3HB3C

High resolution crystal structure of paracoccus denitrificans cytochrome c oxidase
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
EVKLQESGGDLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVASINNGGGRTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCVRHEYYYAMDYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structure of Paracoccus denitrificans cytochrome c oxidase: New insights into the active site and the proton transfer pathways
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1-beta
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hb3C00
1WBZA 4A6YH 2UV3A 5T3XE 5MHSE 4L4VA 2W0KA 1D6EA 2IBGA 3FQTB 4DAGL 4NWUL 3CSYB 4YBHA 3RGVD 2DDQL 5HI3D 3GMPA 1FO0H 1KENH 3RTQA 3F7RA 3MMEB 4MVBD 1BGXL 4FQCL 1KCVL 4KJYB 1U3HB 2XICA 3OX8B 1AR2A 3MLYH 4KJPC 2D0HA 3CSGA 4LRNL 1XF2B 4QYOA 1P84J 5D2NA 2MCPH 4DVBA 3EYUH 1FH5H 1JTTA 4FZEH 3RGVA 2VLJA 1K5NB 1AKJB 3Q0HA 5CGTA 3FFCA 5EZJB 3RY4A 1QSZA 3A6CL 1M6OB 4PRAB 1CXLA 2ZUSA 1PQZA 1IC5H 1EFXD 2OQJA 4WU5A 4O51B 4IMLB 4HFWB 4UOW1 3NZ8B 2AI0L 3O0RH 2CIKA 3I3EA 4OFPA 4P3DA 1S9XB 3LSOB 4LKCA 5K59F 2YEZA 5INCA 2A83A 3DGGA 4RWYH 4EIZC 5TE6L 4NKIL 3L3DB 3LDBB 3OXRA 3OAYK 2AK4E 4AM0B 4IOIB 2X4SB 1U8LA 1NCAH 2QQLH 3SHSA 5BS0A 4EN3B 1A6ZA 2X44D 4JAMB 4XP9H 1IFHH 3VFNA 1MRDH 2V7HB 3OAZK 1KPUB 1S5IH 4MXQC 5FKPB 1QSFB 2BSTB 4ZO6A 3S4SG 1I1RA 4BZ2L 6FABL 3IGAB 3ZDXE 5EIVA 4YDKL 4QHMA 2X89A 1U8NA 1OM3H 1JWUB 4PRPA 4L3ED 3C5ZD 4Q6IB 4U2ZA 4AG4H 4BKLB 1FYTE 4GAGL 4TTDD 3VWJD 4EBQH 1T20B 4JKKA 4G6MH 3TBVA 3ALPA 2AABH 4F2MA 4G42B 4MQTB 2NXZB 4JY5L 4UTAL 4HIEA 3QPQD 4PJFB 4WO4A 4OGAC 4ZFZB 4CRPA 1I4FB 3BP7A 1DQTA 5D1XD 1XGPB 1VFAA 2L0DA 4F15B 3QH3B 5HYSA 4DZ8A 3QUXA 3QULB 1AXSB 3CDCA 4P48A 4L4VE 4XXDB 3AU1A 1L7TH 2UWEE 2XY1A 5I19L 5HDBE 5SWSB 4QTHB 3JXAA 4NC0B 2A6DA 2DQCL 4MA8L 2LVEA 1VENA 2UYLA 3U4EB 4XZUA 4O5LH 3I6GB 1I8MB 2CPCA 3FT3B 3MXWL 4OZFA 2ADJA 4HBQA 1I1FA 5C07B 3DVGA 4I0PA 2NCMA 2R29L 3F7YA 5HHOA 3TN0D 2RCSH 5IFAL 2WM0A 4XP5H 5DD0L 5F9WB 5LQBH 1WEJH 1ZVHA 3C5JA 4JFEB 1UYWL 4NUJA 2FDBP 1D6VL 1QFHA 4WHCA 4B53A 5K9OB 2G9HB 3MRPA 4FXGA 5IIEA 1FLRH 3WE6A 3C08L 3IETB 3D85A 1JYXA 1U8MA 2R4RL 2M26A 1FDLL 1ZLVK 4ONFH 3V7MA 4LCCA 4FQLL 4WV1A 2HVKA 1Q9LB 4JRYE 4EDWH 4YEFA 4K9EL 3LQAC 4FQIH 4O00A 4IIQB 5DHXB 4M1CD 4K9EC 3MACL 3HHRB 1INQB 4U1MB 3ZMRA 3GM0A 1ZHNA 4Z5RB 4G8FB 1OLZA 2P24B 4TUKL 5CSZB 2PYED 1QBML 2ENSA 3I3DA 1S3KL 4Y4FC 4ZS6D 1Q8MA 1NC2D 4OZFG 3KLHD 3O4LB 1CLOH 3UPRA 5E24E 4P59H 4QY8B 5EU6D 5IQ7H 3EIFA 3ZE2F 3D48R 5DJ2A 4X6FB 4MD5A 3CFCL 3M45A 4YXHH 3IJHA 4U31A 3DECA 3KDMB 2IF7A 1ADQL 3F7VA 5EULV 3LS4H 4WNQB 3W9DA 1JCKA 1MNUL 2EEBA 4OZHA 2YA0A 3KPLA 1QRKA 3MV8E 1HI6A 3PL6C 3CLEH 2EH8H 43CAA 3HCVA 1BFSA 1FG9C 4LVNC 1R5WB 1WCQA 3BI9X 4UDUB 1VB9A 4YBQC 5I1KH 4PJHB 4CGTA 3FCTA 1KN4L 1RURH 2C3XA 4PJXF 3SDXB 1OPGL 1U8IA 4Z7WA 43C9B 2EDLA 2BNQD 3WUZA 4QTIL 5DO2D 1HHIB 2VWEC 4NQSA 3NIFE 1YEDA 5EPMA 3PHOA 2ZSVB 5TDPA 5DEGB 4UOW0 2IFGA 3GMLA 3LKQB 4LLDB 1IAOB 1A4JA 4YHMH 1KB9J 1YPZE 1MQKH 3VRIB 4D0DA 2DRUA 2DL9A 3F6IA 4NQVA 5IB4B 4OT1L 2BSRB 2QTEA 3BUTA 1MI5E 1C12A 2OP4H 1KJ2L 1KCVH 3IDJA 1FYHB 2IANB 2VN7A 4HX1B 1BJMA 5JA9A 1YZZA 1LO0L 1NH6A 3VI4E 5HYJA 5D71L 1CLCA 5GISH 1PYWA 2APVA 1IM3B 1NDMB 1PKQB 3RWJA 2DMCA 2OJZL 1U8KB 4U1LB 2DKUA 3OKMA 3SY0A 3OF6D 3V2AR 4U6HB 3UX9B 4WWKD 5IEHB 1RJYB 1KB5H 2BCKA 1BAFH 1S7RA 3O6LH 3DRQA 4DQOL 3FQXB 1YNTB 1WZLA 3S34L 1DL7H 1M7IB 3SQOL 1HINL 1FFPA 1UVQA 5I16B 3DETC 1LK2B 3AS0A 1F00I 1IJ9A 5DA0B 3DX9A 3FMGH 5TPWL 1PJ9A 2W65B 1KCUL 2AXGA 2Y1VA 2AEQH 4F57L 4N9GA 3MYJB 1EMTH 2AGJH 4AM0A 2FJHB 2J5LC 1DQDH 3ZTNL 1UM4L 2F5BH 3B9KA 3OXSA 4BH8B 3PWUA 2M1KA 1HQ4A 2CJUL 4JY6A 4ODVL 1FP5A 2FR4B 4PGDB 1REIA 4XVJL 4F80A 4Z7UE 3PHSA 4ONGH 2DQJH 4ORZC 3GIZL 4WW2F 4MJID 4NBXB 3LIZL 1CIUA 3MLVL 2AABL 3P4MB 2JJWA 4CAGA 2IPKB 1CE1L 4TRPH 4DGYL 1MCPL 4K7PL 1U9KA 4XVSL 3VFTB 1IAIL 4M7JH 5DT1L 1ITCA 3TBVB 3WNNA 2NY7H 3ROLB 3AMLA 5SWZB 2WAHA 4LSPL 4X9FA 2QHRL 4WW1B 5IQ9A 4EN3C 2G75A 3AC0A 2D0FA 2IPTH 4R7NB 1RI8A 4ELKA 4WEBL 3MLUL 4U2YA 5C2BH 1FGVL 1NCDH 5B38G 4P49A 5FM5O 1W0YT 4PJBB 4QHNB 3QXVA 1A6PA 3S8WA 4YHKH 3RWDB 3KYKL 2QQKH 2R1WB 3O4OC 5CJXC 5F96H 1FYTB 2OQJB 3ARPA 1EEUA 2IFFH 2EE3A 2VR4A 4Z7UF 1PEZA 2MWCA 3NZ8A 3ESVF 4OLVH 4P23A 2IQ9H 4BZ1H 2H2SD 2C5DC 2RCSL 3GSWA 1EUTA 1T04B 4PJIE 1A6WH 2R2EB 5EOCL 3KAAA 3P40A 4GQ9H 1CL7H 4JFDA 2LTQB 5DDHB 1KCRL 1J1OH 4GRLB 4AIZB 4R3SB 5C6WH 2P42B 4TUJA 1U3HA 1NBZB 3CFBA 3SGEI 1D5IH 1YPZB 4AQ1B 3ARZA 2H8PA 4Y16C 2HLAB 4JAMA 1N5AB 1DZBA 5FCSH 4M5YH 3BZ4B 3MNVB 5DVMA 4MCYA 1ZANH 1FG2B 4LCWD 2IGFL 4LARL 1JUFA 4YK4B 1OOAA 1ZHLB 4KJWD 3WKNA 3CGTA 3KPQA 4PJGF 2Y6SD 1AIFA 3WEXA 4V1DB 3RL1B 1MCOH 2BVEA 1FZKB 5GRJL 1DR9A 3BP6A 5MENE 1DP0A 1S9XA 5B38A 3OR6A 4ZAKA 1AXIB 1G84A 3NA9H 1JRHH 2IH1B 5HVHC 5EBLA 4JDTL 4KHTH 1KBGH 2IANE 1QRNA 2X05A 1TETL 4K55A 4JFDD 4LLQB 1AFVL 4U1KB 1RIVL 1RD6A 5KSAB 4XHJC 4MAUH 2ITCB 3ARGB 1KB5A 4K94C 2RHEA 3MRBB 5TFSH 1T6WA 3S35X 1FL3B 5CP7B 3UTSE 4YHIA 1X44A 4YXKH 5CEZD 3GNMH 3C8KA 4BSWA 4UT7H 4Y1AB 3MOBH 3E8UH 