 3ZHUA 4ZP1A 3ZE1B 3B60A 1NVFA 3AJ8A 1L1QA 4BTEA 4Z1MA 3RSCA 1GV1A 4JJGA 2P77A 5K6RA 1XMQB 3EAFA 2OAEA 3FHJA 3I37X 5CM8B 3BSWA 4RK5A 3O1IC 1YL5A 5AHKA 5EI5A 1LI4A 5FPSA 3GA0A 3ZZ1A 1V8DA 4BNNA 3VUFA 1I8TA 1SC3A 3Q3IA 3O83A 4G65A 3NHAA 4IIXA 1UOPA 4MP3A 3O3MB 4X20B 3GGJA 5C8YB 1HDCA 3GG9A 4X6UA 4X8HA 1D0IA 3C3BA 3PNSA 3TMYA 4E7OA 1QG4A 2QN9A 4JKOA 5CB0A 3PNMA 1XTTA 2Y3IA 3O5AA 2FEXA 4A73A 4F8YA 5KX5A 1QUFA 3NWOA 3QH4A 4DSAA 1F14A 4A0SA 5F23A 5JZBA 4AB1A 4G4SP 4UXJA 2VJCA 3K1TA 2ONCA 5DXFA 5C1BA 3RRFA 1TF5A 2CKMA 1K6MA 1RQXA 1PP4A 3A8TA 5L53A 1CUJA 3EXIA 3MG9A 2PRSA 2I4TA 1SMKA 2GBPA 3SS8A 3DOIA 3AR8A 5JXWA 4CV0A 3EGWA 1EFTA 2R00C 1SC9A 2C77A 3NHRA 3VC1A 3T1OA 4U2CA 4ZXPA 1U2PA 2G8NA 3C3WA 3PPWA 4G85A 4IDEA 3LGSA 4WSOA 1R64A 2AZ4A 2C0QA 2Z1NA 3GF4A 4R1TA 3R20A 1Z0AA 4BX3A 1VL5A 1UMCB 1YQWA 3KXPA 4FGWA 4BP9A 3UUWA 4OBEA 4Q82A 3ZU6A 1F0PA 2J07A 2VSYA 2IYSA 2WKRA 3TTYA 4L0CA 4Y30A 3GN2A 1H0HA 3T8YA 5E3HA 5HZMA 3X1KA 5DH9A 4XIJA 1AB5A 4D4HA 4UPEA 1F4PA 1ZBQA 5DTQA 4RVGA 5G0UA 4WESA 4HB0A 2IV7A 1T2FA 1R0XA 1T2VA 3HLKA 5LZ7A 4IOKA 2QMHA 3OD5A 5KWJA 4US2R 1G9XA 2ZBPA 3OKCA 3TSZA 4F0JA 2YX1A 5FWDA 5GPBA 3E7PA 3ZCVA 2YWHA 2GEBA 2QQFA 3E61A 2A7XA 2PGXA 3WMFA 2F4NA 3JD0A 3PX3A 5EJEA 5AXBA 1TEXA 1WVGA 5EHZA 3ACDA 3AUKA 1QRAA 3WYFA 3EG5A 3ZWXA 2DHEA 3UK1A 4DA8A 2JFWA 2XTZA 3F71A 3HACA 1ISRA 4NY1A 3L18A 1DJQA 5AK4A 1PZEA 5D3QA 4XOUA 4EO7A 1M72A 4KUHA 3BMNA 1J2RA 2WPNA 3MLBA 3QVSA 4IGEA 1W25A 3VZSA 4EARA 1L5GB 1ZJWA 3O1LA 1FDWA 1Z37A 1LBIA 1KFEB 5BV8A 2IPXA 2Z5GA 1M6YA 1FFSA 2RHHA 3MPOA 2YIMA 3MWEA 5AKYA 3TR6A 1J0BA 2FPMA 3CEPB 1KO7A 2B61A 2V7PA 4AN4A 4COOA 5AFSA 1UXJA 4YFYA 5CLIA 1TEVA 3N58A 4CHGA 4Y67A 1WMAA 2AXEA 3JQGB 3PHCA 4UVGA 4KU4A 5FTJA 4EHLA 2JLWA 5AKIA 2QX4A 3LH5A 4JOSA 3GLHB 3RYFB 1K9SA 5L9AA 2P8SA 3EPPA 4ZZ2A 4DGSA 1XPRA 4PVDA 3FMIA 3QELA 4QO7A 3OQNA 4E2YA 1YDFA 1SPXA 4JP2A 4U9HS 4C6HA 4YRMA 1N2ZA 1OT3A 1QZXA 1Z8FA 1N5LA 2AJBA 1RFGE 1S9DA 3LP5A 4PFJA 2JCBA 1E2QA 4MGYR 4NCAA 4KTVE 5CA1B 2CHEA 4H0NA 1AOXA 2OHHA 4CMGA 2DEUA 1QXSA 3OY7A 2D59A 3QVOA 2PD3A 2X7JA 4JLOA 5LD2C 3TNJA 2HJ9A 2BMVA 4HVCA 1TXGA 4KC0A 4KGVA 3RVOA 3MJFA 4JBGA 4TRJA 4ZPXA 3D0OA 5BMOA 2OBLA 2JRLA 1LC0A 4BQNA 1WB6A 1A7UA 4BO4A 2WM9B 3H4VA 1XZHA 1AN0A 3NTUA 4H60A 2NP6A 2WWTA 1EVKA 4KXFB 4OFBA 4GVPA 3Q3EA 4V02A 4Y2UA 5IM5A 4YRLA 2OV2A 2WWVD 3RUCA 1DRKA 1LX6A 3CC8A 3VKWA 3AHFA 4KSCA 4EPYA 3ZK8A 3IPRA 1IJKA 1ORWA 2Z5LA 3I0MA 4IYRA 4E31A 2X5OA 3EXHB 4XIIA 1D1TA 3CLUC 1XMXA 2PLRA 2AZMA 3FRHA 1BIFA 2O5RA 3PTLA 1LNZA 2OMEA 3NYRA 2P11A 3QXXA 3IA2A 2UVDA 4G25A 1QVWA 1MB4A 2A8YA 3EA5A 2AR7A 2FUG1 2JAHA 2QZZA 3LC2O 3BE5A 1L4BA 1GFZA 4DLZA 1NJFA 4ENUA 3FKJA 1IRXA 2C82A 3LWBA 2X3UA 2KHZA 3IEUA 1L3CA 1QWOA 5DE3A 4H1HA 1I4DD 4CRWB 4MQ5A 2WYWA 4NPCA 1C29B 3HB5X 4ZZIA 4DL9A 1EJ0A 1XVVA 2CLSA 4V0QA 1M6HA 2NNLD 3PYXA 3FD8A 3TKLA 3H1BA 4QVGA 3VV3A 5CDFA 3ZHOA 1O5OA 1YZFA 3PENA 4OLAA 1Q92A 1E5QA 3AX6A 2CC2A 2PZEA 3SK0A 2W8BA 3QI7A 2WIDA 4LSWA 4E30A 1TFUA 1RYEA 4J75A 1YCHA 2HU2A 5FH9A 3QHQA 5IXYA 2QIPA 1YO6A 4RKRA 4L16A 1SUDA 4D3DA 3QBJA 3H5TA 4IEIA 3WKEA 3CUSA 3WLSA 2YYYA 3BCSA 4EJ6A 3F6SA 3K4PA 4V0NA 1EFRA 2N47A 3FYUA 5K3CA 4RK4A 1FS6A 3C5VA 1THMA 1LB1B 5K0JA 2Z8XA 1FPMA 4KSBA 3M3PA 2QR2A 2RAPA 4HG2A 3QVMA 5CT5A 3TFQA 1DNPA 3O8NA 4OHUA 2VKTA 5EWJB 1ONNA 1Q21A 2QZPA 2Q28A 2VNSA 3A3NA 3IV6A 4PXSA 5EPOA 2AN9A 3RYIB 1D1PA 1I10A 1DQNA 2EQAA 4HJXA 5M04A 1PJRA 1Y6ZA 1WLSA 4C4PA 3QU2A 5AO9A 1IMJA 1MAWA 3TDMA 4QYSA 3CMCO 3K1ZA 3QPCA 3CZ5A 4YUVA 4MLCA 4JFAA 3RT7A 4DLXA 5GIOE 1TQ8A 4F21A 3IAS1 4HDSA 5I5EA 2AI2A 3G88A 3UJ8A 4D3ZA 3EGDB 3RODA 4DOMA 1JZTA 1EX7A 3I92A 3SNKA 1WPGA 3DXFA 1YRHA 2J41A 4LWOA 4OSOA 4ZQIA 4R69A 5LYJB 5FOQA 5AVTA 3MC1A 4G37A 2OG1A 4JYBA 4Q48A 5D3ZA 3GBVA 1VG9B 3PVSA 4JA2A 4DPLA 3H83A 3KJEA 5WRFA 3U39A 4DUGA 5A1JA 1AGYA 3R3YA 3EDMA 1K9VF 4YJHA 1P9WA 4RW0A 5ADWA 2O06A 5DT9A 1FDTA 3RT1A 4H7DA 3FYCA 4I50B 3W04A 1OH5A 1EGAA 2Z1MA 1VE3A 2FWRA 3AB8A 3CLVA 3F7OA 2C00A 5TMDA 2XI4A 3RFCA 1Z6GA 5I4KA 1NR7A 4YHHB 1KJJA 1DEAA 2IOHA 4FYYA 3NOXA 2FN4A 3T1VA 2X7XA 1JEJA 5B64A 1QZTA 2IP2A 1UMBB 1AGRA 3JZFA 2WHPA 3Q9SA 1VOTA 4RVCA 1HDZA 2J6HA 3RVSA 3ZD6A 3UCFA 1FY2A 1KOFA 1ZIYA 1ODCA 2XE8A 3B8EA 4AN1A 2ADOA 2AKAB 3LXMA 2W48A 1ZOIA 5F2KA 3NBQA 3KU4A 5K5EA 1MQ8B 3B6ZA 3DJFA 3K09C 3R5XA 1KYVA 2I55A 2ZJ0A 4KIJA 2ZBQA 3OHMA 4KMOA 5J1TB 5D87A 1DBWA 3L4BA 1K2VN 4HWGA 4UCXA 4BU1A 3E1KA 3WNZA 5G0VA 3EC2A 4AZWA 5CDGA 2GESA 1BD4A 1R1DA 1RE0A 1PYDA 1XDGA 4MA4A 1F8YA 1V43A 1DMSA 2C9BA 2JLQA 1JU9A 1YS6A 4NJMA 2AK3A 4J3JA 2PVSA 2NU8A 5KI6A 4LMBA 2PKXA 2HPHA 3PVCA 1I1OA 3PCRB 4EEZA 4B85A 3LV8A 2OUKA 