3HB7A

The crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
188
structure length
188
Chain Sequence
YFQGMAKHAILVIDMLNDFVGEKAPLRCPGGETIIPDLQKIFEWVRGREGDDIHLVHIQEAHRKNDADFRVRPLHAVKGTWGSDFIPELYPQEDEYIVQKRRHSGFAHTDLDLYLKEEGIDTVVLTGVWTNVCVRSTATDALANAYKVITLSDGTASKTEEMHEYGLNDLSIFTKVMTVDQYIQAWEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of an Isochorismatase-like Hydrolase from Alkaliphilus metalliredigens to 2.3A
rcsb
source organism Alkaliphilus metalliredigens
molecule tags Hydrolase
molecule keywords Isochorismatase hydrolase
total genus 62
structure length 188
sequence length 188
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3hb7A00
1NF9A 3EEFA 3R77A 1YACA 2B34A 3KL2A 3OT4A 3LQYA 4L08A 3HB7A 1NF8A 3MCWA 1ILWA 3S2SA 3R2JA 3PL1A 3V8EA 1YZVA 3O91A 3TB4A 1NBAA 2FQ1A 2A67A 4H17A 3O92A 4L07A 3HU5A 4WGFA 1X9GA 2WT9A 3UAOA 3IRVA 2WTAA 3TG2A 2H0RA 3O90A 3OQPA 3TXYA 1J2RA 4WH0A 1XN4A 1IM5A 3O94A 3O93A
chains in the Genus database with same CATH superfamily
1MORA 3TMKA 5CPFA 1OB2A 1FTGA 2ZJ6A 1VGVA 3TLEA 5JZSA 2Y2UA 2H1RA 1U0GA 1E69A 3BJMA 4J9UE 2QX8A 4GLJA 4LZAA 1R5NA 2GPBA 1XTVA 2EJWA 1S8AA 3ASVA 4Q3OA 1NASA 2HZBA 3RT7A 4BKUA 1U9IC 5BURA 1E4EA 2R7NA 1X87A 1MOSA 3IOMA 4C30A 1KA9H 1RPNA 1KJNA 2W2OA 1A8UA 2GTPA 2C78A 2G5TA 4NPAA 4WSOA 4ZK6A 2ZRPA 5AJXA 4EIWA 4RGYA 1ZK0A 4LHVA 2O8EB 4BGDA 1MW9X 2QW1A 3E70C 2HIGA 2DOKA 4K9LA 1P1KA 3L02A 3FWYA 4U6NA 1JNXX 5JYBA 2Y1EA 4BBAA 4I55A 1YE5A 4BMSA 3TM4A 3JPWA 1X1DA 3KR9A 4H3VA 4M8SA 1DDOA 1CUYA 3PJDA 1SD2A 4BQPA 3L0PA 5ICEA 1PK7A 4E6PA 5J2TB 4RTOA 4PGAA 4WCFC 2ZBPA 4PF1A 1AX9A 1JE1A 2O4UX 1JQAA 4FOOA 4MMXB 5K3OA 3D7LA 1EXMA 3TZHA 3TDMA 1CP3A 2GCOB 2Y8EA 2MU1A 4B3IA 5F73A 4H6WA 1AA6A 1XO1A 3N8KA 3SYTA 2CLMB 1S9DA 4GC5A 4PX9A 2I2AA 1ULZA 2AEEA 4ZT6A 