2IPUG 3FT3A 2ZPKH 5IVOA 3GBML 4EVNB 1OD7A 1Y0LA 4RAUA 3KWWB 4CVXB 4Z6AT 3MZGB 4HJ0D 4PS4H 2B39A 5DD6A 1IZKA 1I8KB 2DQHH 32C2B 5BJTB 5LWYL 2VDLH 3W9DB 3WD5L 4X6DA 3C5JB 1YNLL 4Z7VF 4TNVK 1JN6A 1UXSA 4K8RL 1JGDB 2IG2H 2F8OA 3CK0L 4HFUL 1V05A 5ICXA 3HZKA 1AXSA 1I7TB 3MFFA 3HE6D 3O3EB 3SO3C 3QQ3B 2ZWLT 4UT6H 3UZQA 1B4JL 2OR9L 1RIUH 4IJ3C 4LEOA 2WIMA 2Z93B 3G5XB 2VL5A 3QWQB 3RL2A 3UC0H 4AEHL 4LEXH 4WW2A 1MPAH 3ZDXF 2IADB 1OP3K 1JHTA 1CDCA 3NFSH 5E56A 3TVMA 5T5FL 5A16B 4HJGB 1FYTD 4X4MA 4JE4B 4ETQA 2BVPB 5HGAA 1UWXH 3EO9L 2EDWA 5IW3A 2ICWJ 1OAUH 3AREC 3C2AH 1KJ2B 5D1QB 4XHQA 1J7VR 4RGNE 1LEIB 5DJ6A 5BO1L 3EYQC 1MFCH 4JGUA 3FB7A 1RZJH 2CSPA 3LN5A 2O26U 5F7DB 1BBJA 4DQOH 4GO6B 5CLTA 1RFDL 1A14H 4UAOC 2NY4B 5L2KA 4RAVA 2QR0B 4RX4D 2XRAH 1UWGL 4JO4H 4O2FB 5FK9B 5FV1L 3L5XL 4XXCC 1L7IL 1D5ZA 1HI6B 1SY6L 5AAMA 3QEQD 3JVGC 4JKPL 4H5SA 4TOYL 4Z5RA 2DWDB 3BPLC 3VWKA 4RDQF 3FHAA 1U8OA 4Y4FD 3HI6H 5FOJA 4NUGH 4U6XB 4YX2H 1HSBB 4ZFGL 2ZKHH 2AJSH 3B9EA 3H9SD 3BRGC 5I1HL 4HK0B 4YPGA 5JHDD 2A6KB 2OSLA 2O5YL 2AJVH 3ZLQC 1DUZB 2EYRB 3D9AH 3HRZA 5C0AD 5I73B 1XF3A 3W2DL 5IWLC 5KW9L 1RZIB 2HFEB 3X14B 2CK2A 2JCCA 1T2XA 4JFZH 3MBEB 4NQCD 3V0AC 3G5YA 5C0EA 3UJTL 5GGTL 1MAJA 2AXJA 2FX8H 1KG0B 1OY3B 3AM8C 4E0RA 3OAUL 1X6NA 3B5HA 5AZEH 2DLTA 2VNCA 1IARB 1HK6A 1BJ8A 1CFTA 2CD0A 5EBWA 4G6FD 5HYJB 4PJXA 4IRJA 5GSVB 1OARH 3P4NB 4PGBA 5HHNB 1NCDL 2Q6WB 1B0WA 3PWVB 4Z7WB 3D1MC 5C8JB 4Y4FA 3RP1A 1IM9A 1HHHA 3U30C 7FABH 4JM2C 4OSUL 2R2HB 4OGYH 2AEPH 2VDKH 4M5ZL 4APQB 3QUZB 2IQ9L 4BZ1L 3SQBA 1L9MA 1QNZH 3RUGF 3SOBH 1OP3H 3DXAA 4JO2L 4S1QL 5DJYB 4J12A 4GMTH 4K3DH 1CICD 3B3IB 1DEEB 3QI9A 1T04A 3WXWL 5DEFB 4D3CL 3KPRA 5IJVB 5DK0A 3G9AB 3JV6B 3SDAD 4QHUA 3KYNB 1BECA 2BY0A 5I1EL 3QUYB 5CINL 3SKOB 4WI5A 2E9BA 1T21A 1G9ML 5CD5C 4HDIA 3WFZA 1IM3A 1CE6B 3MRQB 1XIWA 4PJGB 4RFNB 5I1DB 1YA5A 3EYVB 3KLAA 4NM8L 4YR6B 3MJGX 1UZ6F 2FJGA 5I9QC 4MCYB 4OLZH 1MLBB 1PG7X 4LPXA 1CFVL 5B3JE 5IMLB 3DRTA 3RKPA 4QXGL 2YMXH 4N0YH 1CDGA 3HE7A 2HLFD 5EU4A 3KG5A 2V2XB 3GM8A 5E6YA 3ULUF 4GKSA 3VXMB 4XPTH 4YHML 3LV3B 4TPRL 1NUFA 4P46B 5MERB 5D2NC 3OR6B 3G6AB 4HCRH 3NTCH 5HDQL 4YH6A 1OAXL 2QQQA 4AH2A 2AERT 1MJ7L 4I0PD 1BQLH 5J9PB 2ICWB 3CC5A 4F9LA 3SE3C 4ZAKC 1MFDH 3M8OL 4LU5H 1LHZA 2Y4SA 3MLRH 3VCLB 5A40E 2R9HD 1U8QB 5DRNB 3MRIA 5SX5K 3X3GH 5IB3A 4N90D 2BHZA 3MGAA 3RZCB 3WCYA 3C6SA 3DURB 2D7PA 1TJIL 2X89D 5GS2D 1J05B 1ETZA 3GBMH 1EPFA 5IBTH 5CSBA 3FL7A 5J8OA 1NCBL 5DRXA 4HKJA 2NXZD 2A9ML 5DHVB 3ZKNC 1YC7A 4PY7B 1PKQE 3J8F7 2NX5A 4HQQL 1F8TL 4P2OA 4I2XE 5ILTH 4Y16A 2QV2A 3P0VH 4J3TA 1P1ZB 4TUOA 2BVOA 3QA3B 2G5BB 3D85D 2AQ2A 3NCCB 4JRWA 4UINL 4MXVE 1VERA 5D7KD 3TN0C 2WNGA 1XGTB 3I75B 2HJFA 4LLVA 3PWNB 2D7TL 4MMXC 1I7UB 4NJAH 4X8JA 2PW2B 1CZ8L 3O3EA 4O9HH 5ALCH 3K81A 3QJFB 4O2CB 1YEJL 4AEHH 1UJTA 3T1WA 2OS7A 1T1XA 1S7SB 3QXAB 2V2TA 3NFSL 1UACL 3FFCD 4DAGH 5I18L 3QG7H 2I24N 2VL5B 4FXKB 3O6FC 3O3BB 4X7SL 3T0BA 3CH1B 2VLKB 4ONGL 3VXTA 5AG9A 1IGCH 3GIZH 5GISL 3B8SA 2PW1A 3BQUA 3SDCB 3UTZA 2AJYH 3CVIH 1S7VB 1T7VA 2BXZA 4ZOAA 4KKCD 1CD0A 2GY7B 3OB0H 4FFYH 4A2LA 1G7JB 1MSPA 3T0ED 5DMKA 3BPCB 5DUPH 1FGNL 4ZSOB 5E9DD 3FHQA 2FL5A 5DD3H 5EO0B 1IGJA 3EJZD 4KMTH 4HJJH 4FG6D 3FB7B 5KOVC 5KS9F 4APQD 3JUYA 3SQOH 4RDQG 1ZT4B 3EOYG 4K23L 5F89B 5F7DA 4XP6H 3OJVC 5JOFA 2DICA 5FB8A 2VIRB 3TA3B 4I3RL 5F7UA 5B38B 3EUUA 4A6YB 1UH2A 3VGAB 1UB5B 2BZDA 1QFWI 4Y89A 2XY2A 4LSUH 4Z7VA 4ODXA 4GBXC 4U1IA 1FZJB 4XTRC 2RGSA 5EORL 3UAJD 2VQ1B 2MJWA 1HIML 4YGVB 1MF2L 5KSAA 2P8LA 4NZRL 4YXLL 2CRYA 1U2HA 4O58H 4U6XA 5F7FA 3SGEH 2RFXA 2R2BB 1UGNA 2NR6C 5EB9A 1DUYA 1G7PB 5FDWA 3TCLB 2IAMC 2R0WH 4GQPH 2W38A 2LV4A 1PSKL 1II4E 3LRHA 1PG7W 1JGUL 5DT1H 4EBQL 5I66A 1RZJC 3KYAA 3LEVH 4ELMA 12E8H 4KROC 1JK8B 1EFXB 5B8CB 1RJCA 1TTFA 4R96A 4RGNC 1LO4H 3TZVC 1BQSA 2FZ3A 4HEME 1EAPA 4FFVD 3VJ6A 5K9KA 4L3CA 3MLZL 3H7LA 5KJRH 4WI3A 4BH7A 5CIPH 2PF6A 5JDJA 1X7QA 1G9NL 1T0MB 2J8UB 2QQKL 4S2SA 1ED3A 1FSKB 4OM1L 3ULVD 2XZAL 4X80H 4L4JA 2GJZB 2YWYA 4PB9H 3SE4A 4DGIL 4I3SL 1PLGH 1CLYH 5FHBH 1FNGB 2IC2A 4N8VB 2Q7NA 5JIKA 3RGVB 4HW6A 4OZFH 1JMZA 1NFDB 1JGLH 5HI4D 4KMLB 5BV7C 1QTYT 1QYGL 3QWOA 4S1RH 5E9DA 4IMLA 2I07A 1D5ZB 1H0DB 1AQKH 4WCYH 2OMNA 3B3IA 4PB0L 5HHMD 1T5XA 4P9HL 2Z4QB 3O2DA 3DV4A 4M5YL 3T4YB 5C7XH 1FFRA 5EOQL 3KXFE 4HG4J 1OAZH 2Z92B 5KVMC 1IAIM 3GHBL 2OK0H 5F97E 4HK0A 2E8ZA 3RTQD 3KHQA 3ULVE 1MI5D 4RMTA 1KLUB 2E27L 4MQSB 1J18A 4ODTL 5EZLB 3ARBD 3S37X 5BVPH 4FQ2L 3DO7B 3OKDA 3LS5H 3IDXH 3ULVH 5H94B 2IWGA 4HPYH 5GIRA 4LVEA 2I9TB 5IK3A 5EOTA 1FIEA 1U3JA 1BEYH 1FZMB 3N1GC 3GSNA 1CFTB 4D0BB 1UKSA 3X3FH 1T0NA 3VMPA 5ENWB 5BMFL 1WFUA 4KXZH 1KYOJ 1Q38A 5IFJB 2NTFB 4Y4FB 2CKNA 1Q0XL 3NIDE 1FORH 3HFML 3V4PH 5GGUB 3B9KD 5DRNA 1FQ9C 1MCHA 3OKEB 1HWGB 1Z6JT 1OT2A 5JORB 4WJ5B 4P23C 3I9GH 1Z5LA 1CU4H 1YNLH 5CJOL 4PLNC 5C0DA 5I8CB 3RHWF 2DKMA 3FN3A 2E6PA 1UWEL 1GRWA 3SDYH 2VZ1A 2F8XC 2XT1B 3Q2CA 4L8CB 4WUUD 1QLRB 3JBG7 4IBLT 1N3NB 5EU6A 3VDCA 3QZWB 4JG1H 1UH4A 4OCNC 1G7HA 1S7UB 4HKZA 2C9AA 4NRYB 4CUCA 2CUMA 3KLAB 4OKDA 3PJSA 3HNSL 1HCFX 1Y6KR 1CFSB 4ZYKB 1BOGB 2AV7A 