3O21A 1RT9A 3EXG2 3F67A 3RRNA 3QFHA 5KYNA 1FP4B 3NM5A 4ECEA 1EX1A 3HM9A 4CL0A 3JZDA 4GFDA 4E5SA 4MTLA 3K2QA 3U56A 2B8WA 1T6NA 4ZOLB 1K3FA 5B3LA 1IEWA 3T5TA 1CLUA 2WU0A 2P62A 2ZSHA 3LECA 3PPYA 4XPIA 5TVKA 1VBKA 4B7XA 5KMGB 1JEYA 3OHSX 1FCJA 1PFVA 1Z83A 3LK6A 4QFMA 3AVUA 4AYTA 1XVUA 1B6SA 1V5IA 3IIEA 3BJZA 3L7CA 4QQKA 4IDAA 1OAAA 5FOVA 4FQ7A 3ZE2B 3PPXA 1VGVA 5A05A 3DE0X 4AL4A 3GAZA 2PJDA 2QMYA 3IT3A 4HUTA 1JKMA 5A03A 2P5UA 3DEAA 3IE1A 1RSZA 3CPSA 2PYZA 1SCJA 2EFCB 4UBLA 4W8GA 5LNK1 3UWDA 3B85A 4BVLA 3IIKA 4DXAA 1Y42X 2BW0A 1LQ2A 2F8MA 2W00A 3LUGA 2D5CA 1UBFA 5ALDA 4B7CA 4CLDA 4F4DA 4Z7NB 1EK5A 4N49A 1IY2A 3SGLA 1N7HA 1PFWA 1X7XA 5FQNA 2F7SA 4Q4HB 1RCUA 4M9QA 3U4DA 1VL1A 1ODFA 2GHQA 4JZYA 4RORA 1V48A 2LCIA 1C1XB 3FNBA 4QPCA 3WGUA 1F8FA 4L3VA 3A6KA 4K6KA 4HUQA 1Z35A 3AR2A 5KHOC 1Y9EA 1HNXB 4LRXA 4I55F 2HM7A 4MPTA 1TX4B 3SR4A 1MB9A 2XECA 1GPMA 1KDYA 1EWRA 4EQZA 2ZR0A 4BTVA 4OEHA 1W6UA 2VZLA 1XTJA 4BE7B 1ZEJA 4EY7A 5EMNA 2RAVA 4DA9A 1NQ5A 2K4MA 5ALJA 1SXGA 1WNFA 2FFAA 4IDDA 3HUUA 3PKZA 3TYXA 2BH2A 4RFSA 1W5BA 2ECOA 3O0TA 5BWMA 1K7EB 1S8AA 5YASA 1KXJA 1N0HA 2HNBA 5JCJA 2Q5LA 4J6EA 4QYIA 2NSLA 3B1WA 3NIWA 3HXMA 2O8CA 2Z5VA 2MWMA 4EHJA 1SY7A 1DI0A 2GN6A 3K71B 2QTAA 3ZHVA 5J4LA 4LA4A 1DFHA 1NKVA 1VL0A 3P9IA 4IO0A 4E15A 3U7FB 4EI7A 3EPHA 2ZZMA 2QLTA 3THSA 3QMVA 2ZPTX 1MHTA 1R6BX 1COWD 4L78A 4TMVA 2I7DA 3GR6A 3ZNOA 3E03A 2X3YA 1ONBA 4JT9A 3CUTA 1V25A 4ZAWA 1JBQA 3RS8A 4AX4A 3K0EA 5G0SA 4F9EA 4HUQB 1WXDA 3MN1A 1GU0A 3DTVD 3EIEA 1W30A 1ZEMA 4YDQA 2WWXA 1RM3A 2ZJ7A 1ODLA 1XF9A 1WKCA 3BL8A 1T9ZA 3GEPA 3OTWA 4MRNA 3T41A 1AUVA 4W9NA 3H3JA 3QOYA 3FDIA 1KE2A 4YRDA 5KSWB 3BPSA 3DL2A 3GLIA 5JS1A 3DAGA 1APBA 2B1IA 2YVKA 4JBYA 1A8UA 2XWJI 3ZDXB 1E2DA 2YWRA 2EGUA 1E89A 3UEOA 4NZPA 3GJRA 1HC7A 2KM1A 2WD8A 5LQAA 1P0FA 1UEIA 3D6JA 1M2OB 3L6CA 3JYHA 2DG2A 3OJFA 2FA9A 1M10A 2OCLA 2P9YA 1KMMA 3QENA 2DCMA 2IHNA 1LVHA 2PA3A 3L7IA 4F3RA 4EM6A 1A5ZA 3Q2KA 3T3MB 1RMTA 3AY3A 4LZJA 4TRNA 3TJRA 4C22A 1U04A 3D4LA 1F8GA 1G8AA 1VSTA 3H9CA 4LPKA 4F9FA 5ARBA 5B30A 4F4CA 7MDHA 1Y9ZA 5LMNB 2KBEA 4ZC1A 3TDNA 1J2JA 4P3XA 2B30A 3FSGD 4DJJA 4X45A 5LZ9A 1VE9A 4B6FA 3EXAA 4EPXA 7ADHA 1B43A 5KNBD 2ONYA 1P1IA 1LTQA 4Q1EA 1I94B 1EM6A 1CERA 5ELXA 2HB6A 1W48A 2DM6A 3ZG6A 2XRYA 3RS7A 3WRYC 3EEYA 5JO9A 3WZMA 2CL7X 5DMHA 3ZXYA 5KEIA 1AU9A 5K0NA 2VWGA 5DM1A 4KQKA 2YUIA 1Z6XA 3OI7A 3KTAA 1EBUA 2R7AA 3CIOA 4K81B 3PJFA 4OK5A 4IBOA 4NNPA 1WPXA 1IQUA 4URZR 3ZCQA 3ZGZA 2AX3A 3CX6A 3DEHA 3JQGA 1YR6A 5BUQA 3H9UA 3LQYA 4WY2A 3QFRA 1KMHB 1GCIA 1YQXA 3IJEB 3N8KA 3Q8WA 4TTVA 5TVGA 4CKWB 4EX6A 1J42A 1II0A 1UFKA 1VJDA 3MRSA 4UHJA 5AICA 4XVCA 3CVWA 1BXGA 3ZVMA 2X6TA 4QBFA 1WV1A 1EFHA 1YCDA 4G4IA 3B38A 4P3KA 1FTWA 3OZGA 2N1MA 4GZLA 4RM3A 2YWJA 3SYRA 2RJNA 2OHXA 1M6WA 3O8CA 2YZ2A 3E3LA 1O8CA 3O8LA 3FR8A 3LHKA 4XD2A 4S1WA 1PJ3A 3T7RA 1X19A 3CRW1 3VOBA 5GTDA 1K97A 2SCUA 4EY3A 3GZNB 1ENZA 3IDZA 4LQ4A 4UCWA 1IZZA 1E0DA 1JPUA 5HZHA 2YHSA 2QOEA 2ZSIA 2CXTA 2IYVA 5KPDA 2OVFA 1E0AA 4IHKA 2XMDA 3RBAA 2PWBA 1SXJD 3BGDA 1CUYA 3G7SA 3R9IA 1DG3A 2ECQA 2A9RA 1L5LA 4ZVUA 4ND5A 2HDNB 2YXDA 3G0IA 4X1KB 5DF1A 1VFPA 4C04A 1PNVA 3PV0A 2PD6A 2ZVPX 4B44A 4UE6A 1ND6A 4V1CA 3JD1A 4TLAA 4U8HA 2DVMA 3H4IA 3WQQA 4Z4HA 2OXTA 3EK2A 4OAQA 3RIMA 3G2QA 1EP9A 4BEJA 3GGDA 2R87A 3LP8A 1OXVA 4IRXA 1JHAA 3ZEIA 3M6MD 5LXTA 2OAP1 4OJNA 3MCVA 2QIOA 1RI3A 1NQWA 2B5VA 3IQZA 2V5UA 1K2WA 1XZNA 2FG6C 3L07A 4MX8A 3D3NA 1SBHA 4FN5A 1OWMA 4NKRA 3PZRA 1PO7A 3PFIA 3SE7A 2UUAB 1W5SA 3L05A 3FKSA 1E1QD 4ITRC 3TOVA 1ATIA 4FDTA 3CVXA 3PGXA 3CVYA 4UASA 1T3TA 2BFDB 1OV4A 1F4LA 2JKYA 2MIIA 1EJ2A 2OZKA 2VQ3A 3F8SA 3AB7A 3VHXB 4ZYVA 3UMYA 2V7EA 3SVTA 1YVDA 3IQIX 3HJFA 3HUFA 1NWHA 3B1JA 1IM2A 4KP7A 3UG7A 3GW8A 4G36A 4Q4JA 3UNXA 4HNRA 5AVWA 3PWTA 1V16A 2EF0A 1GNQA 4H1UA 3GI1A 5B12A 4TSRA 1CUDA 1ZHHA 2Z1DA 5KYUA 4OGLA 2EJWA 2ZIWB 4RY9A 2Y05A 1HLPA 2W11A 1M1YB 2AI1A 4IMJB 2IP1A 2I34A 2E3JA 1XQ9A 3U49A 4OP1A 3ZJ5A 4IIHA 4OX9B 1G21E 2LNDA 2VZ8A 4XCQA 4B81A 4EI9A 1QCDA 1JEQA 1NW7A 1VIYA 5AK6A 3AJEA 3LIIA 3D7NA 1J20A 1DELA 3ZDAA 1EU1A 3KVOA 1GXSB 2RI6A 5EJAA 4DNOA 1HNZB 3IT0A 3BJEA 3QNMA 5FADA 3VTFA 3I9MA 1EFVB 3ZIDA 3BBLA 5U9CA 1MGPA 1BJTA 4KXMA 5K05A 2ZXEA 2HH9A 5HSGA 4B73A 1KGSA 3BAZA 2J9GA 5JEEA 1E6EA 3L7AA 5IT5A 3OTIA 1CHDA 4NFHA 1AS0A 5CA1A 4FMCB 1T8YA 3DDHA 3FOAA 1H9AA 2KLBA 1ZUNB 2EVWX 4BB6A 5BV2P 1YE5A 2QD3A 4JVMA 4AJ9A 2OK8A 2IW1A 1SZPA 4RAQA 4LE2A 5L3RA 3IVMA 5LC1A 4B8ZA 2J0VA 1B8PA 5LSAA 1T6YA 2O2JA 3ENNA 3FYUC 3I09A 5FP0A 1GQ2A 3U31A 3ZWKA 3CGGA 1WA5A 3RRXA 4MVJI 1QG6A 2V4ZA 2XIQA 4FKMA 5DRTA 3W8EA 5TT0A 4JROA 1JN0A 4OB7A 3E5MA 4Q9DA 4GX2A 2IYFA 