1YIDA 4C87A 3G7UA 2XX3A 4N76A 5FBKA 1VSUA 4P92A 2AOWA 3H2SA 16PKA 1M33A 2JC3A 1M1ZA 1SHLA 1M1XB 4KGXA 4WZBB 4Q9KA 5C37A 2BTEA 1EUDB 4RZ2A 2JLZA 4HQOA 3W2FA 3U17A 4BIIA 4M99A 2IYTA 4HUQB 2VQDA 4OJNA 3V4LA 4L0DA 4H4EA 4PNHA 4HL6A 4UOQA 3HU5A 1X8XA 3AFOA 1DKLA 3KJGA 5J5VA 1DOAA 1T8TA 1WDLA 2DFTA 3NBYC 3CB2A 1CRZA 4X7RA 3TLXA 4A6DA 4CG2A 4EGJA 6LDHA 2C9CA 2X1HA 2PUVA 4PLPA 3TE6A 3OJWA 2CUKA 3ZCPA 2R66A 3EXHA 3NTQA 2AMLA 5AJTA 1C2YA 4C05A 3CJTA 1W36B 1YR6A 1ZA2A 3ENKA 1NY5A 5J23A 4F4DA 2C98A 3DLPX 4KPUB 1DJNA 5GONA 3G9UA 2C2MA 2AN4A 4MI1A 4UZSA 1O89A 4LDRA 3V33A 3ZDRA 3QEMB 3ICCA 1XXHB 1L9KA 4PQEA 4RK7A 2NZ2A 1C0LA 1FLVA 4I1RA 1UC4B 1LC0A 1DMRA 3IO3A 3LXRA 3NAMA 5EQFA 1KC1A 3OPVA 4D9FA 2CJWB 2DGDA 1USWA 3K1AA 4XM2A 4YRPA 3K5WA 5SICE 1X7DA 1X7XA 2NXJA 1OXKB 5A3VA 2EG5A 2CWDA 4WA8A 1ZD5A 4Z8YA 5HKAA 2X86A 1TVMA 3K0CC 2ZGVA 5BSGA 5JNUA 3AIKA 2I5PO 2H4FA 2VR1A 3OPYB 5AW3A 2OECA 1BE6A 1E7YA 2O52A 4KBYA 4WOCA 1LB1B 3TCKA 3WJ2A 3L6UA 4V02A 4TL7A 3FCXA 4Y6RA 2FTKE 4EDFA 4X8MA 3H6HA 1VJ5A 1AGPA 1FNDA 2JGFA 2GN4A 3FRJA 3KSMA 1QORA 3OEED 1VRVA 1ZNWA 2XHEA 5JZ9A 3ORQA 4FKBA 2XRFA 4TTQA 1YUBA 4LECA 4YRMA 1J2JA 1OKKA 2IH5A 3SPXA 1MC5A 1RC0A 1XKLA 4L2IB 4BV8A 1QFSA 5J5AA 5JS6A 4G26A 1SBTA 1B6GA 1KMHA 5DU2A 1CNMA 2WOOA 1CF2O 2IEGA 3ANXA 3U2QA 4HOYA 4JY7A 1AMUA 2VDUE 2J6HA 2OMEA 3QJ5A 5A0FA 3AINA 5DLQC 3IEUA 1RPJA 4U6QA 2I1LA 4FYVA 5JASA 1GNVA 3EN0A 3QPUA 3PVSA 1D0VA 4ZAXA 1FYDA 1F4LA 2Q8PA 1BAPA 1YK1A 2QR5A 4GSLA 1BS2A 3GRZA 4NFYA 4ZODA 2IV7A 3ROKA 1ORDA 3ZD6A 3FF4A 4BO3A 4I4CA 3W04A 5CDYA 1DQRA 3D2AA 3RG2A 2O8FA 2XUKA 3QI2A 3TCNA 4KBGA 2VT6A 4KRFA 5CDGA 3Q15C 3VPDA 1VQ1A 5MN6A 1JZTA 1E1QD 2J6IA 3QTLA 2QT0A 1E61A 2NSHA 3LYAA 3Q98A 3SJ7A 1CUHA 5DI3B 3WLPA 3OESA 3EXEB 4WFQA 2CHEA 4EYKA 3AK4A 1L4UA 4RD3A 4GAEA 3W7VA 3KZ1E 