3HB3C

High resolution crystal structure of paracoccus denitrificans cytochrome c oxidase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
EVKLQESGGDLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVASINNGGGRTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCVRHEYYYAMDYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1-beta
publication title High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase: New insights into the active site and the proton transfer pathways
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hb3C00
3TGXA 5FO8B 4PJFE 2H6PA 4FQJH 4ORGB 3IJYB 4R4BB 1KGCE 3KPLA 3BW9B 4WUKH 2DM4A 5CD5D 3BSZH 4X5XB 2WWMC 1VKXA 4RX4A 4MA1C 4ACPA 4HPOH 5IHBA 4MA1B 3GIZH 2VQ1B 1SHMA 3DGCR 4DKEL 1MCWW 4I3SL 3OR6B 3VCLA 1LNUB 5GZOD 3S34L 4OCRH 3GDBA 3L95B 4MJ6A 4LVOB 3MJ7B 1FVCA 2YD5A 4JFDA 2IANA 3LEVL 5DJAB 4PJIF 5LGKA 1RZIB 4NO3A 1JYNA 3LB6C 1WLHA 3I50H 4IIQA 3STLA 4XGZA 1WV7T 1UWXK 4OZ4A 3BKCL 3EOYG 4YHKH 5D72L 1LDPL 1X7QA 4EIGB 5JLZB 1R3IH 4UAOB 4XZUA 3S7GA 2VLKB 3D85A 7FABL 4OV5A 1BQLL 5BJTA 2APXA 4YHLH 4WJ5A 3VXRB 1ERNA 3SDAC 3GUTB 3SDAB 2BVOA 3I75A 4H25A 1I7ZA 5CEYA 2I07B 5DJ6B 2XWJB 3VW3H 5KSUB 1T66C 1CL7H 4PJHA 1HILB 1QD0A 4Q97A 1BVKA 4MCYA 1U3HD 4ERSL 1JK8B 2BP3A 2OCFD 4N90E 1MREL 1AO7B 4YHPB 3E2HB 3WXWH 5J13B 2P8MA 3FAXA 4IRSB 3IDUA 1CVSC 5GRUH 1WBYB 4QGYA 4YX2L 3RQ3A 1X4XA 3VGAB 4JPVH 4PLKD 3BP5A 3L3JA 5J12C 4YHML 5EBLA 3TNNB 1DP0A 4P5MA 3QH3A 3PDOA 5DYOA 5IM7A 4I0CC 5KSBA 4K94L 3VXUB 1RUQH 5F88B 4HS8L 4WWKD 3QWQB 3OAZH 3MNVA 2BVPA 5EUOE 4G8IA 4GMTL 4H1LA 4PRDA 3CFKA 4N1CA 43CAA 4G6KL 2CK2A 4XNZB 3DX9A 5FGCB 4ONGL 3TBSA 5JIPA 3WFHA 3HZYB 1ZLSL 5EU7E 5AUMA 4WY7L 4L29B 4PLJC 3KJ4B 3KYAA 2HFEB 3O45A 2WLYA 4MQXC 2E9JA 3BZFA 4LRIA 4W4OC 1ED3A 5JIIA 2VLJA 2VR5A 2JJTC 1LEKB 1WVZA 2Y06L 3FO1A 4Y5XA 4P2RA 4XVTL 1FBIH 1WJ3A 3MNWA 1CFNA 2AV7B 1NLDL 4TRPH 2IJ0C 1DE4B 1OTUD 3K81A 3QFDB 4UILL 3AM8C 3H0TB 4I0KA 4Y4HD 5I30L 1A8JH 3RUGA 2Y25A 1BPVA 4UDUB 5EU5A 4DN3H 2DQJL 3KXFB 4OZIF 4KVNH 1H0DB 2O93L 4FTVD 1BZ7A 4NC0B 1UB5A 1NMCC 1QRNA 5D5MF 3ZMRA 5IFHL 1YMME 5IB4A 2FB4L 4NDMA 1UZ6F 1YEKH 1F6AA 3SCMD 2PNDA 4TOYH 4YPJA 4NFCA 2IALB 5IVNA 1YUHA 2DQFB 1U2HA 3RJQB 4JY5L 1I8IB 3HNVL 1DQJB 3ARFD 1TJIL 4P4RA 3S4SA 3EW3B 1XGYH 1J05A 1TVHB 3AREA 4O4YH 4WFHE 5FA3A 5JW4R 1CTOA 4YXKL 2EXYC 4YAQB 1XF1A 2FO4A 1NDMA 3GSNB 4JZNB 2DI8A 4YK4C 5HVHC 2Q6WA 2P42B 4YK4B 1S8DB 1BVZA 3UTSD 3B5HA 4LLYB 1DCLA 4P59L 2A83A 4M7JH 2XV6B 5DA0B 5BQ7A 3T0XA 1HYSD 1EEZB 1T2JA 1RMFH 4JZOA 1AQKH 1CFVH 1ZHBB 3D3VD 1EJOL 4YFLF 1QLEL 5C0RL 4Z78B 4U6HA 4HF5H 1BECA 4YNYB 4OI7A 3HAEB 4OZGB 4R7DA 5H2BA 1X5AA 3RDTA 3BKYL 1FVEA 1YN7A 4RFOH 4EEEA 4P5TA 4NQVB 5C6PB 4OM1H 1AHWA 2F19H 3GMMA 3IDJB 3VFSA 1C7TA 3UJIH 2YMXH 1KPRB 3FN0L 4GRLC 2ZUQB 4P23D 4GRLB 1WTLA 3QIUA 2IQ9L 4PV8B 3LEYL 3QNZB 4Q6YA 2FO1A 3QUMH 2IGFH 2QADD 3I6GA 3CFBA 4HLJA 4N8PA 4GBXC 4GKSB 1A1OB 3VD3A 1NH6A 2Z31A 3QQ9D 2RIKA 1RZKH 1OAYH 5CJOH 2CXKA 4JRYA 4PFEA 4FQ2L 2GTZA 2H1PL 1RZ7L 1FO0H 1L0YA 4PRAB 2GJ6D 5T1KB 4ONHA 4ONFH 2ZOKB 1OCWL 5F72S 1U8LB 1BGXL 5E2JA 1GGCL 5ACLA 4YR6A 4R7NB 5INCA 4HS6B 4D0DA 2FX7H 4JO3H 5FGBC 1TQCB 3BO8A 1QSEB 2CIIB 3VRIA 1NGPH 3TBYA 1OF2B 1YYLL 3PP4L 3TNMA 1JYVA 3F65A 4ZTOL 4MS8C 4PGCA 3NCEB 1EGJL 4RA0C 4JFDE 4UT7L 5E2WH 1Z9SA 4U7KA 4GKNB 4XWOC 1M7IA 2MKWA 4TTDD 5EBWA 5GRJL 1OLZA 1I3UA 4PD4K 4F7PB 5M94B 5JXAH 1M71B 5JXEA 1IGFL 2EH8H 5DEZA 3MV8E 1RFDL 5L2JA 3V6OA 1KNOA 3JWOC 1C5CL 4JE4B 1FPTH 5DD0L 1NC2B 4EQ3A 3EO1A 4U1LB 5TQ0L 2VLRB 1I1YA 3FFCA 5BW7C 5EPMA 4MDIB 4ZTPH 1TENA 4C59B 4HZAA 5DMKA 1ES0A 2XZQH 2DJUA 3IFLL 1SMOA 1MCQA 2L4OA 5F7HA 3ZYZA 2OJEB 5JHDE 1FORL 3B8YA 3T2NL 4WU7A 1NPUA 3HR5A 3OKLB 4PJGB 3SE8L 3DUUB 3DI2B 1QQDA 1JE6A 5A2FA 1NGZA 2VDLH 1OT2A 4XRCB 4U6XA 1T3FB 5D2NA 1WK0A 4C56E 2RCSL 2PW2A 4F9PC 2F8XC 3W0WD 2NYYC 1FCCA 1EHLL 4L3EA 3BAEL 5F1NB 4XCFL 5DTFB 4NZTL 4Y4FC 2X09A 4H5SB 4Y4FB 3TZVD 4BFBD 4L8CA 2E7HA 4PJ8D 1L9MA 4DFIA 3O3EB 1JPGB 1FVDB 5FUCE 4MD4B 3BH9A 5CAYB 1T21A 3HPJB 5KSBE 5IBTH 1EA9C 1WZ1L 3RNQA 4F3FB 5I74B 3FO0H 3GJFK 1OSZB 3VFGH 5MP6H 1E4XH 4NQEE 3RA7H 2VDKH 3WEXA 3WSQL 2BSSA 3RPIA 4JDZA 4LLDB 5CZVL 3TIDA 2C9AA 5C0BA 4ODUA 1MFAH 4GUPB 5HD8D 3ISWA 4GT7A 2A0LC 4I77H 5K9QI 3KNBA 2Q86A 2XA8H 1WCBB 4O9HH 1WC7B 2IQAB 4XNQA 5I19L 1D6EA 4M6NL 4MD5A 4HLZG 3DX6B 3G5ZB 1H5BC 2HT2C 1S9XB 2WBJC 5C0AB 1H5BB 3PV6B 2WBJB 4ZFZA 3FTGB 3OG4B 8FABA 5HJ3B 1JWSB 3PXHA 3RWCB 1TJGL 5MHSE 4U1GC 4DJMA 4P46A 12E8L 3BP4A 5IVZA 4DQOH 2PTTB 5DUMH 1HKLL 1CE1H 4XMKL 3DV6B 1MCDA 1J1OH 5I73B 2HTLC 1R6VA 1EGJA 2GAZA 4D8PA 1X5XA 4KAQH 4HZLB 4JM2C 3VXOB 4HHAB 2ZG2A 5EWIL 1CK0L 3UAJC 4ORZC 5F7WC 5JDSB 3MFGB 1A7PH 1AR2A 1M7XA 4OLXL 2I24N 3O3BA 3ARTA 1PZ5B 2NTFA 2RJMA 1X5ZA 4HUVB 2LQRA 1KG0A 3OZ9H 1I3RA 3ZTNL 2OTWB 1IM3B 5ERWA 2VOTA 3GBMH 5FHBL 4EN3D 5HYSG 3VFMA 1BFTA 1HKFA 4L5FH 1WTGT 1ZSDB 1B4JH 5L7XH 1JNLL 2GUOA 4QTHB 3U0TA 4FS0A 1TETH 2J8UB 3HMXH 3V4VL 1SJVA 4KMQA 3VGHA 2C3XA 5DUPL 5EDXA 1AD9B 4LSRL 2HLAB 2D7PA 1I8MA 32C2B 2ARJA 4XAWL 3BFOA 3KGRA 1OM3L 4Y19E 3C5ZC 3G5YB 2NW2A 