3HB3C

High resolution crystal structure of paracoccus denitrificans cytochrome c oxidase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
b'EVKLQESGGDLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVASINNGGGRTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCVRHEYYYAMDYWGQGTTVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1-beta
publication title High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase: New insights into the active site and the proton transfer pathways
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hb3C00
4JGMA 1BD2D 3SJVE 3LKPB 1RZKC 1I9IH 3Q6GL 4HQQL 4ZYKB 4MJ6A 5HHOB 2WZPD 5FKPB 1X7QA 2XICA 1JZ3A 4OQ1A 5FUCC 3S37H 2D3VA 1FIEA 4O2FA 3KYMB 1FO0H 5ESVB 2CR3A 3RJQB 3LRHA 5BVPH 2X7LB 2AGJH 1RZGA 4MXWL 3X3GH 2XT1B 5INDB 3NIDE 5JHDE 1FVDA 5HGAA 5TFSH 3QFDA 4P2RA 5EBWA 4OLXH 3U1SL 3PQYE 5DJ0A 3UBXG 2WMPA 1MI5D 4Z7UB 3PXHA 2GJ6B 4PJEA 4NSKB 3FB5A 3MBXH 1OGTA 1LNUA 2R4SH 3U46A 2V2XA 3S36X 5C0CE 3K7UA 2LV4A 2P24B 4JFPB 3MJ9H 4HJ0D 5F1KC 2XQYK 3MA7A 2EC9T 1CZ8L 1MJ8L 3QEQB 1JL8A 1MHHB 5LWYL 3EDEA 4LKXA 4QRPA 2APTA 3TJEL 5D1XD 5IIEA 4JGUA 5CBAB 4L3CB 2EH7H 3NTCL 4FQJL 4HS6B 2NY3B 3CSYB 3B5HA 3TNNB 2A6IB 1NCUA 4P48A 4JFFD 5JA9A 3FT3B 5E6IC 1FZKB 1W8NA 1AY1L 1XGUA 1MFNA 2ICWA 1PLGL 1MIMH 3RIFF 5CLWA 2M2DA 3K3QA 3O9WD 4ZNEA 4JFQB 4ONHB 4PV8B 1NGYA 3V4VL 3HB3C 5J57B 1JGLL 1MLCB 2R4RH 3VRIA 1QQDB 1PYWB 1DN0B 4ZUVB 4XAWH 3G04B 3O2DA 1DSFL 4XZUB 3TO2A 1ND0B 3MV9E 3EW3B 1CICA 5HHQB 2HLFC 4NNXA 3SDXA 2ITDA 2NLJB 4JQVA 5IUSA 3NFPA 4XTRC 4CN1A 3IU3B 5MENB 2R2BA 3NAAH 4TTDD 1MIEH 3RA7H 4N5UA 1IGYA 2AW2A 4ONGH 1BM3H 2ZP0T 1N7MH 4W81A 1MJ7H 2X4TA 3WD5H 2X1QA 5JXEA 2CRYA 2FR4B 3KJ6L 4M7LT 4WW1A 4F15B 4H26A 1K5NA 4R0LA 1IC5H 1BOGB 2FZ3B 3GIZH 5IB5B 4HPOH 3RZCB 1A14H 4P59H 5IFAL 1BIIB 4D9LH 1YUHA 4ZQKB 4FFWC 2XN9A 1CFBA 5C6TL 3C8KA 4ELMA 5EU5B 2OR9L 4AH2A 4MMXC 4PJ5A 5IHZB 1A7QL 4LCYA 1LEGB 4X99B 5B21A 4YHOH 4NQEB 5HHPB 1I7TA 3MRFA 1MCNA 1F5WA 3NIFF 4J8RA 4ORZC 1RZKH 3NPSB 3C09B 3QI9C 1ZEAL 3JV6A 2YPKA 4GW1B 2IJ0C 3W81A 3SJVA 2V7NA 1G9NC 2NPLX 4PYGA 4X7TB 2IPUK 3MRRB 1CXFA 1A2YA 4JB9H 2GJZB 1AGBB 2PYEE 1RZJC 2K7QA 3O4LD 1L6ZA 2AV7A 4UTBH 3OKDB 2NXYC 4GRLA 4WU7B 1BQHB 4ZXBC 3WDHA 4HSQA 3I3BA 4P5KA 3VMOA 4PJIB 2XKNA 1C16B 1TQCB 3QISA 3WFCH 5FYJU 4QHNB 1I1AD 1ZANL 3DUUB 4UILH 5GGVH 2EEBA 2F53B 5D1QB 4FTVD 5T1KB 3EDKA 4KDTA 1Y6KR 1A9EA 1NAMB 3PWUB 4XNZC 1SEBB 3VI4E 3BHBA 2XTJE 1X5JA 3KHOA 4N8VB 1LO4H 5BS0D 1AO7E 1U3HA 1KNOB 5JPNA 1CL7H 3VXRB 5C7XL 2KQMA 4IRSD 4AY0A 2EDXA 4XNQB 3MA9L 4OFYD 4L4TB 1P5VA 1S7TA 4HWEH 1DANT 4LIQL 5FGCE 2G2RB 3C6SB 1YYMH 3ULVD 5JUEL 1AKJA 3MZGB 3AU1A 3X11A 4R7DA 1IAIM 3QEUB 4U7MA 4Y5YC 3U30C 4OIAA 4AENA 2IGFL 5C0IB 2O26U 1CT8B 2O5XH 4JFEB 3A67H 5E1HB 3GUTA 4GKZB 2A83A 1JF5A 3FQWB 1NKOA 2F15A 1OAXH 3DNKA 4L9LB 3VFRB 5FO8A 4OI9A 2VDRL 4R4BA 4ERSL 4HKXA 5HYQA 5EOCJ 2XV6B 3C5JA 1U8OA 1MPAH 2CKBA 1NBVL 1JTPA 4NUJB 5DHVH 2JELL 5D8JL 4MSWB 3S88L 3SGDI 4EI5D 2LABA 3OKMB 3H42H 4PD4J 1RJYA 3EOTH 1HN1A 4GRWE 2I24N 1NBYA 1MJJB 3OBAA 3TO4B 3MRMB 1JZ5A 4JFDB 3GDBA 1CFQA 3B6SA 4ZS7L 4K9EL 3SDYL 5C0BD 1R24B 5DJ6A 2HTKC 4HHAA 5F7KC 1ED3A 4IM8A 2FIRT 2EKSA 2QKIA 1NAKH 4L5FH 5HBBA 3EUUA 4E9LA 5IT2L 2NX5D 5HHOE 3BQUA 3INUH 3T0EE 1XCTA 4AEHH 1RUAL 4M8QA 4LPCA 3L3OB 4JPIA 3OKNB 4Y4KD 4X7SL 2B5IB 5FM5M 1IBGL 3GIVB 1P4IL 5E7BA 3E0GA 3GK8H 2X4SB 5C2BL 1GH7A 1RUPH 4TULH 1X6LA 1CDBA 4PJBF 5GGQH 1OP5K 1IKFL 4R4FL 4UQ3B 3RTQD 3D39B 1P9MC 2IPKA 2GJ6E 2BVPA 5F7LB 3C5ZA 1X5HA 3S35H 3FN0H 3HAEB 1MCLA 1CD1B 4X8JA 4E41A 1XT5A 3T65B 3BGMA 3QEQE 3TA3D 3FO1A 1A5FL 5FA3B 3MRBA 4OLWH 5SWZB 1KTDA 4Z9KB 2XQBL 3NZHL 3NCJL 3RWJA 1I7ZA 4QRTA 5FUZL 2HMID 5K9JH 3MV8B 5HHMD 1QYGL 1NLBH 3RWEB 3L5WA 4HKZA 3SKNA 4ZODA 5BJTB 3GKWH 1IZJA 2DLFH 2D7TH 2YEZA 4WI8A 3P11L 5DT1H 4P5MA 2Y5TA 5DO2D 2PTVA 2YXFA 2IADA 1F4WL 4XAKE 1QD0A 1WGOA 3IFOA 3VGDA 1CFVL 4PJHB 2ZSVA 3VXMA 3GMNA 4ZSOB 1HHGB 1YEEH 3UTSB 1CLOH 5A40E 4YHYC 4PGBA 4POYA 1EGJH 4WI6A 1KC5L 1U93B 3IGAB 4JN1H 5F7YC 5HHNB 3P4OA 4U7SA 3GFUA 5B38G 1C5DA 5E08H 4XP6L 3K1DA 1QTYT 2NY7H 1KUMA 5JPMB 1GYAA 1RUMH 3ZDZF 2Z8RA 1RULH 1TCRB 3CD4A 1TZHB 3E1F1 5ESQB 4EVNB 4NCDA 1JNNL 3CC5B 5FDWA 3VRJA 1YDPA 1S9XA 2NY2D 1HI6A 2DF3A 3H2WA 1RIUL 4HGWB 2AQ3A 2IANE 3IJSB 4PJ8D 4WUKL 5FYLE 3W82A 2CLZA 3DRTB 3WDIA 4ODUB 4LNRB 2A6DA 3DARA 2OM5A 4WEMB 4M48L 1DVFA 4C83B 1MHEB 1CG9A 1BX2B 5IMKB 3O8XD 3BE1L 5CD5D 3PNWB 5GISH 4ONOA 4P23A 4YEEA 4M03A 1OSZA 2J8HA 4OFIA 2J12B 1H0DB 4X9HA 4OT1H 3QUKA 2A73B 4NKDB 5DEGB 1KTRL 1K85A 3O6MH 3BPLC 4IDJL 4LLWB 2NY4B 4JJ5B 3DV6B 4OIBA 3OKEA 3BH9A 2IWGA 1HQRA 3UC0H 3RUGA 5C0JB 1J1XL 2C5DC 1FSKC 2XG4A 4NO5B 1CN4A 4LRNH 4J3UA 3OHXA 2YS4A 2FRGP 3QCTH 4TTGA 1ZE3C 4FQ1L 4W4OA 1YEHH 1RK0A 3E6HB 4KK5D 3CNKA 2Y4SA 3ALXA 4JKKA 4RMRA 4FQXD 5DYOA 4YHMH 4P57B 3T2PA 4JPWH 1UWXK 4TSCH 3T0EA 4WUUD 4ODVL 3MJ7A 3O3EA 4EZMA 5KS9E 3S9DB 2CDEA 4NKMB 4PJIE 1GZQA 3W39B 3SHSA 4YPGA 2ARJQ 5D1ZB 1FDLH 2B8OT 4PREB 4DZ8B 3S8WA 1X5IA 2UWEF 2F53E 5MHSD 3KJ4C 2BY1A 4UB0L 1ZMYA 3SDCA 1CR9H 2Z91A 5CBEB 