4DQVA 4ZI2A 4E1VA 1JDPA 1KY3A 1LDGA 4A91A 5A6SA 1HL3A 1NV8A 3FKSA 4LRTB 1VI6A 2J32A 4YT8A 2ATEA 5C8YB 3CCFA 5EYPA 1WPGA 4S0XA 1HWYA 3BWCA 4KXWA 3VX4A 4ZXPA 2X8JA 3GFPA 1A9QA 1QGOA 1T4DA 3LUCA 2GXUA 4O63O 2OYRA 1KK2A 2ZDHA 1VJGA 4PS0A 4MQBA 1FX0A 2HGSA 1EBBA 4I14A 3N3BC 4OI2A 4TMZA 3PKZA 5EJEA 1GKLA 1ORHA 5A7HA 3L92A 1E3DA 3QYPA 2C83A 3OU6A 2IX3A 2YJZA 3F4KA 4OLFA 4XR9A 3KKOA 2H2FA 1Q1EA 2HSWA 3Q8XB 4OQFA 3LHSA 2H7CA 3WZMA 5HUHA 4IXMA 2K7FA 2AFIE 2BFFB 3GIDA 4GP9A 4H18A 2J5RA 2ZATA 2OZKA 3BH7A 2C3MA 4J0DA 4GGPA 4EKDA 1HLPA 3ANTA 4ZMSA 1XJ0A 3HDTA 2YVKA 1YHYA 5DOZA 1EWTA 3AJAA 3MLEA 1KE1A 5LFAA 5M7EA 4RK4A 1VE6A 2Q2NA 4MQUA 3RW9A 4CQJA 2EL9A 4MUBA 4ZHQF 3B8HA 4KXVA 4QZVA 5CXUA 2FP3A 4K03A 3VYVA 1N2CE 2CJWA 3C2QA 3IBTA 4LVCA 5AK6A 2BHRA 3KRTA 1QIMA 5KYYB 1PWEA 1FYXA 2GBGA 2JH8A 4JB0A 1NJ8A 1XB2A 2JJ1A 5FV7A 1GG9A 1N77A 4OGKA 1MFPA 1AN9A 2ZB7A 5D8DA 4DFDA 4M76B 1CK4A 5ILQA 5KYUA 2Z3VA 4JEMA 3ZBTA 4BS9A 1N2OA 3VQTA 5EHZA 4J1SA 2XR1A 2IYPA 2QTLA 3GCGA 3T35A 2OKGA 1KHHA 3T3PB 4P6VF 5KTSA 4AJEA 5DHUA 4LDJA 1TMGE 4KXUA 3ANMA 3W3ZB 3DEAA 1KXJA 4X90A 5LP6B 2H51A 3FWKA 2P4UA 2TRSB 1KDYA 4KR6A 3COWA 3MCUA 3IQEA 4BB5A 4DJTA 5KVCA 1D04A 5JNWA 1YU6A 2NO6A 3ACDA 1Q91A 4HUQA 4ZQFA 4DR3B 1IMOA 1ONOA 5JAOA 1V5FA 2FQ1A 5AIAA 1Y7TA 3E03A 3PQ4A 4GPIB 2WY2D 3DFUA 3GYBA 2DECA 3CEAA 3HWSA 4DREA 4WRRA 5SY9A 3PUVA 3ZXXA 1I4DD 1CFJA 3ENNA 1CSEE 4PZZA 3CR3C 3RRFA 2HJ9A 4TKUA 4D3DA 4KGVA 1IZ0A 5D84A 2OV2A 5DIFA 3U13A 2O0MA 1UXIA 3KHTA 4M60A 4RLFA 3SDZA 1DUVG 3UB4A 2WMDA 4LVUA 621PA 4GMGA 1YL6A 4HN2A 4NZNA 2OE2A 4UFPA 5CX4A 2VDNB 4KQXA 1Q0RA 1CQIB 2YJ6A 4X97A 3VJLA 2X41A 1C0PA 3SZMA 1FDSA 1MPXA 4HDKB 2QTAA 3W5AA 3R3XA 5CT6A 1KR2A 4MWBA 4V2UA 3LPCA 4PYNA 3GWGA 3VJRA 3P9PA 5CT8A 2D5LA 2QRNA 4S1PA 2YDXA 5EPUA 4G07A 1O54A 2QMZA 