3VW3H 5CMAB 2VAJA 1PQZB 1ZV5A 2X4RA 5I1HH 1ZSDA 1A7RH 3KXFA 4NQEA 3SKMB 3RTQB 5DC4B 4FTVE 1Q9LA 2YPLE 1NGYA 1QBLH 1OM3L 4HBCH 2WIIA 2ORBL 3HG1D 4NQUA 5C09E 5T1KA 4YUEL 4Y0GA 1IAII 1HEZA 5DEFA 3MOQA 5BW7C 3CX5K 2EDDA 4QYOB 1ZTXL 3BZEA 1U58A 4WVRA 3MJ9H 5BVJB 1MAKA 4KUZH 4F15C 4KQ3H 2ESVA 5DQJB 4UTAH 1MEXH 5JIPA 1U8LB 3RBSA 2P7TB 2VABB 4LVNB 4HKBA 4H1LB 2EKJA 4HIIA 1MAML 4MA3B 1D5MB 4QRPE 3FFCE 2MHAA 1MREH 1YYML 2KZWA 4X7CC 3OHXB 1NANI 2EKSB 3UDWA 5F89A 3RWEA 4U1HA 4I18A 4NYLB 3ARUA 3VH8B 3VFRB 3KPPB 4FZ8L 5E8NA 5TF0A 3CFIC 4YX2L 2HFFB 5LJYH 3UYRL 4FTVD 2QQLL 2I27N 1P1ZA 1MY7A 4OIIL 4RNRB 4HIXH 2AXHA 3VFNB 2W07A 3BE1L 4IRSC 4OZHF 3TWCL 4E5XB 1IMHC 2NY0B 3QUXD 5CJQL 1T22B 3GRWH 5DQDL 3FT2B 5HVHB 5HSFA 5E00A 4FQQA 4JQXC 3GMRB 4NPYB 5SWSA 2XFXA 4MB4A 5F1KC 1J0ZA 4X6DF 3QXAA 5EPMB 2A6DB 2V2TB 2OJEA 3OAUH 4KKNA 1T20A 3IDIA 3GMLB 2BSED 5A43C 3ISWA 4OLYL 4UBDC 2R4RH 1JFQL 3EOAA 4PJFA 3QUZC 2VSCA 1YNKH 1SYSB 4FQLH 1F4WH 1XGPA 5HYSB 5HHPB 2J4WH 2F54E 3S96B 3SDXE 3WFBL 3JV0A 3QIUA 4XMKH 4N1EA 4HX1A 1RUAH 3O2WH 4WWKB 3GBNL 3QG6B 4HAGA 1U3HC 4DWHA 3L3IA 5F88B 1K4DA 2VH5H 3QHTC 4UT9H 1S3KH 5L2KD 5L8KB 2G60L 1I1AC 2UWEA 1H3PH 3LN4A 4LU5L 2J3SA 5DMGC 1IQWL 1MCDA 2FWOA 1Z3GH 2NLJA 2VB5A 4LSQL 4LMQE 5JHDA 3LZFH 3NIGF 4KRNA 4R0LB 1F2QA 2C3VB 1X5JA 4XPBL 1PY4A 3BX7C 1Z9OA 3VXPA 1E6JH 3IU4H 4Z7VB 4X7DC 3GJEB 3HAEH 1SY6A 1BFOB 3WLWC 3NCYP 2EYTB 4O4YL 4IOFC 5EUOA 1CTNA 3RY6C 2I5YH 2D03H 3TBWA 5F1IA 5DWUH 4FG6C 2RFXB 4JFQB 5I15L 1R3JA 3MO1B 2OZ4A 2ED7A 15C8L 1QACA 3HMXH 4PJ9D 1FC2D 3F62A 1RHFA 1CGUA 1P4BH 1ZAGA 1L6ZA 3MLWL 1UM5H 3V7AG 1A7PH 1NMBL 1N8ZA 1JYVA 2R56L 3D69B 4X6FA 5EZIL 1CZ8H 1MCFA 4XNYH 2A1WH 1NCWL 4XT1C 2JKXA 5E94B 2KQMA 3RVXC 3TH3T 3L5HA 3LMJL 1S78D 1Y18A 2P46B 4G7VH 1T66C 2I9TA 1AFVH 2J6EL 4RCAA 1MFDL 1FVCB 3M8OH 4MAYB 5CZVH 4H26B 4OJFL 2P43B 4ENED 3UPRB 2MCG1 5TFSL 4GG6A 5ESQA 3IJSB 1C16B 4Z9KB 3U0PB 1P4LA 4LSVL 1I3RB 5D72H 4JFPA 2UY6A 1T5WA 4LCWA 4NSKA 1JNNH 4BFIB 1BVKB 1NCBH 2MQCA 5H35B 1C5DB 5HI5D 5C07E 3B6SA 3BRFA 3PGDA 3E6HA 3T2NH 1A6VL 2DQUL 2QKIB 1MNUH 1MHHB 4QLRA 2JB5L 5C0FA 3QDJE 3OJDA 4OM0H 3ZHKA 8FABA 1E4KA 2ITDA 1TDQA 2OMBA 1I1AB 4U3CA 1LP9E 1X4YA 4GXVH 1NC4B 3QXUA 1HN1A 5C1MB 3BP4B 3ZYIA 4IJ3B 1JTOA 5JPMB 3NPZB 4NJAL 4K71B 1BFVL 3ELAT 1YJDL 4OZHE 4X99A 5F9DC 3X12B 3ULVC 5IM7A 1E4WL 1CT8B 1KJ3H 4FQJL 1SHMA 5JHDE 5ID0B 4XX1E 3B2VH 4YJZL 3VW3L 4G8EA 1KCSH 3RFZC 1XZ0A 5IESH 3E3QC 4D9LL 4DN3L 5HI4C 4XNUL 4OF5A 3L7FB 1RJYA 1RUQL 4WENB 5IJKA 1A6UL 3T3PE 3TGXA 1CD8A 4YZFF 4TVPE 4Q74A 4FFYL 3EO9H 4EEEA 1OAQH 4Q9BA 2WMPA 4U0QB 5DMIH 1FZMA 3BP6B 1FGNH 4JFOB 2ZJSH 3QRGL 4JQIL 4PRHA 4OZIF 2ICCA 4HGWB 4PJ9B 4KI5F 1QFUL 4Z0XA 1HEZB 1T5XB 2XZQL 4QT5A 5EDXA 4GT7A 5EBLB 1Q9OA 4B7IA 2W9LA 1JMXA 1AGFA 4EOWL 3LAFA 3MLZH 4BM7A 1ORQA 3MRJB 3RDTC 3BXNA 2JELL 3PIQB 4I3RH 4XTRD 1FJ1B 1RFDH 1YEIH 2H9GA 4NC1E 5EU7C 3PWJA 4HLZG 1JNHA 2IPTL 4WUUB 3RAJH 4NNXB 3LHPH 1LE9B 1SEQL 4E41B 1NGPH 3OKDB 1CQYA 3VFWB 1UA6L 2IPKA 1Y0LB 4RAUB 4JFFA 2EH7H 2ERJC 3MRNB 3HI6L 4G9FB 3HKFA 1N0XL 4I48A 5BJTA 4RGOH 1UM4H 1T0PB 2VDML 2VISA 4J4PC 4KC3B 4XP5L 4UDTA 1AQKL 2DF3A 1KCRH 4NKIH 3QPXH 4Z77B 5DSCB 5E6ID 3VE0A 3BZFB 3NABH 5GZOD 2A38A 4PJAF 2CLRB 3KNBA 4ZS7H 4FQQB 2NYYC 8CGTA 3T8XB 3S98A 1IT9L 5EZOH 1IAMA 3O8XB 3EYOA 2XACC 1EJ6A 4YAQA 4MD4B 2A6JA 5FYJE 4P2QA 5HJ3B 5KSBA 2XA8L 3E2HB 4JPWL 6CGTA 2YK1H 4P9HC 2BNUA 2HT3D 3D2UD 1LP9F 1CDJA 1TZIA 4HJGA 4ETQB 1MCOL 1U8HA 4OFDA 2ID5A 1D3CA 3WKMH 1IKFH 4NHUA 4JY5H 1IEAB 1Q1JL 3A6BH 2Q87A 4JPVL 5JDSB 3TESA 5IKCA 4WEUD 3JUZA 3RDTD 2H2SC 1MFAL 1G9EA 3S5LB 3WNPA 5F88A 1IC4L 3QIBA 2F74A 4RSVA 1NAKL 3FZUD 4TQEL 5F6HI 3BGAA 1A7QL 2B2XH 4OQTH 1I9RL 1GHFL 1HOCA 1IAKB 4GMTL 5ITBL 1K3ZA 1HHJA 3IAQA 1UG9A 1VACB 2VKXA 3M17B 3MLSL 3VFMA 1HH6A 2QSTA 3U9PL 1A1NB 1MFNA 4ODSH 4LCIL 5B39G 3UO1L 4MJ5A 1OD9A 1WCBA 2HLAA 1A9BA 3HC0B 4ZODA 4OQ1A 3FOMB 2HN7B 1OCWH 1A0QH 4M7ZB 3BIKB 2HP4A 1CL7I 4XPGH 2VDLL 4GW4A 3IYLW 3ZYOA 3VFOB 3G5VA 1J1PL 3BKML 3VFVA 3KPQB 1U0QA 1ZVYA 2IG2L 3GMRA 3V9FA 2W0PA 1WVZA 2ENYA 3BYYA 4QRRA 2Y5EA 5JW3L 1JTPA 1I75A 4WGVB 3QUKB 2QADD 4JZNA 4G9FD 3DOSA 1TPXC 3V0WH 2VZTA 5ACMA 4G7VL 4W6WB 4LKXA 3QRFM 1VA9A 3IFLL 3EOAB 5I1CH 1QRNB 1GC1H 4NBYB 5CZVL 3PWLB 3DXAD 3X17A 1E28B 3ZSTA 3U7YL 1X5HA 4D0CB 3ZSSA 4E41D 3B9KC 4GMSH 2F53D 3QQ9D 1NL0H 2AK4D 2HJLA 4KDVA 3T3MF 3QFDB 4YDVB 1HCVA 3QEQA 2GITA 2VC2H 4L4TE 3MBXH 5EIIB 4P2CG 2H26A 4JY4A 1IGTA 5D7LD 2BFVL 2F58L 5JXAL 1BQHG 4U7MA 3GMOA 1N5YH 5EU3A 5CJOH 2Q8AL 2XKNB 1UC6A 2H6PB 1D5BA 3TPUA 5TE4H 4CDGC 1DCLA 3E6HB 5HHVL 2VLRA 4LSRL 4PD4J 5T3ZE 4DKDC 1MOEA 3PV6A 4Q97A 3BKYH 3CJJA 3O2DH 3BWAB 1F4HA 4JKLA 5KVDH 1KIRB 3HZYB 4K94H 3CFCH 4P3DB 1NBQA 4LPUA 3TYFA 1ZGLP 1I7ZB 2BRRH 2XRAL 1F58L 5GRYA 2X4OB 2NY5L 3GB7B 3MV9B 4XNMA 2EDHA 3GSQA 1XFPA 3OKNA 3S5LG 4LEOB 3SKOA 4V1DE 2X40A 1INDH 2B4CC 4KTEL 4WDIB 1DN2A 4KK6D 4M7KL 2CKBH 5FGCE 1BBDH 5GGQH 1E6OL 1F11B 4WWID 4E42A 3LN5B 5GGSA 3MV8B 2WBJD 1A2YB 5HPOA 3L7FA 4HEPG 4XVJH 3SKJL 3SEPA 3CVHH 3GJFK 3ARBB 3DX7A 3INUL 3EKCA 3RVWD 3LIZH 2AK1H 4RMSA 1WIOA 3V6ZB 