2OI9B 3SY0B 2LE9A 4LMQE 5FK9B 3HNSH 3RNQB 3VXRE 3MLWL 3EDFA 2V9RA 5FA4B 4CADA 4KUZL 5K59E 4L4TE 2FYYB 3KPSB 2HH0L 3TZVA 3BKCL 4DGIL 4LASH 3PJSA 4OFDA 2VQTA 3Q6FA 4YZFF 5F97E 3MFGB 1W8OA 1G6RA 1EJOH 1Z5LB 2HFGH 2XYCA 4Q2ZA 1LO4L 4JQIL 3MBEC 4QXUH 4C56B 3BKJL 2EDRA 1NGPL 3G6AA 5H8DA 3WHXB 4DK3A 3KLHD 3IYLW 4NOBA 4ENEC 2XZCH 4IRJD 2EXWD 3SGEI 1U3ZA 1G9MH 3HZYB 4KU1A 1VEMA 5DR5H 4HBCL 5MEPB 4DFHA 4L1HA 1DFBH 4LCCB 5KVEH 4KQ3H 5EZOH 4XNUL 1F8TL 2XRAL 5C07D 3IDXL 3MRNA 4JM2F 1U8JB 3L9RB 4KK9C 3GZKA 3UPRB 1G0XA 3HRZA 4JZOB 3PHSA 1WF5A 2X4OB 4HMDA 4JZNA 2QHRL 4AK1A 3VMPA 4F7MA 2VAJA 4H1LA 2EYRA 4K94C 3O2VL 3ULUE 2WWMC 1VA9A 4J12A 4GSDH 4NT6A 4OF0A 3STZA 3NZ8A 1AIFA 4PRBA 5ADPH 3O3DB 3MUZ1 5E2WL 3T2NH 1HOCB 1KFAL 4PLKD 4BFBD 1XGRA 3G08B 4MNHB 4PR5B 3QUYA 3W2DH 1S9WB 4PRPA 4JFXB 4MQXC 2IANA 2AAVA 3LRSA 1FFNB 2QQNH 5TE7H 1J05A 3IB4A 3VFPB 5ETUB 3KPNB 4KY1L 1D5XB 2HJLA 1OOAA 1EHLH 1BF8A 2E7LA 1CXKA 3MV11 5I73C 4JPKH 2YPLB 2ZCKL 2Y36H 1MEXH 1M05A 3GSOB 4XPHH 4L5FL 2QR0A 2P7TB 3VMNA 5EOQL 3MLYL 4Q58C 3D39E 3SDAD 4MJ5B 4LLAA 3EO0A 4WVRA 2BOBB 5JXAH 2X4PB 3OKOA 5KSAA 3GGWB 4JRWA 1JZ7A 2HVKA 5L0QC 5DVOA 4FNLH 4CDGC 1MQ8A 1RIHL 5SV3A 3QHZL 3U48A 4D8PA 5J3HC 1AXTH 4FXLA 3QH3A 5D7IA 2E9IA 1S7XA 1J1PL 4RX4D 2PN5A 2Z9TA 3W0WB 3GNML 2ZUWA 1F3JA 1BZ9B 5JZ7D 1FGVL 4Y8AA 3L5XH 3QDME 4HH8A 4EN3C 5KS9A 4PJHE 5IWLA 2WW8A 1G9NL 4UDUB 5IESH 2VUYA 4M8VA 3VD4A 4ZSOE 3UTSE 1UJ3A 4PYHA 1RZJL 2PF6A 3HMXA 2DJ4A 4G9FB 3WN5B 3ARBD 2NZIA 4TNVF 2DN7A 4Z7NE 3E8UL 3WS6C 4G6KL 4M3KB 4KRPD 5BOPA 5IG7A 2HJKB 4PP2A 2YRZA 3GSNH 4MGXA 5FM5O 1YEGL 4A6YH 1XGYL 1OP5H 3BD4A 4N0FB 4LSRH 3PL6A 4KROD 4YAQA 2J6EH 1DUYA 5CJQH 1A0QH 1GC1L 3ARUA 5I1LB 3WO3B 2B4CH 5C0RH 4GAGH 5HY9A 3HFML 1S5IH 5IEHA 1FNSH 2HJFB 1U8LB 3RI5F 3P77B 4I3GA 3BSZL 1PGRB 3ZT5A 5IFHL 3GEWB 4CGTA 5HGHA 4Q9CA 1F4AA 3QCVH 4P3DA 4MD4B 4WWID 1NEZB 1JZ8A 1A6WL 2YMXH 2ZOKB 5C08B 4P2OA 4XNXL 4MQSB 4B53A 5CHNB 2R8SL 2IALA 5KVDH 2WK2A 1LK3H 1JNHA 3H3PL 3DHJA 3F12A 3OAUH 4NPYB 3UTTA 3QFJB 3S5LG 4YXHL 5I1IH 4IOIA 1T66C 1IGFH 4I1NB 1H9VA 2MHAA 1MRFL 4K7PH 4WWKD 1S7VA 1AGDB 5EBLA 1P7HL 1IM3A 4B5EA 1MNUH 2QL1A 3HZMB 3QWRD 4HFWA 5BRZB 4BELD 4U6TA 5IR1B 2H32B 3R8QA 1RZFH 3KPOB 1ZSDA 3QXDB 1UB6B 3TIEB 4KTDL 4QGTA 3ARFD 1NGQL 4DZBA 1SJVA 3EYFA 4G3YL 1ZHLA 1IGJA 4ZPVA 5T5NF 2KZ1B 4XNMB 4L3EE 1Q1JL 5J06A 3T0DA 4I2XE 5C70A 5I19L 5DS8A 1J8HA 5TQ0H 2E27H 4M1DH 5SX4H 4OM0L 3OR6B 4X5XB 2OTPA 3TNMB 4QRSA 3KYNB 1CD8A 4M02A 5FYKD 1QEWA 2NXZC 5DRWA 2AJXL 2ADFH 1IZKA 3VCLB 1FZOB 3A6CH 1DUZB 2NW2B 3ARTA 3B9KA 4K23L 1JMZA 4JDVA 3VW3L 5C0AD 1SHMA 2VLJB 5EO0B 1AQKL 1NGZA 5SX5K 5F1OB 1KENL 5IOPB 4PJBB 1SY6H 3D25A 3KHQA 3F7RA 3MQIA 3C87A 4ZAKC 4YUEH 1PBYA 1BGXH 1UXWA 4IOFD 3BO8A 4CMHC 3PWNA 4ZMAT 1JHTA 2VITB 3KPSE 1D5MB 4O51B 5EC2B 3MRCA 5D7KD 4NJ9L 5DMGC 1N5YL 1F42A 4NO0D 2QHLA 4YXLL 4KQ4H 4G8FB 1AD0B 1MCEA 1QRKA 2SEBA 3OXRA 4NKOA 4TVPE 2R2HA 3BEWA 3KR3L 4HCRA 5EO1B 3QDMA 1ZGLB 3U2SB 3BW9B 3HR6A 4Z77B 1RUQH 5C0ND 1N59A 2W65A 5ALCH 1UWXH 3FFCA 5EN2B 1WFTA 2WM0A 3VFMA 5D7LD 5MI0C 5CIPH 3CVHA 1JGDB 4FQLH 5IVZA 3DSFL 2P44B 3CMOL 5DJAA 3L3HA 3IDJB 4WRLA 1AXIB 1QRND 2DIJA 4RAVB 3QPQC 3K4DA 1KJVB 2FECI 4OQTH 3L3JB 4XXCA 4HDIA 1S8DA 4KTYA 2A9NL 4H25A 3TVMD 1LEIA 1SYSA 4G6AD 4E0RA 2A77H 1MCWM 1AJ7H 4NRZA 3GMRB 1ITBB 1C08A 3QG7H 1U95B 1MWAA 4M7ZC 3BKYL 4APQC 4TSAH 3DYOA 3RVUC 4N1CA 3RY6C 3ALPA 1HZHL 1HINH 3SDDC 3FB6A 5DGRA 1A6PA 5C09E 1IGTB 1ZS8A 2OZ4H 3FQXB 2W60A 4N5ED 2IBGA 5TPWH 3O3BB 3JWDH 3V0WL 3MV7B 4K3DH 5IJVB 3E2HC 5I17B 3RJDA 1IILE 4F7PA 2CR6A 1S9KC 3UTQA 4AZ8A 3BDBA 3UJTL 5C1MB 3D0VB 4M1GL 2V17H 4OLUL 1FO0B 4U1NB 4RFEB 3EFFA 5GGTL 3AGVA 1AGFA 1FVCB 2M1KA 1G7IA 2JB5L 1A3LH 3F7VB 4HG4K 1T83C 2BHUA 4PJCA 3D48R 5I6XC 5EWIL 3NIFE 4Y1AB 2CLVB 4XP9H 2BNQB 4RGND 2A6KA 1XF4B 4OCWL 1A7BA 3D3VD 1NC4B 3L3IA 3O6FC 4K3HA 4NDMB 4L3EA 1D5BA 4WTZA 2F54E 4BQCA 3RGVD 4I2XA 1DQDH 1CLCA 4NZTH 5B3JF 1I9RL 3K4ZA 2VLRB 2CGRH 4HJGA 3STLA 3VE0B 1UZ8B 3CX5J 5FO7A 4U1SB 1WBYA 4KRLB 1XF5B 1GPOL 1P7QB 2EE9A 5BMFH 4MAYC 4FFZL 4H20H 3MNZB 3GSXB 4G9FE 3B8YA 5F72S 1KIPB 2UWEB 3ARXA 4LHUB 5FXCH 4M5ZL 3TBTB 5M95B 3BP4A 3QIUA 4NO2A 1YNKL 4AM0A 4YHIB 5ILTL 4PGEA 2Y6SC 4L8BB 5E8EA 3WIHA 4S1DC 3FB8B 2J4WL 4XP4L 5DD0H 1DQQA 3U4EA 4R8WH 2GAZB 1OAUL 5I71C 4UTAH 5FHBH 4P4KB 3OPZL 4GKSA 1KLFA 4QLRA 5DEFB 4OZGA 5EIVA 5IV2B 4YIQA 4A6YL 4DGYH 4JZJC 2BVOA 1R5WB 4L8SB 3FT4A 4LSVH 2XIDA 3CUPB 5CEZL 2ZKHL 5JHDD 1QVOA 5C08E 2J6EL 1ZXQA 1LHZA 3PQYD 2DQJH 5CKGA 3ZYZA 1S7SA 4QHLA 2AJVL 5HGDA 3QFJE 4GXUN 5C0CD 2P49B 4ORGB 3VXSE 4JM2B 4L4JA 4U1IB 2DD8L 4MA7H 2PW2A 32C2B 2NZ9C 1ZT7A 1BPVA 5DZOA 2VLME 5EU4A 2CMRL 2J8OA 2PO6A 3EHBC 4FG6C 3MREB 2GUOA 3IJYB 3R06A 1G7QA 4LEXL 1JGUH 4B7IA 4MX7A 2YA1A 4U1KA 1BEYL 2GTZA 3U9PL 4KVNH 2FNBA 1R3HA 2E9BA 4K94L 1U8MB 4MVBD 3ECBB 1TCMA 3K80A 3FFDA 2BSTA 4I0CC 1DBKH 3FN9A 1I85C 1DBBL 4HT1L 2ZSWA 4OZIA 2JJSA 2OTWA 3QXWA 3ZTNH 2D31A 3TV3H 1GOFA 4PJ7F 1CD9B 5CWSA 3ZDYE 1INEH 4PRNA 4LLDA 2PNDA 3RWGA 2Y7QA 3KS0H 1D6EA 4MWFB 1A4KB 1L0QA 4CAGA 2FJHA 5FYJD 4PJBE 3QUZC 3MV9D 3LQAC 