2V9QA 3C5ZB 3U2SB 5FHAH 5C07E 4GAJH 4QT5B 2P8PB 2C1OA 1KEGL 4PJ9A 4HIXH 3ARYA 4E41D 1CFTB 3TESA 1CF8L 5HHOE 1U3HB 4MSWA 4PS4H 4Z5RB 2OTUA 2R9HD 1RZGA 1UXSB 4LLUB 4NYLA 3VXNB 3BQUC 5JW3L 5AZ2L 4DGYH 1E4XI 3UC0L 2IBZY 4G6ML 4L8DA 4OCSL 1SJHA 4HFWA 5CEZH 1TLKA 3IDMA 2VN4A 3TO2B 4LLVA 4XB8A 1JNHB 4HWBH 3MA9H 4Z7UA 3ZDZE 2NY6D 4LCWE 4IOIB 3CCHA 3CH8A 4YDVA 3S37H 1PY4A 4UTAL 3LKRA 1CYGA 4QHUB 1KLGB 3F58L 1W0VA 4Z0XA 5GS0C 1U95B 1E6JH 2DTML 4WWKB 4TUOA 3ZDYF 2RB8A 3BUYA 3BWAA 1LGVA 3ZE0E 1XCQB 5EBMA 2BCKB 3UPCA 3L3DA 2OLDA 2MPAL 1IGMH 4XPFL 2W60A 4U1SB 1HH9B 1Z9OA 3O6LL 4HXBH 5C0IB 5EU4A 1WAAF 3JTSB 1FG2B 4JFOA 4J3XA 3GI8H 5ISZD 3QXWA 1KTLB 4UQ2B 3NCCB 2A9NL 3ARXA 1WUNT 5HGAA 5EUKA 1RZJL 1W2KT 4FZ8L 3MXVH 4JJ5A 3EDFA 4M43H 3GSXA 4CNIA 4NQTA 1Q72L 3U7WL 5KVDH 3PGDB 5LGJB 1TDQA 1DL7L 1U8KB 1TZGH 4Y4HB 4H1LG 3ARSA 5J6GA 1UVQA 3SKMA 5TQ2H 3D0VA 2D7MA 3PP3K 4LSQH 5DHVB 4MXVF 2NW3A 3QQ4A 4FTVB 4V1DE 3B9EA 2WINB 3EDKA 4HMEA 2A9MH 3DLQR 4JGUA 1K2DB 1Z2KA 5IR1A 1WIUA 4BUGA 4NN6C 1KPUA 4LLMA 3SCMB 4NN6B 2HRLA 5DQDH 5H37H 2VDOL 5HHVH 5FO7A 3AAZA 1TMCB 3ARFC 5FYKH 1S78D 3ARFB 4GRWB 3IJSA 4OLYH 5IFJA 4IMLB 4ISVA 2ATKB 2X4NA 3HRPA 1CDHA 3F6LA 1I1AC 4ZOAA 5C6TH 3VG9B 5L8JB 1QSZA 2IPTH 3HKFA 4N8VA 5DD1H 1XIWD 4L4TB 4NZJA 4KFZC 2P45B 1CFSA 5JUEL 4I2XE 4ZNEA 1YPZB 1QSFD 3UTSB 4WHTB 3MJ6A 3M17B 4R3SB 5ID0B 3K8MA 3PWVB 4I4WB 3UBXI 1ZV5A 3WFDH 1AGEB 5INDA 4GLRI 3D3VB 4K7PX 3QUXA 5E94B 1NUFA 4KMLB 4P48A 5E6IC 5DD6A 4TSAL 2QQKH 4PB9L 2GQHA 5E8PB 3D0LA 4LF3A 2LAGB 3SE9L 4JZJC 2ENYA 3O9WD 2EYRA 4JZJB 1N8ZB 5SX5H 3DROB 2DQHL 2JCCB 4LPVA 4F33B 2BHUA 4Z7QF 1R3HB 1I7RB 4ZSOB 1JGEB 4QNPF 3GMQB 3RWDA 4HWZB 4IJ3B 1K3IA 3EAKA 4QY8A 3UEZA 5K33A 2MCPH 3L7EB 4PJAF 1BZQK 5EOQL 2G2RB 4XP9L 5F9OL 1J86A 1T80A 2YKLL 3OV6A 3V95A 3IKCB 4P23B 1NMAL 2H9GB 2ITDA 2X4OA 3IT8D 3RHWF 4LHUA 4KUCF 4QTIL 3GB7B 3WIHH 1XF5A 4M7KH 2AJYL 4OT1H 2QADC 2QADB 1KIQB 1S9YB 3LZFH 3QDJA 1CQYA 4ZO8A 5D7LE 5DJYA 4LSTH 3S5LA 5DGRA 4M3KB 5MEOA 3G6JE 5LBSL 5F89B 2QSCH 2RQ8A 2X4UB 4X4XA 5E2TH 1XGPA 5HYEA 3QIBA 2BOBA 2GJ6B 1GZPA 1TQBB 4OZIA 3QXAA 4P4KD 5GSRA 1T6WA 1EV2E 5D5MA 2CR6A 3PWJB 2X4SA 3BKJL 4OLUH 5EN2B 2NCMA 5ETUA 5DJ0A 5CGTA 1KFAL 1S3KL 1F6FB 1KTRL 3DSFL 4FP8H 3SQOH 2HKHL 5IVOA 3MBEA 1RULH 4OZFB 1F6LL 3X12A 2UWEF 1AE6H 1N3NB 2NQCA 3OPZL 3IAGC 5I1KH 3B9DA 3EBAA 3MREA 1D5MA 4J4PA 4PJ5A 3FQXA 2O5YH 5F7YC 1TTUA 3BEVB 3P0GB 5F6IB 3S3JA 3OHXB 3MROB 5ANME 4LPTA 5TDNB 3IFNH 3LPFA 4PJDA 5EZJA 2GEEA 3QXVA 2FBJL 4N0UE 1FGVH 1S7UA 1WFNA 1UWXH 4NUGL 1GHFL 2GCYB 1DN0B 3QEQE 4XNMA 3VG0L 2D31B 2ZJSH 3ZKNC 2EIDA 4TSCL 1CD8A 1A4JA 2V5TA 5DJXB 3VH8G 3DIFA 4I9WE 3QHFL 3DBXA 5IGXH 1KCSH 2HJKA 3SGJA 3DX8A 4M6MH 3MLUL 1EH9A 4TNVF 5E8OA 3EFFA 1MIML 5FAAA 1MHCB 4V2CB 4EJ1C 2AABL 4K8RC 3MMEA 3RY6A 1YEEL 3B6SA 1EBAA 3CFIC 5D2LA 3ILQD 2A6JA 2CLZB 3HLAB 4OCXH 3BHBA 4XT1C 1ETZB 2GSGA 1T4KA 1VFAA 4L4VE 3UDWA 5J1AA 2EKSA 1BM3L 4JHAH 3NTCH 2YWYA 5KTEL 2NXYC 1A5FL 1CXHA 2B2XH 4DW2L 1ZXQA 4OQTH 4KY1L 1RURL 3BN3B 3GJFB 2ZG1A 1W0YT 4X6EB 1FYHB 4QRRE 4IDJH 3W0WB 2QHRH 5EC1B 2WP3T 2QR0B 2V6HA 1OP9A 1T22B 3JVGA 3ZKMC 5L6YH 1F58L 1T04B 4Z7UE 3VXQB 4YXHH 5BZWA 5SWZD 2H8PB 1YYML 3TZVB 5DWUL 5HYJD 4PJ8B 2DJSA 3N1GC 4LLWA 4Z7VB 1NFIA 4M7ZC 3T0ED 5B38G 5GJSL 4M7ZB 2AEPL 2OI9C 2OI9B 1U8IB 3OKNB 1N0LA 2GT9B 4ZXBC 3O0RH 4MLSA 4BK4A 1OGAD 5E70A 3TN0A 4UTBH 5I66A 2VDNL 3NCBB 3PWNB 4P2CG 4RISL 4JPKH 1A6TB 4KPHL 5C09D 2R0ZL 1NCUA 2FBOJ 1G7IB 1ONQA 3MYZA 4N9GB 2Q87A 3F5WA 2K1MA 4K7PY 5HD8C 1JPFB 2Z93B 2B1AH 1JI2A 2ICCA 1NCNA 3V6ZA 1E4KA 4YHOH 5DEFA 1EO7A 1AQDB 3RGVC 1A47A 5MENE 4NKQB 3UJTL 2HWZH 4I3RH 1BD2E 1XGRA 3KJ6H 4KU1A 3UYRH 4OCWL 4LKXA 4WHDA 2DF3A 3MRMB 4LEOA 3OKYA 1PD6A 1DTUA 1EXUB 3Q1SH 1I1FA 1LO0H 2R4SH 1T5WB 4PJIE 3ZHLA 2YD8A 2GI7A 5CCKL 3CX5J 2VDPH 1RVFH 1VFBB 1QBLL 3D6GA 4XP4L 3T8XA 3LCYA 4BQ9A 3CU1A 5DGQA 4KJQC 4OJFH 2XZAH 2DWEA 3HI6L 2B0SL 2MQ0A 4Q7DA 1EHNA 5TDOB 1A3QA 2AQ1A 5IWLA 2WUCH 4PY7A 4X6BA 4PPTA 1MRDH 5CIPH 4HIIB 4OV6F 3UO1H 1MRFH 2YPLD 4OZHA 4QHKI 3U30C 3LV3A 5DHVH 5GGSB 3QXUA 2ZOLB 2D03H 4R2GC 4N1EA 4CVZB 4NHUA 4HK3J 4E0RB 4X8JB 5FOBB 1CR9H 3L5WB 4Y7MA 2Z35B 4XXDA 4YDIL 3R1GL 3D2UA 1LMKA 3SDDC 3RP1A 2ATPA 4EN3C 4X4ME 4EN3B 2NXZD 3OJDB 3DARA 5FV1L 3HZVB 2BY0A 1IC7H 3RIAF 5F7EH 1DVFA 3MRJB 1PX4A 4IOFD 4XC3L 1MIEL 2N1KA 3RX7A 2FWOB 5HPMB 1AKJD 4XMPL 4NNXA 2XKNA 4AENA 1A7QL 2J5LC 3U83A 3VDAA 2WIMA 3WFCL 4TUJA 4D9QD 3MZTA 4WEBL 1NL0L 1EEYB 4YBLC 1ACZA 4PRPE 4YHNB 3U7YL 4ZFFB 4TUKH 1HXMB 3VE0B 4F57H 1KCVH 1BOGB 5T3ZE 1B88A 1K4CB 5GRXG 4U2ZA 1T1ZB 4GW1A 5I1LB 1HWGB 3U7AA 1MFDL 1QFWH 3KPMB 5FUZL 4PRBA 1S7XB 3RVVC 1FFPB 2BSRB 5AD0B 1A7BA 1KT2B 2EDTA 1NMBH 4E5XA 1F2XK 2ZNXA 1BLNB 4TNWK 1CE6A 4U2YA 4X6DF 3RNKA 4JANA 3FHAA 1CGSL 1LWRA 4WFFD 1HE7A 5M95B 3KG5A 3LHPH 4F58L 3LN5B 5ITBH 5ADOL 2OL3B 3QI9A 4GMSH 2OZ4H 3SKOB 4GG8B 4NFDA 2NY6B 4R97B 4BH7B 3A67L 1MWAB 2A73A 1U8PB 2Q76B 1ROWA 1VGKA 2IFGA 5SX4H 4NHCH 3L5XH 4S1DC 3MNZB 1GGIH 3KPPB 5T1LD 1R3KA 5H8DA 4JFFD 5CILH 1IGYA 3GKZA 3BZEA 4X6CF 4W6XB 4Z7WA 4V2BA 5HI5D 4JB9H 3CVIH 3H9SA 