4YBLB 4N9OB 5E7BA 4EXPX 3C5SB 1DVFC 4NKMA 5H8DA 4F3FA 5INDA 4UIKL 5L9DH 2OXGA 1KXQE 2EC9T 2BDNH 4HGWA 4ODHH 3H42L 3G5ZB 3BSZH 1L0QA 3TO2A 2DTSA 4QT5B 3HE6B 1H8SA 4X6BB 4PJ9C 2HKFH 3O3DB 3D0VB 1DBKH 1LO0H 4CN6A 2ICWA 2PYFB 3FOLB 5DQ9B 1R5VA 4MHHI 3PHQB 2QBWA 4UNTA 5IHUL 3QPQC 3LKPB 1CG9A 1FE8L 2P5EE 4F9PC 8FABB 5GHWL 3UYRH 4QTHA 1MCQA 1UA6H 2JCCB 1J0KA 1MCWW 1YECL 3WNMA 5F3BA 3REVA 5F6IB 4RGOL 1SVZA 4LRIC 3BUYA 3KPSA 4ORGA 2G2RA 1P7HL 3LZFL 4JGMA 4Y16B 1KFAH 4ZFOB 2VLMD 4O2EA 4GH7B 2VISB 2O61B 3VGFA 5F7MC 3IDNA 5E4EC 4IIQC 3A67L 1KCUH 5I1EH 5IEKB 4WU7B 2DB8A 3S88L 3LQAL 5IMOB 2PTTA 3RWFB 1NBYB 2DTML 1TTUA 2CRZA 3OKKB 3KYMA 1MRCH 3D85B 1E4XI 1HILB 3PNWA 3NFPA 4QWWC 3RVWC 2BSSA 3ECBA 4M02A 3QCUL 5TGBB 3B83A 4YAQB 2ZUUA 4WGWB 2R56H 4MQXC 1UFUA 1YY9D 3VFPB 5ACLA 5HJ3A 5I17A 5JUEH 2M2DA 1G0XA 3MLXL 5EO1A 1TQBB 4MNGE 1FCGA 3CFKB 3T0WA 2NTSP 2XPGA 4OD3L 1BHGA 3T4AB 3HLAB 5C0NC 1QNZL 4GAJL 3ALWA 1U41A 4OLUH 1VSCA 3TVMC 2VXTL 3T04D 1PW3A 4C54A 4AEIH 3FB5A 2I9LA 4HH9A 1L9NA 1YEFL 2AKRA 5CBAB 3PL6B 1KIQA 1NMAL 2DJ4A 2FL5B 1K85A 1JNNL 4U1SB 4HUMB 4HUXB 4O4YH 2BJML 4QRQA 1GGIH 3BDBA 3WUWB 2DQTH 3OWEA 1MIEH 3UBXG 4JM2F 4X5WA 3MJ6A 2D31B 5GGSY 4KZEH 5C7XL 4GKSB 1QSEE 3WIIH 1T21B 2EIBA 2Y6SC 4Z76B 5SV4A 5FGCB 4NQXB 3TO4D 4N0FB 3ES6B 4NZTH 3WD5H 1MFBL 4LDOB 4DEPC 3BW9B 1CDYA 4WI6A 1YUHB 1J1OL 4DW2L 3SE9L 3IFPB 3VD4A 5D2LF 2BVUA 5C9KA 1BD2E 5T1LB 1KTKE 3BKCL 4KDWA 3WO4C 3SDXA 1VPOL 1JWUA 5FYJD 5C09D 1C5BH 3DWTA 3VFVB 4YO0B 5CZKA 5E6IB 4PGCA 1E4XL 3BPOC 2NY2C 5IOPA 4NM4H 1MIML 1Z9SA 3KPSD 2FLRT 5FO9B 4PR5A 1DQLL 3MRCB 3GSVA 2X1WL 4YZFE 1RUQH 4BQ9A 5C0CD 4ZOCA 4MDJB 3P30L 4ELMF 5JPNB 3NN8B 4WI8A 3V6OE 3GSXB 2AXFA 4MQXD 1OP5K 3NA9L 2A9NH 4XVTH 3BN9D 3AU1B 4Y4KD 4LMQI 3GMMA 3QFDA 3QWRA 4J4PD 5D2NE 3UTQB 4AIOA 4GKOA 3HB3C 5IBTL 4ALAL 3KPNB 2FSEA 5JW5B 1KIPA 3V4UH 4HT1H 2PUQT 3QIBB 1MVUB 4PBXA 4O2CA 1TNNA 1OGAB 4FQXD 1XF5A 4U6YB 3VGBA 1AD9A 4FFWD 4P4KC 4EI6B 1B6DA 1F3DH 3IXAB 3EYOB 3KHOA 3ARVA 1JF5A 4FXKA 5EUKA 4OZ4B 4LLYA 5JIIA 1P84K 2BXYA 2A6JB 1XGRB 2BP3A 2JK5A 2W91A 4P2QB 1XGTA 1KIUA 3ROOB 4BUGA 4PJGE 5KANG 4L3EE 4Y16D 3HG1A 3BIKA 4NKOA 4NHUB 5GS2H 1T1ZB 4C56D 1KF9B 4KXZI 5E4IA 4G8IA 3REWB 1UQSA 4FABL 4G9DA 1OAQL 2KQNA 5HBBA 1FFQA 4P46D 4AG4L 4GG6E 4JANB 2NZ9D 4NKQB 1C7SA 2F19L 2FO4B 2XKUA 3MLTB 1TJGL 3LSOA 3QI9D 4PTTA 2RQ8A 2AK1L 5C0BB 1OGTA 1QBLL 4JRXE 2QQNH 2R0WL 2IMNA 1T03L 3CLFH 4ZO7A 3VD7A 2VAAB 1JPSH 3O11B 3UYOD 3L3DA 3OXRB 4P4KB 2XZCL 3S37H 1W8OA 4KY1H 4JQVA 3UZVB 2D7QA 3W11C 3QO1A 1YEEL 3G04B 4M3KB 4ODXB 1ZLUK 4G7YH 4NFBA 4D0BA 1KPUA 5FKPA 3MRKB 3WNOA 3FCTB 3N85L 4KV5E 4Y19D 4X6BA 4LHQB 4LQFL 1SEQH 3NCYS 4O5LL 1B9ZA 1IKFL 2K1MA 5F7EL 1DUYB 4XCEA 4PJ8A 4Q7DA 3D3VD 3TCLA 1GCFA 1FNHA 4HUWA 5GGUA 3T3PF 1RZJL 4POZC 3CFEA 4WNQA 7FABL 4C83B 5GSRB 3VFSA 5GS3A 3ZKXC 3VDBA 5KSVB 2J1KA 1T1YB 4HIXL 3CFJA 4KDTA 1UYWH 4UIMA 3M1BB 5GZOC 5TF1L 5ANMB 1DSFL 5K9KB 4XH2A 5CJQH 1AR1D 3VXRB 4L8CA 5EOCJ 2DKSA 2FIKA 4NO0B 3AREB 5E08L 3T77A 5I76A 4GUPA 1J8HA 3VWJB 1NDGA 5D7LB 3LKNA 4PJ5D 5CKAA 1NDMA 1TITA 2Z0BA 1R3LA 5EUOF 2ZKHL 1EXUB 5CZXC 4NQED 2YK1L 3OZ9L 1NBYA 1QSFD 2AJVL 3D9AL 5FYLH 5KW9H 4NJ9L 3WKML 2VDRH 3WHXA 3T2OA 1B3JA 4K07A 4D9QD 4ODTH 5CCKH 3RUGE 2R0LL 1QEWA 3BN3B 1AKJD 1V3MA 3RPKA 4P5KB 1W0VA 5L0QB 5FECB 2MPAH 3MRPB 5I1GH 3EYQD 4ZAKB 4G5ZL 5D1QD 3WE6B 4L8DB 4WO4D 4X9HA 1NAKH 4Z7NF 4WEMB 1U58B 3RX7A 3QXTA 3DHJA 1NUDA 2EE9A 1BQLL 1JV5A 2ZG3A 1H3PL 1NFDA 4YBLC 4P46C 3GGWB 1IEHA 1S7RB 5GXBB 4YXHL 1NCNA 4ZMAT 4L3EB 2ZCLL 5E8EB 3EO1A 1FVDA 1S7WB 2CMRL 4LF3A 3JWNC 35C8H 1MLCA 4LHUB 5AWNH 2PO6A 5ITFB 5FAAA 4Q9RL 1FNFA 1YY8A 3FFDA 1YDPB 3IAGC 1KELL 1WJ3A 4Z7NE 3FB8B 1ACZA 2FGZA 3BUYB 4ORGB 3RWEB 4ERSH 2HWZL 1MHEB 2C1PA 4GAYB 4X8XA 5MI0B 3LPFA 1F8TH 3KPPA 2V5MA 5ILTL 2HYMA 2X70B 4NC2B 3OKOB 5JW4R 1CWVA 4NQDD 4D3CH 4LFHG 4P5MA 1B0GA 5DJ2B 1DTUA 4JKMA 1UZ6E 5LXGL 4C58B 2BRRL 3P77B 1MQKL 4QRUB 4UUJA 3N1MC 1U91B 3TT1L 1WWCA 1LQSR 4XPAL 5DFTA 3WFDH 4KRPC 4PJBA 3QDMA 5KVEH 3RWDA 3MRFB 2LFGA 5BXFB 1N2RB 1ACYL 1EERB 3CD4A 3NFNB 5DK2B 3SGJA 3WJLC 1MY5A 5CIPA 3U46B 5HYQB 5GS1C 3RL2B 1J8HE 5BMFH 3TCXA 1MI5A 4P23B 5CJXA 4WFFE 2IADA 1RVFH 3ARYA 4PJ5B 4RFOH 4KRPB 3AY4C 1SYSA 4XPTL 4HS8H 5KN5B 3GDBA 3AXLB 2N7AA 3WIFA 1MUJA 3H9SE 1DLFH 1TVBB 1QSVA 5HDOA 1Q0YL 1BAFL 4OCWL 3BSZL 3CZFB 1AD0B 2NQCA 1R6VA 4MA7H 1Z5LB 3D39B 1LO3H 1ZT1B 1A47A 1K4DB 4K94L 4Z0BH 4JM2D 4X83A 3X3GL 4AMKH 4EJ1C 1GOFA 4JZOB 4YDIL 1OGAA 3P0YH 4X4XB 4YIQA 1MAMH 2IH3A 1UEMA 1HHKB 3KXFB 5TPWH 1NFDE 5D7LE 1KEMH 1S5HB 3QDGD 3V4VL 4ZNEE 3I6KB 3LB6C 1W0WB 4J7RA 3BOVA 5ESVA 4F57H 3IDUA 3G6DL 1UKQA 3EBAA 1JF1B 4X7EC 4ZPVB 1VFBB 25C8L 3DMMD 2CJUH 5DJDB 1R0AH 5J1SC 4Y2DC 2BCKB 3O6ML 1A7OL 3ZE0F 3U1SL 4LGSB 2MSPA 4M03A 3TWCH 1GGCL 4PREB 4NQEB 2NY1D 4PGCB 5DJZA 3VMOA 4IOSD 3E0GA 4Z7OF 4QCIA 1M71B 1YEJH 1ZTXH 5I16A 4OZGF 4F7EA 3S35L 2BDNL 2FEDD 3DMMC 2NY7L 3H42H 2BC4B 4CMMB 2CDEB 3GMNB 4I18B 4R2GC 3BQUD 4PUBH 3VH8A 5E94A 1AQDA 2YSSB 2OTUB 4RAHA 2AQ1A 3BIAX 1M7DB 4LQ1A 4ZAKD 5DJXB 3STZB 5IW6B 4PJBE 3SDDB 1OSPL 1NCUA 1NGWA 