4GBXC 3UTZA 1DL7H 2P8MA 5K9KB 3PG2A 2AEWA 1XF3B 4LVHC 2AEQH 3U36A 4ETQB 2HFFA 2VZ1A 5LGHH 1RK1B 5D7SH 1Q9LB 2DS4A 2MPAH 3DX7B 4LIQE 1HHIA 2AK1H 4PG9A 3BIKA 5IBTL 1J87A 5DRZA 2WUBH 2ZG2A 3BP5B 5CSBA 2OTUB 3LY6A 4HXBL 4PPTA 4LSUH 3T2QA 3AMLA 3ZDXF 1OAKL 2V7HB 3FOLB 3O3UN 3QEGL 1R0AL 3UDWC 3DTXB 2ORBL 4V1DE 5DFVD 1H8OA 3QUMH 2F54A 5TE6L 3MLSL 3QWOB 3IDMA 1YPZF 3F6IA 1I3RB 5EZLB 1R5IB 1OTSD 5IFJA 1OL0A 1WUNT 3RX5A 4OI8A 1LO0H 2AEPL 1MAKA 3REVB 2YKLH 1A4JA 3IT8D 4MZ3A 4TSBL 4LBEA 4P2QD 3LQMA 1OAQH 4MD0B 5EBMB 4QF1A 3D18B 3VWKD 4CW1B 4HGKC 3TWCL 3P73B 2ZCHH 1EFXB 3G6JB 3AREB 1NUNB 2ATKA 4XRCB 5TH2A 4LP5A 2WBJB 4XPFL 1UKSA 2IEPA 3CVIH 3O3AA 1PG7H 5F6IC 3GMLA 1RI8A 1FNEB 4PBXA 5E95B 5SX5H 2D7PA 5HSFA 3BPNB 5C6WH 4TRPH 2ADJA 2BCKB 4IJ3B 3B3IA 3BJLA 5F7HA 3QDGB 2PYED 5L9DL 1F4YL 1T5WB 3IVKB 1OCWL 3PDDA 4OZ4B 1DQMH 1YQVL 3N1FC 4FQLL 3GB7B 4P99A 3BXNA 3C60D 2H26B 3BVNB 1TXKA 4WI7A 3HG1E 4GKOA 1D5IL 2FO4A 5D5MA 1O7SA 1QFWL 5E56A 4NZJA 4HUXB 1T2XA 3QUXD 2XTJD 1MCWW 2CD0A 1AO7D 2VLKB 3MV7E 3TC9A 4RFNB 5GGSY 3FZUD 4TSAL 1JV5A 3VXSA 1LK2A 3BJ91 4OF5A 3L7EA 1XGTA 2MSPA 3LKQA 4X9BA 4CVXB 4Y16A 1Q9KB 3CZFA 4JRXB 2IAMB 3V6OA 1YEIL 4HLZG 4QWWC 3MGTB 1CU4H 4JVPA 5DMIL 1HCVA 3N06B 2HA1A 2BRRL 1D9KA 4QXTB 1W0VA 4HPYL 3RVTC 5E99L 5IQ9B 3T4YA 5IM7B 3S97C 1WLHA 1E27A 1OLZA 4N0CC 4AEIL 4HWZB 5D7JA 2BNQE 1IT9L 1DVFD 3KPPA 3NFNA 3RNKB 3BZ4A 3IDIA 4XVSH 5BZDA 4YGAB 3MR9B 3NFSH 2OL3L 1GGCL 4EUPA 3ZT6A 3RPIA 3J8F7 5I8KH 1V7NL 2YD5A 4HK0A 4Y4FC 5FM8A 1T1WA 4P23D 4WI3A 2VLRE 3MYJA 1I75A 4OBSA 4XWOD 4BKLB 4ZFGL 3IFPB 1CLYH 3JV4A 4ISVB 4NQCA 1T1XB 3VGGA 1T3FB 4GFTB 4JY4A 2DQCL 1OVZA 4ZO7A 5GJTL 5SWSA 1H3PH 1CGSL 4NNYB 1JHKH 5DLML 2GKIA 2NXYB 5C9JA 2RIKA 2CIKA 4HWBL 2UWEE 4XHJC 4RNRA 5TQ2L 2DYPB 1BF2A 1H15B 4HUWB 4XBGA 4YHPB 4L1DA 5FCUL 4Z7VA 3CFKB 5M94B 1JPSL 3KLAA 1CWVA 4Z95L 1PZUB 4UUJA 4NRXA 3CFDB 1M7XA 4U1LB 1X5GA 5GS3A 4QTIL 4H20L 1UACH 3N1QC 3VDCA 5HHOD 4HMCA 1YEDB 1KTKE 3NGBB 2G5BB 4OCSH 2V5SA 4G6FB 4MDIA 5F7FA 1URLA 1VADA 2QADB 1TPXC 1WBXA 3TT1H 3WJLC 4S1QH 4PJDA 1QFUL 1JN6A 3VDBA 1KEGL 3C9NA 1TNNA 4UDTB 4BSVA 3EFDH 4PB0L 4AIOA 2QSCL 3LPFA 1GXEA 5DMYA 5T3ZD 4QHUB 2HRPH 3GBLA 2GJ6D 1B0GA 1AGEA 5DQDL 5JQ6L 1FNGA 1P1ZA 3WEXA 5F89A 1NH6A 4P5TC 3DPBA 3HZKB 4HJJH 1FL6B 1LO5B 3TZVD 2R0LL 3QEQD 1MVFA 5E8PA 4LSPL 5EIQA 3NN8A 1WCQA 4KKLC 2FDBP 4TUKH 4KXZI 4N0YL 4PG2A 3N9GH 1AD9A 4P2CG 5HTSA 4DQOL 4X7DC 4XAKD 1WTLA 3DXAB 3HCVB 1GGIH 2VXVH 4LCWE 1JJUA 1MFCH 1A6AA 1L9MA 5AAWA 1T04B 4MHHI 2MCPL 3HG1A 5GS2D 2YZ1A 2R29H 3EBAA 4O58H 3UYRH 1ZTXL 1TJGL 1WVZA 1QFOA 2WP3T 1T0NB 1WZ1L 8FABA 2F74B 4OCRL 5FUCE 3JV0A 3ROLB 2V6HA 4PS4L 1NL0H 3E6FA 3RL2A 3TYFB 1H5BA 2OP4H 1ZVSA 5B8CB 4KMTH 1NMBH 1JWSA 2VDOL 3LOWA 1WBZB 4AL8H 4G5ZL 4K07A 5MEND 2GFBB 4XCYB 3WXVH 4UQ2B 1DQLL 4PTTB 4Q0XH 1LDPL 1TZIA 2FHBA 5FYLD 3LH2H 2Z4QB 3I02B 1YA5A 4WFFE 2DQIL 4KUCD 4JE4B 3GRWL 4MA8H 1I9JH 3ZYOA 2K1MA 5ANMB 1KJ3H 3M1BB 4GG8A 1T0MA 1IARB 2B2XH 2OK0L 3BDYH 4XP1H 3HC0B 4XB7A 3ZKND 3RZCD 4PRIA 2BVUA 1CK0L 1TTUA 2VMFA 5JIPA 3DECA 4OZFH 4QRQA 1FYTE 1W72H 3JUZA 2VDLH 3QRGL 5ACZB 5F1IB 4HXAL 2C3WA 3DUSA 1CDUA 2XY2A 2ZCLL 4NQED 4HFUH 3FQTA 4I3SH 4ONFL 4GAFB 3IETA 1CVSC 3P40A 2J88L 4U7KA 1AQDA 4JQVC 4FZEL 4YHYB 4TPRL 3HI1B 1XMWA 2K7PA 3T8XB 4W68A 5HYJA 1GZPA 2WNGA 2L7UA 3EGSA 1YC8A 4ALAL 1DP0A 2D7OA 4E42B 5JOPE 3KPMA 4YDIH 3X14A 4Z76A 5FOJA 2ZG1A 3OG4B 3H0TA 1JPGB 3RVVD 4R0LC 4I3RL 2DMBA 4HH9A 4WW2A 4P9HL 2F53D 5D1QD 5T1KD 3WIIH 4GLRH 1T7YA 3WS3A 3BP7A 3D87B 3LKRB 4HGMA 2P8LB 1HH9B 4LLVA 3LV3A 3VXRD 3BOVA 4U05A 1TETH 2PXYD 3BUYB 1QA9B 2R1WB 3CFEB 3RHWK 5HJ3A 3TJHC 1MH5B 4L4TD 1INQB 2P5EE 3JTSA 2WV3A 5E8OA 5T1MA 3NACL 5DD1H 4JRXE 1VACB 2W9LA 4MAUL 5FKAA 2DMCA 2L7JA 2N4IA 5HVHC 1W2KT 4M62L 1QBLH 4JY6A 1U8IB 4YHNB 5KTEH 3FAXA 1EHAA 2XI9A 5I30H 4N0UB 1SM3H 4JFED 1JGEA 4RISH 1OW0C 3TM6A 5DQ9B 5SWQB 4GRLC 1A1NA 3FB7A 4WU5B 5IVOA 1BZ7A 1F3DH 2O5YH 1MREH 4LCWA 4P2OD 4ODHH 3I50H 5DSCA 1FSKB 2VC2H 3HE7A 4N9OB 3QQ9C 5AWNL 4PUBH 5GRUH 2F8XC 2DICA 5JOFB 3LMJL 4U33A 1LEKA 5EORH 2V2TA 4KDTC 2R0KH 5HD8C 3P30H 4JR9L 4PJ7B 3O6KL 4MQ7A 4OI7A 1WSST 2JB6B 1U3HC 1P2CB 5I1JH 2FJFA 4S2SB 4EOWH 3TO4D 2FHCA 3DETD 5HPMB 2JKXA 3WYRA 4JFDD 3UJIL 3QQ3B 4K55A 4F3FA 4OGXL 1NCNA 4X6CF 5GRVK 1KIRB 5D71H 3EDJA 1IL1B 2NNAA 4U0RC 1KLGA 2AJYH 1U8QA 1Q94A 1Q9WB 2APBA 5DZLA 5JR1H 3LQAL 5BXFB 2DDQH 3MGOA 1SMOA 4M6ML 2CLRA 5EU6B 3BGAA 4JHAH 1JGVL 2QQLL 3GSNB 4CL7A 3HZVA 3WSQL 3ILPB 4A6YB 1WISA 1UM4L 4LDOB 4OV6F 1YPZB 3GHEH 2FX9L 4U6HA 3CH1A 3IRZA 3TBYB 2A1WH 3VRLF 4DVRL 1NEZG 2BVQB 1EO7A 5DWUH 3F65A 3AB0C 2LTQC 3D39D 1F2QA 1FYTA 5GRJL 3K1KC 3TH2T 2F58L 1HWHB 1NDGB 3IFLH 3O2DH 4JKPH 1JTOA 4Y5VB 3GSVA 4LARH 4F9PA 2UYLB 1VENA 1OM3H 3V5KA 5E6IA 2J5LB 1UENA 5DA4A 3UMTA 2NTFA 3KYMA 1QNZH 1EIBA 3RX7A 2Z8WC 1VGKA 2ZOLB 1EFQA 1CDJA 1Q0YL 1JFQH 1FFOA 3MRKA 4I0PB 4RA3A 3MV8D 4JAMA 1NDMA 1HYRC 3QG6A 2BERA 2AJUH 4L3AA 3HMWH 1ZVYA 2DM3A 4OLEA 4S1SL 5HDOA 1ETZA 4U2YA 4QRRE 1DBAL 3LKSA 4HIJA 3CXHJ 3DXAE 1YYLH 3SOBL 2HG5B 4Q9QH 1NFIB 3MOAL 4YNYA 2BNUB 4DCQA 1QLEH 3UTSD 