1IWPB 4A0RA 2EZ9A 4NEQA 1SFRA 1M66A 1GQYA 1HLGA 2C7GA 1ZP6A 2AZDA 4EL0A 1KYXA 1PEAA 2GK7A 4PHCA 2O8EA 4D44A 2BI8A 1Q20A 2RBKA 1GFWA 1XTZA 4IIGA 1OHHD 1N5RA 5LCXA 2X5JO 2YHBA 1DS6A 3ON5A 4DY6A 4Q66C 4G56A 2QKYA 1IY9A 1M6YA 1PYDA 3RSSA 1SU6A 4DC0A 1GN8A 1TVKB 3AHJA 5DLDA 4OHMA 5HFAA 4RS4A 4YASA 5DRYA 2JD1A 5AJZA 3O7WA 2D3WA 1MJHA 1QANA 2VEOA 2FJUA 4MDYA 2Z8YM 3BEDA 5AXCA 2HXSA 3IIJA 3B6ZA 3OPYA 1VC2A 4G23A 3RC8A 3UW3A 3CLRC 4F4UA 1E1RD 1IFXA 3U7GA 4D02A 4P22A 1Z6YA 3S29A 4EB8A 4EJMA 3LXUX 3GRUA 4YUVA 4F86A 4TTRA 3AKYA 3EC2A 3R9KA 4ZO6A 2ZUSA 2IP4A 4GM1A 1CDZA 4KV7A 2P1RA 4ES6A 4MA4A 2X0IA 3EEFA 1QIHA 1NRXA 1AGXA 1FMCA 1HLFA 2H7YA 4WZBE 3KTFA 4JP5A 1X19A 4A1FA 1JB1A 1GADO 1R74A 1O03A 3HN7A 1GUDA 3ROTA 5CGQB 3OQHA 2G09A 4JROA 3IDZA 3TBFA 4B31A 1Z5GA 4Z9YA 3DCYA 2PS3A 2ZYHA 3Q7IA 3WAJA 1E18A 5JSZA 3K2IA 5G3ZA 2A57A 2FFJA 4TT3D 4U7HA 4TYQA 4BRSA 3A05A 3VAYA 2HFJA 3SQDA 5A6VA 3LTEA 4N5DA 1X1RA 4LKRA 3WJ7A 3EBPA 2BW0A 3G49A 3O90A 2E5FA 1SVIA 1HSOA 3ESAA 5JCOC 2W2KA 3ORHA 1QF9A 1G6KA 1NI5A 1T5BA 1M9NA 4IIXA 4PSCA 8LDHA 2ACVA 3FTDA 4LV8B 2PMKA 4G2TA 4HH1A 4CU2A 2G6TA 1NOIA 3DEYX 1K4KA 3MTBA 1J8QA 4O4HF 2RK6A 3N86A 4I66A 4MKGA 1S7GA 1PK9A 1VB3A 2MR5A 2QPOA 4NYJR 2E4XA 4REQB 5CR9A 5HQJA 3F3SA 1L4YA 2X19A 3QVVA 4FQ5A 4FILA 1U04A 3DOIA 3G9QA 3R2JA 4IRXA 4P7JA 2Q5JA 4PAMA 4XB6B 2CT8A 2BSQA 3BJRA 3EGIA 1YOBA 3FN4A 5CYPA 5EIAA 5IVHA 3K1JA 4QJIA 5ESRA 1QRAA 2ORED 3STVA 2IT1A 3NG1A 1MVLA 4BJ1A 1YL7A 2ZIEA 3EDOA 3ITNA 4WXEA 3K09C 4A6EA 1GHTA 1WOMA 3I5MA 4IV8A 5BV1A 5K8UA 3LVBA 4BLWA 1E64A 2XCLA 4AN1A 2CE7A 2QSZA 3FGNA 3PLRA 3UG7A 1M8PA 4JMLA 4CLOA 1W7AA 1FTNA 2B2CA 2FX3A 2XOXA 3I1YA 3NVAA 5GQSA 3FUCA 4MYTA 1VLVA 4OV6B 3VGPA 5KYKA 4OOFA 5C4IA 2QDKA 3VR0A 3A26A 5J2TA 4O4HA 3P0JA 1FUEA 3M6LA 4YT5A 5JZBA 2WFLA 2MT9A 4QTUB 