1HQRB 2VJXA 5CGYD 5I2IA 4NKOB 4MB3A 4QHLB 5HVFB 3LOWA 2YD3A 4BSVB 1UZ6E 2D7TL 2NY2C 4G9DA 3QDAA 4X4YB 5ISZB 1Q9LB 3R0MA 3WIIH 3HE7A 5B4MC 3BWUC 4G9FD 2IADA 2AXGA 2XZCL 2ZNWA 3CVHB 2G75B 1S5HB 3VFPB 4PJ5E 1BQHA 2ZG3A 5C92A 2DAVA 4RZCB 2A6DB 1ADQL 1QVOA 3MV7E 1HZHH 1SM3L 4HKJB 2YA2A 1GGBL 1GSMA 3PWUA 4LIQE 5B8CB 2IPKA 2EDEA 3ZHKA 1H3PH 1GAFH 1WF5A 5JR1H 3F7YB 3KDMA 5F6HJ 1O5DT 2AKRA 1JNJA 4FQLH 1U91A 3B5TA 5FA4A 3CXHJ 1P4LA 3PJSA 3ULVD 4GQ9L 3W81A 5F9DC 4G6FD 3Q5YA 1S7WB 1MUJA 3IGAA 3WJLA 3SE4C 5DQ9B 3N1QC 1FYTA 2P5WA 4B41A 1E0OB 1RD6A 1F3JA 4HLZH 5KAQF 3X13A 4X7SL 1IM9A 1SEQH 3ZE2F 4RGNE 4JPIA 2VXSH 3MLPA 1V3JA 1U92B 3AB0B 4MQ7A 2FGWH 5C0DA 4XBGA 1KLUA 3JV5A 3LS4L 1XIWB 1ORQB 5BRZD 2DQUL 4QRSB 3VFWB 4E42B 1QSFB 5DEGB 3ARVA 4MX7B 3CX2A 4PRNB 2RR3A 3U0WL 4BKLB 1HQ4B 2V2XB 1NEZB 3N1FC 4PGEA 2DD8L 2IFFH 1T0MB 2I60H 3TT1L 5E9DA 1HHHB 4OCYH 1CI5A 1UJ3C 4QRPD 1J0JA 4GAGL 4CRPA 3VH8B 2H2SD 5DUBA 2LU3A 4HC1L 2DQGL 2SEBA 4MA8L 1LDSA 1MCPH 3FQUB 4JO4H 5SX4I 3PV7A 3KPSD 1R24B 1A6ZB 3PL6D 4XVJL 3PWLA 5T1MA 1MCEA 1N4XL 4DZBB 4L8BB 3CLFH 4ZO7A 4N8VG 5CHNB 3HRZA 2EC9U 4FQHB 4NQDD 2CR3A 2YN5A 3HN3A 5DRXB 4XAKE 4WO4D 1P7KA 5DURD 5DZNA 3D25B 4PJXF 1KYOJ 1J11A 1WEJH 3ARBA 2H32B 5TFSH 1S7RA 4LKCA 3BVNB 3ARUA 5JA9A 4ZAKC 4D9RD 5CINL 1PY9A 4ZAKB 2R1XB 4JQVA 2Y7QA 1RUKH 4PLOB 4KK6D 3HC4H 2EC9T 4PIRF 4R26H 4G3YH 2QQNH 3DV4B 6FABH 3ARGA 2V2TA 2PO6D 3V6FB 1YNLL 5BZDA 1PQZA 3IDYB 4JVPA 5B38B 4UZGA 3RKDD 3V0AC 3P9LB 4JHWL 3LQAL 1JTPA 5I9QC 4P4KB 3FT3B 3P11H 1KGCD 5CUSH 3T3MF 1S7TB 1RZ8A 5JW5A 1NANH 1R5WB 6CGTA 1NGWA 4U3XA 4O00A 3QO1A 4QF1B 4R4ND 1ADQA 4ZPVA 4KDWA 5EO1A 3C60A 1D6VH 1AY1L 5JOEA 2Z91B 4EI6A 2B5IC 1S9WA 2E6JA 2JKXA 3IETA 4K23L 1CICA 4JFYA 4R9HA 4YPGB 4PP2A 4NBYB 4K3JL 4FXGB 2A2QT 1FFQA 4XNUH 3P0YH 3TBTA 5T5FL 4JJHA 4EDXA 1INEL 3ARDA 5KVEH 3E8UH 2FLRT 2HFTA 3QQNA 3W9DB 5GS2D 1T0PB 3EYOB 1KB5B 1MCRA 4MCZA 1FNLA 1J87A 3MRDA 5HHNB 1NFKA 5I17A 1SBSH 1NCDH 4G6JH 4UOW1 3WS6C 1NJ9A 1J0IA 1MCJA 5I8EA 3CFJA 2P46B 3H6JA 4H20H 1YNTB 2EDHA 1ACYL 1UB6B 5E2VL 1KIPA 5DI8B 2XT1B 4ZYKA 5KOMC 1JZ5A 1A3RH 3QZWG 1NBYA 1ZLWK 4M1CD 3C08L 2AQ3A 3ILQC 3WL9B 3MRFA 2J88H 1KCRL 2F74B 5BVPL 4H1LH 1AC6A 4Z77B 3HI5H 3GMOB 4LSSH 4P9ML 1XGUB 1V3LA 3CUPA 1PX3A 4N90D 1RZFL 3BPNC 2B1HH 2NLJA 3IB4A 3D69B 1LHZA 2APFA 2VL5A 4UINL 4Y2DA 2HH0L 3R8BB 2F58L 3QRFM 4L3CA 3V8CA 5E7FA 4YLQT 3WFZA 5GZND 5J9PB 4JKPL 3T3PE 5I1HL 4HC1A 5SWZB 3GI9L 1FFOA 4M9OA 5KSAD 5HVWA 1MJJB 1EO5A 1T5XA 4NZRL 3SOBL 5HYJB 3T0EB 4M8QA 4U6YB 4BELD 2DTSA 3VJ6B 3E6HA 5HGBB 3HG1D 4WUUE 5F3BA 4NP4L 1IT9L 4IMKC 3D1MC 2YBRA 4BQBA 1PKQB 2AJSL 3N85L 5C08E 4A2LA 1OGAB 3VXPA 4JRXA 1KUMA 5TH2B 3AY4C 2HFGL 1YEFL 1G7MB 1QTYT 1T1XB 4DKEH 2XOTA 5IEHA 4RDQG 4KHXL 1FG9C 5C09B 3U0PB 1QYGL 3S34H 3VU2A 4KRNA 3OSKA 4H0GA 4JDTL 4KK5C 5HDLA 4KWUA 3OR7B 1ULVA 3LEVH 4NFBA 3SBWA 2ICEB 1IJ9A 3K74B 5DQJA 1DBAL 1JGDB 4GH7B 1AD0A 3TIEB 1T83A 3U4BH 2AJUL 1MFEL 2VZOA 4PJCF 1HIML 1NANI 4RQQB 4DVRL 3GMPB 1RHHB 4ZUTB 3BKCH 5F96L 5D72H 1LDPH 4LPXA 3PP3H 4YZFF 3S35X 4WEUD 1AXSB 1TTGA 7FABH 1BQLH 1LEGA 4LMQI 1H15B 2EYTB 2E6QA 2OK0L 2YRZA 3MACH 3G5XA 4O02H 1A7NL 2F9BT 4K7PH 3SO5A 1FFNB 1HXYA 5JPMB 1JWUB 5IMKA 1N2RB 3SKNA 2QEJA 1YMMD 1FZOA 3MCKA 1G9MC 2XYCA 3MLYL 2YPLB 4WI7A 4ODHL 2IMMA 2L7UA 3K2MC 1KPVA 1MREH 4XP5L 2A1WL 2AK4E 1YJDC 4FQCL 1FJ1A 1K8DA 1TVBA 2R0WL 2X4PB 4DGVL 5EOCL 3IDNB 1LE9B 2HVKA 5K93A 3ZKQD 2R2BA 3U1SL 3VFNB 1T20B 2YRLA 3ESUF 5BS0E 4WFHD 4YX2H 2FZ3B 5ID1A 3UZQA 4KK8C 2HLFC 3QFJE 3WFEL 5KS9F 1N7MH 5GQBA 3B43A 1G7LB 2NXZB 5EU6A 1U8HB 3VWKD 4YHMH 5F9JA 2R1YB 4YQXL 2C7UA 4K94H 2K7QA 1AKJB 4WFEE 4I18C 4KROC 4GMTH 3BGFC 4NQCA 2KUTA 1MI5E 5MEQB 5FUOL 4R0LC 2GK0B 4G6KH 3MRRB 4ONGH 4PGBB 3ZDYE 3EOBB 1ZLSH 4WY7H 1HHJB 3L3HB 3MRLB 1MNUL 4NT6B 4WU5B 4JFEA 3HS0B 4OLVH 4XPAL 3ET9F 3EJYC 3NIDE 4LNRA 2Y06H 3VI3E 1MHHB 4XVTH 1WAAE 1XR8A 4XTRD 4WDIA 3K8LA 2KZ1B 2AGJL 4CN1A 1NLDH 1GCFA 4ODXB 1U8NA 3MGAA 4LCIL 4DZ8B 4Z76B 4HUKB 4EUPA 4XCYA 4IRZL 3QJFA 5B39G 4UILH 1K6QL 3BPLC 4OIIL 5IROC 5I30H 3BPLB 1F4AA 2DQJH 4B50A 5T1LB 3VXMA 2KDGA 5DLML 1G7JA 4EVNB 4RAUB 4JFFB 5IFHH 1AP2B 2EDQA 1UENA 2FX8H 3RX5A 3PDDA 4GS7B 2VLME 3TJHD 1YC7A 4J23A 4NM8L 2FDBP 2DN7A 5F7LB 3D48R 4L9DA 1Q9KB 4EI5C 4JY5H 5FIEA 1S9VB 3QAZC 3HNVH 2J8OA 2Z92B 3BH8A 1TJIH 2F5AL 3BD4A 1FZJB 5HGDB 1SVCP 3MRKA 2Y6SD 3CFDA 2NY3D 5D7IB 4YXKH 5I6XB 3MV11 3QCTL 1TJHL 4G9FB 1T89C 2Y36L 3LKQB 4GJTB 3BISA 2IG2L 3KPQA 4JN1L 2CH8A 3RWIB 4C83A 1RJCA 4UQ3B 3C6LC 3OKOA 1L0QA 4P59H 5ENWB 5GRVK 3IU3A 3F7PC 1QLRA 1L7TH 1A14L 1G9NL 1A7RL 3JZ7A 4ZUVB 1EJOH 4J7RA 5A40E 1HHKB 1PEWA 3MV8D 2E7CA 1NAML 1QLEH 3H9YA 5C0RH 2CUHA 2NR6D 3MFFB 1NAKL 4FABL 1CT8A 5KG9A 3VW3L 3MUGB 1I9EA 3QQ3B 1VPOL 4G6FB 3MLWL 3C6SB 5SWQA 1VB9A 2DIAA 3BKYH 5FYLE 3V5HA 4MNHA 5E1AA 3P77B 4XH2B 4I0PC 4NUJA 5JHDD 3VRJB 1BQHG 4Z7QE 1PYWA 1JUFB 4NO0D 2NPLX 1OVZA 1HHGB 3OF6D 3FN0H 4C57C 4JDVA 1FIGL 4QNPE 4OLEA 4K55A 2IQ9H 5E5MB 4P3DA 4JPVL 3O3AB 3TJEL 1JHTA 4PJEE 3Q5OA 3HC0A 5BRZB 1NDGA 2ZWLT 4PJAE 4C56D 3RWHA 2VABA 4F7EA 2YUVA 5KVFL 5F7KC 1EFXA 