5DGQA 4H1LA 3UPCA 4E5XA 2JELH 5TJWK 1WT5A 4ZPTA 3SE8L 2C3HA 2ESVE 2VJXA 3TNMA 4OD3H 3CXHJ 4W70A 4NPYA 4IEFB 3VFRA 2OJEB 5DD6B 3RZWA 3PWPB 1A21A 4PJAE 3CFEB 3M07A 1G7IA 2GJJA 4JHBA 3K3QA 1D6VH 4W4NA 5CFHA 2CR6A 4LSQH 5C0CB 3L6FB 2BJMH 4HGMA 2V2WA 1XGUA 5B3NA 4ELKB 1D9KD 4HWZA 1MCJA 2YWZA 1PAMA 5EORH 4GW1A 3T77B 3HC3L 3NZHL 4R4BB 1NDGB 5D7LA 1YPZF 4ZO8A 2GAZA 2ZCKL 2D03L 5ADPL 3MRQA 4NJ9H 4NGHL 3EYVA 3WDHA 1F4WL 3DMMB 3I2CH 4ODWA 4IHOA 2YC1A 3OMZA 4L5FL 2YPVL 5T1DH 4JPWH 3RIFF 1NMCC 2BNRE 5AUMA 2XWJB 5C0AE 4R0LA 3D5OF 2B0SH 1AGCA 2P5EA 5J12B 2Q1EA 1RIVH 1RUPH 3SDAA 3PXJA 2QL1A 4PJFE 2A1WL 1ODAA 4PJEF 1QP1A 4U3XA 3L3IB 4AEIL 5MERA 4PJ9A 4Z0XB 4NRXA 1FL5A 3HI1A 3P9LA 4KVCH 1FN4A 4XPFL 3TYGL 2WUBL 2WWMD 1OAYH 5D1XC 3LD8C 2W59A 2GJ6A 3BHBB 2ATKB 2GT9B 4PG9A 2FWOB 3Q5TA 1R3JB 1BX2B 1KTDA 3HAEB 4F7TA 1ORQB 4NWTL 3VCLA 3V52H 4PB9L 3RHWK 1WFNA 3SPVB 1RIHH 1SJHB 4N1HB 3JWDC 1FJ1A 3RU8H 4UAOB 3MR9A 3VXPB 5BZDB 1A6TA 3PQYB 4NNXA 4XBPA 4DW2H 3WL9A 2E7BA 4P2RA 3S36L 4HWEH 2Z8VC 5E6ZA 4P4KA 2EDBA 4JFYB 4I9WD 2CH8A 1T2QH 4R26L 2CRIA 1FNSL 4XPGL 4GAYA 4Q58C 2HRPH 1ZLWK 1KLGA 4XI5C 2X4TA 4M9PA 5GJSH 4F8TA 2BY2A 3IDGB 3OKOA 5F3HB 4TUOB 5GRUH 1IGML 1NMBH 1U95A 4X5LA 2HT4C 3UJIL 1LEKA 3RWIB 3CXDH 5E2WL 1XF3B 2JIXB 1VDGA 5JXEC 1OAZL 4QXTA 4G6JL 2ZOLB 2C4FT 4HUVB 2CRMA 3STLB 3W0WB 1KTRL 4OV6F 3IFLH 4M6MH 5F7KC 4GW5A 4P9ML 3ARED 4UQ2B 2R2HA 1CVRA 2FATL 2ICWI 4G3YH 2B1AL 3D2UA 3BT2H 4L1DA 4WU5B 3MXVH 5MP6L 5HVFB 1QEWB 2ZP0T 5JQ6H 2DYPB 4KMQA 1WC7A 5DMJB 4UIMB 3ULVL 1MHPL 4PGBB 2XOTA 3GRWA 1C1EL 1VEPA 2BX5A 4X99B 2XA3A 5CD5D 1A6VH 2FHFA 3JTTA 5DI8B 4FFWC 2FIKB 4NO0A 2SEBA 2R39A 1C5CH 1O0VA 5HGBB 5C0AA 4DVRL 4MZ3A 3EOBA 4KV5F 1FC1A 4X0KA 4KKAD 4Z95L 4O51A 4RMWA 4QRRD 3S5LA 4XBEL 3EYFA 3MREB 5FGBA 2V6HA 5I8EA 2G5RA 2GJ6E 2A83B 4P3CH 4ZO9A 1CT8A 1J9CT 3LHPL 4AK1A 1G6RH 4H1LH 1J8HD 1RUKL 4XNQA 1LE5A 5T3ZD 1O5DT 2F5BL 4ZOEA 1WISA 5A2LH 3DLQR 4LCYB 4HZAA 1D9KB 2DBLH 2V9QA 3TO4C 4NFCA 4AT6B 1GGCH 1I85C 1YEGL 4YGVA 3QH3A 4MWFB 1H3GA 1TMCB 1V7NL 3TFKD 4DOHB 3ARBC 3QDJD 5T5NF 4QXUH 3DRTB 2R69L 1HWHB 2CLZA 4RAVB 4YHLH 4Q2ZA 4K8RD 1I9IL 4LIQL 4UV4L 3S6CA 1PDKA 2A73B 5C86A 2NW2B 5AD0B 3LEYL 4PRHB 2ICEA 3FQRB 1YDPA 4OLYH 2GQHA 4ODHL 1NFKA 3N85H 1AP2A 1IT9H 1FFNA 1KJMB 5IMMB 1AGFB 4R96B 3L1OL 3L7EA 4BA8A 5IWLA 5DJ8B 1G6VK 4IMKC 4YHKL 5DJXA 3STZA 2GTWB 5C0RL 4XP1L 5IW6A 1KEGL 3OR7B 2APXA 3RPIB 3PWJB 5CAYB 5BV7B 3CZFA 5EIIA 1CF8L 5FGBC 3U4EA 1FRGL 4PD4K 4MNQA 1Q1JH 1S9VA 4QF1B 1MEXL 1VHPA 4Z7WF 3U7AA 4D94A 2XN9B 3IETA 5C0JA 4PJDB 3ILPA 2R8SL 4HF5L 3RVTD 1G1CA 1K8DA 1M1SA 2R29H 3QUMH 4ELME 1N0XH 1IVLA 3DVGB 4I0PB 4JM2B 5HHOB 1PX4A 1MI5B 3TO4A 4NKDA 1HZHL 5HHNA 4C56A 4JFHD 2HH0L 4YE4L 3B5GA 2EDKA 4JRXA 2VKWA 4OKVB 4NUJB 1INQA 3U79A 1WTLA 2VXVL 2EEDA 1JF1A 3ZTJG 3I6LD 3N9GL 4X8JB 1A3QA 4FXGB 3SJVE 4U05A 2B20A 4OLZL 3ARXA 4AYFA 1G9NC 2AVGA 1U8JA 3I2CL 3HC4H 1GZQB 1HXMA 4FTVB 1D5XB 1JRHL 1QFWH 4MLIA 3TFKC 3ULUC 1KLUA 5FUZH 1F11A 4PJEB 3MV8A 4P57B 1CR9H 1HH6B 2W92A 1HHGA 2XWTB 3WLBB 2ARWA 1KPRB 4PJ5E 5FYJL 3RWCA 3WS6C 2HLFC 3EDJA 1XF4B 5DR5L 4ONOA 4P59L 1NSNH 2X4NA 4KK8D 1P2CA 1KENL 1IE5A 4TSCH 3MOBL 5D5ME 1G7LB 5DJDA 4PP2A 2GUOB 4PY8J 2ZUYA 1RZFH 3DBXA 3I50L 4X9GA 1WUNT 5DEZA 3FOLA 2LAGB 3O9WB 1K4CB 3VXOB 1CTOA 2GSIB 3O8XD 3S3SA 1RZ8A 3UO1H 1M71A 5J6GB 3OKEA 5IB5A 3WIIL 1W72A 4JRXD 3ZHLA 2EEAA 3EYSH 1A6AB 5D93B 43CAB 2FO1A 3C60C 4GXVL 3BP7B 1PEWA 4PJHA 3CCHA 3OJMB 4IM8A 3NCBB 4MNQE 3SDDD 3BKMH 1IGMH 3CIQA 1XIWC 1SBBA 3UJIH 5ISZA 2KL6A 3IDJB 4L3CB 5IF0A 2FGWH 3VXSB 3QEQB 1HXYA 4RWYL 2D4DA 5CD3B 3UCRA 4O2EB 1JI1A 2D3VA 3QUKA 4JZNB 2AJUL 3SN6N 1TZHB 1IGFL 3MCLL 1UB6B 3HPLB 4C56E 4CL7A 1UJ3C 4UMGA 2R1YA 1G6RB 1FO0L 1IGCL 3Q5OA 4OCYL 4D0CA 5SV3A 2FZ3B 5K59E 3IDMB 2OYPA 5ETUB 1A7PL 4LNVA 1E6OH 3DJ9A 5AG8A 1G7IB 4H0IA 4Y5VB 3SDAB 2BSSB 3ECBB 3DSFH 3AB0C 3FQXA 2Y7QB 1XH3B 3SKJH 3SO3B 1BF2A 4NOBA 2IAMB 3D87B 3L6FA 3VFPA 4WFGE 2NY0C 1A4KA 1HYSC 2XN9E 2Z4QA 4L4VD 3ALXA 1CFQB 4KI5E 1YQVL 3QJFA 4OLEA 2L4OA 1KB5L 2GFBA 4PGEB 2AXGB 3TV3L 3OAZH 1UWGH 4JO4L 2FJHA 2H2PC 5T33L 4QEGA 4X0KB 1FV1A 1ULVA 3SDXF 4FQ1H 3PWUB 1FH5L 4FZEL 5JLZA 1CICC 4PGDA 1KIQB 4L4TD 1XR8A 1A02N 2XNAA 4F33A 1H8OA 3G6DH 4W68A 5KS9B 3SKNA 1GOGA 2FB4L 3IRPX 5H94A 3TBSB 1N7ML 4AIXA 3P9WB 5IK3B 4PJBF 4MMZC 4XCNB 1XIWD 5IVXE 3ZL4H 2HVJB 4N8CH 5INDB 2W1NA 3C60D 1CGVA 2CKBL 3GIVB 2OCFD 3DROA 3U4BH 4UOJA 4JO3L 3GZKA 5SWZE 5K9QI 4RNRA 4HS3B 1RK1A 3K8MA 2JIXA 1YUHA 4KUCD 4Y5YC 1OF2A 5TE6H 2IJ0C 3L5WA 4NP4H 4AJ0A 2GEEA 1BVLA 3HE7D 4L9LA 4MX7B 3U9UB 1JJUA 4HXBH 3LEVL 4MSWA 4R90L 2QQNL 1NCAL 3KJ4C 4HHAA 3VXSD 2GY5A 1IAIH 4Y4HC 4PJIA 5FM5M 3ZYJA 3KPLB 3EJZC 2HKHH 1L4IA 3IXTB 2WWKT 2BERA 4UDUA 4G80B 4KRLB 2KBGA 2F54B 5FUOL 4K9EH 2RBLA 3O3DA 3IDYB 2G2RB 4NN5C 3OG4B 1A3RH 3ARSA 3BZDA 4HUUA 2DQCH 1HDMA 2PYEE 5FHBL 4HZLA 3VXQB 3QJHB 4OAWB 5DJ8A 2VQTA 4R3SA 4HV8B 3VG9C 3L3GB 5D1ZB 1S9KC 2EDTA 3QIWD 2NW3B 4EUPG 2FSEB 2DBJA 1S8DA 1U92B 1MFAH 2ADFL 3QUML 4LSTH 3QHFL 1CLOL 4MJIA 2FBJH 5GGVL 1QYGH 4BQCA 3CAFA 3NGBB 3D3VE 1EAPB 1CXFA 1Q9WA 5C0JB 