2D9CA 1MHHA 4G8IA 3G5XB 2DQGL 4ZO6A 3C5ZC 4L8DB 4ZNCD 3CSYA 1Q38A 4JFFB 3DOSA 2R9HC 4KJQD 1Q9OB 1RVFH 3LIZH 2G9HB 2P5EA 3VFGH 1M7DA 1P4LA 4RZCA 1LMKA 5I73B 1J5OH 5FB8B 4RAUA 5A16B 1Z6JT 4X4XB 4X98A 4HUUA 2AJZB 2X6MA 1QKZL 2V5TA 3O9WB 2XA8L 2Y1VA 5IB4A 4NHUA 1TQBC 1BVZA 1VFAB 2D4FA 2AXHA 3SPVB 3NCMA 4NKIH 4NYLB 4YBQD 5DK2B 3A6BH 1CL7I 1PYWA 5CCKL 2FO1A 4HJ0C 4BUGA 3BN3B 3DMMC 1ND0A 5GSRA 3ELAT 1EO8H 1X5FA 1V3LA 2JIXD 1GAFL 3QI9A 2IQAA 4JFYB 4OD3H 2NY6D 4IEFB 5B3JE 3GMOA 1QLFB 3HUJA 2AABH 3QNZA 1RQ5A 5J6GB 4OF8A 2PTUA 1IQDB 1T1ZB 2NY4D 5DXWA 1T22B 3VWJA 3CXDH 5HI4D 1W0WB 3EOAA 3S36H 1IQWH 5EZIL 1KTLB 2FD6L 3FT2A 3MLTB 1BQUA 3D0LB 3CU7A 3KYOB 2ADGA 4PB9L 5E03A 5I76B 4GH7B 4Y19A 5TF1H 5GIRB 1RZIA 3DX9B 5J0BA 3VA2C 5K93A 1N8ZA 2FJGA 4XH2A 1C7SA 3H9SA 1BQLL 2CK0H 5CIPB 4GXUM 2VDKH 4R2GC 5A2JH 5ENWB 4OUUB 2CKBH 3FN3A 3MCKA 3BMVA 1ZGLP 4A2LA 4X99A 4YC2B 4X5WA 5D1ZD 5HHVH 3BX7C 3QIWD 2APWA 5TDPB 1JHLH 1ADQA 4Y5YA 5DTFA 2H6PB 1G7LA 5T1DH 3ZL4H 4K71B 4NM4H 3OAYK 4JQXC 4TTDC 4M7KL 1AGBA 3QRFM 4NGHH 2A74A 4HIHA 4X6FA 3IXAA 4UNVA 4LHJB 2Q7YB 4HS8L 5F3BA 1I4FB 3KPSD 2KH2B 3I6LE 5T5FL 2VXQH 2Q6WB 5C0DB 4RMUA 4PP1C 1UWEH 4PRHB 1CF8H 4HIIA 4KZDL 4JG1H 3VA6A 4LSQL 5J8OA 4W4OC 5K9OB 5ESAB 1PKOA 5E2JA 5GS0C 3U6RB 3EYQC 3S4SA 1C12A 1QFPA 2HLAB 4J7RA 4QRRA 5F7EH 1W0YT 3OGCA 4M7LH 1QLRB 1XCQA 2E8ZA 3U4AA 4GQ9L 3MGAA 4IMLA 1C7TA 4ZTOH 3CJJA 4PTUA 5EBGA 1AP2B 4QEGA 1SBBA 3KPQA 2DLGA 3GMQA 4Z8FH 3WFBH 1IFHH 4O9HL 4G7YL 5ADOL 4Y4HB 3U4BL 3NCEB 2W9DH 5JORA 2XZQH 5F6HJ 1MREL 4GKZA 4CJ1A 5CINH 4ZFFA 3B2VL 5D72L 3ULSB 2RFXA 1TJHH 1HSBB 4LHUG 4QHKI 3VFRA 2CJUL 4WFGE 1EK3A 3RIAK 4BZYA 1I1AC 1KCVL 2DWDA 2ID5A 5I16B 2I60L 4BZ2L 1IVLA 3NIGE 3LN4A 4IHOB 1GHFH 1DDHA 3C5SB 4ZDHA 4XPBL 3BI9X 4FABH 1WJ3A 5EU6E 2GY7B 3BH8A 4PV9B 5C09D 1QSEA 3EJYC 5HDQL 4JFZH 3ZDXE 1PKQB 4OFVA 4PJFE 5C0BB 4WO4D 4GXVL 3ULVC 3VJ6A 4LAJH 3F8UB 2EYSB 2R2EB 2YA2A 4HUKB 5DUMH 2JF1A 1FNFA 1BBJB 4P2YA 1NCCL 4J4PA 4MCZB 4FQQB 2NX5B 3UJJL 4D3CH 1IEHA 4QXWA 2D03H 5E8NB 1KELL 3BP6A 3BWUC 4LHQB 3OKYA 2VXUL 4M00A 4EIGB 3MRQA 4X4YB 5DMKA 1EXUA 3LB6C 1DEEA 2AV1B 3U7WH 1A3QA 3QZWB 4R90L 2C1OB 4Q9RH 5IVXA 1BLNB 3BT2H 4ZPTB 3KPRB 4D0CA 1OT2A 1K3IA 5IW6B 3DGGA 4P46A 4CU8A 1A7PL 5DJ2A 2AXGA 2R23B 1IEAB 1T21B 4H5SA 3SQOH 1RHHA 3KWWA 3SGEH 1U8HB 1BFVH 4QHMB 2CO7B 4N9GB 3MLUL 2IQ9L 4L9DA 2IG2L 5DJ8A 3MLXL 3DYPA 4NWTL 3K4AA 1CD1A 2E7LC 3TA3B 2VYRE 1MAML 1TITA 3MTRA 4I9WE 5IHUH 4ZFOL 3L7FB 3O11B 4GRWH 4G9FD 4M7ZB 1TFHA 3FQNA 3SDDB 2DKMA 2NY1C 3MO1A 1GGBH 2EDNA 5KSAC 1GIGH 4NZRH 3GBMH 3GI8L 5JLZB 1WIOA 3AS1A 1TJIH 4PJEF 4HF5H 4Y4KC 1SJHB 1FH5L 3V5DB 5GGTA 2VIRA 3FMGL 2YD2A 2ZUQB 3D85B 1AHWC 1JRHH 3MODL 4F8QA 3RTQC 1U93A 1CFSA 3EYSH 3VFVB 1VFUA 2P5WE 1MCCA 3ARGB 4C4KT 4HKBA 1KT2A 2N1KA 5L2JA 3MX0A 5C08D 1QSFA 4HS3A 1K4DB 3K81A 1RMFH 4TQEH 4MB5A 5E4EB 4R96A 3RWIB 5CJXA 2F19L 1U41A 4EI6A 1UJ3C 1TZGH 5E9DE 3QFJD 5ESQA 1FL5B 3MCG1 4BK5A 2OSLA 3NA9L 2CDFA 3BKMH 3X17A 5ITFA 2BY0A 4NQXA 3D2UB 1E4XL 3QUMB 1C8PA 2PW1B 1M6OB 5DO2C 4KKBD 5D70H 2VLMD 4RGMB 1T1YB 3O8XB 5BRZD 1FBIH 1D9KD 4OZHA 1MRDL 5TE4L 1G6RH 3PL6C 1ZGLM 3LQZA 3B2UD 4MAYB 5I1HH 2GTWA 3VGAC 1BBDL 1G7HB 3V52L 2Z93B 3STBA 1KPUA 5F1NB 4PRDA 1XR9A 3L3DB 4X6CB 5T1LB 3SDXF 1N0XL 5JW3L 4G8GB 1V7MH 2YBRB 1OP9A 3IDGB 5GGSA 4LPWA 4CUCA 5GRWA 5DQJB 4BYHA 4WHTB 4OGZA 1QR1B 4QXGH 3F7YA 4PJFA 2C3HA 2PUQT 3DX6A 4R26L 4N90E 4NO5A 1KIQA 2AK4E 2IBZX 4XCNA 4AIZA 3PWVB 2GSIB 1NCBL 4F2MA 5I71B 3UO1L 3V4PL 4YFDB 4BFIB 1PZ5A 1OGAB 1NCWL 1KJ2L 3KLDA 1CS6A 2NY2C 3MBEA 5IMMB 1LP9A 1NBZB 4H1LH 4C55A 3GHBH 4YO0B 3V8OA 2YN5A 3TN0A 4M3JA 3I6GA 5TF0A 4ZFZA 4YE4L 4ELMF 1SJXA 1HH6A 5KN5B 1U0QA 4PRHE 5CD3A 2CIIA 3DURB 4V1DD 4NHCL 5KVFL 3IKCB 2E9WA 1E6JL 5L6YH 3WL9B 4ODWB 3SY0A 3CDGB 5CKAA 4AT6B 1TIUA 3HC3L 3HI6H 5GGUA 1QBAA 4XVJH 5E8DL 3PF2A 4F7EB 5T5NG 3B9KC 2B1AL 3L5JA 4DVBA 3V7MA 2YN3A 1UJTA 1GGYA 4PD4K 1MFEL 2EXYC 1B3JA 2BNRB 5BQ7A 3O45B 1MAJA 4M93B 4QOKB 2IH3B 4KK5C 4PJ9B 5GJSL 4FQXC 3P9LA 4C56A 2VAAB 2EE3A 4M43L 5D4QA 1B2WH 3QXTA 2Y06L 3U9UB 5LAXA 3I85A 1JPST 1RUKL 3HZYA 5MEPA 4FN0A 4X9FA 4S11A 4UV7L 2APXA 3OAYH 2O5ZL 3HE6D 4LSSH 1YC7A 5TDNA 1UADC 2GW5A 3QDJE 5F9AC 2VRAA 5FF6A 2LU3A 4GW5A 5F9JA 4QCIB 3L9RA 4KZEH 3L3GA 2F5BH 2X4QA 4JO2H 1RIVL 4ODSH 3WLBB 5INCB 3CU1A 3TFKD 4ZG1A 2P5WA 4WI4A 3QWQB 12E8H 1PKQE 3KXFB 3SCMB 3HMXH 4KRMB 3LZFL 4PJGA 43C9B 4FQIL 3MV7D 5E9DA 5I1KL 1FLRL 1K8DB 1KF9B 5J4MA 1WZKA 5CAYB 2H2SD 1N5AA 1JWMB 2VDQH 2FH6A 5DFWH 3TBSB 1MCOL 4LQFH 1ONQA 2BP3A 2HYMA 1XF2A 1KN2H 1FFNA 3VGFA 3DROB 1KN4H 3KLHC 2XQYG 4WIQA 1A6ZA 4EN3A 5I15L 4FQCH 4IRJC 1CE6A 4XPTL 4LCIH 2ENSA 2YPLA 4Y1AD 4OGYH 3TBWB 5I1AB 2BNQD 1HNFA 4X4MA 5H35B 2PR4H 3KPRE 1XF1A 1NC4D 2E6PA 5CUSH 4ZUTB 2Z35B 2N56A 1S3KH 1LO3H 3MMEB 3EIFA 4A2MA 5F6IB 4XPGL 5BZWA 5IW1B 4YR6B 3VFNB 4LVOB 2VLRD 1E4KC 4JRYE 3ROOB 1XR8A 2X41A 3LAFA 2IPTL 5KVGH 3GMMB 1KG0B 5HI5D 1P7QD 1BP3B 1F13A 5HHXH 1MF2L 4WI2A 2AK4A 3QO0A 4PLKC 5F8RC 4U1JA 4DKEH 1A7NL 3FJTA 3OXSA 1UQSA 4RWYL 1EMTH 2NY5H 4NJAL 1II4E 4LHUD 1DLFH 1S7QA 1ITCA 3GI9H 