1K4DB 4XVUC 3D87B 2Q7YB 4HX1A 1TNNA 4OZGF 4FQ2H 5I18L 2H1PH 3LKPB 3OKEA 1DBJL 1RZ7H 2YK1H 2MWCA 2G60L 2VSCA 1XGTB 5CZXD 1OCWH 4QRPB 3L5IA 1BGXH 3CH1B 1GGCH 3F7VB 4HIHA 4YO0A 5GJTL 5IVXA 2FL5B 5GPRA 4PJBB 3L3OB 1FAIL 3L6FA 4GOSA 2VN7A 4NQED 3FQWB 4QRQB 3PL6C 2JK5B 3KPSB 3PL6B 1QRKA 2VAAB 2ZUXA 4YHIB 3QZWB 4Y4KD 4XCNA 1YYLH 3PP4H 1RY7B 1BQUA 1UQSA 8CGTA 2FJGA 4NQDB 4U1KA 4Y5VC 1Y0LA 4ZTOH 4Y5VB 3WYRA 2G5BB 1EGJH 4UT7H 3HPLB 3MR9B 4WO4B 5DURB 1J1XL 1VACA 4K7FA 4Q6IA 2N4IA 2UWEE 3H3PH 5GRJH 2ED7A 5D1XC 2VWEC 1IGFH 1HH6B 5D1XB 1RFDH 5CD3B 2C3HA 4GKZA 1C5CH 1C12A 3CSPA 1HSBB 5DD0H 5TQ0H 4YXLL 4M62L 4HS3A 1CG9B 1SEBB 4K9EL 4O2EA 3BN9D 2PO6B 4LLQB 1B0RA 1QFOA 3NVQA 3PHSA 3B9KD 3IFLH 4HH9A 3FQTB 4PJFB 4MJ5B 5MHSD 4XX1E 3MJGX 3R8QA 4LBEA 1FORH 2ILLA 3T2NH 5FYJL 4D0BA 4PBXA 3HZKB 3CDFA 35C8L 1C16B 4O4YL 3SE8H 4KKLD 3ABZA 3QA3A 2DDQL 3DVNB 5F7DB 3V7AE 4LDLB 4AT6B 4U6VL 4ZQKB 2KPNA 3H9HB 5IGXL 3RX8A 1FN4A 2RCSH 3SDCC 3RWJB 2NY1D 3LIZH 2FR4A 4AEIL 1KULA 4NSKA 2HJLB 5EOTA 4QXUL 5IHZB 4UUJA 1NAMA 1EHLH 2CRYA 3BAEH 4HK0A 3CMGA 4XCFH 4NZTH 1NCAL 4HV8B 5D8JL 4ZUUA 3T2PA 5H94B 2WNGA 1KXQE 3F12B 5FCSH 3ULUL 5C71A 5CWSA 5EIIA 5CP7B 4Y16C 3NFPA 4H8WC 4JLRA 3QDMA 3G5VB 4O2FB 1A1MB 4NQCE 3QWRD 4WV1A 2EYSB 3HNSH 4RMUA 3WSQH 4Y19D 3H42L 3GMNB 3SPVB 1OQOA 5CZVH 5DDHB 4HGKC 5C07D 3PUCA 2DQEH 3MLZL 4L8SA 3VFUB 2AQ2A 5JW4Q 3ZO0A 1BIHA 1QEWA 2ZCLL 4MAYD 4LIQL 2XN9E 3TA3D 3L1OL 1AJ7L 1GH7A 5HHOD 3V5KA 3Q2CA 5IQ9A 4DN4L 1S7QA 1MCSA 1DFBL 2XY2A 4XBPA 2NZ9C 2LVEA 2BVUA 5I19H 2IGFL 4M6NH 1MLCA 3UPAA 2YUWA 1VENA 3KYNA 3NCFB 5KSAB 3BRGC 2EIZB 2BZDA 4Y0GA 3WO3B 1TJGH 2QL1A 4LCWD 5JHLL 2R29H 3SN6N 1FO0L 3FOMB 12E8H 4N68A 1WIPA 1J88A 1HKLH 4XMKH 4MGXA 3RWEB 2YC1B 2FX7L 4JO3L 5IIEA 3GSVA 5EUOB 2VLLA 4PRHA 1J8HE 5EWIH 1C08A 2MMXA 4JY4B 2DMCA 4P2OA 5JIKA 3L7FA 4PJ7F 4RFNB 4OLXH 4QRUB 2IAMA 2QQLL 4OF7A 1R3JA 3ZTNH 5FHBH 2ZUTA 1IKNC 3AXLA 5E7BA 1JZ3A 2GSIB 2AV1A 4IHOA 1PDKA 5HTSA 3MV9E 3V4VH 4UU9A 3JV4A 5I8OL 1UWGL 3QUKA 5DR5L 4P5KA 4CN6A 4LSRH 2V5MA 5T3XL 1DQDL 5I1JL 1OM3H 4JGJA 3X17A 1OT1A 3UPRA 3C5SA 2APVA 2FJFA 2P24A 3QUZC 4RIRB 3WD5L 3DUSB 5IB2A 4OSUH 5C9KA 4TVSa 1VADA 1IVLA 3AS0A 4V1DD 2E8YA 1YMMB 3F6IA 4XXCC 2BXYA 1CF8H 2R1WB 3BP7B 4F2MA 5K59F 5JW3H 5AZ2H 3UC0H 4RGOL 1P6FA 4G6MH 5CFHA 4OCSH 5I8CB 5CSZA 1IAKB 4HIJA 3TCLB 1S5IL 3QG7L 3EHBD 1D5XB 1LO4L 5D1QA 3RBGA 1GPOL 4U7SA 5IB5B 3UCRA 3RZCA 4KK9D 5GGRA 3CC5B 4ODVL 4X6DE 3VWKB 4F8QA 4MVBC 5GHWL 3RL1A 4UTAH 1SY6H 3QUYA 3V0VA 1P5VA 3CIQA 1LO2L 4D0CA 1F90L 3F58H 2DTMH 1G7QB 1A02N 2F54D 4NQSB 4GG6E 3EZJB 4NQUA 1N0XL 3RVTD 3RA7L 2HG5B 4X5LA 3NA9L 2A38A 2FSEA 1FL6A 2VXQL 2QQQA 4APQC 2MPAH 4XPFH 3TC9A 3VI4F 1BIIB 1WZMA 4X7FC 3K0WA 1JF6A 3O6LH 4YIQB 4X6CE 4G6AD 3QUMA 2FIKA 4QXTB 1D9KD 1UZ8A 5SWSE 1BVLB 3MRIA 2W0LA 5K9JL 1K85A 2JJSC 4F7TB 3LVEA 1OAQL 5F9AC 3WLWC 2A9NH 1B3JA 5JA8B 1FO0A 1IFHH 1RZJH 1MELA 4QOKA 4FZ8H 4X9IA 5I1AB 1P84J 2PKDA 5C7XL 1U58B 4YJZL 1ZT4A 3ES6B 1Q72H 3U7WH 3VWJA 2YD9A 1DL7H 5FO8A 5DZOA 3VA6A 1LP9F 2AEIT 3EYVB 5C9JB 3IJYA 2W0FA 4R4BA 3KPRE 2LTQB 3WIFB 5DMGD 3K4ZA 2JIXB 3O2DL 3RKPA 5D7LD 4M93C 5I75C 3ROLB 2VQ1A 5ESQB 4CKVX 2C3GA 3OR6A 3SJVE 2CDFB 1Q0YH 1AIFB 1LNUA 2VDOH 4JFZH 3WE6B 4I1NB 5HYQA 1F4XL 1MRCL 3L95A 2Y6SC 2VISB 3QT2A 3V6BR 2GJZB 4NKMB 5IHLB 1IEHA 4K3DL 5DJAA 3B2UD 3OZ9L 1RZIA 5KOVC 1Z9MA 1KJ3H 1JHKL 2YPVH 5CP3A 3ZE2E 3D5OF 5JUEH 3O4LE 5FF6B 3V5DB 5JLZA 4JFDB 2VLKA 3MQIA 3GSNL 1X5IA 1A3LL 5F44A 2JJUA 2I9LB 3QEQD 4TSAH 3VXRA 1YY9D 3GUTA 4IIQC 4I48B 4PB9H 4HWEL 5E24E 3SDAA 4CVXB 4PV9B 2NR6C 3MV8B 2I07A 5DJ6A 2XWJA 1AI1L 3SE9H 5KSUA 2DQHH 4XZUB 1HILA 5B22A 4I9WD 1P53A 3RWFB 3NPSB 1JK8A 2BK8A 5BJTB 1UA6L 3KS0J 4DUWA 2APTA 1AO7A 4YHPA 1GGYA 4IRSA 5I1IH 5ICYB 1CVRA 4JKWA 3I75B 4HMCA 3V7MA 5JHDB 1AGCB 4NKDA 1BBJB 1WBYA 3B3IA 4NO0B 3C9NB 4Z0BH 3DO7B 4XP9H 5F9OH 2FJHA 2YKLH 5B21A 3T1WA 1NMAH 1PGRB 3IFPB 4L4VD 4W6WB 4QTIH 4LSUL 2ZUUA 3TNNA 2AJYH 4C56B 2DIJA 3VXUA 4PJXE 5C0CE 5F88A 4QRRD 3DXAE 2X4TB 4LVHC 4NBZB 3RWGB 4LVHB 2BSED 5LBSH 1CN4A 4RGMC 4WHYG 4UV4L 3MUY1 1WFTA 4JCLA 5A2LH 5EZOH 3QR2A 3HE6A 5DVKA 5DC9B 3TVMD 3NPZB 2OS7A 1X5GA 4MNQE 1VERA 3FRUB 5KSBB 2R69L 3ARRA 4FOMA 4L29A 3BKJH 3HTLX 2HFEA 4I13B 4S0SD 1KFAH 1S3KH 4NQEB 4UV7H 3SY0B 4W4OA 3SGKA 3DSFH 2HKHH 1G84A 5DK0B 1LEKA 3C87A 1FL3B 4Y4KB 2Q20A 2MOVA 3T3ME 4NGHL 4XMLL 3P73B 3Q6FB 2AV7A 3MSPA 2JB5L 1DE4A 3FONB 2WP3O 2ADJB 3MXVL 1DQLL 2F53E 4HXAL 4LRIC 3O2DA 5AAMA 3QFDA 1Z5LB 2FBJH 4OBSA 2ICWJ 3H0TA 1OTTD 5EULV 4NUGH 1FNAA 5JPNB 5J1SC 1GHFH 4Y5XC 5MEND 1BD2D 5F8QC 4UDUA 3QWOA 3KXFA 5F7UA 3VG0H 1MCKA 2OMBA 1H0DA 4S1QL 4FMFA 4TSCH 3P9MB 5TE7L 3ZYOA 2Z0BA 3BN9C 1MJ7L 3K4DA 4CU6A 5GGVL 4HMDA 3I2CL 5DD3H 1YY8B 3MLUH 3B9KC 3IDGB 1MIMH 3B9KB 1T03L 2IALA 2DQFA 2ORBH 5EU5B 1I8IA 1WT5A 1DQJA 1YEEH 3P4OB 4UT6H 5TGBB 4NIKB 1OAXL 1TVHA 3HMXA 4L1DA 1DLHB 1WWWX 5IT2L 3WHE0 1CDGA 2C4FT 3EYUL 3CX5K 5FECB 1NSNL 3JUZA 4YAQA 3GSNA 4JZNA 1BM3H 2EO1A 5KTEH 1A5FH 4DW2H 5CEXB 4KY1H 1S8DA 1YDPB 1G7HB 2XI9A 1A64A 1HYRC 2WQ8A 2NY1B 4OAWB 3AREC 4P2QD 1J05B 4LLYA 4WTWA 