4O4HB 4PR0A 4Q7QA 1MQ8B 1Q1BA 3JRXA 4MCIA 2SCUA 3BXEA 1MHTA 1XA3A 3OMWA 5FWYB 3PC8C 1OGYA 4EKIA 4KHZA 5CEFA 3T9CA 5HF9A 3R74A 5AVVA 1IK6A 1P9WA 4NV3A 2PKQO 1GOTA 2PE5A 1P0FA 4RWEA 3OZDA 1OZHA 2N47A 1HYGA 3F7NA 1V47A 3ZBUA 4TRNA 3ZZUA 5A03A 4Q15A 6GPBA 1OJ7A 1ZK3A 5AW2A 1ZWLA 4YJ2F 5F5NA 1QYCA 3RVMA 1CUDA 1OBVA 4BKPA 3ZCQA 4NDZA 3TZQA 3PQEA 4HYEA 3I2IA 3MB8A 4E32A 2C2BA 1G9TA 2ZBQA 4DNPA 1SOAA 1AKTA 3EQ7A 1PZNA 3EG5A 2L82A 3AP1A 2V9ZA 4R7TA 3RT9A 4DCSA 5MFPA 1U9YA 4B4UA 1OI3A 3H4IA 4OXQA 5C51B 2HMVA 4QG7A 3TQHA 1MZVA 4Y9DA 4YP0A 1XNGA 1KHTA 1B8VA 1Y4ZA 2PSFA 2M6RA 4D9HA 3OEYA 5BV2P 3MTGA 2WUEA 2BGKA 3EXFB 4LJKA 3KNZA 3Q9SA 3ZTYA 2FMUA 1DUSA 3F6PA 4A6XA 4FOTA 1G8JA 4LBWA 1AQLA 2XCSB 1TZBA 2I2FA 4FFDA 2QP3A 2WYVA 1RT9A 3WADA 4L78A 1R9GA 4J16A 1NXXA 1Z33A 3GN2A 3GP5A 1GXSB 3KAKA 1L6RA 1TJ3A 3THWB 4JUAA 3M6UA 1Q50A 1RJ9B 1KWKA 1OZAA 3TLBA 2BR5A 2IUYA 3F2VA 3TL3A 4HTAA 2FE1A 1AS3A 4JDUA 2C04A 4K86A 2Z09A 1X38A 1HUQA 1DADA 2ZJOA 5B3KA 5HIKA 1U1CA 5T5QA 5H9WA 1XZFA 4QNMA 4NOMA 1JEJA 5LJIA 3C3WA 2OESA 4EVSA 4L15A 2P9EA 4M89A 5K9ZA 2XMZA 3KS9A 4A2CA 2BZGA 3HSYA 1FLNA 2GVZC 4JC0A 4O2AB 4Y1FA 3QXCA 1M2JA 4B2YA 3EVGA 4CEJA 2BDUA 1JWBB 1JBQA 1TAGA 1CS0A 4PX2A 1C7QA 2FK7A 2NU8B 1O97D 2L2QA 3O4HA 3UMRA 2CSXA 3UNXA 1G291 5E9AA 3RQSA 3M1IA 5KU7A 4DE5A 3SJBA 5B7PA 4CHTA 4E2ZA 3N70A 5HKBA 2O0HA 3QOXA 1IIRA 2Q3EA 4AP6A 3OHMA 5C7OO 1FMJA 2GXAA 3FX2A 1KZ6A 5A9TA 5LL6P 1HT2E 2YVQA 3AUFA 4NF2A 4DC9A 1EDBA 1EHCA 2ASEA 2JD2A 1V71A 2CBXA 3DLIA 4G8CA 1RZRA 1WEKA 1WCYA 2EHJA 4X1KB 3UT6A 2GZ2A 4HATA 5ICFA 1SK9A 5KNCH 4CG1A 3G85A 3DTTA 3DTNA 2XQJA 1G20A 1G7CA 4H6VA 2O3QA 4BLQA 5FP0A 4HDRB 4K46A 1XI2A 1JHOA 3T3MB 3IOYA 2LVBA 1DC6A 2PTHA 3O8LA 3LLCA 4G9BA 1K0UA 2IUUA 4BKOA 4S2EA 4UFOA 4YAOA 4X8HA 1M34E 4A26A 5T7BA 4QOIA 1XLTA 2YXNA 