5LQBL 2FYYA 5KG9B 3GI9H 1ROWA 3RAJL 1YEFH 2WZPD 1B90A 4MA8H 2D9QB 4M93B 4JN1L 2FECL 4PYHA 2WP3O 4BSJA 2WIIB 5T3ZH 4Y19A 5HGHA 5CUSL 3LQAH 7CGTA 4HWEL 4R97C 5TQ0L 4KZEL 3WDIA 1KXTB 3PJSB 4NKOB 1I3UA 3D39E 3HUJA 2HMIC 4ZYKA 2RAMA 4FQXC 5HHXH 5D8JL 3OZ9H 4YHOH 5JW4Q 5GRJH 2AQ3A 4TPRH 4KK9C 4HH9B 3REWA 5IBLC 2VZVA 5CBAA 2VDRL 4TTDC 1SJEB 1A7NH 3NPSB 3HUJF 4ZS7L 1EBPA 2ESVD 3C8DA 3EGSA 3OHXA 3ZDZE 5A3ID 5EO1B 3W39A 5DR5H 1GC1L 1PGRB 2Y06H 4MQ7A 1KPRA 4YWGL 1OSZA 2J8OA 4PJAA 3SE4C 3HR5A 2VDOL 4KZDL 3MRBA 1DE4B 3QO1B 5D1ZD 4KI5D 1OW0C 2FR4A 4GSDL 5LKNA 4LBEA 4PP2B 4DN4L 2W9EL 3F65A 3UJJH 1ZHKA 3VI3E 1CQKA 4U1HB 4XMLH 5E6IA 4S1SH 3QNZA 3BD5A 3QQ9C 1ZT7A 5IOPB 3GSNB 3JWOL 2HFFA 3PABA 4HC1L 2FECI 4QGTA 4AEFA 5ENWA 2Q8BL 4X5XB 1U2CA 3BKCH 3O4LE 4JJ5B 4Y2DA 5L2JB 4JVPA 4PLJD 4WI9A 2BNRA 5LXGH 1Q9KB 1RQ5A 3D3VA 2GTWA 2C1OA 3C5ZB 3HNSH 3GMMB 3TT1H 3UTQA 1A0QL 3RPIA 5IROA 4MVBC 1P4IH 1FYTA 3KPNA 3UTPE 5CJ5A 3AREA 5I76B 4PFEA 4G3YL 4FXLA 2BMKA 3QCVH 1TZHA 1V3KA 4PY8I 4WV1C 5CGMA 4PJ7B 3ZKQD 2OTWB 3DTXA 3MCG1 4PJDA 1ONQA 5KVFL 3X13B 2FNBA 4MDJA 3NCFB 5IJKC 1U6AH 3R4DA 1TPXB 3DHMA 4UILL 5DURD 3VXUA 2B1HH 3ARFC 3HUJE 5DUPL 2F19H 5C3LD 5C09A 3G6JA 5GS0H 3LD8B 3INUH 1AC6A 1MELA 3MGTB 1WZMA 1I7RA 2PTVA 1G7HB 1S7UA 5CJBA 3WHXB 4ZXBA 3TC9A 1M05A 4Z18A 1N5AA 4H5SB 4MGXA 3V6OA 5CJ8A 3C2SA 2WLZA 2FBOJ 1U42A 4Y1AD 3PV7A 2GK0A 3HI5H 3L3KA 4B5EA 1BBJB 1SVCP 4Z7QE 3K1DA 2C4FU 1GVIA 5DLML 3LKOA 2EDNA 3O9WA 3LEXA 4CVZB 4QRPA 3IJYA 3ARGD 3A6CH 1QBAA 3BXNB 2FJFB 1FE8H 2VSDA 5IFHL 5GGRY 1SJVA 3BH8B 5C08B 3EJYC 4U6VH 1LE9A 5DJAA 3O6FB 4G8GB 2PO6B 2EYTA 4HF5H 2H41A 2QLVB 5F7YC 4XHJD 4O58L 3K2MC 5J1TC 2AP2A 5H37G 1NGXA 4Y4KB 2E7MA 4HWBH 3IFNH 4HXAH 2DI7A 2ESVB 3NACH 1T66D 2ARJB 1TXKA 1R0AL 4EQ3A 3G04A 1CL7L 1FO0A 3VH8G 1ES0A 4G9DB 3S36X 4I48B 3G9VA 3TN0A 5TH2B 3SJVB 4M3JA 3CZJA 3MLVH 1KC5L 4HS3A 1KPVA 5ANME 5CILH 5ABDE 4MNHB 4U49A 4PJ8B 4UUJB 3KGRA 1UJ3B 3X11A 5GGQL 32C2A 5IHBA 2EXYC 3QDGA 1S7XA 3L3OB 4HMCA 3Q48A 4HKXA 4RISH 4X6DB 3PP3H 4KGLA 1JN6B 2EDYA 1JGDA 3W81A 5DJYA 5HYQA 4OF8A 1RUAL 3O2WL 4JB9L 4LQFH 3MNWB 5D1XA 5D7SL 1SM3H 5EO9A 3RVVC 5GZNC 5KSBB 5E1AA 1C08A 4M1DL 4TSBH 4XMPL 4BFIA 2LTQC 5HYIA 2GFBB 4NC1C 5EU7E 2R8SH 5HDBF 1J86A 2ED9A 1QKZH 3G6JE 1WITA 2QSCL 2YD9A 3DI3B 3UDWC 3N1QC 5EWIL 4TSCL 5J3HD 1AD0A 1XZ0B 2V17H 4GQ9L 1OAKH 4WCYL 1E27B 1EFQA 4LL9A 3CDYA 1ZT1A 1NBVH 3VFGL 5EC1B 3ZT6A 3WXWH 1WZ1L 4NDMA 3B9DA 3TP4A 1RZFL 1N0LA 3S96A 4EZMA 1XGQA 1EBAA 1G1YA 4OLWL 3CSYA 4MD0A 5CINH 2EC9U 1UZ8B 3HE7B 2XTJD 2ZPKL 4KKCC 4ODUB 1QUNA 5ID0A 4GUPB 4KAQH 3WYRA 1WBYB 3FTGA 2X4SA 1ITBB 1CFQA 4PRIB 1YMMA 1VGKB 3MODH 1LVEA 4RGMB 1HQRA 1XAUA 5CBEB 3KVQA 4X6CA 3HUJB 1PG7L 5EZIH 4QXWA 4HAFA 3CNKA 3MRJA 1KJVA 5DD1H 4P99A 3Q5YA 5JQHC 2Z35A 1F5WA 2GCYB 5EU4B 2DLEA 3LV3A 5LBSH 3NTCL 1MRCL 1EV2E 4X6CF 5FYKE 5HDQH 4F2MB 3T0EA 2LAAA 4WI2A 2ZG2A 4F7CA 2XG5A 4FS0A 4FQIL 3T0DA 2CDEA 3GMNA 1AHWC 4XC1L 4LSVH 3VFWA 4LNRB 1A5FH 4XGZB 5T5FH 1XCTA 3WS3B 5KZCD 3QUXB 5ALBL 3BMWA 1JNJA 3ARQA 4MCZA 2APFA 5J7CC 3P2TA 4DN4H 4N0UE 4GJTB 2JJSC 2EYRA 2B5IC 4K71C 4EQ2A 3GBLA 2V7HA 1H3VA 4QRRE 3K0WA 2ZNWA 2DQDH 1J05A 1MCKA 1TFHA 4RZCB 5FUCC 4ALAH 4OGZA 1ZA6B 4PTUA 2HT4D 5GRXG 1W8NA 4X7TB 3S36H 2EXYD 1NFIB 3E3QE 3RVUD 3TV3H 3P0VL 5KG9A 4KH2A 4JEGB 5F1NB 3MRFA 4YNYA 3VXNA 3R06B 1LO3L 5DK2A 5CIPB 4G9FA 2FGWL 4C57C 3PABB 1FFOA 3U82B 3BVNB 1B0GB 5IMKA 5HGHB 1NJ9A 3GJFB 5ADOL 4OGAD 3FQNA 2WBJA 1L7IH 1P4IL 1KCSL 2V2WB 5DHYA 3MJ8A 5K9OA 4OAWA 4DEPB 4NZTL 2B4CL 5EZJA 1LO5B 1OPGH 3DVNB 1AI1H 4KPHL 2FHCA 1N2RA 25C8H 1KNOB 3QFJB 5J0BA 4LVHB 5DZOA 1LO2H 2CIKB 2P5WE 3MUHL 5J56B 2NY0D 2YD4A 3DUSA 1CGXA 5GS0L 1IBGH 1F4YL 3QRGH 1JIBA 1CDIA 4BK4A 1F3DJ 1T03H 4ISVA 4FMKA 3B2UD 4OCSH 4QOKE 2DLFL 2R0KH 4LVHC 2HJKB 3MGTA 4HUNB 4OIBA 3V6ZA 5HGDA 3JSSA 1F42A 2HKHL 4H8WL 4G8EB 4R97B 1RV6X 5BZWB 3OB8A 1X4XA 5D5MF 4G7YL 4JVUA 1YEKH 1BQHA 3H9SA 4LFHD 4QHMB 3TF7C 2XV6B 2Q7YB 5D2LE 3CFDB 4M93C 2GT9A 3FO9B 5CKGA 5JO5A 1HHKA 4HT1L 4AENA 4PREA 1X5FA 5ACZA 5A2FA 1ZLSL 1UXWB 3SE8H 1BFTA 2Z8SA 3P9MA 3O8XC 1F97A 4CJ1A 5L6YH 5F9AC 3BAEL 4X5XA 4XBPB 4ZPVA 4Y88A 3SOBL 3Q1SL 5J9PA 4KK6C 4CKVX 3RGVC 1A7OH 2H1PL 3PWPE 5DXWA 4JFYA 2D0GA 3HR5B 3KPSB 1JHKH 43C9A 2F5AH 2JIXD 3F5WA 3RZCA 1KLGB 4BQBA 3TZVA 4JFZL 3TJHC 3IDYC 3DURA 5F3HA 5F9WC 2JJUA 3ME0A 4S2SB 5MEND 5DEGA 2Z8WC 4A2MA 1A22B 1KOAA 1G9MH 1G0YR 1A1MA 2DI8A 4GBXA 2ZOLA 2Z8RA 1DN0A 3TIEB 1I9JH 1JZ6A 1DVFA 5KVGL 2GJ6D 3X11B 2BSRA 2WWKO 4XMKL 3F7VB 1OSPH 2DAVA 1HILA 3PNWB 4JB9H 4OF0A 2HJLB 1ZHBA 2ZCHH 5I8KL 1MFEH 4BH7B 2VITB 2R23A 4ZSOE 4Y7MA 5D6CA 5T1DL 1MCPH 5E9DB 3ZTJH 1NQBA 4LLVB 1R5WA 2IAND 2OR8A 3MA7B 3TYFB 4W6YB 3ZE2E 4OSUH 1CDHA 4TULL 1C08B 4JGJA 3MRDB 4HCRL 3VG0L 3ULSB 4AL8L 3JTTB 1OHQA 3R8QA 3VA2C 1YMHB 3OKYA 4XPBH 3CDFA 1JPGB 1KYOK 3RBGA 4OCXL 5L0QC 3DTXB 1PBYA 1VFOA 4X6DE 2V9RA 1S9WA 1VGEH 4KDTC 1UM6H 4U1MA 4LPVA 3CDGA 5CUSH 2O5ZL 4F7PB 1CGSH 5CEXA 4G8GA 1BLNB 4KKLC 2P24A 3S3PA 5C09B 2P49B 3SBWC 4OV5B 2LVCA 2DI9A 1MJUL 3T1FA 1JGVL 2WLYA 2ZZUT 3QIBD 2L7JA 5TF1H 3LKRA 1VKXA 2F74B 