4DVBB 4OLWL 4GW4B 4NRXB 1NCTA 5FDWB 1F58H 4RWHA 3X14B 5EH1A 1EEZA 4J2XA 1M7DB 1YYMH 1K8IA 1ZHBA 1AXIB 3L3KB 5DWUH 2FO4B 3CK0L 3CJJA 1NDMB 5J1TC 3CSBA 3RVXD 5GJSH 1UACL 2BVTA 4AG4L 2AEPH 4Z78A 4FQXD 4LU5L 5FXCH 4YNYA 1TTFA 2FEDD 2A83B 1UXWB 3HAEA 4OZGA 5FV2A 2X10A 1JMZA 2VDNH 4JZOB 3HNTL 5CJQL 4MD0B 4RISH 3QUXD 4Y19B 3H3BC 4MNGE 4HWBA 4KPHH 2CK0L 4NQVA 4PRPD 2R0ZH 5C07B 3IDJA 3VXSE 3PQYE 2MCPL 1YA5A 5T3ZD 1NFDE 1KPRA 4L1HA 4MAYB 4R96A 3RDTC 5IK3B 4GXVL 3BRDA 3UJTH 3VGDA 3TA3B 5HHOB 4PV8A 5A16A 3QNZA 3MRNB 4OCWH 4OUUA 3AUVA 1AHWC 1MJUL 2JB6B 3WXVL 3MV01 5IESL 4GKSA 5DA4A 1A1OA 3HCVB 3FN9A 1P2CB 1KN2L 4CMHC 2XTLA 1VA9A 4TVPL 3KYMB 4S1SL 4CMHB 5CCKH 4OIAA 3QIUC 2ESVA 4PJCE 4P3WA 1JF5A 3IS0X 3I02B 5T1KA 1AC0A 4U1IB 4LCWB 2ZOKA 2B0SH 3HI6H 4POUB 1U8LA 1J7VR 2VDML 2Z31C 2XIDA 2Z31B 4QXWA 5I1EL 4M3JA 5HDQL 1MFNA 1QSEA 2CIIA 3K3QA 1YEJH 5AYQA 5EO0B 3WKNA 4FQPA 3DURA 3HUJE 4YR6B 4YDIH 3R1GH 1XR9B 2LU4A 5J3HC 3KR3L 3QIWD 4GKNA 3BO8B 2Y23A 4XWGL 4F7PA 4OFDA 2AJZB 1Q9OB 2HJFA 1M71A 3BOVA 4GXUM 4XC3H 1FNGA 5GGTL 1NC2A 4XNXL 5KS9E 4U1LA 4XMPH 5JZ7D 2BERA 4RMTA 1A7QH 4MDIA 1M6OB 1I75A 1U6AL 3BXNA 3MV7D 1VGEL 5GRYA 3WFCH 2VR9A 4NRZB 4WEBH 2D9CA 4PJHF 5DMJB 1V7ML 3O8XD 2VZSA 3V6OC 5CSGA 2OJEA 3U7YH 2ZCHL 1MQ8A 1AGBA 4UMGA 4OF8A 3RVWD 3W5MA 4MA7L 3EO1B 3OKLA 2NY0C 4PJGA 4V1DB 3DUUA 1EZVY 1AR1D 2FEEI 4WRLA 3BPCB 1MFDH 4XRCA 3THML 1T3FA 5FUZH 2DICA 4XHQA 1CXFA 2DLTA 2XWBB 1KEML 2HMIC 3D39E 3EHBC 1QOKA 4F58H 4RGND 5DTFA 5F1NA 3CXHK 5ADOH 4KK9C 4JO2L 1OP3H 4ESKA 3STZB 2ZUSA 5L2KE 2DL2A 3O3EA 4DK6A 1JPGA 1FVDA 4K71C 4MD4A 3OJMB 3HPJA 4F3FA 3T77B 3KPOB 4I2XB 1U8QB 4KJYB 3JXAA 2PXYA 3ZDXE 3MODL 4WHCA 3LDBB 4YWGL 2WWMD 3MUHL 1ZVYA 2R2CA 2CUIA 2IC2A 1UADC 1IRAY 3BH9B 3KLHC 4HBQA 4GUPA 1XH3B 1KF9B 1Z9LA 3KYOB 3BPOC 4G6AC 3BPOB 3LY6A 5LQBL 3CPLB 2VXUL 1D9KB 4YHOL 3WNKA 1IBGL 3WJJA 1WCBA 2H41A 1HHIB 3RPIB 4I3RL 5CBAB 2XZCH 3NBNA 4AEHL 5L8LB 1WC7A 4CJ1A 4NRYB 2IQAA 2OXHA 5L88L 3B9AA 1WGOA 2UVFA 3DX7B 2V2WB 3WKML 5KBNC 1A6WL 3LB6D 3IKKA 4WW2B 3DX6A 1ADQH 4XAKD 3G5ZA 1SM3H 5C0AA 1GGBH 3NN8B 1H5BA 4TTGA 3FTGA 5HPOA 4KHTH 4NOBA 3VD9A 1TPXC 1JWSA 3OGCA 3RWCA 4FFZL 2Y9RT 2D2OA 4PP1C 3WHXB 5DMGC 5E8EB 2EH7L 2PTTA 3DV6A 5D7LB 2AXHA 4GQ9H 3FL7A 1ZT1B 1T66D 3NGBC 4L9LB 1NGYA 2EDOA 3NGBB 1BQSA 1KYOK 1R5IB 3M1BB 4KDTA 3G6JB 4HZLA 3VXOA 4HHAA 3BRFA 4P46C 5JDSA 3MRQB 5IFAL 2JE8A 5KVGH 3VA2C 3ELAT 4X7SH 2Q1EA 3LPWA 1PZ5A 4LAQL 2HRPL 4IRJD 4HUVA 2EEBA 4KUZL 4YDKL 5KANI 3B2UC 2OTWA 1IM3A 1LQSR 3IU4L 3WN5B 1HINL 4Q0XL 4QXGL 5FB8A 1EMTL 1ZSDA 3LS4H 2AXFB 4QTHA 2X7LA 4JM4L 2FATL 1AD9A 3UJJL 2HLAA 32C2A 4KRPC 5ANMB 1G6RB 3EO0B 4KRPB 3U0WH 5CBEB 4G8EB 3G5YA 3GMLB 1HEZB 1T6VN 2PCPB 3U2SA 4DKAA 5I71C 4N0UB 5GSVB 3VFMB 2BNRE 2DD8H 4NQXB 1DBMH 1VCAA 1T7XA 2LU7A 3QEQB 3TT1H 5C3LD 2B39A 1IEBB 4QT5A 2P8PA 5GGQL 1IMHC 2P5EE 4GAGH 2HVJB 4HC1H 1CFTA 4GW5A 2DQGH 5CEZE 4LCUA 4PLJD 5HI4C 2XTJC 1TITA 4K3HA 4WI9A 1U3HA 5EORL 4MQXD 4Z5RA 4XVJH 4LLUA 1UXSA 3VXNA 1N4XH 1MQKL 4PJ9C 2G5RA 1CLOL 3QP3A 3LKOB 1F00I 3MGOB 3TO2A 1I85A 1FIEA 1JNHA 3EOAB 3X3FL 1TNMA 4XHJD 3KHOA 4L4VB 4IOIA 4N5UA 4X98B 4IM8A 2F15A 3PGCB 1UM4L 5CINH 4QHUA 3L5XL 1KLGA 2F8OA 3KYKL 1U95A 1YZZA 4WWKA 2ICES 4QRRB 2EECA 2ESVE 2V7NB 5DRNB 3O3DA 1JWMB 2AEWA 3LRSB 3O6KL 4Z7UB 1YNLH 4WCYL 5E5RB 1LP9A 1XCQA 1IL1B 2BCKA 3S3PA 1JMXA 1FZMA 4YDVB 3TVMB 4JHWH 2ZUVA 3LQAH 1MFBL 1U41A 4LPYA 4U1SA 5HY9B 1ZTXL 4LVNB 1H3UA 5C0IA 1FG2A 4WUUD 4X6FB 1KCUL 3BIKB 2UUDK 1T1YB 5GGRY 2ED8A 5C08D 1SYSB 4PUBL 4UQ2A 1AY1H 4Z95L 3L3DB 4K23H 2EXYD 2OR9L 3BZ4B 2W60B 4BQCA 4K3JH 4Y5YB 1OY3B 5T5FH 2K7PA 2EDBA 1INEH 4N0YL 4AM0B 2N56A 1S9KC 3S88L 5LGJA 3PGDA 1GIGL 1U8KA 1FSKB 2AJXL 1Z6JT 4Y4HA 5MENB 4D94A 3DYMA 1BD2B 2Q8AH 2H2PC 5J11B 4X80L 5D7KE 5DHVA 2YD2A 4AH2A 1VFMA 1GAFL 3I3DA 4FTVA 3FQRB 4JJ5B 5FYKE 2WINA 4HGWB 2QHLA 5IBLC 3MUZ1 3OKKB 1K2DA 4PJIB 3BP6B 1ACYH 1UCBL 2BFVL 1EDQA 5E2VH 1K3ZA 3SCMA 3CMOL 5LAXB 4HT1L 1CIDA 5JMOC 3C08H 3ARFA 3UP1A 4IMLA 2ATKA 2VXSL 2D4DA 1PG7L 5A2IH 4M1DL 3FB7B 5IG7B 4P9MH 3WDHA 1KPUB 1N6VA 4GRLD 1RZFH 4K8RL 2X9WA 2AK4D 4KH2A 4UINH 1YPZA 2HH0H 3AGVA 2F58H 2EICA 4UBDC 3UTSA 4P2QB 4WHTA 3M17A 4R3SA 3OXRA 5ID0A 4GBXD 4JKPH 3PWVA 5I1HH 1TZHB 4POZC 4I4WA 5BS0D 4X4ZA 1AGEA 3GI9H 2Q3AA 3QFJD 5E94A 3D3VA 4NZRH 4RAVA 3SOBH 2DQTL 3JBG7 1J0YA 2VXVL 3RVXC 4CU8A 1CFSB 2IFFL 5E8PA 1D3CA 4XPBL 2YUXA 4FQXB 1CGWA 1ZT7B 1N8ZA 3DROA 4NP4H 2JCCA 1IT9H 4M7LT 3U9UB 4J8RB 4WFED 3BD5A 2AJSH 3O2VL 3N85H 4MJ4A 5LG1A 5E8NA 4F33A 1Q38A 1R3HA 1I7RA 3QG6B 1YEFH 3JTTB 3QUXC 4ZSOA 3TEUA 3BT2L 1MCPL 2HA1A 3QUXB 4JO4L 1MI5D 3GMQA 4HWZA 4KHXH 3UROR 4PRPB 1RK0B 3TO4D 5CMAB 1BF2A 1NCCH 4MS8D 2G2RA 4JDTH 2J1KA 2MHAB 3IKCA 4P23A 2H9GA 1NCBL 3GB7A 1DBAH 3IXAB 1M1SA 4PJ7E 5TFSL 2AJUH 3NACL 5F3HB 1MFEH 1NC4D 2WK2A 1AXTL 1HIMH 1U93B 4MQTB 1KIQA 4R8WH 4QY8B 2J6EL 3GGWB 4N5EC 1G7PA 2IF7A 4Y1AE 4Y8DC 4G8GE 4G3YL 5F89A 2X4UA 2R2EB 2X4OB 3HAEG 3ARQA 3OAUL 5JNYB 2OK0H 4FQIL 1ZANL 1CXKA 4MA3B 2GJ6A 2CIKB 1A7NH 2YWZA 4HUNB 3PWJA 4NCC1 5E95B 3P11L 2HTKC 4O58H 4TN9A 5EN2A 3SKUD 3MLYH 