2RH9B 3DMGA 5FB3A 3CPHA 4RKFA 1EEHA 1PT9A 3DJYA 2I99A 1A8PA 4D96A 2BHSA 5AVWA 3O4FA 1GCUA 4QRDA 1HURA 2M9MA 4I3HA 5BOSA 1CF9A 4Y2XA 1EIZA 4PRZA 2GCPA 1G60A 3PPIA 4PINA 3RS2A 4C7MA 2A33A 2PR2A 3MWEB 4HAYA 1PE0A 1IXYA 1HT3A 2GNAA 3FHJA 5BSVA 4WBNF 2HL6A 4P08A 4LYAA 5FRDA 5KNBA 3PHBE 2XCTB 3WTCA 3M1LA 2P9ZA 3A8TA 1QFYA 1S3GA 3EGDA 2V7BA 5AHRA 2OR3A 3J7AC 1BCRB 1E9VA 1FFCA 1GAQA 2Q3LA 4PYQA 5C31A 3V1MA 3O8QB 4LY0A 2BE7A 2JBWA 3C87A 3LQYA 2B35A 3PF9A 2PSEA 1E6WA 4ZJYA 3S27A 3UMGA 3Q6NA 2OCBA 3GF4A 4OL9A 1O6GA 1RLIA 4M7PA 1BFUA 1EB8A 1N2GA 2W2MA 3JQAA 3GLKA 4R1OA 3UUWA 3LHIA 1DWPA 4F1JA 721PA 4MROA 4D0GA 3W3AD 2I65A 1BJKA 4HN4B 1M1YE 2IP1A 4ER0A 1ZMXA 4GLFA 1Y6ZA 2JRLA 4ETWA 1PU2A 3JD1A 3HI6A 2R5WA 1NW6A 2VATA 2XBUA 3UV6A 1W46A 3DXXA 3AIOA 1NVGA 4R4JA 4YLGA 5G1NA 3TSOA 3F71A 4GPBA 3QFTA 4QBFA 4DR1B 4J2OA 2XDWA 2J07A 3G13A 2X0EA 5I9SA 1G7SA 2A5LA 2VHYA 4FX5A 5KHLB 2V4UA 2G5GX 4RADA 3TTVA 4GYJA 1UJ4A 4HAXA 4RMJA 1TIPA 5IN4A 5KWEA 4OHXA 3FUWA 2RHCA 5KNLA 1X9GA 1N4DA 4Z5XA 3R6DA 4ZVRA 1WXQA 1U98A 1UC8A 1MVOA 2IDMA 3L93A 5TVKA 1CLUA 1VYVA 4AY4A 5HFJA 5HJ7A 5JD6A 3MLAA 4O2LA 1BEEA 3FLEA 1JAXA 2PGLA 1NPTO 1I6MA 2X0DA 2YZMA 3CVOA 2H0AA 1L5HB 4LNAA 3AHFA 3PB3A 2H2GA 4DB2A 4R1UA 5ALRA 5G0TA 2IVZA 1FRFS 5F2KA 1EJBA 1HM5A 1P2FA 5DBHX 2ECKA 2FA9A 2QOEA 1ZGBA 1MX1A 3TK1A 3FSGD 3I1JA 3F67A 3GEMA 4RQUA 4EHDA 4GQAA 4PE5B 3VR5H 1RMTA 4KYIB 4UAVA 4G5RA 5LOVF 2PEYA 1GPKA 4J49A 4N8EA 2YWCA 3M5CA 4FTWA 3SVTA 3O6VA 4Q4JB 5C8YA 1EFDN 2VT7A 2Z5VA 1N9GA 3LBIA 4W5RA 3ZDBA 1B8PA 2WG0A 4EUEA 1XT6A 4ZYWA 3KJZA 1YOVB 2JARA 3BZWA 2DHCA 1C9JA 4JUCA 3G0BA 4IQ4A 1HI9A 5CTAA 3UXEA 1KI8A 4HLUC 2ATCA 2JHPA 3NEPX 4GX2A 1X86B 1UXJA 2QV0A 2VCYA 2PBZA 3LY5A 4HTFB 3SEFA 1ZJYA 5I8WA 4H7PA 1BEUB 2NO0A 5AHXA 3U7EB 3VSAA 1A2KC 4LCBA 1PP4A 3O1HB 