1QK4A 1V1RA 2MYNA 3QU4A 4F4UA 3FMPB 5E95A 3OU2A 1PNTA 4OJQA 4X7RA 5ALQA 3DH0A 3KJZA 3QHPA 1GGMA 3PD0A 4KXQA 5A3SA 3AHCA 3R77A 4DNPA 1MEOA 4A7PA 4WUTA 1SHTX 2A0FA 1TADA 1IN6A 2WWFA 3MWDB 5DVZA 1EFKA 5EPEA 3QXGA 3P0EA 3PE3A 2FPRA 2J4FA 2J8ZA 2VDJA 2V7QA 3PNQA 1LY1A 1R9NA 4FIDA 2H3HA 4MUXA 4PRLA 1HYHA 3QVTA 2JBAA 4URUR 3U40A 3VYUB 1OH7A 4YH1A 3O9MA 2BKVA 1SEPA 4IWXA 1KH2A 5TB5A 4DBZA 2VJQA 4FE7A 1PJ4A 2J9ZB 2JGEA 1P2VA 5T3YA 4ZO7A 1WETA 2VUHB 5GZ6A 3E9MA 1G20E 3DMHA 2XOKA 3E9ZA 1F2VA 1UBRS 1D6NA 1XZDA 4K05A 3V3TA 5BSGA 3AI2A 1GNRA 3ENKA 3E3AA 1JHYA 4L5JA 5IC5A 5KSPA 3L0IB 2C2BA 1BG6A 2NO4A 1E9EA 2YTZA 4LNAA 4MJ3A 3WAGA 1OZFA 1UCFA 2Q3MA 1D1SA 2JCYA 3AUXA 1Z0SA 3F49S 3I6BA 3NX4A 3OTHA 5E2BA 3K5HA 4BEWA 1R37A 1JU3A 1CLEA 1H66A 1SKBA 1NDQA 4MV1A 2OXIA 1TL7C 4RGQA 3VH4A 5JI3E 3KS9A 1TLLA 1YNOA 1FS4A 4IOLA 1XD2A 4IIBA 2QUKA 2OECA 3OQIA 4YQZA 2BBWA 5FWAA 4ARZB 1XDBA 3TEJA 3ZYZA 1HMPA 1XRJA 4YR7A 2ABWA 2Y1XA 1ABFA 5KYKA 1B0ZA 1XL0A 3K70C 1TUBA 1Z5NA 2QUJA 1LK0A 4LVOA 5FBKA 2CWDA 3A9VA 4WZ6A 3BFXA 3GWZA 3P2KA 1WUIS 3IE2A 2FEWB 2E7ZA 1N6OA 4MVJG 5JAQA 4BZPA 4ENWA 2PNFA 2NYVA 3DUWA 4AMYA 1SXJA 4BFXA 3B6KA 1OVGA 1U3DA 1XMPA 2DJ5A 1KYIA 2ZSUA 3LUAA 4N7MA 5C37A 4F93B 5KO2A 2NVOA 1SB9A 3C1AA 1O5TA 4KQEA 2XZLA 1LLQA 3S1SA 1M34E 1RXWA 5IAEA 1V45E 4AF8A 2NO1A 4KYVA 3BF8A 1EE2A 2FPXA 2ZTVA 3L0CA 1FXWA 1ZN8A 2I5PO 2K5UA 4IS3A 4BE4A 1Z4KA 1E20A 4LYJA 4PQGA 4M7PA 2R6FA 5LUBA 3GH3A 1Z4IA 1A4XA 1JQAA 5EHNA 2EL7A 1Q0LA 3TQCA 3KV1A 3KQPA 3RVBA 3O8QA 2NZWA 4G8BA 3U4MA 5C4MA 3G3EA 1RC1A 1FQJA 4GXNA 4RJJA 4EJSA 4DGQA 4NATA 3QXHA 2PXHA 3BICA 3TIIA 3ZKWA 3UW1A 4BWYA 3EEOA 1KH1A 3R3JA 2WTUA 2FR1A 3AEKA 3T95A 1D6SA 1EGVB 2SKEA 5FWXA 4V0LA 4KR7A 2G7ZA 5DWQA 3FDFA 4KE8A 5CK5A 3U37A 3STHA 3AI1A 4YRPA 3RROA 2NM0A 2BSQA 1TCVA 2KYRA 3EEQA 1CUBA 1G8MA 3QFSA 5TSDA 2HQRA 4B3BA 3BL6A 2L18A 5FO1A 1ZVMA 1N6NA 2C2HA 3OCCA 3NBZC 4ME6A 4WL0A 1PV1A 3JQRA 4L74A 4QICA 4Z8XA 4D9IA 1EP1B 2PGAA 1F6WA 5DHAA 4B3IA 1BS2A 3W2TA 3DZFA 3BGSA 5I51A 1R6UA 1NQOA 2XVMA 2KB0A 4PFQA 1MJGM 2MYUA 3IPXA 4RHXA 1E2UA 5HK8A 1A8SA 1Z18A 2PH7A 2VHYA 1K75A 3E3NA 3R3HA 5AM5A 1KYZA 3WA6A 4BQPA 5IAOA 2V7XA 1GA1A 2XT0A 3ASUA 4M1SA 4TWAA 4UTXA 3VR6H 3U6KA 1JFTA 1HE3A 2BEKA 3RSLA 1Q0TA 4UQOA 1L7BA 3TLYA 3OKAA 3HBAA 2C9DA 3CEJA 3F9RA 3FMVA 1RJFA 4Q3DA 5F1OA 4TSKA 5IH3A 1V41E 3M49A 3ZY2A 2Q3DA 3Q9NA 3ZWDA 3M3HA 4FWTA 5AJWA 3L7NA 4DUZB 4U2EA 1UAYA 2CB9A 4BNFA 5DI3A 3UXEA 4EVRA 3MGCA 3G5UA 4HH0A 4CQLB 5KNDD 1PJSA 1YMVA 3L92A 4E6EA 4ZKDA 2FPGB 4XJVA 4KIGA 5L95A 3NBUA 1PDWA 1RXVA 1QTNA 1H1LB 5EFOA 4YGXB 3RUPA 4MWSA 3TOZA 3WMXA 4F8EA 1M6NA 2P4QA 1D0SA 5EE9A 1QRUA 2BGGA 1Y8RA 1H3FA 3N2ZB 4A0HA 3D6FA 4IWNA 2YDYA 1GY8A 3BEDA 4ZV4A 4WI1A 5F3RA 3F47A 1VFNA 1A3CA 3G49A 4LMAA 4I36A 4NMLA 3E22B 1AZWA 3O8OB 1ZNXA 3R23A 2VLBA 2OMKA 4PYKA 4DQUA 1N6RA 1MC1A 1P1JA 4ZO4A 1F12A 1P0CA 3REQB 3WA7A 3LT2A 2HU5A 4UM5A 3OFVA 1B8NA 1PW5A 2Y76A 3GUUA 2C42A 3K0CA 2CVHA 3AVTA 1E99A 4A82A 1E4YA 2HSWA 1Q12A 1U0FA 1ESEA 3N2YA 4FYIA 4W5TA 2ZSKA 3K94A 4OQDA 2ERCA 4GQBA 1YAJA 3M1YA 3VZDA 1PNRA 4OI0A 2HEGA 3PUZA 3TMAA 1U6KA 4GLOA 5LWHA 3B9BA 4OM7A 5HE8A 2E4VA 2V03A 2XHZA 4TVBA 3KLBA 4G07A 4UNPA 4Y6PA 4ZAGA 2JAXA 1G16A 2PFKA 5GJCA 1I7PA 3OEWA 4TVSA 3PL5A 2Z43A 1WVMA 4JXZA 1TQ2A 3DLBA 1K5HA 1V6AA 2PTHA 3TSYA 1OFUA 3I5YA 4JJ4A 4FDUA 4I8IA 5EJGA 1VPTA 1HE1C 4P35A 3QV2A 4M0UA 4Q4AA 1MX9A 1P6QA 3P0IA 1HM5A 1ZFNA 3QVVA 3N59A 3ECSA 2XVYA 1JIVA 3GIDA 3HXPA 1EK1A 4YMIA 3UANA 5KNLA 1QP8A 1WDKA 3S1AB 1W76A 5ESWA 3RAJA 3U3KA 3U13A 3ER6A 1E9CA 1Y0BA 2B0CA 3ZU4A 3AM4A 2QRVA 4OAPA 3I1IA 4G81A 3A0RB 4AC9A 3OHPA 3HWSA 2NU6A 2X41A 4HSEA 2VOJA 1DMRA 4KE6A 4MP6A 4TUYB 4XKJA 4ZD6A 2X5JO 3GPDG 3SR3A 2VRCA 5ICEA 1E9RA 3RRYA 3HB4X 5AI0A 1RE1A 2G67A 2ZT5A 4X93A 1Y1QA 4YJ3F 3CSSA 1MH9A 1W4AA 1E4OA 1D03A 1RLIA 2A6PA 2F00A 3N2IA 1ZXXA 1SHUX 3N7AA 4GL4A 3DVAA 4P54A 3ENQA 4R1MA 5AWFC 1EXNA 2P2LA 1UKYA 4LK3A 1TZ2A 4X9XA 2WKWA 1UK7A 3RM3A 4M7RA 4UVIA 5CR9A 3G9UA 1XDUA 3U3RA 1HUQA 4IDOA 4IIJB 4RSMA 3TOXA 1EFPA 1EUDB 1RXIA 4AS2A 3K0FB 4OHPA 4DLPA 1C8VB 3CF4G 3DNFA 5LJIA 1KIFA 5DSXA 3WNCA 5C52B 4QTXA 4N5IX 3HJUA 3PNVA 2J9XB 1GG5A 4ACBA 2CCKA 3AR5A 2E48A 4ZDWA 3I3OA 3L01A 2Y1CA 1MDBA 1BXGB 2FJ0A 2NVUA 2FN9A 2PKQO 2PX5A 2XCUA 3MINB 1HRDA 1HYQA 1XZMA 3DBRA 1WHSB 3FTPA 4OYRA 3KSMA 2D1QA 1M73E 3FXAA 2IUUA 4Y2QA 4X60A 1TNDA 1XU7A 1M34A 5IARA 5CDTA 4ZANA 5JSHA 2VDPB 1XX6A 5B1IA 4IRMA 5B58C 4IMIB 1HFEL 2BBSA 1R2QA 1SEVA 2Q8NA 2WUEA 3OE4A 4R16A 1AA6A 4ROTA 4ZQFA 3WL8A 3ERCA 3E81A 3Q6NA 4GP9A 1E7MA 4MVYA 1GVHA 3AP2A 4IHQA 5A4DA 4D3SA 2OXEA 1Q7CA 2VS1A 3BZBA 3TRDA 4BQEA 4E94A 1SKMA 1QYVA 