1A9BB 3LH2L 2VLMD 1XGPB 3QIBC 4KRLB 4OZFA 3QIBB 2A1WH 1RJLA 2BOBB 1N3NA 4FQCH 4DGVH 2R0WH 3QXAB 1X4YA 3V79C 5EOCH 3VGEA 2NX5E 4K3GA 3L3GB 3BEVA 2X4SB 3U1SH 3OHXA 4WHYH 3MROA 4QHKJ 1IQDB 5TDNA 25C8L 2LABA 4OF0A 1KJMB 4X0KB 4F37F 2E9IA 2NYYD 2X1WL 3QIWB 3D9AL 4Q74A 4Z6AT 1H3TA 3WFEH 4ODWB 4Y4FD 5K59E 3MBEC 3JUYA 2GCYA 1DN0A 3WO4B 1MEXL 2W65B 3W9EB 5BVJB 4M02A 3IRZA 3MJ9L 4J4PC 2D31A 3W39A 3P9WB 5FK9B 4YQXH 1RHFA 4PJ5B 1QKZL 1EAPB 3INUL 1ZLVK 5DJXA 1N59A 5D70L 3QXTA 3MOAL 3UTTE 2OSLB 3ULSB 2GJJA 5IBUG 1C5BL 3MV7B 3FMGL 1MHCA 5FUOH 3O8XB 4TULL 3BZDA 5LKNA 1XMWA 1X44A 3RU8L 2PYEE 2N7AA 2CLZA 1EEQA 3HLAA 3JV6B 5GGUB 1ETZA 1MNUH 2VQTA 3SGJC 2HJKB 4QO1A 4XPAH 3VI4E 4XPTL 4LSSL 3T1FA 5DMIL 3O6FD 5FYLD 5LJYH 3RY6C 3GJFA 2B1HL 1MY7A 3W0WA 2AGJH 4LL9A 5EC1A 2QR0A 2NY5C 1T22A 4RGNB 1T04A 3GJEB 1QFPA 4LCIH 3VXQA 2H8PA 3BEWB 4IRZH 3TZVA 2XQBL 5E5UB 5J1AB 2HT2D 1K6QH 4PJ8A 2WBJD 4OIIH 4LK4A 4Z7VA 4OGXL 3RIFF 1SMAA 4ZUSB 4TNWF 4KTDL 4XCCL 3I6KB 3V52L 5DLMH 3GSWB 2GT9A 3JVGC 3BJLA 2OL3L 4HH8A 1LP9E 3PWNA 1FCGA 3NZHL 2RFXB 1MWAL 2W07A 2HTLD 1A9EB 1A6TA 1DDHB 3T08A 4NM8H 4H0IA 2PW1B 1QO3B 3WV0A 4JM2D 4JGMA 4N9GA 2ADGB 3UAJD 1JPFA 2F5AH 2Z93A 1ZVSB 3LAFA 2J6EA 1MHEB 3O41B 3TN0C 3K1DA 3QCTH 3O11B 1TJHH 2O5XH 3KLAB 4FG6C 5CSBA 2ADIA 3WNPA 2Y36H 2X89D 1UM5H 3F7QA 5EZIL 3U4BL 2IG2H 4KJPC 1CLYL 3MRMA 3D18B 1ZHLB 4JN1H 4LOUC 1EXUA 1XFPA 2XY1A 1E4KC 3FZUC 1BFVL 5EO9B 1T5WA 2X44D 3V6ZB 4JFXB 2DWDB 4KI5F 3X3GL 1VFBA 4LDOB 5HHPB 3CVHL 1RJYB 1XAUA 1G0YR 1A14H 1G9NH 1A7RH 3C5ZD 5IMLB 2X5PA 3BYYA 4QHNB 3MRPB 3MACL 1R3LB 4O02L 3Q6GL 1NAMH 1IAMA 4K7PL 1I1FB 1NAKH 4B5EA 2YS4A 1PBYA 4FABH 3ARWA 3RI5K 1VPOH 3MCLL 4PREB 3T8XB 3MLWH 5GGSA 2ZOLA 3S96B 4NCDA 1XF2B 1CD1B 4CVZA 4E0RA 2VKWA 3DGGB 3E6FB 4X8JA 4DFHA 5FOBA 5IWLC 1ZGLB 4M9PA 3L5WA 3BQUD 3MJ9A 1ZGLM 2Z35A 2EDJA 4PY8J 4IRJC 3ILPB 1G0XA 5ACZA 4IRJB 4YE4L 4GSDL 2FH6A 4NBXB 4A6YB 1RK1B 1FIGH 4EN3A 3OJDA 3HZVA 1N7ML 2YSSB 1F3DH 4LSDA 1TXKA 3TJEH 4KGLA 5BOPA 4JFPB 3QDGE 3MRJA 1OAUL 5J12B 4LCCA 2BNQE 3BE1L 1OPGL 1F11B 2FWOA 3MRGB 3GM0A 5HPMA 5KVFH 1JPTL 1P69B 3VFTA 5FM5M 5GS0D 1WZKA 2W38A 3BGMB 4LFHD 4YFDB 3JV0A 4DKDC 1EEYA 5I18H 1DBJH 4YHNA 1KJVB 2G60H 1W8NA 4W68A 4ZFFA 1HXMA 3VE0A 3QHZL 5GJTH 1JNNL 2IBGA 1K4CA 4S2SB 4E41A 4CW1B 1FAIH 2L0DA 5LCVL 4JY6B 1HDMB 3DPBA 4OLVL 4WW1A 1IAIH 1KB9K 5GGVY 2WSKA 4MJIE 1S7XA 1FFPA 2BSRA 5AD0A 1KT2A 3GBNH 5J4MA 1CFBA 2H3NB 1BLNA 3TT3L 2DRUA 4Z8FL 3LN5A 4ZFOB 4G43B 1J1XH 2OL3A 5IB1B 4XHJC 2YN3A 3SKOA 4D9LL 3GMRB 4GG8A 4BH7A 2XN9D 1MWAA 43C9B 1U8PA 2Q76A 2WQRA 3UTQB 3MNZA 3KPPA 3U9PH 1ZE3C 2FCBA 4YXLH 2Z8RA 4FFWD 3PABB 4M62H 2Y5TB 3QI9C 5ELIA 4K9EH 1NMCB 5C0JB 2FX8L 3MCG1 4LQFL 4QYOB 3T0AA 1MCOL 3GEWB 4NKOA 4DK3A 4EIZC 4QHLA 5FYJH 4KXZH 1XF3B 2P8LB 5KN5B 4BSVA 4WUUB 1JTTA 35C8H 4S1RL 5DSCB 4X4YA 5ISZA 1Q9LA 5FKAB 5C08B 4PD4J 2DDQH 4EZMA 4PJDF 4U6VH 3S8WA 1J8HD 3CVHA 4KKAC 1I1AD 3V7AG 5I15L 2G75A 1S5HA 3VFPA 1AFVL 4L4TD 3MO1B 5ICXB 2CLVB 4S10A 3KVQA 5HVHB 4OD1L 1FL5B 4RZCA 4AEIH 3AS2A 4QXUH 1PLGL 5C8JB 2A6DA 1C5DB 4ETQB 4FFYL 4JG1L 3GIVB 1NCAH 3HE7C 4HKJA 5D8JH 3H8NA 2CUMA 3HFML 5B8CA 4MAUL 4YH6A 1L7TL 3PWPE 4NM4L 4PJFF 3UTZA 5B3NA 5E6ID 1EUTA 3F7YA 2FD6L 5ICZB 5EC2B 3ULUH 2DKSA 3MV9D 4U1HB 5HDOA 1DUYB 1FZKB 2CLRB 3QDHA 1DZBA 4P9HC 1S7WA 5AG8A 5D2LF 1KB5L 3SE4A 5ILTL 3MA7B 1YEHL 5ACMA 3H42H 2X4RB 2CMRL 4RDQF 3A6OA 5DJZB 3MLZH 2YD4A 5FA4B 1P7QD 4U05A 3WJLC 2ZCLH 1U92A 4LIQH 4J3VA 1BAFL 4PRIE 3L1OH 3DRTB 1AJ7H 2JF1A 3DRQB 1XIWA 5HDBF 1ORQA 4DN4H 1EVUA 3G08A 1ND0B 4QRSA 2AK4B 1DFBH 3VFWA 3X13B 4E42A 1QSFA 1X5FA 3FOLB 5DEGA 1ZOXA 1IAII 4IS6B 4MX7A 4GBXB 4PRNA 2QTEA 4RWYH 2P49B 3P30L 4BKLA 5DJCB 5BS0B 1R5VB 2OQJB 1A6UL 4KJWC 2V2XA 3QFJB 3T09A 2W0KA 1U36A 1T0MA 2X2YA 5JHLH 1A2YA 1B6UA 1HHHA 2YK1L 4YBQC 5L9DL 2E9BA 3N06B 3W2DL 1KENL 2FX9L 1UM6L 3VH8A 5AZEL 3O9WA 1MCBA 3CAFA 1KN4L 3UZVB 1JF1B 3R4DA 5ESVA 5IBUB 1P4BL 3FQUA 1UC6A 1R24A 1A6ZA 1X4ZA 4PGEB 1WITA 2YA0A 2ZP0T 4JPWL 4DZBA 1MI5B 4BFEA 4L8BA 3V2AR 5CHNA 4UB0L 5EG6C 4FQHA 3TO4C 1FLRL 3TO4B 1LEIB 5DRXA 3D25A 4M8VA 2QQLH 3K8KA 2IANE 5ABDE 3REWB 5SWSD 3HMWL 4HQQL 4ELKB 1IEAB 4HJGB 1INQB 2H32A 3H3PL 5TDPB 1D5ZB 4KXZI 3MOBL 3BVNA 1NC4B 4BZ1H 2R1XA 5I8OH 5IOPB 3ZKND 1UWGH 2HN7A 3MLSL 5DR5H 5F1SA 3DV4A 4B0MM 1KCKA 3V6FA 5T3XH 1DQDH 5I1JH 4PTUA 3ARBC 5TPWL 4WTZA 5CP3H 3AS1A 4OZHF 5B38A 3OAYK 3P9LA 5J56B 3WD5H 3SQBA 4N0CC 4JQVC 4P4KA 3FT3A 1WWAX 1G1YA 3KPRD 4LMQE 2I26N 4K8RD 1PG7W 1S7TA 3ARGC 1P84K 1R5WA 4PJHE 2I5YL 4QF1A 3FT4B 4WENB 5K9OB 1AGFB 5GIRB 1DLFL 5JO5B 2Z91A 2VE6B 2APBA 4P3CL 3SJVD 2FHBA 4YPGA 4JQIL 2NXYD 2GHWB 4FXGA 5DJDB 4RGOH 3MRCB 3LIZL 1UYWL 5SV3A 1S5IH 1G9ML 3QG7H 2V7HB 3WCYA 1LO4H 3W9DA 1GPOH 2OYPA 3ZKMD 3EYOA 1BMGA 3ZT6A 1KB5A 4Z18A 1YJDL 4ODVH 1S9WB 2H26A 5HHNA 5GHWH 4PP2B 5CJBA 1LO2H 1F90H 1OWWA 3O4LD 3MC0A 1ZWIB 4GRMB 1PKOA 1YNTA 4X5WB 1N0XH 4ZXBD 4IBLT 4FZEL 5KSVB 3NA9H 4BYHA 3HNSL 5DI8A 3OBAA 2WLZA 3MRDB 2VXQH 4OZFG 5C2UB 5I17B 1F45A 1QR4A 2DQEL 1NJ9B 3WL9A 4EBQL 1PG7X 4E41E 5ALCL 5I8EB 3NFSH 2F74A 4OTXL 4Z77A 2QSTA 