1BFVL 3ULUH 3FONA 5ID1A 5LXGL 2O93L 5SX4I 4WDIA 3HA0A 2F8OA 3LS5H 3QA3B 2OR7A 4M6NL 1F6AA 3QJHA 4RQQA 2WINB 1ZT1B 5LQBL 3CAFA 2C3GA 1OAZL 1L7TH 4XPAL 1MFAH 4Y2DB 4NQDB 4OF3A 4HZLA 2Z31B 4Y7MA 5GGRA 5ICZB 4PFEA 3VG9C 1U92B 2BXYA 3SDAC 1RU9H 1UWGH 3NH7L 3EO9H 5E2TH 1K6QL 2NYYD 3OR7B 4NFBA 3ZYIA 3DIFA 4K3JL 4GAJL 2OL3A 4CN4A 1HXMB 1MQKH 4PLOB 1RJCA 2YUWA 3RHWF 1A6TB 3LDBC 3ARDA 4FA8A 5GS0L 4KHXH 5FHAH 5LCVL 3B9AA 1XH3B 4JM2D 5DFTA 4HAFA 3W5NA 4L4VA 1QG3A 4NCC2 2FX7L 3MACH 5IQ7L 5CZVH 4G6JH 4HWBA 4LSTL 3VXUA 4U6YB 1N4XL 1YY9D 4GO6B 1RD6A 2W0FB 1MLBB 3V6BR 1KSRA 3ZKSD 3UZQA 1JPFA 1O7VA 1LQSR 4M5YL 2NW3B 4O02H 5AZEL 1HILB 1WC7B 4QGYA 5AZ2H 3EYOA 3LHPL 4MNQA 4OZFB 3D69A 3QDJA 3GSUB 4MMZC 2BC4B 1HHHB 4FXKA 3X12B 3HC4L 1W72B 2IPUG 3EO1B 4QT5B 3JBG7 4LCUB 4NN7C 4X6CE 5EA0H 2EKJA 1K4CA 3LEVH 4W70A 1FAKT 4ZAKA 4G8GE 3L5IA 1FBIL 2XWJB 2EIEA 4GG6E 3TT3L 3WFDL 3MUGB 2Y07L 5TGBA 3FRUB 3H7BB 1UB5A 4H88L 3C08H 4OJFH 5DJZA 3WFHA 4KROC 3RDTA 3CVHH 4HKJB 1U8NA 3MNVA 1G7PA 4YDJB 3F58L 1OGAE 1RJLB 4N8CL 3AROA 1UKQA 1E6OH 2VZ3A 4GKNB 3ULVL 1JNLL 4F37F 1EZVY 3MUHL 1BWWA 1ES0B 4GAYA 2Z8VC 1T4KA 1WWCA 4OB5H 1MWAH 1X5AA 4ODBD 4JO1H 5BV7H 2MQCA 3RUGF 4WFFD 1OAYH 3HNTH 3W5MA 1WWAX 4GW4B 4K7PY 4KAQH 1F2XK 4JVWA 1DCLA 1LO2L 5DUPH 1MY7A 3U79A 1UXSA 3O0RH 5IVZB 4YXKH 4JRYA 4QY8B 4NWUL 3TCXA 3LN9A 1Q72L 4NNPH 5A2FA 2BJMH 1D5MA 4DN4H 1FYTD 4GS7C 1IKNC 1X7QB 2Q8BL 2NR6D 1MHPL 2UZIH 1EFXD 2AI0H 2YD1A 2HFEA 1R3KA 1JP5A 1T7ZA 4O2FB 5FGSA 4HIEA 2BNRE 1GCFA 2WBJD 4QOKE 3RY6A 3TP4A 2DWEA 1RZGB 3MPCA 5AUMA 1AE6L 1NUGA 5C8JA 1SEQH 5ALBH 4G7VH 4FP8H 4JG0H 3S3SA 5JHLH 5HGAB 2EICA 3QFDB 4P2RB 2DQEL 5EBWB 4LU5L 3BW9A 5DJ0B 5F96L 1A6VL 4Z77A 4PJEB 2FEDC 1A3RL 3FB5B 1OGTB 2AXFA 4X80H 1LNUB 2K9UA 3U46B 1U8PA 2V2XB 2DM7A 2HKHL 4U1HA 4FQHA 3MA7B 1EHXA 2ZPKH 1EEQA 4XXDA 5HPOA 1A7OH 2HLFD 4BA8A 1YECH 4CVZA 4OD1H 4F7CA 3GRWA 4J6RL 1EDQA 4LKXB 1IAIL 2Q76A 3IDJA 4UAOB 3I2CL 4XTRD 3I75A 1T83A 5IIEB 5I1GH 3KXFE 2R0WH 1KULA 2JJUA 1KB5L 3GO1L 1ZWIA 4XMKL 1G7MA 4U0QB 2V2WA 5EOCH 1HXYA 2P5ED 2Q8AL 3GJEA 5EUKB 1A02N 4NUGL 2ICWB 5EDXA 4JRXD 2IAMD 3WIHH 1IGML 4LK4A 1I1FA 5LG1A 3MLRH 3MOBL 3ILQC 5C9KA 4KHTL 4F57H 1GOHA 3CZJA 15C8L 4FFWD 3OJDA 3X3FL 5BVJA 3VRIB 1KBGL 3GSWA 2EECA 2VDQL 4KTEH 4TVPH 2X1PA 3TO2B 5FM4A 5BO1H 1CICB 5ITBL 4NNXB 3SDXB 3VXPA 2ITDB 4HIXH 3ES6A 3CGTA 2ESVA 3NFPB 5KJRH 3F6LA 3MLZH 4GG6A 4WY7H 5JIKA 2XXMB 1KEML 3LS4L 4X7CC 5CJOL 2BY3A 2GQHA 4DJMA 1IGYB 2DTML 2C1PA 4MLIA 3G5VB 2YR3A 3DX8A 3IU4L 5J9PA 4WEBH 1ZT4A 2HKFH 2NXYD 4ZXBD 1NKRA 1FG2A 4WW1B 2RQ8A 2DYPD 4H26B 5T33L 3V6OC 1K5NB 4JZJA 4BH7A 4R0LB 1EEYA 1C5CH 3Q5TA 3THMH 3VE0A 4LNVA 4U1SA 2HN7A 3PWLA 1YUHB 2UUDH 1OB1A 4HX1A 2XN9B 4N5EC 3Q6GH 4HQQH 3C8KB 4ELMB 4AH2B 4NQDE 4G6FD 4PJ5B 5KG9A 3S96A 3CH8A 1WITA 1DLHA 4HV8B 2B39A 1CCZA 3HNVL 2QADD 1I7TB 2X9YA 3MRFB 4J8RB 3MRGA 3PGCA 5D7IF 4D9RE 2EO1A 3WBDA 4YHIA 3JV6B 3SEPA 2YPKB 4MXWH 2VABA 1CIUA 5F70A 3SJVB 2V7NB 3RY4A 1A2YB 4TUOA 3U1SH 5J13C 1Z0NA 4EQ2A 5KS9F 2AV7B 4NP4L 4GRLB 1Z3GL 4RGNC 4DTGL 4UMGA 2PYFA 4M1CC 4P5KB 2P45B 2XKNB 1M71A 3KNBA 1CZ8H 1MJ8H 4Q6YA 5LWYH 2G75A 2GSGA 1A9EB 2L4OA 2D7MA 3I9GL 5FO9A 1EHNA 3BHBB 1MVUA 3BAEL 1X4ZA 1NC2A 3TJEH 1B90A 1MCQA 1U3HB 2D7NA 5JPNB 4XVTL 5K59F 4M9OA 1KCRL 3NTCH 4FQJH 3FO0L 4KPHL 2AJ3A 4UV4L 5DVKA 3DXAD 3L6FA 3QUZA 4GBXA 1AY1H 2HTKD 1AKJB 5D2NA 1CE1L 3AU1B 1I7UA 1PLGH 1SBSL 5EOTA 1KGCE 3D9AL 3X11B 4U0RB 3RKDC 3C2AL 2MTPA 4AENB 2ZNWA 4LFHG 3H9HA 2H3NA 3V4VH 3GUTB 1JGLH 4NQUA 2A83B 4Y5XC 1ZK9A 2C4FU 1MCPL 1OTUD 3UDWA 4HCRL 4FFYL 1L7IL 5FO8B 5ELIA 4R4BB 2C7UB 4NC0B 4HKXB 5HYQB 3C5JB 1DSFH 1D3CA 2CKBB 4R9HA 3IDYB 2RBLA 5IMOB 1J0IA 4KGJA 4JKMA 3AB0B 1RJYB 5CGYD 3WNPA 1EX0A 1UA6L 2ZUYA 4JY5L 3IS1X 3ULUF 1I7RB 4KJPC 4F7TA 1M4KA 1CFQB 3B6SB 4EJ1C 4XBPA 5L2KE 4ZUUA 5DJ6B 1R3IL 3KJ6H 4HHAB 1ED3B 3PWPA 3L3KA 2EKSB 2DBLL 2QKIB 4XWGL 3VFUB 4XVUC 5IFAH 1RY7B 3BQUB 1XIWA 1YN7A 3QIBA 5C6TH 1XCTB 2N7AA 5JDSA 4M8QB 3WDJA 2OR9H 4D2NA 1UCBL 4JPIB 2X1XR 4XT1C 1A7QH 4MVBC 4HC1L 4DN3L 5DK0A 5KSBE 3BRGC 2XFXA 4CU7A 3S5LB 1PJ9A 2DIAA 3V79C 1DBJL 3REVA 4P2RE 4JO4L 1ZEAH 1MUJA 4WNQA 3BDXA 3U82B 5AEAA 2IPKB 1HHJA 1KCUL 3N85L 3VI3E 2VL4A 5HGGS 5A2LH 2BVPB 4LLUB 3C5ZB 4EUPH 5F3HB 5EFIA 3G6JA 3AREA 4LAQL 4WFHE 4R3SA 3GJFA 4OLYL 4X8JB 3WHE0 4E41B 5E00A 3QEHA 1L0XA 3BGMB 1SEQL 3FO1B 3MRBB 4PY7A 1KTDB 3RWJB 1I7ZB 4QRTB 5F7UA 1ZANH 3C6LA 1JUFA 4QRPE 4HUVA 3L5WB 3FQRA 4HKZB 3SKNB 3VGBA 5DHVA 2YEZB 4MDJB 4X6BA 1U58A 4G6ML 2J3SA 4P5MB 2Y5TB 2IADB 1DQJA 3IFOB 4PBVC 5C7XH 5BW7C 5HYSA 3MA9H 2BDNL 2ZSVB 1NGWA 3VXMB 2RCSL 1ZA3A 4U31A 5H94A 3GMNB 1A22B 5L88L 4LIQH 1OTSC 3Q1SL 4LLQA 4Y4FA 4LQ1A 2AKRA 2P8PA 3OX8A 4PGBB 4ZNEE 4RFOL 1BAFL 4YEFA 3QPXL 3WIFA 1CTNA 2APVA 4AEEA 2BX5A 2XNAA 1C5DB 1F58L 2IGFH 1FFPA 2VLKA 2WWKO 2ZJSL 1R5VA 2GITA 1X4YA 4KI5C 5FGCB 5EIIA 1JE6A 1K9TA 4DUVA 2VZUA 2QLVB 2VDRH 4ERSH 4K2UL 3LKOA 1NBVH 5CILL 5FDWB 1YN6B 3VRJB 2JELH 1S9XB 2ADIA 3RL1B 4QXTA 5D8JH 2WANA 3S88H 2CLZB 1UCTA 1WQVT 4FQ2L 3LN5A 4MD5A 4Z5RA 2A6DB 3RAJL 1DVFB 5F44A 1CG9B 2P1YA 5MP6L 4KC3B 