1UZLA 3M1LA 1CQPA 2E82A 4KBGA 3RREA 1T9KA 3SZLA 3DC2A 1IPEA 3IUSA 3WAKA 5HX7A 1C3OB 1X42A 2ZRJA 3BD9A 3GL9A 4PRKA 1AUQA 4RVSA 4F2DA 2AMYA 2WNIA 3AESA 2HJGA 1CVIA 1G2OA 2PGNA 3OZWA 3OX2A 4UAGA 3MINA 3U7JA 4E2WA 1RRFA 3KUKA 2DXIA 2DTEA 1TVCA 4YVFA 4ZT4A 4RVOA 2CMDA 4MW0A 4TS9A 4TWRA 2Q29A 3G9XA 4XQGA 3ITNA 5JNSA 2P2YA 2P9EA 5DGHA 2GASA 4JNKA 3SXPA 4EA8A 4OLBA 1X9GA 2W6IA 3ACCA 3H5OA 3MSCA 4Q34A 1FQKA 3M4XA 3BCHA 4YUAA 1KZYC 4OA8A 2PUWA 1LQUA 2CD7A 4UZFA 3TTSA 1KK2A 1W1WA 5K3DA 1IMOA 4P5EA 2E4UA 3DPIA 5JWRA 2AOVA 5DPMA 4LYEA 1X7YA 2ESRA 3I61A 2CFTA 1YF3A 5JRDS 2NZVG 4NYIR 7AT1A 3SSAA 4RMJA 1XCJA 3CNQS 2A14A 4KFSA 1BHJA 1RJGA 3C3PA 1K06A 3RIEA 5JDIA 4GPD1 4KQHA 3ASZA 3B9PA 4JC5A 1JR6A 2HXGA 3GPIA 5A6SA 4NU0A 5KYXB 1PVOA 4YAFA 1JVSA 2OCGA 5IASA 4HAIA 4F12A 3KETA 2WVGA 3GP8A 4JK3A 1QUEA 1TCBA 1UL1X 3HLTA 4N5DA 2QR5A 2C4VA 1KAGA 1YZHA 2WD9A 2BDEA 3CNOA 3EAGA 4NLLA 1GYRA 3VPDA 3ESQA 1AGPA 5GINE 3RADC 3L1VA 2Q6KA 1R8SA 3DAOA 4C4YA 3Q87B 4KDEA 3ZQJA 1TTHA 4PAQA 3VZBA 2HL6A 4DUYB 1YB6A 1YZGA 1QH1B 1W19A 3DV0A 1VMIA 1X0VA 2QP4A 1XLTA 2FFJA 3GJXC 2GI4A 3OIYA 1KMCA 2GILA 3UMVA 4RZUA 2PWYA 3DVQX 1O94A 5BORA 1WP9A 2REQB 4MS1A 2H1HA 2R84A 4FCCA 4NJOA 4PZCA 3WBFA 5IT9A 3GLFB 1E3MA 5G3YA 3VU1A 1ZDMA 1JFRA 3C8MA 4MYRA 2JPDA 3KZXA 2Z2XA 4R1OA 4TVKA 3BA1A 1PGPA 4P33A 1AY0A 1PG0A 2AN4A 2JJQA 4CKBA 4ZU1X 3PPIA 4LDRA 4MA5A 3HTXA 4ZVOA 1GPBA 1UMDB 3VPAA 1W5FA 2XJ4A 4G0MA 1TUIA 3C6YA 4HDMB 5EIBD 2XXAA 4IRUB 1EFRD 1F9AA 5HJ5A 4JJIA 2GRAA 2Q27A 4XDGA 1RJ9B 1AHNA 3D6HA 3O90A 4WERA 5AW1A 2PS1A 1QYWA 1CNMA 1E6UA 3RS5A 4CDGA 5C7IO 3IURA 1SKAA 1BN7A 2DQKA 2ID9A 4PQFA 4ZEVA 4PRYA 5EHQA 3WB2A 3H5NA 2REQA 2YZ7A 3GLFA 1N5JA 3N86A 1JFLA 2WFAA 2GEUA 4ISBA 1D0VA 4QU5A 3K6SA 2VAMA 5BURA 2ZITA 2ODNA 1XZGA 4ASUD 1LSOA 1QOPB 4XVHA 4BJ5A 4YP6A 4F6CA 5JY1A 3G0DA 2O8DB 2JJMA 4J0HA 3RDPA 4RF4A 1NRXA 1BZYA 2N3ZA 2ORIA 4UOZA 4YDRA 4ARSA 3TLGA 2J3JA 1B6GA 2P75A 3ESCA 1SKQA 2J5QA 1KOLA 2VDQB 2H1WA 2PL1A 1M76A 5F4BA 3JXEA 1NHGA 2I2XB 3D8TA 3M89A 3UQYS 3ZC3A 4ZT7A 3SHVA 2ST1A 1UJ4A 1TEHA 1V3TA 621PA 2ZRGA 2AT1A 4GP6A 5IAKA 4DA0A 1Q57A 4BNVA 3OLXA 2XMCA 2QG4A 2X0EA 2VDKB 2FFQA 5BWBA 2XUOA 2HA2A 8ATCA 3LF1A 4D0LB 4MKGA 1E3QA 2IUTA 4IIDA 1T4MA 2BFOA 1FP4A 1JU4A 4JEHA 3VAYA 5JU6A 2EP8A 2I4NA 3DAPA 2C2ZA 2OGSA 3RNOA 2OILA 3GFVA 3WJ1A 4P9NA 4PZPA 1J5PA 1GZSA 2OZVA 2Q2OA 5FNVF 1G21A 3EBPA 4HLQB 3U3MA 4QDTA 1JKFA 1IXKA 5LXTB 4YAEA 4Z0TA 2HRCA 1ZC3A 3PP8A 4Q00A 3GT0A 1YZYA 3R7AA 4LEIA 4NARA 4TRMA 3H3FA 5LQUA 1RAIA 1X7HA 3R7DA 4HXFB 3TLKA 1YE3A 3SQMA 2ZAYA 3ROMA 3PYLA 3VAZA 3AM3A 5EL0A 2IIBA 4YJ2A 3QEOA 5K01A 4XH9B 1ZSNA 2WUVA 4O4IA 4PAWA 3RFFA 2OLEA 5ED4A 4X8MA 4PLPA 2EKZA 5DLYA 2W37A 1Z39A 3IP6A 4GGMX 3T5BA 3RTBA 1TCAA 5JQWA 1LK7A 4LHYA 2CYAA 4RD4A 1XHLA 4GR5A 1TYAE 4FR2A 4CQNA 2NXCA 3L0ZA 3WK8A 3ZHXA 3V4FA 2H1FA 2UYYA 3FPFA 3K6RA 1Y7LA 5DASA 1R27A 3A58B 4PZ0A 1JRLA 3QXJA 2CXPA 1NQVA 3QLEA 4GHWA 4AO7A 3AY7A 1CUWA 3G0GA 1H1TA 1ORRA 3K0AB 4YAIA 4DR6B 1EINA 4Y2TA 2O4CA 4A5SA 2X0DA 4DA4A 3C7KA 3SS7X 4UAJA 2PSEA 3DDUA 4KH1A 5TPWB 5B1DA 5A5DA 2UXDB 4UOEA 1BMDA 1NC1A 4DR3B 2JW5A 4DUGD 4YMTA 3SBEA 1TLTA 1MT3A 2B7CA 4H7EA 2H52A 2NTNA 4IVNA 3GFPA 4KK3A 3VPHA 3SFTA 1VYHA 3WIOA 2AN1A 4ZYZA 1KY3A 1RWPA 5BW6B 3RJMA 1QU3A 1CY2A 1NL3A 2JKZA 2PV7A 3FTEA 3BMOB 2ZYTX 3GY0A 1EFLA 2ZTMA 3EGCA 2BKAA 1Y33E 4W82A 5HGJA 4JP3A 5C31A 2H2WA 1DTWA 5B1EA 1Y1TA 5EJ8A 2YZMA 4C5AA 1T2UA 1DQYA 3K9WA 2VXOA 1HFKA 1KRHA 4MI9A 1EXWA 3LC7O 3JVUA 4L8FA 1BQ4A 1R4AA 5D6OA 5JWHA 5ENZA 4HFMA 1WSBA 2Z04A 1V4BA 2BCGY 3R3UA 3E27A 4YC7A 5KWSA 4ARIA 4D3XA 4K7JA 2JEYA 1GNTA 3J81A 3K73O 1HLFA 2IXEA 4XI9A 5K0SA 3R6TA 3W9YA 2IEAA 2PSSA 2HQ1A 2UVPA 1II8B 4WZBE 5CVDA 1QTRA 4J0KA 1RQ2A 2GT1A 2XF8A 3EHEA 3IHKA 3WV5A 3BHJA 1CUHA 1K7XB 3N8NA 1MP0A 3R0IA 4BKRA 3NDRA 3W05A 4BPRA 5IC4A 4MVJM 1S9HA 2VJYA 1UK6A 2VI5A 3SEFA 1LPOA 1JQJC 3W5VA 2AR9A 3B8HA 4NXMB 2B5WA 2I22A 3R40A 3GDFA 1JLSA 4L5AA 3ZTWA 4C43A 4UFPA 1QRTA 4BGUA 1GD1O 2OLKA 3O4VA 5GVRA 3K4HA 3B2NA 5LQDA 4MROA 1KPIA 1JDUA 2PAFA 2YR0A 3O75A 4OQZA 4FIZA 4QXMA 5AKEA 3VA7A 5E6SB 1SIBE 3ZDCA 1RJDA 3T5AA 2REXB 1CUEA 2OCPA 4LI0A 4P7BA 1LSUA 1I33A 4GE0A 1IG0A 4GS5A 3KZMA 3U62A 4HJRA 5E0KB 5JZVA 4CKEB 4PN3A 2DBQA 1WY7A 5BSFA 2R8ZA 4N5LA 1K7YA 4JVSB 4I2VA 1KO1A 1TA0A 1ZZEA 3PGKA 1SQSA 2VPZA 3PJGA 1Q16A 2C7PA 4KQXA 2Q3LA 2OC9A 3T1TA 3AF6A 2QGFA 2WIFA 1BCRB 2ZSFA 1EX6A 3HGMA 1AKYA 3OPMA 3IPYA 1M7BA 2H65A 4XOIA 3T3GA 4R98A 3X2EA 4BASA 4CPDA 2OK7A 2RHRA 8AT1A 5IMSA 4Q3BA 1U80A 4TRRA 3ZNNA 1UT8A 3I2JA 2CXRA 3V00A 2R25B 3RRBA 3D4PA 1ECFA 5EAIA 1A82A 2FY8A 4GZMA 4WEQA 4BNHA 5T4BA 3WWOA 4UQLA 3K0SA 