3EDKA 4Y5YA 3HE6A 1NEZB 4UINH 3QDJB 3MV9E 4BH8A 3QO0A 3IKKA 4ACPA 4I5BB 5A3IC 2NTFA 4K7PY 4ZFFB 4X6CB 4U1JB 5FO8A 1KTDB 4WY7L 4I0PC 3TA3A 4WHYG 3SDCC 3RTQC 2E6QA 1P5UA 1X5LA 3U4AA 4YFDB 3DRQB 5C0BD 1HNFA 4YDLC 4U1IB 5DF0A 2W60A 1QSEA 1RZKL 4N5UA 1CFVH 3T0EB 2WUBH 2DIAA 3AS3A 1RZKC 4U7KA 3FQWB 3ZKMC 2R0LH 1T7WA 3T0AA 2R2BA 2W65A 4UU9B 5MP6H 5JPNA 1CYGA 2X4TB 3UJJL 3GSXA 4XAKE 3I50H 3SDDC 4GRLC 1IC5L 4MAUL 1WV7T 3KR3L 4JO1H 5FHAH 3MA9H 3MR9B 1HH9B 4OZIA 3SKUD 2GI7A 5E8PA 2V9TA 3W0WA 4FFZL 3P4OB 5L8LB 3BESR 3H6JA 3IS1X 2K7QA 1K2DB 4POZD 4DVRH 4I4WA 1CFSA 4NO5B 2FX7H 4N5ED 5E2TH 4HLJA 4M4RA 3ARFA 3SCMD 2R2EA 4R8WH 4XWOC 5GJSL 2X4RB 2H32H 3FO2A 1QFOA 3JWDL 1EA9C 3IDGA 3K1KC 1N6UA 4ODUA 4P2RE 2ARJQ 2YN3A 4PJCB 5BRZA 3V4VH 4B7LA 2GJZA 3GMQA 1NCTA 3QCVL 1U8KA 4NIKB 4U1LA 2X09A 2G75B 3BZEB 1DLHB 2ZG1A 5CP3H 4M7LT 2YD1A 4R7NA 4OZGA 4U6HA 1MCCA 5BW7A 2FATH 5I30H 5C0ND 2APWA 4YXLH 1T83A 3CVHL 1J0YA 3MXVL 4ZDHB 1V8HA 5J3HC 5KSUB 4I2XB 1YEGH 1TLKA 1EHLL 1JHLH 1HE7A 3PL6A 1NGYB 4JN2B 3DSFL 3EYFB 3MREA 1GXEA 3N0PB 3TT3L 1JPFA 2R0KL 5HVWA 3PE9A 4DKFL 5F9OH 4JFEE 3GB7A 3MV9A 2BNQE 1KSRA 4UV7H 3RVXD 2V5YA 5I18H 4GRLA 4AIZA 1HHGB 4JHWH 5FCUL 2BVQA 1JZ3A 1RVFL 4Z76A 4XP4L 2V7NB 3B2UC 5FYKL 3BO8B 5F8RC 3O9WD 1UT9A 2Q76A 5CGYC 3C5ZC 1FNAA 3BP5A 3H7BB 5SWSE 1V5JA 5F72S 4M1DH 4TSBL 2O5XL 3MRKA 2MCPL 3MXWH 4PTUB 4U1SA 2XQYG 4Y1AA 4HUXA 3KPRE 5FV2A 4X7TA 3DBXB 3OG6B 4Q2ZB 1RUKH 2XFXB 4LVOC 3R06A 4MXWL 2CKBB 5D96C 1QSFE 1WEJL 1WIUA 1IC7L 1A8JH 2F53B 1A14L 4H0HB 5FO9A 3H2WA 3OGCB 4Y2OA 4Y8AA 4OZIE 1X5ZA 3FQNB 4S1RL 4U1KA 5MEPB 5ICXB 3IT8D 5FXCH 3AM8A 2MKLC 4NHCL 1J10A 1MJJB 4YC2B 2EIEA 2ZNXA 4IRSB 1R3IL 3GKWL 2HT2D 4KTDH 4YFLI 4EI5D 4JPKH 1KNOA 1FLTX 1MHCA 2Z93A 4RISL 4BSWB 2X4QA 3MODL 1R3KA 1X5GA 3MRCA 3TBYA 3O45B 3W9EA 3H3KA 3L1OH 3KWWA 1I1YA 1ZEAL 4M6NH 5BV7H 2LE9A 4G6KH 4PIRF 4JM2A 4ISVB 5TQ2H 2FCBA 1JGUH 2DN7A 1KJ2A 5D1QA 2JK5B 1FFOB 3CFBB 2BVTA 3JTSB 4I3SH 1YPZA 1OW0A 1ERNA 3DETD 3P11H 4JRXB 1IGYB 3QUMB 4MNGA 1UH3A 3DIFA 3OB0K 5IHLB 4NZDA 3QBTB 1OAKL 5IMOA 1QLFB 5ITBH 1MVUA 5KJRL 4OCXH 3NBNA 1WQVT 5DJCB 1JUFB 2GHWB 2W0LA 5J12C 2BNQA 3U9PH 5ALBH 2APBA 1TJHH 3JZ7A 1MCEA 4ZUSB 4AENB 2Q3AA 3MO1A 3EFFB 4GKNA 2JE8A 3CUPB 5DUMH 3P73B 4YE4H 1Q72H 4HWBA 1GH7A 1ZWIA 1J5OL 5C0BA 3I85A 3RUGA 4F7PA 4Z7OE 2DWDA 4LLQA 4XAKD 3KPMA 3RIAK 4HIHA 2HJKA 3BJ91 1ZLUH 3QNXB 4OCRL 5F93C 3MCKB 5GRWA 4N8PA 1WSST 2P7TA 1LEIA 3FB5B 3EDFA 1Q94A 2ILLA 1IRAY 3IFOB 2X4NB 4HKBB 5DJ6B 4HIIB 4MA3A 1TQCC 4CBPA 5GGVY 4PV9A 5ADOH 5FUZL 2OSLB 3N1FC 1BQHB 4X4ZA 3T2PA 2DQEL 2X9YA 3QDJA 4JG1L 1U93A 4IDJH 3P4LA 4FN0A 4S0SD 2Y07H 3V5KB 5JOEA 4LLMB 4PBWD 5AZ2H 2H32B 3I3BA 3FO0L 3FB6A 3B6SB 2PO6D 3BQUC 4FHBD 1NEUA 5ADPH 3G5YB 3PGCB 3ZKMD 3QDMB 4O2FA 4N0FA 5FK9A 1ZHBB 4JPIB 4PJ8C 4MAYA 5BXFA 2VITA 3BT2L 4OCYH 4NFDA 1DBMH 1P2CB 3IXTA 4WTZG 5ECJE 1RPQA 5A2KH 1QO3B 3HZKB 3O2VL 2QADC 1I7TA 3MFFB 1MHPH 4PJ5A 2LU7A 2FEEL 3KR3H 2QSVA 5FHAL 5IF0B 3T09A 1YC8A 1WFTA 1SMOA 3ULSA 3VXSA 3QQNA 5M95B 3LN9A 4JQVC 1HXYB 4Y4KC 5HHOE 3DUUA 3ZHDA 1NGQL 1OAYL 3QUZA 5HHQA 1OLLA 1LDSA 2I60H 4EUPA 1DN0B 1GAFH 1A6AA 1G6RA 4MJIB 3KJ6H 3JWDH 4X6CE 3V6BR 3UXFA 2BHYA 1DEEA 4H20L 1D6EB 2AXFB 4UB0L 2DIJA 2PNDA 3FQTA 2X10A 2EDRA 4RGMC 2NY2D 3QNYB 1KJ3L 4QHUB 1ZLSH 2D4FA 4ZUTA 4KHXL 3DUHA 1KCKA 4JFOA 3ZTNH 4QHKJ 3MA7A 3B2VL 4P5KA 5BRZB 1UWEH 3LKRB 1VKXB 2YZ8A 3SDYL 1ZS8A 5I30L 2GIYA 5I1KL 4M6OH 3D18A 2YKLH 3ARGC 3E6FB 1DQQA 3QO0B 2H1PH 4P0DA 5HD8C 4K3EH 4JCMA 5JNYA 1A3LL 2YXFA 1MLBA 5KZCB 1S9YA 1V7NH 5ALCL 4NT6A 4F7MB 2AEIT 3ROOA 2P4AB 3BMVA 3C60A 1JGEB 3MRMB 3NIDF 1RHHA 4J1UB 4LIQH 4UV4H 3ARTA 4ZUUA 4QCIB 2XNAB 4F33B 1AGBB 4LHUA 3DVIA 1WWAX 2X1OA 5FECA 3VWKB 2HKFL 4F7EB 5I75B 1EEZA 4L8DA 3TBSA 2DJUA 2BC4A 3L9RB 5CLWA 3QEUB 4PGEA 3PQYD 2DQFB 2HTLC 2AJYL 3CVIL 2XQBH 3LQZB 4UTBH 1UEYA 1M7DA 2E8YA 2EIZB 2A6KA 2CUHA 1FV1B 5BS0B 4EN3A 3QIWB 1F13A 5I1LB 1J8KA 1IKNA 1JNHB 4X4YA 2VLLB 3U9UA 4H88L 3BZFA 3WS6A 3ZKXB 2NR6D 4PRPB 5KSBE 4TSAL 2Y23A 3F12A 4X9BA 1TNMA 2NX5B 4FQHA 3HR6A 4N8CL 3KJ4B 2X41A 1SEBB 3QHFH 1L6XA 5DJ0B 4P46A 4G42A 3DV6A 3O4OB 5DFVD 1MQ8A 3P4NA 1HINH 1NLBH 5H35A 1MJ8L 4KTDL 1DDHB 1RK0A 1U91A 1K5NA 3R0MA 5FEBA 5GZND 1P69B 4NZRH 2DS4A 3ARDC 1TVBA 2YHGA 2ATPB 4BQ6A 1PX3A 3HTLX 5K93A 4C4KT 3C6SB 5EA0L 1S8DB 1U92A 2VTFA 3L5IA 1XR9A 4MJ6B 4I4WB 3IF1B 4LPYA 1K6QL 3QI9B 4NQDE 1I8MA 4LGPB 4YHPA 5EFIA 3VGHA 5D2LA 3AGVA 5IJVA 4U1GB 3OV6A 3CVHB 1BZQK 4OLXH 3LEYH 5C0IA 5INCB 12E8L 1HDMB 1K8IB 3H9HA 3MRGB 3RVTC 3VA6A 2A0LD 3NAAL 1IQDB 2HTKC 4AL8H 3A6BL 4JPVH 1MUJB 4D2NA 5E70A 4K3JL 2VXQL 3LKNB 1QPXA 5DMKB 3BN9C 3GMQB 3C09C 2EXWC 4HIJB 2ZUXA 2NW3A 3WHE1 2YUVA 1M05B 3VRJB 4H1LG 4DK6A 2ZCLH 5EWIH 2P8PB 4TYUA 3FFCB 4HULB 3BGMA 1ZXQA 3K2UL 3TA3C 3ORJA 1Q72L 4WEBH 5AWNL 4C4KO 4XVUC 1T2JA 5DRZB 2DYPD 1RU9L 4GKNB 5T3ZL 3P73A 2G60H 1S5HA 3VU2A 1I1CA 2WWMC 1X3DA 1ZWIB 2I5YL 1UB5A 5C6TH 3VGEA 1WCBB 4FFZH 1CXEA 3BH8A 4S1SL 1Q9OB 3DI2B 4D9QE 1I4FA 15C8H 3HMXL 3I84A 4JHAL 4Z7UA 5CSZA 4UT6L 1AO7D 5ISZD 4LK4A 3BPCA 5D7JC 3SDDA 3BDYH 3H3PL 3B9AA 2NZ9C 1E4WH 