3GMOA 1XGUA 3R06B 5K9JH 2VLJE 2XWTB 3RGVD 3TPUB 1RJZB 3O6FC 3LSOB 4P2RE 1OAQH 3O6FB 3OXSB 4OFVA 3D69A 3MRFB 2EDXA 2Y4SA 5J9PA 5C7XH 1PJ9A 1QZ1A 2OM5A 5SWZA 4BUHA 1MJJA 1FGNH 5HYJA 4RMQA 3RUGE 3T0EA 3QEGL 4U6YA 4PJEB 4Z7WF 2R29L 4KJQD 3VJ6A 4PJAB 4FXKB 4U1GB 1JRHL 1KJ2B 1ODAA 1IKFL 1QRNE 3O2DH 5C0CD 1PKQA 1MLBB 4WWID 3W5NA 1OGAA 3DXAD 4UIKL 5TH2A 2CJUL 5DJ2A 1FFOB 1G7MA 4HKZB 3PNWB 4K2UL 2BHYA 3BMVA 4YUEL 5HGGS 2UUDH 3MLTB 5C09A 4M8QB 4R2GD 4JM2B 1OP5K 3U0PA 1Q94A 4RFEB 1F4XH 2CDEB 4MNQD 5HI3C 5F3BB 1CFQB 1MRCH 5B3JF 3MRHB 3P4NB 3U6RB 3MPCA 5J6HB 3OR7A 5CZKA 2DOCA 4K3DH 2ICEA 3SDDD 5JW4M 4XC1H 5BCAA 1JGDA 1JHKH 3TIEA 5IEHB 3DHMA 2MSPA 1NBZB 2OMNA 5JQHC 1TCRB 4RQQA 2FLBT 1T0NB 5E4EC 1LD9B 1RHHA 4RNRA 4ZUTA 2R39A 1MAKA 3K4AA 2BSTB 2EE6A 1DBKL 3V4UL 1AXSA 2F53D 5E4IA 1FFRA 1TCMA 3GSNH 3ZSSA 1H15A 1I9JH 5J89A 2EYTA 1A3LH 4UT9L 2D0HA 2UWEB 3ESVF 5F1IB 4FNLL 5DHYB 4HWEH 3LQAC 1FFNA 2DBLL 5MEPB 5JPMA 1JWUA 1AI1H 3ZYJA 1HN1A 1N2RA 4OSUL 2B20A 3LKNB 1EUUA 1Q0XH 1XGQB 2CKBL 2YPLA 1LO5A 1UA6H 2AK1H 4HUWB 5AWNL 2X4PA 5E08L 3IVKB 1FNEB 1YQ2A 3PXJA 3IDNA 1LE9A 3RVVD 3KWWB 3ULVL 1L4IA 1SJXA 3BQUB 1GL4B 2GFBB 4GLRH 5MERB 3VFNA 1QG3A 3HAEH 5T1DL 4LARL 4OF3A 1MAJA 4B7IA 3DOSA 1F02I 1G7LA 2LE9A 1U8HA 1KPVB 3FT2B 5C0GB 4LSUH 1S7SB 2R1YA 1Q1JL 1SY6L 4E9LA 1FV1A 2R2BB 4NWTL 4KQ3L 1AKJA 4S1DD 3QB7C 4HPYL 4KI1A 1P6AB 3KLDA 4AMKL 4NNYB 4MWFB 1QHPA 2W9EL 4JRYE 4UV4H 5IW1B 5MEQA 2GK0A 5J57B 2P7TB 3N9GH 3MRRA 5KVMC 1YEDB 1HI6B 3HI1B 2R69H 3IDXL 1HHJA 1J12A 3EYFB 3L3HA 3MRLA 4NO5B 4NT6A 4WU5A 5IJKC 3ARPA 2C3VB 2NY2D 3WUWG 4CGTA 2HAZA 2ITCB 5B4MD 2VIRB 1JN6B 1MHHA 2UY7A 4MXQC 1N26A 4NGHH 4XMLH 1IAOB 5TE6L 5EA0L 1UKSA 1B2WL 2X1OA 4N9OB 2JB5H 3VXSD 1IFHL 3PQYD 1DQLH 4HXAH 4Z76A 1XF4B 2XN9B 1MOEA 1EIBA 4OKVB 5C0ND 3VFOB 4BH8B 3V6OE 3GK8H 5T1LA 1JV5A 4S1QH 4G7YL 4EVNA 1DUZB 4D3CL 2X1PA 4O5LL 3MLVL 4RAUA 1QHOA 4JFFA 5TE7H 4FFWC 1AP2A 4M61B 3FFCE 1MJ7H 4EUPB 3AROA 1BJ8A 5GGVH 1IC4L 3TBWB 3B5GA 3I2CH 1GC1L 3ALXA 2L7JA 1T03H 1Q9KA 2DQCH 1Q0YL 1S9VA 1XCTB 5IP4A 4JFZL 2Z92A 1FZJA 5HGDA 1OAXH 4OCNC 4DUXA 2ZSWB 5IT2H 5D7IA 2ZUYA 3EYUH 4NPYB 4PTTA 4G9FA 1NSNH 1J8HB 2JJVA 1I1AB 3LKQA 5D2NE 1KJ3L 4KRMB 2YPVL 1HSAB 3JWDL 4JAMB 3FB6B 3BH8B 3GBLA 4L3EE 4OLWH 4UQ3A 3BUTA 5FKPB 5IF0B 4Q9BA 2EDYA 5LGHL 3L3IB 3CK0H 4ZUVA 1HHKA 1UACH 2IEPA 4AG4H 5E6IB 2DM3A 3MFFA 2V5YA 3CGTA 1ZA6B 3MV9B 4LU5H 1EO8L 5CKGA 5FYKU 3MUGA 3QQ3A 2LV4A 3LMJL 3C6SA 3HNTH 1KTDB 4G42B 5CJQH 5FO9B 2R0KH 1J9CT 5C0BE 2X4QB 1PSKL 2CK0H 4XH2A 5I1IL 1E27B 3VRJA 4H8WL 3NA4A 1SY6A 4ZG1A 5BV7C 1P7QB 4X99B 1G6VK 5BV7B 1JPST 4GXVH 4Z0BL 4BM7A 2Y1VA 4HAFA 2ZZUT 5E5MA 3O3AA 4U1JB 5D7SL 3P4LA 5D7JD 4XP6L 5BRZA 1I4FA 1MJUH 1ZHNB 4NUJB 3WXVH 5IESH 2Y5EA 3MYJB 4ZAKD 1NKRA 1K4DA 1KN2H 3D39D 1ORSB 1H3VA 4TVPH 2Q7YA 2PN5A 4S1SH 5HYJE 5FYLH 2VUOA 5GGSY 3MUJA 1C7SA 1HNGA 3LKPA 5F9WC 5L2KD 3S35L 3V0WH 4X6DB 3C5JB 5EZOL 4KMTH 4MMZC 1XGTA 4QRPA 3CH1A 4R4FL 3F7VA 5DJ8B 2VDMH 2FL5A 2WW8A 3SDYL 3L3OA 5I1EH 3FQWA 3N0PB 4QRQA 1DEDA 5HDQH 4GG6B 5IJVB 2JK5A 4UV7L 3KPSA 3PL6A 3E0GA 2I9TB 1IILE 2VAAA 4YHIA 3QZWA 1FNSL 5EFIB 1JI1A 1KJ2H 3NH7H 4XP1L 4NN5C 3QEHB 4NQDA 2WZPD 4Y5VA 2G5BA 3HPLA 3MR9A 1NGXB 1CGTA 4WO4A 4X6CB 1YEIL 3KR3H 5SWSB 4XWGH 1LVEA 1NEZG 1E6OL 1TVDA 4C54A 5J0BA 1U8MB 5CD3A 5IMOB 4ZS6C 1JZ4A 4U1KB 4XPHH 1CZ8L 1HSBA 5GGTH 4XNXH 5BMFL 3LN9A 1CG9A 1SEBA 3BESR 2HT3D 4OUOA 1G0DA 2PO6A 4LLQA 1U6AH 2B4CL 1VGEH 2XTJE 3FO9B 1W72B 4M4RA 1V7MH 5DD3L 3FQTA 1ZKAA 4PJFA 3FKUS 4MJ5A 4FQ1L 1WFUA 4PGDB 4X8XA 2ORBL 2ZCHH 2DQIL 3UYPA 3DO3A 3KPRB 3HZKA 4UT6L 1I1RA 4MA7H 1C16A 1OAZL 5K9KA 5ITFB 5I1DB 3DVNA 5F7DA 2VITB 4AT6A 4ZQKA 2W0PA 3L9RB 1ZLUK 3H9HA 5D6CB 3THMH 3SJVB 1U0QA 3RWJA 1KEMH 2R4RL 2NXYB 4PGJA 4ZFGL 2XFXA 3VFRB 3L5JA 3NABL 4DEPC 3G04B 5IHZA 1KACB 3FO2B 2W9DL 1CDUA 3DYOA 4HV8A 4W81A 1KSRA 3OB8A 1YC8A 4JO2H 3DMMD 3VDCA 1A6VL 5H94A 4WTZG 2FEEL 3OKMB 2FR4B 3F12A 3V4PL 3PGFL 4FFVC 4NSKB 5CP7A 1D7FA 1MVUB 3O4LB 4M4PA 3EYQC 3G5VA 4O2FA 1A1MA 4ENEC 3MODH 4ZUUB 4YWGH 4ZXBB 4M7LH 2A6IB 2VH5L 3ZTJG 4BQ8A 3IF1B 3GMNA 4LNVA 5HYIA 3SPVA 2BNRD 1I9IL 5DDHA 2AJ3B 3W11C 2E8ZA 4NJ9H 3DYPA 2VDQL 3VFUA 3I85A 2P5ED 2WUBH 5LQBH 2IH3B 1UH3A 2VXUH 4KKNA 5CEZD 3CZFB 4C4KO 3WHE1 4UIMB 4KK5D 1IBGH 3KPTA 3RGVB 4AEHH 5JOFB 4L8SC 3NAAL 5L88H 3CZJA 1BZ9B 1KOAA 3WKMH 1A6WH 1H3WM 2J4WL 4LSPL 4N8CL 4MB4A 4JFQB 1RUAL 1FHGA 5KSAA 2EIZA 2VNCA 5I1CL 4FFZH 2M1KA 3QCVL 3FOMA 4MJ2A 2KQMA 4U1MB 1Q9WB 4KI5E 3HG1A 2EH7H 3VGGA 5IEKB 1OARL 2ARJQ 4PJXB 5C0CB 3RWEA 4F7CB 2CQVA 2PTUA 3DXAB 3U4EB 5IV2B 3QO0B 4X7DC 1YQVL 3U46B 3QPQD 5HHQB 2DM7A 3RRQA 4WIQA 1IQWH 3GSQB 1CCZA 3U30B 1YEJL 2LFGA 5BXFB 4JY4A 4R2GB 5IFAH 4EXPX 3TM6A 4OI9A 1QA9A 2PYFB 4MNQB 2J12B 5C0FB 1NBVL 4LAQH 2HRPH 3FQNB 3IRPX 1MFCL 2VZVA 4KUZH 5DRWB 4WW2F 4YDKH 3IU4H 4G80B 1HINH 3WUWB 4Q0XH 4QXGH 3SDDB 4KK8D 2HLFD 1EMTH 1D5IL 1C08B 2GSIA 3LN4B 4GRWH 4W4NA 1HWHB 4ZNEE 1GZQA 2VZ3A 3K80A 1CS6A 2K3TA 3E3QC 5GRVL 4BZYA 3J7HA 4JM4H 2FATH 4CMMB 2IAMC 3UJJH 2R23B 3QNYB 1R3JB 5B39A 2ICWB 2X05A 2F53B 4BFIB 2J5LB 4KROD 1EVTC 