1PWYE 2B69A 2IPLA 1W0KA 2OPBA 2PZAA 4L2IB 3WWCA 5CCBA 5FYQA 2GD0A 4ZHQF 5JY6A 1RWMA 3P2OA 2IBSA 5AI4A 3GVPA 3WI7A 4YQFA 2RC6A 3RVKA 3DMDA 5JZMA 2BF7A 2JGIA 1S2GA 3OCWA 1JTFA 3I6YA 3IEVA 2C8JA 4Q1DA 4CTOA 5EWLA 4C4SA 1UBLS 1YJBA 3DE1X 3IBTA 2I0FA 3U19A 4WZAB 1UDRA 5EEHA 2J0SA 2BFBA 2PUTA 3CU5A 4OHCA 3MT8A 4J4BA 1XRRA 2ZYIA 4OUDA 3O2SB 1T36B 1Y7PA 5EJ2A 3SI7A 3M4ZA 1Q7BA 2RGXA 3C4QA 4C7KA 4R31A 2XCSB 4Y1RA 4HNSA 8LDHA 1NAHA 3F8WA 1U4OA 3N1UA 2H08A 5PGMA 1JIUA 1Q1QA 1Z5PA 3EUEA 4YECA 2NO5A 2JGNA 3FIJA 3OZSA 1IHXA 2CZCA 5DYIA 5FUBA 3VC2A 1XEFA 4I1OA 4WH0A 5CT9A 3R0XA 4I66A 1KERA 2ZBDA 2GCOB 1G19A 2P40A 2BYTA 4N18A 4C7JA 1MD9A 2WF7A 1T9BA 3ZE6A 4I5GA 4IKPA 5FI1B 4Z2AA 4PBRA 1M2VB 1ODIA 3OUUA 4HYEA 4LOIA 4V2IA 3LA8A 2Q7DA 3D8NA 1XJ5A 3DL7A 4BGIA 2PL9A 2HMTA 4QXRA 5AJHA 4EHHA 4MUBA 1IK6A 3OFND 3PTZA 3KEOA 1VG8A 2DPMA 3WC4A 2ON6A 1V8PA 3DQZA 4QRHA 3F5FA 3TIXB 3JAMA 4I19A 3JZIA 4X1KA 3R0ZA 1E0JA 3H0CA 1A88A 1R5OA 4HWRA 4JX8A 4N3GA 4J1TC 4LXIA 3ZHRA 2FRVA 1C0LA 1KJNA 2IIPA 2AOXA 3GLFE 1GJRA 4ICIA 4LOLA 3ZWNA 4DSTA 1VBNA 4HQRA 3IEPA 4HDKB 3TRHA 5BSWA 4AUKA 4D8UA 1NXTA 5C3MA 5FKJA 3GZNA 5FO0A 4YUWA 2IHYA 1GRRA 3C70A 5F7ZA 3CJTA 1Y4SA 2F3QA 1YQUA 1YS2X 3TL3A 4B4UA 1NURA 1VCIA 4UUNA 3SIPA 1PF7E 3OA2A 3QLVA 4N3AA 3OF5A 4B5LA 3LCCA 2ZRNA 3OQPA 4LOKA 1K63A 3KPJA 1PEKE 2V9PA 3P0FA 2CL6X 1L7VC 3NVMB 4F6RA 3EYAA 2H63A 3I0NA 4TMZA 3L4EA 4UJ5A 2R5WA 1TMGE 3NEPX 3NBXX 2Z56A 3JQEA 2BMWA 1O03A 2J9FA 5F33A 1XZIA 2WDPA 2FTKE 4NULA 1TYCA 2GM9A 1ST2A 4OPMA 4PGGA 4F9GA 4D9FA 3DB1A 5BR1A 1VB5A 3OQHA 1MU0A 5GWXA 4BRUA 4S1NA 3P9PA 1BC5A 3PICA 1A71A 3FY4A 1T8RA 4W1SA 2WFLB 5BYAA 3P2JA 1WTCA 3IX7A 2DFNA 4Y1RB 4CZ2A 1YQGA 1LGYA 3GQBB 1Z4PX 4MRVA 2EIHA 1P2FA 1A50B 2UZ1A 1M8GA 1X1SA 2J85A 3NMUF 3STYA 1F0YA 3L8CA 4JP8A 4M1MA 1THTA 2PX3A 1Y1SA 3T5DA 2OFPA 1XNHA 4ZVKA 1F9EA 3FVRA 3ILVA 3SN6A 5H4GA 4AF6A 3N7TA 1T24A 2W83A 3TLGB 2F3SA 3WO0A 1BE6A 3QU7A 4NZ9A 1NJ5A 3WB9A 4Q4AB 1JVBA 2HLNA 1IRIA 1K3UB 5JG7A 4BDSA 1NVMB 4DLSA 3M5WA 3RKUA 2QTHA 4NFYA 3R3ZA 1H3NA 4IH4A 3PUIA 5BUSA 4BNUA 1J22A 3ORHA 2P6MA 1RAEA 1ZKDA 2YH2A 2N1BA 1K7SN 3BRQA 4HVLA 1FDIA 3CLSC 2OO3A 2WMDA 3W5HA 4H27A 3UYLA 4D9KA 1TJ5A 4M83A 3H1AA 3V33A 2QP3A 2IYXA 3DOOA 3N0VA 4PVCA 1ZHOA 3EHDA 1SO8A 4ZEMA 2HZBA 5IEJA 2A3NA 2W2VA 3FUUA 2WJ3A 1M67A 4Y6LA 1HZJA 2YWFA 3D6MA 1P8JA 2VHXA 3ZIAA 3OOJA 2QPAA 2P67A 3TB6A 4D9CA 3PXGA 4GQIA 3EWSA 1MH1A 4FLEA 4RIEA 1VHQA 4IH1A 1U9CA 1LJ8A 3AKEA 4JHXA 4Q4LA 1UK8A 3T7AA 3EGVA 1WUYA 3ZE0B 3FHCB 2R97A 4GKKB 5ALYA 3FZQA 3LZDA 2BELA 1PVVA 4LTNA 4UREA 5AI5A 3NBYC 2H9AA 4TYYA 1AA9A 2JI8A 2VJLA 1R6XA 2W6PA 3G0BA 1TKBA 2CLLB 2YZNA 1DIHA 4BFSA 4JI1B 3TTXA 5AMXA 4S3MA 4QUHA 2PMFA 2H16A 4MKXA 1Y4ZA 2B34A 5LVAA 4I50F 2GR9A 3NBAA 2AD5A 4G4SO 4I1PA 5GGYA 2OL4A 4JWKA 5I7VA 3MHPA 3H04A 3THXB 2HCJB 4MICA 4G0PA 1EJBA 1US8B 1P7ZA 4YMLA 1E1NA 2WICA 3CLTC 1QH1A 4URVR 1DKOA 4L0MA 5A5GA 2QAIA 2W2QA 4O8CA 1KYXA 4FFLA 4DWVA 3AUUA 1FMCA 4WOCA 4KNYA 3AVWA 5HWSA 2HK6A 1YR9A 4KOEC 2OCDA 3S2YA 1I2ZA 1OXSC 1RBYA 3LRPA 4WX2B 2Q2WA 1NKTA 4P4LA 4RQTA 3SJ7A 5BYBA 3WLTA 1W46A 1X87A 2H2HA 3IE0A 2FUCA 3ZGYA 4LXXA 3Q6MA 5L7TA 2CUTA 4BGEA 3L3BA 2O59A 3FTDA 4TN5A 3H7AA 5KDOA 3JYNA 1YI8A 5ADVA 5IULC 5EA2A 1PJ2A 5TY0A 1KQNA 2DHCA 5IPFA 3CYFA 5FNVB 2QBYA 4OFZA 2G28A 1RWNA 2IU6A 4WV3A 2C5FA 5AOCA 1MC4A 1KTIA 4RIGA 4YNBA 1AV7A 5B36A 1ISHA 3KJIA 4GLJA 5AKGA 2DFPA 1KSGA 3W77A 1G38A 3OMLA 1LEHA 1R4NA 4MW2A 4M89A 2IC5A 2PANA 4L4YA 4QTZA 4EB6B 2P41A 4ZVTA 1ZN2A 2PUHA 1CUVA 3HCNA 3NASA 4N82A 5TQ2A 4EYOA 1CC1S 3DOCA 4BTLA 4B47A 4DVGA 3GJ4A 4NC9A 1HL7A 1TMYA 1EJ6A 1GYPA 4BBZA 4II3A 1H94A 4OB8A 1Q3HA 1MMFB 4DCPA 3HFJA 3ZW9A 4FB5A 3GVIA 3NIBA 2CBZA 4IQ8A 2V5AA 1VSVA 5JNUA 1Z88A 1ZQ1A 2GAOA 2PX8A 4RJIA 4V03A 1DBQA 1YBMA 2PQ6A 2V55B 4HWPA 2GVNA 4LZWA 4O3FA 3TI9A 2NU8B 2GRUA 5FUVA 2OOSA 2ZBGA 3EVBA 3BE4A 1IXYA 3C98A 1FRQA 2NACA 4NVRA 5AVKA 5P8WA 1DB3A 3SQWA 4L15A 2X0KA 1OFVA 3R6DA 4I8XA 3UT5B 5DM60 4B5KA 2AFIE 4IJKA 2NGRA 3A9SA 5AJZA 3W4IA 2O3QA 3QYAA 3VYRB 3DT8A 5TQJA 1BDHA 1XEXA 5H1YA 1L7QA 4FFRA 1DTWB 2ETXA 1A96A 5E9AA 3MYYA 2P3SA 2DF8A 1DKMA 1BDIA 1I0IA 3A28A 4LZAA 1QG2A 4JSRA 4X84A 1PU2A 4U3JA 1PUJA 1FJ2A 1IL0A 1Q50A 1WD5A 2ZJ6A 3RK1A 8OHMA 1SXPA 3K8QA 2CLIB 3MUEA 4YP1A 4ZU3A 4GLFA 1ZD3A 1L3BA 1NNUA 3WL3A 3VYTB 2VTBB 1OJ7A 4Q9IA 4XGNA 4AJ4A 5AHXA 1E2PA 5EJFA 4CMCA 3CUVA 3W5AA 2R8OA 2O2EA 5BV1A 2B6NA 5ITVA 1VE5A 1NBAA 2R1TB 4CETA 3UHFA 2IEBA 5UKDA 3WYAA 4JITA 4ZARA 2AQIA 4OL0A 1KDVA 2ZUUA 5ED0A 2AXQA 5AM3A 2ZG6A 2QI9C 2HA6A 1VLZA 1ZY2A 3BE6A 3FJOA 5GM1A 5IEBA 4BIMA 2XCRB 1CKEA 1BU5A 2D2IA 4FB4A 3RYCB 2C9CA 3DMFA 4NS4A 