3RNKA 3CFBA 1Q0XL 3BYYA 4WV1A 3NABL 1YMMA 4WFGD 2X70A 3WFEL 1K3ZA 4ZS7H 2WQ8A 2XWBA 4K9EH 4NC1E 4GMTL 4P23B 3SDYH 1OSZB 1OTTD 3FRPA 3QUKB 4Q9BA 4Z0BL 5J1AA 9CGTA 7FABL 1IM9A 4GRWB 1YEJL 2XTJC 1YMHA 5DVNA 1UM5L 5I1DA 5IT2H 3OKEB 3BH9B 2DLTA 5EU6D 1HQRB 4I18A 4P5TA 5IEKB 4HAGA 3FZUC 3RUGB 4PJCF 1RUAH 2Q20A 3HE7C 4OAWA 4YQXH 5L2KA 3SE4A 1CFNB 3U0PA 1IBGH 3QCUL 1BJ1J 1FL3A 4OGAC 1FZMA 3OHXB 1P4IH 3O4OB 4EDXA 5C2BH 2P47B 4X6EA 1TLKA 3M45A 4EXKA 1RK0B 5E5UB 2VDNL 2ZUSA 1IKFH 4U1LA 5DYOB 4R4FH 3DVIA 3T0EB 5DRNA 2B7DT 1CFTA 1RZ8B 4ENED 5A43C 2N7BA 5E5MA 3O3EB 1EAPA 2X1WL 2H2PC 5IBLD 5B39A 1GZQB 2BSSA 5I1EL 5KSBA 2R69L 2X10A 4YPGB 4DFIA 4AIXA 1X3DA 1V3MA 1FAIL 2AXJA 1A5FH 1CDIA 2XQBH 3NZHH 3NCJH 4G80A 4I0PD 5FUZH 1EUTA 4UIKL 3SDCB 2Z91B 5IMLA 4MJIA 5CGTA 4JPVL 1QYGH 4KJYA 2AP2A 1HEZA 3PXJA 3MJ8A 3CFJA 2ILLA 4EXPX 1X9QA 4CADB 3P11H 2WWMD 1WEJH 5C0EB 1F4WH 1FVEA 4QYOA 2VXTL 5FYKL 3TZVB 1CFVH 4I8DA 4MB3A 3PJSB 4I9WD 43CAA 3Q6FB 1G6RB 1A1OA 5FUOL 4OZGF 3R8BB 4Q2ZB 2X4UA 4XCEA 3JTTB 1HSAA 4MQXD 4BQ6A 1KC5H 7CGTA 1U3JA 4XBEL 3G6AB 4IIQA 5FGRA 3B9DA 4F9PC 3G5ZA 3IKKA 3NCCB 4XP6H 4L29A 5ISZA 1UVQA 1T04A 3ME0A 3MRNB 1C1EL 3U0WL 1HKLL 1AC6A 1KXVC 2QQKL 3BZEA 1JNNH 3BGFC 5D6CA 3HRZB 5FV1L 4GLRI 3EYUL 4JZNB 3EOYG 1RIUH 4WUKH 1MJUL 4F7MB 5LGKA 2P5WD 4YPJA 4H1LB 2EYRB 4NT6B 4M48H 1YNTA 2HAZA 1G7JA 3STZB 3NZ8B 1AIFB 4WHYG 3IFNL 1IGCL 1J0ZA 3JZ7A 3BE1H 5J3HD 1XGRB 1AGCB 3QUYB 4E5XA 3VFOA 2LVEA 2VNCA 4PRPB 5CJ5A 2IANB 4OZIF 2I9TA 3LRSB 4ZFOA 4XMLL 1J05B 3BIBX 1FGNL 3MLVL 2NY3C 4IDJH 5JOEA 4ZUSA 4OF6A 2HJLB 1N3NA 4F8TA 4EN3D 4WHCA 1PSKL 4JJHA 1J1XH 3T1FA 4JGJA 4OV5A 1MFBL 1M05B 5CJ8A 2FGZA 2EC9U 2QR0B 1IMHC 4NN5B 3AUVA 5LGJA 4OCNC 4FQ1H 3NOIA 1V5JA 3U0TA 2KL6A 4POZC 2X05A 2R39A 3EO0B 4MNGA 5I8CA 4JFHE 1BVKA 5KSAB 3OKOB 2BVTA 1D6VL 3DBXA 2HVKB 5J11B 4ODVH 4E41E 1NGXA 4LFHD 3BZFA 4RBPK 4D8PB 4N90D 4HK3J 2AK4D 1RFDL 5DC0A 3QH3B 5D7IB 1HDMA 1S7XB 2JCCA 5C71A 3LVEA 1L9NA 1JF1A 4UB0H 3VXNA 1F3JB 1OW0A 3P4NA 3VWJC 3MLWH 5KS9B 3CX2A 2WIIA 4MLSA 5F8QC 4E42A 2EE2A 4KUZH 1VPOH 2ICWI 4KMQA 3VXME 2J7LA 4K3EL 2HH0H 1UJ3B 3ZZ1A 2DKSA 3BKCH 3FO2A 4PRHD 4DGIH 1BVLA 1T66D 3ZKNC 3RZCC 1MCHA 3BIAX 1GC1C 4JQIH 4XCCL 3EJZD 4IS6A 1SJEB 4PP2B 5IG7B 1IAKB 4ZUWA 3QAZB 2PXYB 3BKJH 5JW4Q 4YHZL 1NGPH 3QHTC 3RRQA 2DI7A 1LE5A 2DM2A 3PL6B 3PV6B 3RWCA 4YAQB 4HBCH 1DUYB 3VXQA 3UZVB 4RMSA 2Q87A 4XNUH 1F8TH 2XRAH 3C09C 5HY9B 3OF6A 3IDXH 3CPLA 5IEHB 4CN6A 3H9YA 2R1XA 2W1NA 4YGVA 1LVEA 4X7FC 3RVWC 1FORL 4Y4HD 2HVJA 5HGHB 5D5MF 1N6QL 4R97C 2DQTL 4P3DB 4EBQL 2QHRH 1KJ2A 2AVGA 4P2OB 3O2VH 2FX8L 5DURB 1YQ2A 3HR5A 1TQCC 2UY7A 1JNHB 4HBQA 3V5HA 1ZLSL 3RVVC 5E2WH 4YWGL 3UTTB 1KFAH 4ZOEA 3QDJD 4IOIB 4OM1L 5DJDA 5A1AA 4NN6C 5GRXG 2MHAB 3T4AA 1S7VB 5J89A 5EBLB 3EZ8A 4RIRA 1WAAA 4ZAKD 1IM3B 4BSWA 4UZGA 3QULA 1NCAL 4OLVL 4HFWB 4JKLA 3V6FA 3RUGE 1MFDL 4KY1H 2OJZL 4X9IA 1ZSDB 3JUYA 2VXSL 4RAHA 1KJMA 5DMGD 3T77A 4DZBB 5J6HA 3EYFB 1ZHLB 2ZCKH 1IGJB 4ZPVB 4P9ML 4GUPA 1P5UA 3FOMA 5F9WC 2O61A 1T03H 1J8HB 5EOQH 3MLYH 3VXTA 5C0GA 4QRSB 3QQ4B 3ZDYF 4DGVL 4I4WA 1QEWB 4YQXL 1B0RA 3MSPA 4L9LC 5DRWB 2E6QA 1E4XI 3FQUA 4UNUA 3B9KB 1BZQK 4JDVB 1RIHH 1DANU 3QHZH 3D1MC 1NGZB 2ICEA 2Y25A 3KPRD 2GIYA 1BD2A 1U36A 3MRPA 2EDFA 5HI3C 4Z7VF 4KK6C 1JF6A 3MROA 3D25B 1J1PH 1Y6MR 2E3VA 5I8EA 3GNMH 4WTWA 4Y5VA 4OZFG 3QPQD 1UXWB 1FGVH 3BO8B 2UYLA 1JHTB 1IAOA 3ZHDA 1EBPA 3MRCB 5CMAA 3CCHA 1G9NH 1T80A 1I3VA 3JWOC 4F80A 1CDCA 4K7FA 1EEZA 2QEJA 4O2EA 1RZJH 1HIML 4PJDF 4APQD 5L8LB 4J4PC 5DI8A 2SEBB 3OXRB 4NKOB 5FYJL 1MI5A 3SDDD 3BPCB 3E8UH 2R2HB 3BEWB 4G6KH 1UT9A 1WEJL 4U1GB 3QDMB 3MC0A 1TVBA 1YEGH 3OZ9L 1K2DA 1XGYH 3DMMA 2B5IC 1N59B 2W65B 4W6XB 1CLZL 3QNYA 4MCYA 35C8L 3D85D 3FFCB 2D9QB 2EDLA 3T0XA 4KJWC 1GC1H 3T2OA 3VFMB 1J18A 1F90L 3CVHB 2W07A 4U49A 5EUOA 5KAQF 1T0PB 5D1XA 4P46C 4XB8A 3HFMH 1MCSA 1NUDA 1OSPL 4XCFL 5DRXA 5DJAB 3L3HB 2FSEA 5IB1A 3BSZH 3BEVA 4Q97A 5IFHH 4L8CB 1KLUA 3ARGD 4OLZL 2VSDA 3TGXA 1PX3A 4HDIB 1S8DB 4H25B 2DI9A 1LEIB 1Q9OA 1A6WH 5HVFB 1SYSB 5I66A 1VHPA 4XNXH 4E0RB 2YPVL 3B5TA 4NRZB 1KXTB 2R8SH 2I25N 1C08B 4DW2L 4OKVA 2EIBA 1YEFL 3RU8L 3H3PH 1MWAB 3O6FD 3O9WA 4PRPE 4YK4C 4YXHH 5BV7B 3RIFK 4LPVA 1MRFH 3FB6B 3D2UD 1T2JA 1YY8A 3HS0A 1SY6A 5IJKA 1FG9C 1ZS8B 1MCFA 8CGTA 1V3KA 5B39G 3MRJA 4MAYD 3R1GL 2IH1A 2JIXB 3WJJA 2NY6B 2FWOA 4F7PB 4KTDH 1NGQH 1T5XA 2FBOJ 3UTQB 4G3YH 1KV3A 4PJAA 5T1LD 1AXSB 4BH8A 1VFBA 1TDQA 4JQXA 1IGIL 4I48A 1Q1JH 5CS7A 1ZKAA 2OJEA 4G8GD 3HLAA 3TCLA 1TVHA 3EFFB 2V5RA 5EZJA 5I19H 3WLWD 2W91A 1SYVA 3EKCA 4OM0H 1G7IB 1QR4A 3RWFB 4UOW0 3VD5A 4PJCB 3R4DA 2AJXH 5CJXC 4PIRF 5GSVA 4IDLA 2GYSA 1A8JH 4K23H 2A6KB 5D7IE 3VW3H 3JWNC 1I1YA 2B0SL 4D0DA 4FZ8L 3L3IB 5I76A 3Q3GB 1A9BA 1D5BB 4L3EB 1AQKH 1ERNA 1OGAD 5FOBA 4I2XB 1KENH 4FHBD 4S10A 3RFZC 1JZ4A 5HXMA 4YBQC 1A1MA 4HJGB 3STLB 5FO7B 1WBYB 3M8OL 3MFFA 2XY1A 3TLRA 4DKFL 1BMGA 3WO4C 1FN4A 1ROWA 3QIWB 4NJ9H 3CLFL 1N5YH 4YXLH 5FECA 3BP4B 4LPXA 1ZLWK 3QIUB 1NLDL 4NO2B 4AM0B 4GMSL 2DQHL 4YX2L 2NZ9D 2NY4C 3O4LA 5J7CC 5DK3A 1K8IA 3PHQA 4PGEB 1VPOL 3H3BC 4IOSD 5E8EB 2H9GA 