2Z31D 3UYPA 3PXHA 3TN0B 4LF3B 1DEDA 1T4KB 1ACYH 2AJUH 2Y9RT 4YEEA 5GS1B 4GOSA 3Q6GL 1N64L 1PZ5A 1ZANL 4M7LH 5FF6B 4XRCA 3W39B 4K3GA 2PXYC 4TNVF 4LLUB 4KUCF 4ZUVB 4D9LH 1ZT7B 1DQML 2EDFA 2Q86A 1UM5L 4HLZH 4UQ2A 4GRLD 1MCNA 2G5BA 4RMVA 3VJ6B 1BQUA 4HIEB 4FRWA 4QGYA 5DYOB 5DSCA 3VDAA 3ZO0A 4Z77A 4LBEB 4OCWH 1KBGL 1G0DA 3F8UB 5D1XB 1CD9B 2FRGP 2JB5H 3TNMB 4OM0L 4XXDA 5DUBA 4PYGA 4N8VA 2C7UB 4JFDE 1Q0XH 4ZUSA 1AGEB 1NAML 3PDDA 4XXCA 3O8XA 2VLJD 3QIUD 1WWWX 4XCFL 5HHQB 2NY6B 4U1NB 4XB8A 4N90E 4JKPH 2KDGA 4WFHE 5IW1A 1JK8A 5GRVL 5GGSB 5DLMH 3T2NL 3RUGB 4NQVB 2WBWB 5I1AA 3VGGA 4JCLA 1AE6L 3BPNB 5DO2C 1C12B 1QLEL 3AXLA 5JXED 2VZOA 4M1GH 3DV4B 1NGPL 2DQHL 2AJSL 2VUYA 5J6HA 3RVVD 3DXAE 3NIFF 1GSMA 4FQPA 1AJ7L 3SGDI 3ZL4L 5I2IB 2P8MA 5A2JH 1AI1L 4CJ0A 4F8QA 3MNZB 2QJDA 4K8RH 2PTUA 5HTSA 3W2DH 5MENA 5EO0A 5HPMB 4HWBL 4U1GC 2VDMH 5MEOA 3NIGE 1BZ9A 4BQ8A 3CK0H 5MEQB 1FNGA 1LO2L 1YMMB 4OF6A 2R9HC 2BVYA 5DMIL 5GJTH 2BHUA 5I8OL 3QPXL 5AUMB 3GK8H 2HVKB 5FA4B 3S3JA 4UV7L 1S9YB 4QRPB 4KY1L 4RFEB 4NO0D 4UQ3A 5DS8A 1AGCB 2P5EB 1JPTL 4GXUN 4KK5D 5JW4M 4DGVH 4DN3H 1XCQB 3RA7L 3FONB 1OTUD 1EEYA 1FIGH 2I07B 1A7RL 2CDFA 2YA2A 4HGKC 5DJAB 4APQC 5KANI 3NCEB 1VESA 1Z2KA 4WRLA 5GRVK 3HI1B 3P9LB 4JG0H 5T3XH 4F58H 2O5XH 5FDYA 3L3KB 5D1QC 2ARJA 4MAYD 5DFWH 5T1MB 3QEUA 2PYFA 5DQ9A 5C07D 4MLSA 5HVGB 1Y6NR 3CMOH 3MJ7A 3Q6FA 5E5UB 3P11L 4FNLH 2O93L 1T7YA 1ZLWH 1AHWB 3B9KB 3OXSB 5JMRA 4CMMA 5B8CC 4EOWH 3W11D 1BIIA 3KDMA 1ZGLM 5EUOE 1MREL 1B2WH 1YYMH 3F12B 4TVSa 2ZOKA 1RY7B 2GTZB 2YBRB 1IM9D 3PP4H 2VXSL 4PG2A 2UZIH 4I13B 4JN1H 5J1AA 4Z78B 2X1QA 4XCCH 3TO4B 3ULVF 2MOVA 1CK0H 1PKQA 3RWJB 3EFDL 1EGJL 1DQQB 4KROD 4M7ZC 1EZVY 1ZA3A 5EA0H 5DHYB 4NUGL 4JM4L 4P5TC 1E4JA 2YS4A 4NO3B 4GW5B 1BOGA 2KKQA 3EOBB 5CEYB 5TQ2L 1I9EA 4PBVC 4KRPD 4Q9CA 5BS0E 4HKXB 3V5DA 3W82A 1AC0A 5TGBA 5AYUL 2ED8A 4IDJL 4ZQKA 3H0TB 1ZMYA 1RJZA 3GSWB 2VLKE 1CIDA 3T4YA 4QRQB 3CVHA 4XNMB 4GG8A 4KKBD 4NRZA 5BVJA 1OTSD 2QEJA 2CDGB 1UCBL 4MB5A 1NBZA 4J8RA 4Q0XL 4DKEL 2GAZB 2VDOH 1ZS8B 3UBXI 4KVNL 3PGFL 5HY9A 1CGTA 4BFEA 3VFGH 4E42B 2VLLA 3VD3A 2P8PA 2EYSA 2NY4C 4ERSL 2VWEE 2XWJA 3U0TA 2GUOA 3Q3GA 2EKSA 4XNZC 5I8EB 2IBBA 2VR5A 2EC8A 4HWNA 3WFEL 1R24B 3B43A 2D31A 3VFTA 1G7QB 3ZKSD 4TTGA 2HRPL 4IRZL 4NRXB 3O6KH 4JQXA 4R7DA 5D1ZC 5ERWA 4LCYA 2XN9D 4PJCF 1EEZB 5IB5B 3NH7H 4WFGD 2EDEA 5IVZA 4J6RH 3MLSH 3IFPA 1E6JL 4U4BA 3GI8L 1DDHA 5AZ2L 4XWGH 3CCHB 3WS3A 3ULUD 2CGRL 5D5MA 5DD1L 4LCIH 5KVEL 2EIZA 3PDOA 4OI8A 4KQ4L 4AY0A 1YMMD 4R4FL 5I1IH 4M8VA 5B3JF 5I1LA 3FN0H 2I25N 4NWUH 3IVKA 5LAXB 3KYOB 3V0VB 2PR4H 3ZZ1A 1CGWA 1XR9B 3SGKA 4NBZB 3SO5A 5C0DB 5I8CA 1UB6A 1KJ2H 1KTLA 5E5MA 5EH1A 1NL0L 2YXMA 1YN7B 3P3YA 4H8WC 5C0IB 3CPLA 4HMDA 3VXME 1U6AL 1TZGL 3T0EE 3DV6B 5ISZE 4LLAA 4CMHC 1YN6B 2AW2A 3D0LB 4OKVA 4OB5H 5L88H 2QSQA 3UBXB 4QKXB 3U7YH 5IEKA 1D9KC 4RZCA 3MOAL 3MV7B 5ID1A 2X7LA 3BKYL 1EDQA 3QQ3A 3O6LL 4LGRB 3NFPB 3MLRL 5CZXD 4LDLB 1DQJA 1XF5B 3WDJA 4H20H 1T1ZA 3UROR 1IZJA 5F9JB 4JFFE 1AD9B 2K3TA 1AXTL 3QFJA 3MGOB 3AB0B 3GSOB 1FZKA 2DYPA 1PY9A 1N5YL 2Y72A 2AS5M 4P4RA 5HHVH 1HIMH 2Y36H 3N50A 1XR8B 1IFHL 4WHTA 2DBLL 1BLNA 3C9NB 1LK3H 3U1SH 1GGYA 4TUJB 5I71B 4XBGA 4YDKH 1KB5B 3VWJC 2Y5TB 1ZLVH 3WN5B 4OBSA 4PP1C 4YHIB 1DJSA 4UNUA 1TJGH 1BJ1J 1F4AA 1G7LA 3AUVA 5MEQA 4Z7WE 2VDPH 1ZHLA 3D69A 1OWRM 9CGTA 5FF6A 5FUCE 3ZYZA 1EZVX 4WUUE 2ZUQB 2UUDK 3LH2H 4XNUH 3S88H 5E8NB 4MA1B 4KKAC 3EO0B 2QR0A 3T0VA 4OGXH 3U0WL 5DZLA 2MFNA 5IVXA 1EHXA 4U33A 1BF8A 1JWMB 1T89C 1FSKC 2AJZB 4QOKA 4TVPH 4KJQD 5CSGA 5T1LA 4CN1A 1PLGL 1LDPL 4L8SA 1I3RA 1QFUH 4NNYA 5ESAB 3LKSB 4LLWA 1URLA 4FA8A 4JFQA 5BOPA 3TZVB 2BOCB 2Z31A 3UAJC 4TNWF 1YECH 3EW3B 1F90H 3MJ7B 3Q6FB 2RJMA 4LVOB 2P5WD 2NY3B 3L3GA 3DO3A 2HFGL 3BPOB 3FQRA 4NCC1 2X4UA 1LEGB 2ADIB 1EH9A 4KMTL 3MRLA 2YN5A 3BYTA 1P7KB 5F21B 2V17L 1OP5H 3S9DB 5A16A 4LSSH 3PP4L 2VXSH 2BVPA 5HGAB 3CFJB 3ULUE 5FA3A 1I8KA 2J6EA 2XXMB 2VR9A 1T6VN 3QIUB 4FQXB 1VFUA 4KRMB 5T1LD 5E08H 2R23B 1MRDL 3HC3H 3NZHH 5JW5A 1CI5A 2IAMA 5EN2B 1S9VB 2Q6WA 1EO8L 1QFWM 2W0FA 4DVBB 3TIEA 3QCUH 5KSAC 1DVFB 3MACH 2VLJB 4MJIE 4NO3A 5DHVH 3RGHA 4JJHA 4HPYL 3BDYL 1MFEL 4NQCE 3W5MA 2HT3C 4APQA 4WW2B 2V5TA 4C56B 3MUZ1 5IW1B 5KSUA 5JLZB 3W0WD 3UTSB 2NPLX 2HRLA 1BVZA 3ETBF 2DWEA 1MLCB 2NZIA 4WI7A 2AAVA 4HD9A 5F71A 5IQ7L 1INEL 4KK9D 3O41B 4NWTH 1JV5B 2CDGA 1HXMB 4FTVA 3FKUS 2YPLA 3S4SB 4WUKL 3GIVA 4J8RB 5FO7A 5IV2A 3QUYC 1QBMH 4YHNB 1EX0A 2OXHA 3GSUA 2PXYA 4MZ2A 5I1DA 3QDME 3BGFB 3I9GL 3LS4L 1KGCE 4ENEC 1OGAD 4KGJA 4PLKC 1J5OH 3IB4A 2EIDA 4RWHA 3WLBA 3U0TB 5DTFA 1FNSH 1KUMA 4PJ7E 1Y18B 2VE6A 1CFNA 1F6AA 1MFBH 5IHZB 1ZHKB 4XCNA 1JYWA 1YEHH 1F45A 1NMAH 4MJ4A 1CICA 1TQCB 4GG6B 5IB1A 5BOZG 3QZWG 2ADGA 1GGIL 4JFPB 1T5WB 1JPST 4N0UB 1FNLA 3U2SB 4J3VA 4OTXH 1RIUL 4ZFFA 4NNPL 1ZA3B 3FN0L 3QULA 1FAIL 3WIFB 2QKIA 5JZ7D 3ZT7A 5D70H 4UNVA 3ARRA 2VDQH 1DANU 1RZKH 5H2BA 3EOTL 4QWWD 5GSRA 3BH9B 4RMRA 3ZDZF 5DZNA 5L8JB 1NC4A 5KSVA 4RFOL 3QUZD 5C0EB 4EXKA 4ZNEA 4PY7A 4B50A 3TBYB 5EU5B 5BVPL 4FQ2H 2BNUB 1OB1B 1EHLH 5I1CL 4NM4L 2A6IB 3SGKC 4OB5L 2Y25A 3GMPB 5KN5A<