4P34A 4LOHA 2Q5EA 5EHGA 5CA1F 5JJ5A 4OGFA 3GDWA 2QL6A 5BN5B 1RYZA 2HRQA 1UEXC 3AF5A 3DZHA 2I4LA 3TLXA 2D5IA 2HHLA 3FRIA 4MQFA 4HT3B 2PT7A 4RVFA 3WJ7A 4BMXA 2BRUA 2HI0A 3TQQA 1M2OA 1N5IA 3O26A 5COQA 3OT4A 1L4EA 1ABBA 4HGYA 5LIPA 4E14A 1UJMA 2X23A 1RXYA 2XLBA 4HWOA 3BF7A 4OREX 4U7JA 1WBJB 4UCQA 2GM4A 3NRJA 4O08A 2G0TA 1T36A 3N8DA 1NT4A 3DD5A 1J0CA 4Q1BA 4A1OA 2R1VA 2R1UA 1KVSA 4HB2A 1XAHA 3PHJA 1IY8A 1DBSA 2EFHB 3I8SA 3N6RA 1IAQA 3R3XA 4HAOA 5EQDA 3SZUA 3O8OA 3LUCA 4ER3A 4DLLA 4M1WA 2FV8A 1FJHA 1N6IA 3CCFA 4BNIA 3DDNA 1WZEA 2W0SA 1O4WA 3CZCA 4MS4A 1OYYA 2XDQB 4FOOA 1OI2A 2P90A 3AT1A 3OJLA 3DZKA 2KSQA 3C16C 4FT2A 4BMCA 2HUPA 4EK9A 1DARA 2YIVX 3NC1C 3NHKA 3RVNA 1TQ6A 2WTBA 3QVKA 2ISSD 2ZJBA 3E0QA 4CM6A 1FYVA 2DY1A 4LGYA 3QOXA 1N5OX 2HIAA 3KSZO 1CK4A 4D9NA 4YJKA 4RTJA 1EP2B 3SS9X 1N7IA 3N2GB 2OHJA 4QDZA 3O0DA 1J33A 5DISB 4I3FA 4Q9JA 4ZCRA 1P0PA 4BJ6A 2ZANA 1HKHA 3PQ3A 5TDHA 3FNGA 3G13A 1A27A 1N2CE 1O6FA 4KN5A 1T3LA 3DMNA 4PCAA 4DABA 1ESMA 1L8QA 4GRDA 3CR3C 3THRA 4M37A 5E1BA 4R2MA 3GN1A 4BZWA 4DLRA 4YDSA 1JYFA 2VDMB 4BOYA 2IEDA 1MNAA 3KALA 4AYXA 3AEQA 4GYKA 1LSJA 3VHLB 4UZEA 1H8HD 3TVTA 3G5AA 4PYRA 3UA4A 5LZ4A 3BXFA 5HCNA 1QH9A 4PX5A 2XKAA 1JLLA 1JJBA 2Y4OA 3UB4A 2PUAA 4A36A 3AUFA 2IU3A 4PCVA 4M8SA 3TW8B 4BKPA 3ONEA 1YB2A 3QLUC 1KP9A 1GP2A 4R8LA 4X1IB 4EKGA 3NGMA 5HBRA 1F51E 1MOPA 4BKQA 4AJPA 3Q7SA 2Q45A 1I7DA 2FW9A 3MJTA 2WM3A 5DYWA 5CDHA 2I2AA 2I29A 5AOBA 3HDJA 3TW4A 2E87A 2HRZA 1PBNA 2C2WA 4J1SA 4NYIQ 3BSSA 5FI5A 3OQOA 5TXGA 3HGTA 1CRPA 4DC9A 5IAAA 1JDBC 1H2AS 1T8SA 4ER7A 1IFXA 4E33A 1CETA 2A5JA 2J46A 1VKZA 1RQRA 3TI7A 4EJSB 5A9TA 2PUFA 2C20A 5JCPA 3HDYA 1EXVA 4LZOA 4UNRA 4X5OA 4ZHQB 1R0KA 3CUUA 5JMPA 5FBVB 3GZTB 1YR1A 3RCBA 4Z3OA 2O7RA 3MT0A 4ONEA 4PCUA 4MUEA 2JCVA 3HJNA 5T5QA 4LFCB 3VKFA 2ZRBA 4QNMA 1L5VA 4CTMA 3KE8A 3VU0A 5EMHA 4MYTA 3BFVA 1SK9A 1SKYE 3U4IA 4HX9A 4MDYA 4ZK6A 4YAWA 1JXOA 1LF5A 2BF4A 1QYDA 2OR3A 3BDVA 3BQNB 3QIAA 4C20A 2IHBA 2AUTA 3P1JA 2B78A 4QGFA 3BXOA 3KTFA 2RHGB 1GNLA 4RK0A 4CEHB 1AG9A 2P35A 2XMRA 1U0OC 1I7LA 3NOOA 3AWDA 3AERA 1VA5A 3KUDA 3NH6A 4WADA 5CNKA 3WKDA 4MAMA 4KEAA 2ONZA 3HA7A 1L5WA 3SC4A 3H11B 1QO7A 3PNOA 3S68A 3GJ5A 3HZOA 3LX4A 1JHZA 3PC3A 1TUBB 2R8BA 3V9PA 4U3JB 4TS1A 3IBFA 1WDWB 3JQAA 1KDPA 4FI3C 5IP5A 3Q98A 2NQ8A 1PRYA 4BVEA 4CT4B 1DUSA 2E89A 3FJ1A 3CRNA 1TZKA 2ODQA 1A2QA 1T4DA 3OU6A 1I4OA 3IXLA 4DBLC 1W85A 2MOKA 3H7IA 5SZKB 3KXKA 3ZWMA 1N1EA 1DX6A 4HAWA 1G60A 3UJDA 5BUZA 3B1FA 2B25A 3WAJA 3PHBE 4R0VA 5CMLA 5EUBA 4BNXA 1V9SA 4CCWA 3ESYA 2O7QA 1N8KA 1U5AA 1C3OA 3PB3A 3CO0S 3LLSA 1M0EA 4FM9A 4TYNA 1UEJA 3IERA 1U1GA 2QRMA 2FZCA 1Z26A 3PGA1 2A9KA 1ZI8A 4H6PA 1CNFA 3NZEA 5L3SB 3HG7A 5ILGA 4AJ1A 4BKMA 1JX6A 3KJNA 3IO5A 2ILVA 3L8EA 3RS2A 5ECWA 3TLZA 1SA0B 4CIAA 1Y3IA 4EGAA 2IT1A 4KW7A 4WCVA 2HHCA 1MAAA 4FMCF 4XDHA 3QLUA 2GETA 4DFDA 1A9YA 5IK2D 1IOWA 3FDZB 4F1JA 4RQAA 2WJ4A 3OZAA 5JS6A 5LQRA 2INGX 5KVAA 2ZUWA 5DJ5A 5KQSA 3C3DA 1HQYE 3MD0A 4DNQA 3VUEA 2FVXA 3D9QX 4M46A 2VDLB 3VRHA 4C0JA 5LM3A 3EDQA 1FDVA 1NX6A 2CFIA 3DKIA 4Q4DA 1B15A 3PQ5A 4OUKX 5JMTA 1CY0A 1ZSVA 4ROSA 2IYYA 3RQSA 3H9GA 1GDTA 1I4EB 3H16A 2FR8A 2IYRA 2C4KA 2GERA 1ZM3A 4LCEA 4OGKA 5JQGA 4OHKA 1O97C 4F3CA 4CMEC 1VM6A 1X7ZB 3HMKA 3PT9A 4HGNA 4I9UA 4RH0A 1K0FA 4OHYA 10MHA 2IQ5A 4QBGB 4ZAYA 1PR5A 4Q3AA 3GLGB 2XEXA 1KFJB 3BFPA 2GEJA 2R7KA 2ECPA 3DTTA 3GFGA 4I1SA 1N2SA 1T5TA 1JHPA 2OY0A 4Z9BA 3WYDA 1ZUNA 4ZV7A 4H6XA 3IAM6 1AGNA 3KWJA 4HZUA 2EFYA 2CHGA 4JT8A 5K0BA 1FBNA 4AP5A 4I6JA 4BFVA 1DWOA 3SHFA 2ZREA 3WKCA 5HVNA 4MV9A 2IOQA 2N0SA 4YCSA 1AD2A 1C9MA 4YMHA 4EYEA 2O8DA 4C01A 5EMMA 2OGUA 3VNSA 3TM4A 2QSYA 1ADGA 1GQQA 2QXUA 1E0SA 3GJ6A 1XZKA 1E66A 1NULA 4GC9A 4GOLD 2C9ZA 4B6EA 2BGNA 5EHIA 4KR9A 4MARA 4N8DA 2FSPA 4Q4JB 4HO1X 4DDKA 4P8RA 2HA5A 1SBQA 5E2AA 2UYCA 3PE4A 3QF4B 2JG3A 1B0AA 3NBMA 1GRNA 1T9CA 3HR8A 1AKTA 3D81A 3DAFA 3PC7A 8GPBA 5K0EA 3D2AA 3MMNA 4X0EA 3E6AA 2XW6A 4LCBA 2BFFB 2Y93A 3CX8A 3JWPA 1OKKD 3NHUA 4CLXA 5KJ1A 2CNLA 4TKMA 2IS2A 3BGWA 2SHKA 3V8NA 5BNIA 1J0XO 2WB2A 4OBXA 4G1VA 1NNLA 1T34A 3WGLA 1R8XA 2PX4A 4AMZA 4RPGA 4Q37A 1WIWA 3B48A 4KL8S 2ZWMA 1CYDA 1G5TA 1TQDA 2VXBA 4LVCA 1ZGAA 3HRHA 3EG9A 1H69A 1DFIA 3FCOA 4G23A 3N9IA 4O2RA 4RENA 3ZX4A 2XNDD 4PYNA 1WOYA 2QQ5A 4P4TA 3R7BA 1T0UA 2X76A 1JWAB 4L08A 1CUIA 3IHTA 4CIXA 2V96A 4P38A 5CB4F 1QO9A 2XNSA 4KOAA 4IHAA 4LE0A 1GG9A 2JLSA 3BH0A 3L7BA 4L9RA 4GYJA 4QUBA 1JG1A 5DGXA 1IC6A 1PK8A 2JGDA 2QENA 3GPCA 1Z2EA 4PAMA 2QSZA 1CVRA 2EKPA 2FUG6 4R51A 1K6IA 1FE8A 2DFKB 4NBNA 1N3YA 3KKNA 1QQ5A 2JLBA 1VMAA 1S5PA 3NOVA 2EEZA 4NZYA 3GBPA 5CFRA 1N77A 3BFJA 3IUYA 2FEKA 4K86A 2PFGA 3X1JA 4CODB 