3KR3H 5HI4C 3OB8A 4FG6D 2A38A 3HPJA 2HT4C 1I1AA 1DQQB 5AYUL 2OZ4A 3U4EB 4TUJA 4FTVA 1VKXA 2HT2C 2W9EL 4GKSB 2BNRD 4OZGB 4QOKD 4YIQB 4ACPA 1FLTX 4PJ9D 4RBPH 4WW2F 5BS0A 2BVOB 3DSFH 3FO9A 3FT4B 4IRSA 4BSJA 3CMOH 3VXOA 1ZA6A 4OFYA 3AM8A 1QVOB 3MJ6A 4UIMA 3TN0C 1FRGL 2X2YA 1N64L 5E94A 2A9NH 3A6OA 1S7SB 2PCPA 3B8SA 5I2IA 4QHLB 1U6AL 5D1ZC 4K8RC 3UTTE 4KMLB 2UVEA 3MNWA 1CDGA 1ZHKA 4H8WL 1T20A 3RY5A 2OMNA 3BKYH 2GK2A 2OXHA 2OI9C 3P9WB 2GT9B 1I8IA 2PW2B 2VH5L 1HZHH 1ZT7B 2OLDA 1S78D 4G43A 5EU4B 1ODAA 2PO6B 1FYHB 3SCMD 2LVCA 3KXFD 2GUOB 5T3ZL 4O5LL 1G7QB 1MCRA 4MX7B 4U1KB 1UC6A 2GTZB 3V0WH 5D96B 2NY0B 3Q48A 3RWHA 3ZTJH 1R3HB 4C58B 5F7WC 4EI5A 1JRHI 5L7XL 1I8MA 3FFDB 3UJTH 1LD9A 2BSTB 4OIIL 1J8HE 1XGQA 1BECA 4UBDD 2JK5A 3L1OL 4M6OL 4M1GH 2ZSWB 3X13A 4CNIA 4OZIB 2OTWB 2X44D 4OLUH 2D31B 4MS8D 5C09B 5GGTH 3SKUD 2EZ0C 4U6VL 2FGWL 5CWSB 4PRNB 4LLDB 5E6YA 1N2RA 2JB5H 1DJSA 3RWGB 4WO4B 2Y7QB 4LCCC 1D6EB 5EWIH 1DE4B 3B83A 3PHOA 3U7YL 4MXQD 1T03L 2ATPA 2FJHB 4OCWH 3SE8L 3GSRA 2CO6B 1TNMA 2RAMA 2P8MB 4JO3L 4RWHA 5DGQA 1P84J 3SKJL 3CXHK 5AD0A 3U36B 2X89D 2HFFB 1P4BH 1FPTL 4WGWB 1I9RH 1HHIB 4PG9B 3BIKB 1NANH 4Y4KA 1IEBA 4AG4L 2OQJA 5DRZB 5SV4A 2BSED 1GPOH 2DRUA 1R6VA 2BFVL 1AHWA 1AFVL 3MRDA 4FFZH 2F54B 3IJHA 1OARL 3RTQA 1KB5A 4M5ZH 4FXGA 3TH3T 1YNKH 4QHMA 1JIBA 4PGJA 2CPCA 1A4JB 4WHDA 4LBEB 5ILTH 4OCYL 3N1PC 2VJXA 4QF1B 5C0FA 4TOYL 2J4WH 2KPNA 4XP4H 3FFCE 4OD2A 4Q74A 5FYLL 3AY4C 4I77L 4NQDD 4Y2DD 1OPGL 2ATKB 2Z31D 4UOJA 4OTXL 5TH2B 1OAUH 3ESVF 4K3GA 2H1PL 3O3AB 3VH8A 1RPQA 3OPZH 2W0LA 5ACLA 4D9RD 4OSUL 4QWWD 1JTTA 4WCYL 1ACYL 2ERJC 2ZKHH 5GHWL 5CEZH 2R0ZL 2ADJB 4RRPA 3RVTD 1PG7W 1UYWL 5I1CL 4LEOB 3B3IB 5DC9B 1DQTA 2V5MA 4KK8C 2AJVH 3VG0L 3BXNB 4XGZA 2DQUL 4DAGL 2RGSA 3B4NA 1ZHBB 1MSPA 3QSKB 1RURL 1XAUA 3LEXA 1FZJA 3DO7A 4HEPG 4J3OC 1PD6A 1JYWA 2DD8H 4DEPC 2AERT 2FO4B 5D5MB 1I3GL 5DHYA 4KVCL 1ADQL 2CMRH 3RBSA 1K4DA 3BWAA 4ZS6C 5CSGA 5F88A 2CDGA 3RWIA 2YXMA 5E1AA 2X9WA 2I9LA 3F5WA 4LEXH 4P3WA 1JV5B 1BEYH 3VXSB 3WN5C 1T2QL 2VDPL 1XGTB 3L7EB 3U9PH 1HQ4A 3LKQB 1NPUA 4M4RA 4Y16B 4K94H 3CZFB 3F7QA 4PJ8A 4NQVA 4AQ1B 1DBBH 4HT1H 3IF1A 1D9KB 3AXLB 1W0VB 3T4YB 4PJCE 4PY8I 3ARDC 3UBXA 1NAML 1E27B 5DJXA 3CLEL 1S9VA 5D7JB 3T09A 3KPPB 3NFNB 3BZ4B 3IDIB 5BZDB 1U8KA 1FCCA 1OD9A 5F1NA 1DBML 3PWJA 4EUPB 5HGBA 4AMKL 3RPIB 3QDAA 3MCLL 3IDNA 4RMQA 5DD6A 4HK0B 1T1WB 3MYJB 4MA3A 3HUJF 3R0NA 5HYIA 1NMCB 3VFSA 1X5KA 1BFOA 3JV4B 5DQJA 2BSRA 3CFCL 5D6DA 3O2WL 5IBTH 4JY4B 5SWSB 4YDVA 4Z7WA 4BZ1L 5C9JB 4HXBH 2CIKB 4JHWL 1OAKH 1FE8L 4RNRB 4YHKL 2FIKA 2VL5A 3QEGH 4LMQI 2C3VB 1R0AH 1NCDL 2ORBH 4FQXA 5DJCA 5TE6H 3MLSH 4XBGB 2BXZA 4Z7VB 3PDOA 2GI7A 4KKLD 2J8UA 3V7AG 4F58H 4UUJB 4NRXB 4WUUA 2EDEA 2AEPH 3PABA 2I5YL 3MRIA 4TSBH 1QOKA 2XPGA 3RDTC 3B2UC 1FQ9C 2X5PA 1OD7A 3NVQA 3TWCH 4MDIB 4V1DB 1VADB 1WBXB 5EPMA 4OZGE 3MOQA 4M7JL 4PJDB 2FECL 1JN6B 4LLYA 4XPFH 2X4RA 3KG5A 3C9NB 4EIZC 2IC2A 4BSVB 1E4WL 3JWOL 4AT6A 4CMMA 5EC1A 3G5YA 3GSQA 4P2RD 3K0WA 4UT9L 2HTLD 3BYTA 1YJDC 1AGEB 3ARZA 1FNGB 1P1ZB 3WEXB 5F89B 5L9DH 1F4YH 1OCWH 4WFHD 3WXWL 1YQVH 1M7IA 3MUJA 5E8PB 1WWWX 5DUBA 3NN8B 5MEQA 4N0RA 1NBQA 4ZD3L 3FHQA 1CGXA 4QRPD 4IRJA 1J0JA 1D5IH 1KPRB 4UU9A 1AD9B 1NFDA 1QFWH 1YEKL 3HE6B 1ZLWH 2A6JB 2EH8L 5C07A 1JWUA 2DMKA 1N0LA 3TPKA 3EZJB 3OL2A 3LEYL 1A6AB 2GCYA 3G9VA 3HG1B 4JM4L 4OZIE 1E4KA 2EIZA 1YEIH 3N1GC 3GMPA 4UT6H 2R56L 3C8DA 4HC1A 4X6DA 1MRCL 2L0DA 5DMIH 2BRRH 1CGUA 5I8OL 4P3CH 2E7MA 8FABB 4HPYH 5E99H 2Q3AA 5ABDE 2E6JA 2D2OA 2V5YA 4AEIH 3QJFA 3RL2B 3E6FB 1IT9H 1H5BB 3AAZA 2FL5A 1S5HA 1ZVSB 4P4RA 1JNJA 1HYSC 2BRQA 1CICD 2OL3H 1GGCH 3SGKC 3LD8B 1JWSB 1UM6L 1P6FA 1KPVA 1V7NH 2VZTA 5JW5A 4ZFGH 1IRAY 4XNYL 3FCTA 1EUUA 5GJTH 2DQCH 4PGCA 1EVUA 1CGSH 1TVDA 4GRMA 5DLMH 4GG8B 4Z7OF 5JXED 2DJSA 1JPTL 3KYAA 4RGOL 4HWBH 1T0MB 3SDAA 1CXHA 5TQ2H 3MUY1 3MMEA 1P4BL 3H3KA 3QNXA 5D2LE 3TIDA 2VDML 5FCUH 1JPSH 4Z95H 1VGEL 4PRIB 1IC4L 2NQCA 1JYVA 3K46A 1F00I 3VFWA 4QRQB 3OJ2C 2XN9D 4OFKA 4QTIH 1S7WA 4PJ5D 5BCAA 3Q5YA 3I6KA 3DUSB 2GY5A 3TJHD 4LVEA 4RX4A 2H2SC 4IRZL 3UYOD 4XC1L 3FQTB 5IVXF 3IETB 5IW3A 3VD7A 1S9YA 1AQDB 2YK1L 3MRLA 1PEWA 1QFUH 5C3TA 3WFZA 3L95A 1KEGH 2EDBA 4J23A 3SJVD 4H1LG 4PB0H 3AS0A 2QSCH 2B1HL 2AJSL 5J12B 2D0FA 1F4XL 1GZPB 1ZT1A 4Y8DC 4P9HC 3EGSB 3S34H 1MHCA 4JDZA 5DQDH 4GRLD 3V0VA 5JQ6H 3ARBA 3KPMB 1KCSL 4OKDA 1QO3A 3X14B 4Z76B 4EDWL 3H0TB 3GJFK 3WKML 2YUZA 2FEEI 4Z78A 2R0LH 4HH9B 4WW2B 4LSPH 3DRQA 5D5ME 1PQZA 3OB0K 3P0VL 3BP7B 5HD8D 3WS3B 2Q86A 2J1KA 1CBVL 2XZAL 4N0YH 5HI5C 1NEUA 2HT3C 1U3HD 5KSVB 1FJ1A 2C4XA 3C8HA 4JREB 3LV3B 4LLVB 4NQTA 3P0YL 1S7RA 5HJ3B 2KBGA 3F62A 4PJXE 4DQOH 4ZTPL 3JTSB 5E8OB 2WBKA 5T1MB 3V6OE 5FKAB 2PTTA 1AKJD 4LLMA 4WJ5A 1F6LL 4F33A 2MCPH 4JN2A 5IKCA 4K8RL 1FNAA 3J7HA 3OKKA 5DDHA 1OLLA 2EYTA 2ARJA 5H2BB 1ZTXH 2VN4A 1TJGH 2DL9A 1JGEB 4Z18A 1WZ1H 5B4MC 1A1NB 3FB7B 2BC4A 1BZ7B 4OCRH 2F5AL 5IB2A 4MZ2A 4LCWB 5DSCB 4P4KC 4PS4H 3HE7B 4WWKA 2H8PA 1I8KA 3FAWA 4JLRA 1VFOA 3C2SA 2OXGA 2NYYC 3ALWA 5DD5L 3WKNA 1LEKB 2XKSA 3QWRA 2V2TB 4EQ3A 2VDOH 4NQCE 1D5ZA 3MUGA 4MQ7B 4ELKA 