3CSYA 2CDGA 3DUSA 4YBLB 5DO2C 2F5BL 1L7IL 5D7KD 3FFDB 5GGQH 2VXTL 2ZPKL 5FYKD 1YMMA 4QHMA 4G8FB 1CDYA 3B2VL 4PG2A 5EORH 3ZKSD 3UPRB 3BP7A 3EJYD 3PIQB 4MXWL 1KLFA 3IXTB 1UH2A 2EXWC 3H3KA 3DETC 4OGAC 1MQKH 1NKOA 1CLOH 1GGUA 1IAKA 3TCLA 3TFKC 1D5XA 5DD5L 3BIAX 5IB5A 3TF7C 3X3FH 3CC5A 4XNYL 1MH5B 1WBZA 2A77L 4HBCL 1OW0A 3VWKA 4OFPA 4QKXB 1WWBX 1UM4H 3QDJE 2WBKA 3N1PC 4YHYC 5D1QC 3KYKH 1G7QA 2GTWB 4DUVA 3X11B 3RZCC 2YD7A 4NNPL 4NQSA 1CXIA 3MBXL 5IVXF 2HG5A 2MKLC 3O6KH 1S7VB 4WCYH 1JTOA 1QFUL 5JDJA 4KKBC 1PZUB 3QUYC 1BIIA 4OZIE 2BVQA 1MFBH 1ZTXH 4YIQA 5D5ME 2NY4C 4EI5D 1BFOB 1KCUH 1T1WB 4QXTA 5ESAB 2VUYA 1E4WL 1BVLA 5HGHB 2NY2B 2BHZA 4PUBH 5FGRA 2X1QA 4Z95H 1X6LA 1X5KA 3IJHB 4MNGB 2OR9H 2GYSA 3HHRB 2AS5M 3EJZC 3O81A 4JN2B 2V5RA 5DK3A 4M48L 5I1AA 4KTEL 1I9RL 1U58A 3VXSB 4N0YH 4PJDE 3PQYB 1RIHH 1UZ8B 3S88H 3ES6A 1NFDB 3MGTB 3C6LD 3OX8A 4OZFH 1GIGH 2IWGA 2AJXH 1VHPA 3EYVA 1RZKC 4KHTL 2WM0A 5C0NC 4D9RE 4X80H 3WIFA 5DS8B 3OAYH 4Y1AD 3ROLA 4JR9L 2D7OA 4G8GD 1UCBH 2BFVH 5ESQA 5IB3A 4PJCB 1UKTA 2CDFA 3CMOH 3M45A 1AIFA 3SGDI 4HT1H 2PETA 2W0FB 5IKCB 3WE6A 1EJ6A 1EERB 1ZEAL 5KVGL 5D2LE 1IGTB 5AEAA 4I0PD 2VISA 2IBBA 2GJZA 1W72H 4NKMA 1PG7H 4M1DH 3SDXB 4RBPK 4NO2B 4K8RH 5HYQB 1B0GB 2DLGA 1E28B 4LVOC 2A6KB 2NX5D 3HUJB 4RMWA 1V5JA 5FF6A 3V5DA 4YDLC 3OTTA 2V5SA 1JCKA 4YDLB 5HDBE 3QHTC 4XVUD 4YBHA 3G6AB 4WGVB 1LK2B 2DQTH 2I9LA 4LEXH 1BJ1J 1VFOA 2QV2A 2VXVH 3GJFH 5E8DL 4M5YL 1DBML 2DKMA 4I48A 4CVXA 4PV9A 4XPBH 3MV8A 1KC5L 3ECBB 4JKMA 2VZUA 3CXDL 1V3KA 3BDYL 1EHAA 1Y18B 4UAOC 4DKFH 1UJ3B 5KS9B 3O2VH 3VFVB 4BSWB 3RWFA 3UTTD 1X3DA 3GRWL 3BT2H 3PHOB 5KW9L 2AW2A 3KPNB 4AK1A 5ICYA 4KKCC 3BGAA 4QWWD 5JHDA 1AGCA 1BBJA 2XICA 2PYED 4NO0A 3C9NA 3RFZC 3DO7A 3OF6A 4PG9B 4H88L 3IFPA 3E2HC 5J13C 3GSRB 1NCBH 5D7JC 4IRSC 4CDHA 5D7JB 3UTPE 3NACH 3C8KB 4C56A 1AXTH 1BBDL 5D1XD 2J6EH 4NKDB 2ZSVB 1QFHA 4ELMF 3WNNA 3B3IB 2R0LL 3KS0H 2MQCA 2X4TA 3D39B 1PEZA 3RWGA 3VGAC 2FJHB 4AQ1B 4OQ1A 2EO9A 5I0ZA 5I1GL 4QLRA 4OFYD 3HA0A 3OAUH 4FQIH 5L2KB 1ZANH 5T33L 3HG1E 4NJAL 3FRUA 1VEMA 5H35B 5I9QB 5EZLB 1OP5H 5E6YA 4OZHE 4NQEA 4U3HA 3LH2H 4JO1L 3SY0A 2P44B 4XNZC 5DK0A 3HE6C 3AMKA 3LS5L 1DEEB 1FL3A 3HE6B 4Y4KA 3MRBB 1IC5L 3G6DL 2QKIB 5D6DA 4OI8A 2B5IB 3P73A 3Q6FA 4U49A 3SDCD 3KJ4C 3FONA 1OGTB 5F71A 4Y89A 2ADJA 1MY5A 25C8H 4HG4J 1MCCA 5C6WH 1EEUA 3SGKC 1Z5LA 3D9AH 2XPGB 5JPNA 3GFUA 3PDGA 4ALAL 1MEXH 4XCEA 5TF1L 3TWCL 1VFUA 2Q8AL 3MJ9H 5C0EB 1QKZH 4LGRB 1JIBA 1JFQL 3INUH 3P9MA 1I7UB 2CGRL 5D70H 1QPPA 1CDIA 3MOAH 2HT3C 4AEFA 1C5BH 4Y16D 1PW3A 3EIFA 1IGIL 1YY8A 2ARWA 3IDGA 4LHQB 1CBVH 3FMGH 3GO1L 3B9KA 3P3YA 3QWOB 4TULH 3P4OA 5TGBA 1F4YH 4R6UA 3RU8H 5GS1C 4FQQB 5GS1B 3BJ91 1DLHA 1OLLA 3LKSB 3REVB 5FECA 2EE9A 3ULUF 4XPTH 4GXUN 2F8VA 4OLZL 1A6AB 5DMIH 2X70B 5CEXA 4JFHE 1YDPA 1G7HA 1WT5C 3UZEA 5IQ7L 4OAWA 1T2QL 3BPNB 4DVBA 4LCYB 1P9MA 2NZ9D 4GW4A 4NRXA 5CJXC 2DYPD 2Y72A 4L3AA 5ALBL 5FDWA 3X14A 1M7DA 1BFSA 3DMMC 2XQBH 2BC4A 3L3KA 5F1KC 3DMMB 3FB5A 3TV3L 4BSJA 4OGXH 3GRWA 1XZ0B 1CL7I 1IARB 4KTDH 5M7QA 4XCCH 3QDGD 3Q3GB 4ZPTB 3V52H 1U8OB 2BNQD 3AU1B 1UXWA 2OL3H 2VC2L 2BMKB 3EKCA 3QWRA 3K2UL 1K8IB 4MD0A 3NZHH 1MWAH 4Y19A 4NC1E 4Z7WE 3QISA 2BNRB 3H9SE 3LQZB 5C07A 1P1ZB 4UNUA 3CFEB 4M5ZH 4Z7OF 1LE5B 3UBXB 4F9LC 2EE2A 3T0BA 2P5EB 5SV4A 3P2TA 4MAYA 1NCCL 4I5BB 5IK3A 1H9VA 4OD2B 2HYMA 1DQML 3TA3A 5HHOA 4R90L 3OKDB 5D1ZD 3MRNA 4MJID 5EZIH 4JEGB 2DMKA 2JB6A 5B3JE 1CLYH 1TIUA 4QCIA 4R8WL 5C1MB 3HCVA 4F7MB 1BFVH 1P2CA 4HDIB 3NIGF 3KYMA 2ZUQC 4R96B 3EUUA 3X3GH 3EOTL 3RY4A 3CVHH 2V17L 5A16B 1O0VA 2Q8BH 3I02A 1CDBA 4U1IA 4LCWA 4OUUB 4FXLA 1UGNA 4ZO6A 3Q6GH 3QUZD 4Y88A 5E2UH 3DJ9A 3H7BB 3T2OA 4O58L 3MCLH 3NFNA 3QPQC 2ESVB 4Q58C 3TCXA 4ZS7L 1FYTE 3QXDB 2P5WE 5EO0A 3C2AL 4U1NB 1W0WA 2G9HB 1FDLH 4HGMA 1XR9A 3SE3A 1TQCC 3OMZA 3UMTA 3QEUB 4YE4H 4GSDH 4ZDHB 1MCIA 2AJZA 1Q9OA 1YEGL 3NCYP 2A74B 1J5OL 2ICWI 5EU3B 1OAUH 3DURB 4MVBD 3BE1H 1OPGH 1JPTH 4QEGA 2XNAB 1RU9L 1M6OA 1URLA 4I18B 4NRZA 5JORB 4KROB 2HJFB 3BGFB 3IFOB 5E9DE 1QPXA 4HJ0D 4R0LB 3PWPD 2EDWA 4APQD 3QHZH 2D0GA 3QNXB 1FNGB 2E7BA 1JNNH 1G6RL 5DFVC 1V05A 1EX0A 1ZA3B 4V1DA 3WNOA 5IMMB 5LCVH 3BXNB 5IHUL 3BPCA 2IBZX 3QCUL 1C1EH 3FN3A 5DT1L 5GRZA 3RTQD 2XWBA 1WICA 1CGUA 1AGBB 3GSUB 4HKXA 3TT3H 3VXTB 3WLWD 4F8TA 4Z8FH 3CDGB 3MJ8B 1ZS8B 3CLEL 3RZWA 4J1UB 4LASL 3WFBL 3STZA 5F1OB 1UWEH 2YUZA 4D9LH 4PRID 3HB3D 1HOCA 3DTXB 1MCHA 4MDJB 1M05B 1F3RB 5E00B 3T77A 3KPOA 4I2XA 1U8QA 4KJYA 3K7UA 4JQXA 2JIXD 2F54A 2H32H 5F97E 4EOWL 1BJMA 5CKAA 1FC2D 1FE8L 4LQFH 3Q5TA 3SEPA 1SJEA 1MCOH 4MXVE 3ZSTA 3NZ8B 5I74C 1JHLL 1XH3A 3KYOA 2PXYC 4EI5B 5IUSA 2PXYB 3QAZB 3CPLA 4S1RH 1D9KA 2M2DA 4RX4D 1HHIA 4XPGL 5CBAA 2O5XL 5I15H 2UZYB 4NRYA 1AFVH 1UM5L 3DX7A 1OD7A 2V2WA 4OD1H 3ZTJH 5F21B 1PLGH 5DK2B 4WW2A 4B7LA 4FFYH 4JG1H 3WS3B 5I8KL 3NN8A 3WJJC 4JFDD 3C6LB 4AIZB 1P7HL 2BX5A 2IAND 3T3PF 3HFMH 1G9EA 2CKBB 4MAUH 2XKSA 2ID5A 1FNFA 4PJ7B 4NM4H 3R0NA 3WHXA 2BY3A 5E8EA 2FD6H 5D7LA 1J10A 4Y1AB 2NTSP 2BOCA 1ZT1A 4L9LA 4O2CB 1KB5H 2C5DC 1R5IA 3D85D 3M1BA 2EZ0D 4G8GB 3G6JA 5ILTH 1T7YA 1YEHH 4CADB 3OGCB