3RS0A 3B36A 3MEQA 5D5PA 4J3NA 5B6IA 4WNIA 3DMGA 1JKXA 2FDRA 1Q0RA 1ULSA 1GU1A 4NJMB 3AWIA 5FHRA 3MJEA 1N25A 2JEOA 4FS8A 4XVRA 1EDZA 5DNVA 4M2LA 2NWQA 1KR2A 2QL7A 5ALWA 3NP7A 2PK3A 1I9GA 3GOQA 2HNAA 2QRKA 3DLAA 5IKXA 4RCVA 4B79A 3GNTA 2VT6A 2GRJA 3F6PA 2C7VA 2X8AA 3BQ9A 1SZJG 3CUKA 4QL3A 4DV3B 1WVIA 1XD2B 4O2BB 3CH6A 5FOXA 2V9CA 4OU5A 2LKCA 3AZOA 5CLJA 2IHZA 3B7PA 2F43A 4D82A 4GPZA 4X71A 3PQ4A 3I5MA 3CZAA 1ZAKA 1RM4A 4TQUS 1OIXA 1D5WA 4GYYA 5I4BA 4IJMA 1II9A 3C1OA 4GKVA 4YCJA 4AWBA 2MR5A 3IOYA 4DN6A 4E0BA 3EAQA 4Z9FA 1Z45A 4KO2S 1FK8A 2ETVA 2AG8A 4Q1FA 2XWQA 4ZGBA 4MV5A 3ZJTA 1HE5A 5ALUA 2C57A 2P27A 2IYZA 3RRZA 3DO8A 2YBDA 2R0QC 1ZJJA 1Z15A 4UHEA 4DCTA 5JCXA 1EXDA 2WSSD 1GPKA 2AG0A 4J6FA 4HF7A 1TPYA 2CDNA 5BSHA 221PA 2XUFA 1OY1A 4X95A 5BWNA 5KJFA 3AEUA 3B5EA 3PNLA 4KDRA 3IT1A 4HMQA 3QITA 4QYMA 1MHPA 2O9JA 4V0SA 1MRNA 2O23A 4FFBA 5TQ2B 5C5EA 3DZCA 3TFWA 5FUQA 4HUJA 4UUQA 3TRFA 4FXOA 1FOEB 1YTUA 1T8PA 3ZIUA 2VP6A 1NW9B 4WA8A 3ET5A 3TGWA 2HBYA 1M5UA 2X4IA 5A4IS 4L51A 2WZCA 4PO9A 2VUUA 4BWFB 2HSJA 4JZKA 3VR3D 4AAYA 3J81k 3NWEA 2B36A 3A3YA 4QLBA 2IYAA 3PEFA 1IXZA 3K31A 4CKCB 3JCZA 2FZGA 1IN7A 2D2VA 1MX3A 2CBGA 3A6FA 2CE2X 2VPIA 3BT7A 1C3EA 1I80A 1QGAA 3A26A 5IBQA 3A1DA 3ZZMA 3KQYA 2P6NA 3V2HA 3QPAA 4KTTE 1RBZA 3DL4A 5A9SB 5C7LO 1NDUA 2ZQYA 4B2PA 3D3JA 3PD1A 5G1NA 1MEJA 5KU7A 2G40A 2B8TA 3LOQA 2WG0A 4MMYB 2BDUA 2C94A 2OE2A 4FZ5A 1KY5A 1PEDA 4D2IA 1FFWA 4ZEXA 3TBKA 1EQUA 1NVBA 3I34X 4MW7A 1DJMA 1W59A 2W2XA 3V32A 1X3SA 2FLKA 1KWGA 3QEAZ 5BVGA 4ACAA 4ZHQA 2DBVO 2HPAA 1KVTA 3A32A 3KP1A 3Q7RA 1XKLA 4YONB 1MNQA 4UTZA 3HL0A 4IXMA 3DE6X 4H17A 3OEED 1NUUA 4GSKA 3C74A 1A9TA 1E6LA 1M83A 3JQFA 1MUUA 5A3RA 1LC3A 2VK1A 2PZKA 4F85A 3OMXA 1HRKA 3SDZA 9ATCA 3VNUA 1XIVA 1E7QA 2FPPB 1HTBA 3QPWA 3QEBZ 2D7CA 4JL8A 1L4GA 3JATA 5ICFA 1RKQA 4MUAA 3L8MA 1FIUA 3VJRA 3SM3A 2QN6A 1RP1A 3DR5A 2Q4BA 3AIMA 2HIGA 5I8PA 2YMMA 4J2HA 4Q19A 3AK4A 1TTQB 3L0YA 1X7ZA 3OO0A 3KIPA 2ZYHA 2MTBA 1XLWA 3QYFA 3I9FA 1ICEA 3UAVA 4KFCA 3S55A 1XEAA 3WGVA 3IIJA 5LMCA 5IHXA 1X1BA 2ENWA 2HCTA 3ZR4B 3CW2A 1DC6A 4Q47A 2PDAA 2YFQA 5F2EA 2BVNA 3MBIA 1XKQA 2AFIB 2IE8A 2Q1YA 2RCNA 4CQLA 2OZEA 4CMIB 4O59O 3ZQKA 1PV4A 1E2HA 1U7XA 2FLVA 4Q1VA 1IVYA 2J0UA 1G7SA 1Y8AA 2CLKB 3P7MA 2F8LA 3TE6A 3KFXA 2QM0A 1CZLA 3EARA 3FX2A 4L8WB 4YCLA 5KWIA 4F4JA 3HO6A 1YRLA 1RDFA 5AW8A 2EW1A 3OU7A 1GSIA 2QMUA 4RABA 3TR5A 5AW2A 4ZI7F 3FTFA 4RO0A 3W4JA 1AQLA 2Q1XA 4XEHA 3FYDA 4RY0A 3WNVA 3KEFA 4KR3A 3NIFB 2C3UA 5F5XA 2LWIA 1E79A 4RD3A 1IOLA 3DR3A 2H2AA 4RZSA 3T99A 3WXMA 3L0BA 2WI8A 2ECFA 2E4ZA 2EWMA 1VSBA 1E5XA 1Z4NA 3ZDFA 2BGIA 3NYIA 3WHLA 4NBLA 1ZA1A 3C6BA 4YRTA 4Z3KA 5A4KA 5CYOA 4G5FA 1Q2UA 4MW9A 2I8LA 1JKJB 3WQBA 2F67A 1K1EA 2B7BA 3CF2A 4FFPA 1GTJ1 3ZHCA 3K2IA 4URYR 3PFHA 2GS9A 1D04A 4ITUA 3UIEA 4DJ5X 1U3FA 4RD2A 3AVVA 1QHHB 1GZ5A 2NPOA 1ABEA 4NOKA 3A1WA 3LY8A 4HDRB 4M0FA 5ARDA 2XGGA 3F73A 4L28A 1SG6A 1TZBA 1LFAA 3F97A 5LMUB 1U28C 2H1IA 2Y27A 3W3AD 4F71A 1HZZC 2FE1A 3QWFA 2WWGA 4G63A 5K0GA 1EK2A 1VTKA 1C8BA 3JQFC 3KWFA 1N1GA 3NLLA 3S27A 1F2TB 1KQGA 1P7CA 2HK9A 2B92A 2G8LA 2FSFA 2ZSAA 3OPXA 3KE9A 3KB1A 5D5HA 4B32A 3BKWA 3VM6A 1KNXA 1SCBA 2ZJOA 1JFVA 1KU0A 4PM4A 5CNIA 2AWNA 4BV2A 1LI5A 2FW0A 3I4FA 5GM2A 4JL6A 3GHHA 3RFXA 2I91A 1DJLA 4K3UA 1GTVA 2GPTA 3NQ41 3V1KA 2CHFA 2BN4A 3FSEA 3UWSA 5MN5A 1P4GA 1ZNQO 3G8YA 1L5NA 1U8YA 2I6FA 2FMIA 4JBIA 2G4VA 3QV1A 4LJRA 3AFHA 2OFXA 2QM8A 2PZJA 3QU9A 1ZJ6A 2BD0A 3ESRA 4L0DA 3UPDA 4XIYA 1J2YA 3N76A 3HEBA 4HS4A 4KZPA 4ESOA 2O3SA 3PCTA 3HBNA 4XM0A 2R6AA 3IIMA 3OCXA 1YRYE 4F4FA 4LF9B 5DGCA 3LYLA 4O0LA 4DVJA 2OXFA 2QM3A 4G9BA 4Z6KA 4K6CA 1FLDA 1K8XB 2PGJA 4V3BA 2VZEA 1RLJA 2YFHA 1YTLA 1CWUA 1W5AA 2ZT7A 3NHJA 1NHWA 4MR9B 1MF7A 5JYDA 5LZ2A 4D74A 1T3GA 3ITDA 1REQB 2NTVA 2WWYA 5FV4A 2WJGA 1XDWA 1H2HA 3LT4A 4LTMA 4FJ1A 3RVPA 4O4LA 3HA2A 1RVDA 2AE2A 2BR5A 3QLJA 5G40A 2VSOA 5I9IA 4OHXA 1KQFA 3ZHBA 4XGQA 4FOSA 2X0FA 2JK1A 2F3PA 1K68A 3P2EA 4YRJA 1L7PA 3RARA 3SQLA 1DEHA 3DKVA 1U7PA 3I05A 5CPBA 5GZ1A 1YQ9A 1WZ2A 3VKUA 1CFZA 1R74A 4RTRA 4ZDKA 2C92A 3C87A 2OV3A 4LJ4A 3ZCUA 4ZIRA 3WGZA 5KJ6A 2IF0A 1Y5LA 1ZMXA 1XLTC 1TO6A 3EXFB 3SR0A 3W9SA 4LJ6A 4UUBA 1LSSA 1ENOA 2GLTA 4ZAXA 4EFMA 1YUBA 2RHDA 4GBJA 1AZTA 1E1YA 4ES6A 1Q1GA 4ENPA 4OQNA 3NAQA 1PI3A 2GBLC 1JMYA 1V2HE 2ACEA 2QNBA 4CCYB 2ZU6A 5JS2A 4UD6A 4Q18A 2IV3A 5DGIA 4OAOA 1E5VA 1FB5A 2JGLA 4IJUA 4QXPA 5E4JA 3LX8A 4B3JA 2BI4A 1C80A 3FCCA 5IBRA 4KYUA 2F1JA 4M98A 4OO3A 5JNTA 2D2FA 3KRTA 4V0KA 5BRAA 1HZZA 1C7FA 2P6PA 1U8AA 2QE6A 1JAHA 1XZJA 2GA8A 1C5KA 2C5HA 3N53A 5IBPA 4C3ZA 3TSAA 1LDMA 5LBIA 3R4VA 3DDSA 1U65A 3R75A 2Y2UA 1W0JD 1QR6A 4RY2A 3FPGA 