4G5ZH 5I18L 1IKNA 3MRHA 5I9QC 5SWSE 2FJFB 1DQLH 3ARFA 3O6LL 1LDPH 4OZHF 1OHQA 4LF3A 4ODTL 1NSNL 2DQIH 3D3VE 3GRWH 4ZOCA 3REWA 4Z7VE 3NIGF 5D2NC 2OK0H 2YZ8A 3IAPA 3E3QC 3ARQA 1D7FA 2NNAB 1YY9C 3SGJA 1KLGB 2YC1A 1U8QB 2Z8SA 4HW6A 1Q94B 1CK0H 3KYKL 3RVXD 1A6UL 2Q1EA 5B38A 3BQUD 3MGOB 2CLRB 2NTSP 1T7XA 5C0AA 3WE6A 4PJFF 3QRGH 4TNWK 5JNYA 2EEAA 4XP5L 3HZVB 4BJLA 4HXAH 5FGBC 5F9DC 1A7RL 1RJZA 3DI2B 4PJDE 2ZCLH 5D2LA 4F58L 2ZUUA 4ONFH 4U6HB 3CH1B 1U2HA 2J88H 4FZEH 4QY8A 4TPRH 4YDKL 1LP9F 3DHMA 3RZWA 1FYTB 2EDKA 5JO5A 1AI1L 4BFEA 3C5ZD 2DB8A 3GSVB 4JFHD 2YUXA 4GJTB 3V5KB 2R9HD 5E6IB 2JJTA 4NO0A 2NTFB 4ALAH 4E41D 1VGKB 1F11A 3ZHKA 5IVNA 3CK0L 1FFOB 3MRKB 4I3RH 1B4JL 4JAMB 1NDMB 1R3LA 4P9HH 3QG6B 3BGFB 25C8H 1OF2B 2ZZUT 4UT7L 4OCLC 5IF0A 1XIWC 4ZOBA 2IFFL 5KANI 3QIBC 1ETZB 1Q8MA 3LKSB 4FFVC 4HIJB 2A0LD 2VISA 5D7LA 5ICXA 5TDOA 3VXMD 3DMMD 1YNLL 1ZHNA 4YNYB 4LOUC 4DCQB 2OCFD 3NACH 3VDAA 4MAUH 4G8IB 1QRNA 4F9LC 5MERA 2OMBA 5EO9A 4M62H 3RGHA 4G8EA 3LPWA 2VLLB 3R0MA 3TVMA 3KPLA 1QBML 4WHYH 4U1MA 3T0WA 2NR6C 5HVWA 4XMPL 4I0KA 3AREC 4ODXA 4PJXA 3WUWA 2P5EB 1M7DB 1P4LB 4RZCB 2FATL 2WBJC 4RAUB 5EUKA 1HCFX 5CEXA 3DV4A 4X98B 4HUUB 3UZEA 5AWNH 2FB4L 4UT6L 1J1OL 3C6LC 2F8VA 4P3CL 3PGFL 4M9PA 4NHUB 5IB4B 4YH6A 3LMJH 4S1RL 3BPNC 2EIDA 4Z0XA 4JANA 3T04D 4JR9H 4IJ3C 1FIGL 3O6KH 4R2GD 1Y18A 3W9DA 3SE9L 4PJGF 2ZUTA 3KDMA 5FYJE 1M1SA 3DGCR 4I5BA 2Z92A 3TPUB 5CZXC 3HHRB 5GSRB 4R4NC 3MXWL 3UJIH 2CRZA 2IQAB 3QI9B 3ARSA 5LKNA 3GMOB 4PRIE 1CXIA 4OGXH 3DSNA 3HUJB 2HWZL 3ZMRA 3QNZB 5E2UL 1VEPA 3OKLA 3QXAA 2XG5A 5F1SA 3LQAH 3VWJB 4M6MH 3G5VA 4RFNC 3G6DL 3LSOA 4ZXBB 1I8LA 3M17A 3EOAB 3D3VA 5DF0A 1JGVH 3FT2B 3RGVA 2QQLH 1NUFA 5E2VL 2BOCA 3WSQH 2IAMC 3VFTA 1LE9A 1UM4H 5F9OL 1E0OB 2ADGB 1IC7L 4PP1D 3K74B 4Y19B 2FX9H 3BZDA 4H0IA 1RZIB 5CEYA 4XNZB 1N8ZB 5GS0D 4P2QE 2FJGB 4DVRH 3EYQD 3EYVA 4XH2B 5HYJE 3H9SB 5JMOC 1FNHA 5H37G 3HI5L 5GRJH 3T0ED 2F58H 5LBSL 1NFKA 3MCKB 4NQSA 4KI5E 4HV8A 3V4UL 4WV1C 3ZSTA 4X5WB 1B88A 5ICYA 2WUCL 1JK8A 4N1HB 4NZUL 1Q0YH 4Y5YB 3U30B 5DTFB 3ZKMC 1G7LB 1NJ9A 1R3JA 3SDCD 4HULB 5IGXL 1RZ7L 3S34L 1QACA 2A74B 4R97B 4HIHB 1INDL 4Y5XA 1CVRA 4X6FB 3IXAB 4S1SH 4I18C 1VSCA 1DBAH 5F3BB 1TTFA 4B7LA 1AR2A 2P43B 6FABL 3T3MF 3SE4C 3P0GB 1KYOJ 3SOBH 4LKCA 3MOAH 1YJDL 4HIIB 1OQOA 4X0KA 5CGMA 3WNNA 4O00A 3MXVL 5D9SA 5JHDA 4NN6B 3KPTA 2YRPA 3S4SB 1Y0LA 1C12B 3PQYA 4LPUA 5DA0B 1J0KA 3P9MB 2DQGH 4QRRB 1ORSA 3NGBC 3OGCB 5C0CA 2EDWA 3EJYD 1H3UA 2ITCA 4NC2B 5AAMA 2R1YA 1XCQB 2QBWA 2VB5A 3QO1B 4YHLL 4WTZG 2QADC 4IMLB 5E6ZA 2RB8A 3LKNA 3K2UL 1U91A 2DQDH 3HPLA 4PTUB 4KKCD 3QHFL 3KPQB 4N68A 3GMQB 5F9WB 1QKZH 2XA8H 1KACB 5JORB 3GJFH 5KSUA 4ZFFB 3T1WA 2RFXB 4O4YL 2EDQA 3OB0H 3SKMA 5CCKH 1CDHA 3HN3A 3LB6D 2C7UA 2VUOA 3UX9B 1XZ0A 4JFOA 5KW9L 2DWDB 2W92A 1O5DT 3LN4B 3QUYD 5GZOD 4UOW1 1GAFH 5IMOA 5IHLB 2WLZA 4PRPD 1DDHB 5F7DA 4ZDHB 5DD3L 2IAND 3NMEA 4J1UB 4IIQC 5T3XL 4R7NA 1FNLA 1WCBA 3BH8B 2H41A 1QSEB 1I7RA 5GRYA 2OYPA 4DK6A 5CFHA 3MV9A 5EZIH 3VJ6B 2FD6H 4YDLC 3P4MA 4ZO8A 4UNTA 3UCRA 1PEZA 4PB9H 4NO3A 3VFUA 3TYGL 1J86A 2A9ML 3ARWA 4JDTH 2LU7A 2NY1D 1JI1A 5IB3A 4Q6IA 4KFZC 3BP6B 1BQLH 5KSAD 5BW7A 2X4NA 1OTUC 3MRQB 2GJJA 1C5BL 5DMKB 1EXUB 1DEEB 4HZAA 5B8CC 1NMAL 2V9TA 2EDTA 1J12A 3VGEA 5IVXB 3B9EA 4MJ4A 2K3TA 3S5LA 5HVGB 5ID0A 2X09A 4D0CB 1I9IL 1T89A 3DGGB 5T3ZE 1HHKA 4P46B 5HYEA 2BVYA 4P2QA 2OBGA 5DJ2B 2AXGB 3VWKA 5CGYC 4H5SB 1RHHB 4Z7UE 3KWWB 4LLUA 3S37L 3BN9D 4M7KH 1FO0L 5F3HA 5DJ8B 5KANG 5BVPL 1DTUA 2AGJL 4HS8H 5DZNA 3X3GL 1UFUA 3IDUA 5T5FH 5TFSL 5EU3A 2QTEA 25C8L 4G42A 4OLXL 4YK4B 4KZDH 3DVNA 1QHPA 4LSQH 3FTGA 3FQNB 3MBXL 2R4SL 3EOBA 3MO1B 2PYEA 1UZ6F 4MDJA 3SBWA 3MJ9L 4PRAA 5ERWA 2I07A 2DI8A 3C60A 2GK0A 3PL6D 4PGDA 3O41A 3UPCA 2VIRB 3TBVA 4GQ9H 1G9MC 2MQ0A 5GS1A 5CP7A 1RV6X 3NPZB 1F02I 2EH7L 3QUXA 3BPLB 1CFSB 1OT1A 3U83A 2DTSA 5GZNC 2LFGA 4PLJC 4O9HH 4G7YH 1AO7A 3V6ZA 5ADOH 3U4BH 1JMXA 4HKBB 1KT2B 5L2JB 1QSFB 2WLYA 3B2VH 4HS3B 5D72H 3UAJD 4C57C 4TYUA 4M61A 4R96B 1UH4A 1MIML 5DURD 2CJUH 2Y5EA 3S3PA 4EI6B 3UTTD 1KB9J 1KCVH 5J1TC 1TTGA 3DWTA 2I60H 3HUJE 4QKXB 2OSLB 4BZ2H 1YN6A 2CDFB 5ITFB 3RL1A 5MENE 2R4RL 2XOTA 4NQXB 1E28A 3K2MC 4XI5C 4XAWL 1P7KA 4XPBH 4O2CA 4D0BA 2UVFA 3ULUD 4OZHB 5HDQH 4IMKC 4QTHA 3LQZB 3WO4B 4W6WB 1F4HA 1MELA 2GTWB 3SO5A 1WWBX 1KPUB 4GXVH 4U6XA 3BFOA 1XR9B 4PRDB 3KJ4B 4Y19E 2YSSA 3NAAL 1DN2A 1MIEL 4CJ0A 3RA7L 4QRUA 1NCCH 4G9DB 1J8HD 3H9SE 4ONGL 5GQBA 4NRYA 1BM3L 4GG6F 1N7ML 5GGSB 3UJJH 3PIQA 4LSDA 1MJ7L 5IK3A 3WD5L 1KELH 5IEKA 1BQSA 3IXTA 3F7YB 4PJFB 3FKUS 3DX6B 2VXUH 1J11A 4KDVA 4NQEE 1I3UA 1IC5L 3B9KD 1KIQB 4XCNB 3GIZL 3N50A 4AIZB 5IP4A 1CFNA 4HPOL 1A14L 4R90H 4BQ9A 3ORJA 4P59L 3W9EA 3UROR 5MEOA 4F2MB 2BMKB 3SKOA 4D9LL 2EXYD 3SE3C 1PZ5B 3LKPA 3MBEB 1LP9B 4ZYKA 3ZT7A 5HHOA 1A7PH 5FKPA 5EU7C 1P6AB 4YHOL 1RZ8A 3TN0B 4PBWD 5ESVA 3WUWG 3MLUH 3I6GB 2IQ9H 4B50A 2IG2H 2EDYA 4ZFZB 3MLXH 1RZKL 2X7LA 4NWTH 1HH6B 1QPXA 2YWZA 1MAMH 4BQBA 5CD3B 2CIIB 5INDA 1OTTC 1WFNA 5E4IA 4JB9L 1IE5A 2YRLA 4Z7UA 2GJ6A 4UTBL 4NSKA 5HYFA 3QDMD 2VR5A 4JFPA 2P24A 3WFCL 5GGUB 5C0EA 4C54A