4PPNA 3OZXA 1KORA 1WV0A 2XYQA 2ZCUA 5K3EA 1NBIA 1FRZA 1K7FB 3N8IA 4XA8A 5BSVA 2IX3A 1HEUA 3E70C 4O33A 5D3MB 2UDPA 4DKJA 1CX9B 3CLKA 5G0TA 1YH3A 3AEYA 5JJIA 1JQEA 1MJFA 1Q1AA 1OUMA 3G8AA 3GELA 3IUMA 2YRXA 1RWQA 5D8DA 4OKSA 3UC5A 1Z5VA 1JDPA 1KAQA 4MVJF 5C1OA 4DLBA 2ATCA 1X1RA 3CLRC 3MTAA 3RW9A 1ZOSA 3CLUD 2EF1A 1BOOA 3TNDA 1DV2A 4IJWA 1ISJA 2RGNC 2BHLA 2Y1EA 2HXYA 4M36A 4NBSA 3PQFA 1BS9A 4GE3A 3E9QA 1KARA 4HNAB 2WT9A 1JV2B 5C80A 4K6HA 3VNRA 3UJNA 4AS1A 3QU5A 5D2CA 2RI1A 3MCZA 4RGBA 5TEVA 2HWYA 5ISMA 1FZTA 1U98A 3A70A 2I66A 3I9JA 4JC4A 3MXTA 1Y80A 1XWFA 2BFDA 3WK5A 1RKVA 1QOQB 4DSZA 3MELA 1U3CA 4C1BA 3ILSA 5DULA 3WLOA 2OSBA 1JAZA 1Q95A 4UEKA 4N6OA 1WBDA 1VJCA 3DEFA 3U17A 2HLDA 3EBLA 3OPVA 1ORDA 4GSYA 3A36A 4IZHA 4MR7B 2HJRA 1SVMA 2P9BA 4LW8A 1YGPA 1RYHA 2JA1A 4UAUA 4K6GA 5ES3A 2GWRA 4H7IA 4CKCA 4ZDIA 4ZOQI 3ZX5A 3DW1X 3IOBA 1H6BA 4L85A 4K1XA 3M7IA 1PV2A 4E13A 1T4GA 3BWEA 2R8PA 2BKLA 2AJLI 1OH8A 2PPVA 4P22A 2AQ8A 4XCXA 5LQCA 2BGKA 4MQFB 5AD1A 1JT2A 3HU2A 2GEFA 2A9VA 2X6RA 4FDAA 1Z17A 2DHQA 4M49A 4QATA 1MJGA 3KEMA 5DB4A 2UZ0A 5KX5F 3NAGA 4KWCA 1VJTA 2ZCVA 3HA3A 2R00A 1K4YA 1COZA 1KBQA 2HYIC 2VP4A 1PWEA 1MIOA 3F8TA 4M7WA 1Y5NA 2WTEA 1C4WA 1GKUB 2WUGA 2ZTSA 4FOPA 3TPCA 1T91A 2ANCA 5HQ3A 3N5KA 4K6MA 2CEKA 2J4DA 3LSTA 3H18A 1BYIA 2WDZA 1JILA 4KVAA 3C39A 4N0QA 4M86A 4O1IA 4WIAA 3U4GA 3VPGA 2X4LA 2D5BA 3ADOA 4YXWA 1ZCZA 4E5VA 5IHPA 4OGWA 4DV1B 1Y5IA 2MSNA 1V9CA 2GZAA 2J7PD 5F73A 3VZCA 3ODPA 1ESZA 1IM8A 3R5SA 2QG6A 1N2HA 4KQCA 1A9RA 2QTLA 3CUEF 4ZFNA 2J32A 1C7JA 5CFZA 1Q3TA 3D6TB 5I7UA 2VH2A 1I7SB 1NLUA 1F2UA 3EE6A 3QG5A 3FPSA 1XR3A 5F9HA 3MGBA 5DTMA 2GM5A 3LLUA 1U2SA 4RVNA 2WZDA 1T3SA 2F2TA 3UT0A 1JIXA 3R2JA 1THZA 3EA4A 4RANA 5CT6A 5KVCA 1B93A 3QPBA 2ZWVA 5F3WB 2EBUA 1TTPB 5EIAA 1JFFB 3FNHA 3DZBA 5AW0A 1MEEA 4MPRA 5TE9A 2E1RA 3DA8A 1OWLA 2VLIA 3ESDA 3KDAA 4HDRA 5DCYA 4LDNA 3PRJA 3HJCA 1XA0A 3K30A 3F4LA 4JEIA 4KXWA 4FHZA 2VJBA 3UMBA 1P80A 4DEVA 4B4VA 5FX2A 1NBHA 1U8EA 3ZGVA 3ZOZA 2VRWA 4TKUB 4X24A 5KSYA 4FTWA 4P5PA 5GIPE 3EGXA 3H05A 4GRIA 2HGSA 4CNQA 2AYYA 4WN3A 1T1GA 2A1UB 1CP3A 5JMOA 1GAEO 1D2RA 2QKYA 1K89A 2WIJA 5DYYA 1Q7TA 3QA3E 5KYWA 4EY6A 2J3QA 5ALHA 1OHHA 2DTDA 5JWOA 3AVYA 3CVVA 5ULLA 3FTQA 8ABPA 1Z08A 1EWKA 3W3AA 2XNJA 1S2IA 3OPYB 2IGTA 4ZGGA 4RTQA 2DR0A 3D3EA 4YJHB 2E18A 3K3PA 1L3IA 4ETWA 2XDYA 4GBED 1V7CA 4GPIB 1T43A 2FRDC 3EMDA 4LV6A 2IHKA 2B6HA 1OSNA 3R7LA 5EJ5A 2BR4A 3L9XA 3EWNA 1FMJA 4FPXA 2O50A 3EY9A 3B3FA 5J58A 3WFIA 3RS3A 3PTAA 4JQSA 1RWKA 2AN3A 2OO5A 2QK4A 2EFEB 3G1UA 2VQEB 1FVFA 1LW6E 4PX2A 2GAJA 5F3DA 2C7OA 4M1OA 2E5WA 1A7JA 5A7HA 4YRQA 4G0ZA 4YXWD 1QHNA 3GLSA 3HWWA 2AVNA 3JQ9C 4ZVLA 3PWZA 1GQOA 1D9ZA 3SYTA 4XWAA 3QKRB 1AQ6A 2GJ4A 4AJKA 1JXMA 3KQQA 1GTL1 4X7MA 5T4EA 2DHRA 3BREA 3QUBA 2V4MA 1TVKB 2CDCA 3FUWA 5FB3A 3UOGA 4OF4A 3V6LA 1QIDA 1H05A 3Q8MA 1P1FA 1HT0A 4K9OA 1NXVA 2PZBA 4RPCA 4ZQEA 5EWMA 5F1PA 3K9FC 3NDBB 2YV3A 1O87A 4HGZA 3T0FA 4EJ2A 3KSRA 2VYVD 3KWLA 3Q2IA 2M6LA 1KFKB 1UM9B 5ER9A 2BFBB 4WEOA 4E08A 4E21A 1QH0A 1CQIA 2Q5FA 1IXRC 2W4IA 3NAZA 3FSGA 1T5HX 2H0RA 4J4TA 3FOCA 3NEAA 1Z4MA 2FFRA 4K1LA 3DYIA 4P4SA 5G53C 4DARA 2OCYC 4EKDA 3EXHA 4BLTA 3UV7A 1RFLA 5J2TF 1PW7A 3OFNA 2XUAA 3HJAA 3WVNA 3GA5A 1LNSA 3QEMA 3GGGA 4PF1A 4J0QA 2CHQA 1DX4A 1WHTA 4PHGA 5LJLA 1N2GA 3BSFA 3V97A 5B1YA 4PSUA 4ENQA 2M2IA 3BWVA 3JALA 4R0MA 1YA4A 2UU9B 4LISA 3Q5GA 1EUQA 2EBFX 2WE7A 4HZUB 3JQDA 3PSAA 4OFWA 4FP9A 5KYVA 4E2FA 4EGJA 1DT3A 4DYVA 5CA0F 1E32A 4IOJA 2JFOA 2X2FA 1UPAA 2JGFA 2YZGA 3CT4A 5EE5B 4AURA 3RHZA 3WQRA 4ZT3A 2HLPA 3RAGA 2YMPA 5KTOA 3A9UA 4XSGA 1YBAA 4ZZ1A 3GFSA 5ITWA 2D5LA 4N5MA 1A8PA 4AO6A 2WYOA 4GAEA 1VXOA 2QLMA 2W6MA 5C1PA 5LQKA 4N9QA 2I62A 3EZGA 2GHTA 5ILQA 4URFA 1M1UA 3A05A 3N0WA 3VPCA 1ZM4A 5HQTA 2IUFA 2TECE 1ADJA 4DUPA 3LLMA 3Q0TA 1KXZA 1V3QE 1D7OA 2RJ3A 2YWDA 3TG2A 1RBQA 1TMOA 5CU7A 3O3CA 2Q3HA 2R6HA 5E6SA 3V7NA 1XCBA 2QT1A 2WYHA 4EHNA 4XWOA 3VTZA 3ORYA 1IPHA 4TZ6A 1J8YF 2W22A 3U7QA 1OFIA 1GSAA 4Y1GA 2EYQA 4Y0NA 3MWEB 5FTMA 1QFZA 2QV0A 3CEHA 4HFJA 1EVLA 3QKWA 1QIMA 2VXCA 2NXNA 2OO5C 2R1ZA 1NUHA 2VBCA 3RC3A 3MQ2A 4AY3A 4B33A 4BWGA 4MVCA 3NALA 4MWCA 4US0R 1M6VB 2QV7A 5E9WA 1H5NA 2OFFA 3V6MA 2FH5B 5T8KA 4UCFA 3NVKI 4XLLA 3DWIA 2IYPA 2R65A 4E09A 1JVNA 4JS0A 4NYMQ 3K1AB 1FP1D 4KDFA 2A84A 5EXSA 3BD8A 4RLQA 2G0AA 2VSQA 3O4GA 3AKCA 1JTEA 1FU7A 3IP1A 1AHHA 1OZ0A 2DC1A 4FYXA 2GPWA 1RCFA 4ZT5A 3STUA 3BWBA 2CMGA 1WUTA 2WWHA 4XZ3A 4OHVA 4HN2A 3RV4A 3R44A 3FKQA 5FJJA 1IB6A 3VX4A 1G18A 4OL9A 1Q2XA 2GVDC 2CN1A 4JOQA 4G89A 4N5NA 2QTFA 3I4CA 1E3IA 1ZIDA 3HBJA 2HC9A 5IYZA 2Z0MA 1ENPA 1FEZA 4JLAA 2JFVA 1ADYA 1EUYA 3R7WB 3BH7A