2AJLI 5JDCC 3STWA 1PUXA 2G8LA 2FZ4A 4NG4A 5E4YA 2DUJA 1J24A 4ENTA 1YZVA 3HRHA 2XY4A 2YYZA 2YV5A 4DV1B 4L8YA 3AR6A 4BO0A 2X4GA 4HB0A 1CUWA 3WWPA 4GSKA 3YASA 1SWWA 2BEUA 5EHXA 4ZICA 2A6PA 1FP7A 1U0BB 5IJ0B 3C6MA 3RSCA 3ZD8A 1EFAA 1G4AE 1E94E 1ZM7A 3PNQA 1EPUA 2DUUA 1GQFA 4EAQA 4R8KA 1J8DA 1IH8A 4F06A 2BEKA 1LSSA 4ZP1A 1E1RA 2IHZA 3NTVA 1CIJA 2X2PA 1PTKA 3X1DA 5NLLA 4NOLA 5B7NA 3C97A 2O05A 3GOQA 5BW8A 4GGOA 1E59A 4L76A 3RS3A 3LC2O 4WHMA 2QR3A 1QE3A 4W63A 1VJCA 3WFZA 5JXHA 1ZGAA 2RHMA 4HQ0A 5AVTA 1NOKA 4WY2A 4Q48A 3ZE1B 1M8FA 1MIHA 1QK4A 2Q1TA 1A04A 2ZI6A 3B9BA 1I3KA 2BTOA 2NPIA 4LQ4A 4LYYA 4MS4A 2BTQB 1AUOA 4E88A 1RWBA 3N05A 2I54A 4XDZA 1G18A 3SHTA 4ZAFA 2I3AA 5HF8A 3INGA 3KOYA 2JNWA 2N1BA 1N8TA 1NXTA 1M8GA 2W2NA 2AQKA 1R3DA 2VYFA 4QYMA 5C5DA 1NQTA 1NNSA 1EVLA 6YASA 4J1NA 4MV5A 1J56A 1QYIA 2ENWA 3EVNA 4GRIA 4HWSA 3TG8A 4MWCA 1X0XA 1HDRA 2YWJA 2A84A 3BDIA 3OOYA 4BNDA 4ZCRA 1KI1A 4K8OA 3DZBA 2Y9PB 3L2OB 1WL8A 1LK5A 4WKNA 1B43A 1YB7A 4J0IA 3C14C 2C7VA 5IM5A 3UATA 3C6XA 3HG7A 3ZKWA 5GZ1A 4G67A 3NS7A 3EVZA 2OCAA 2H5JA 2QL6A 3JYQA 1V1JA 4RKEA 1JH8A 3O92A 1LCIA 1THZA 3P4XA 1K98A 2AUNA 3F5DA 3IMEA 2FCAA 5IK2A 4CL3A 1F8FA 2XUGA 2WP8J 3AY0A 3DKVA 1CUVA 1V96A 1EXNA 3B70A 4H60A 4WKGA 4ZYVA 2QK4A 4J91A 5HM6A 1VE9A 2KSQA 4MA0A 1ENOA 1BD4A 4EVIA 2E9SA 5K99A 3C5VA 4EHNA 4RMHA 4Y9RA 3PITA 2AFRA 3ZK7A 4A10A 3WC4A 5I7FA 2CLKB 2DPHA 2BONA 3NXSA 5IT9A 1Z7WA 1P61B 1MU0A 1FUUA 2ZZKA 4M0UA 4Z8XA 5BWBA 3K94A 4JX8A 1KFKB 3JSAA 4DLKA 4UUOA 4G2NA 3HM2A 4LYJA 5B37A 4X7PA 3QF7A 5C4MA 1OQAA 4E5KA 4G25A 1NULA 2WIKA 4L4SA 5DBFA 3MA0A 1IB0A 2JIZD 2AMFA 2UYHA 3AHHA 4FBLA 1QF7A 4GVXA 3WAGA 3GFBA 3WGNA 2BT4A 2CXSA 5T3UA 2K2WA 2GCOA 4MEAA 1L5LA 1A1SA 4R05A 2I9KA 1KVRA 3Q12A 5FUVA 3ROGA 2XCIA 4J7CA 3R7AA 3RSQA 2H5IA 3NHJA 2RHLA 1Q0UA 4UDOA 5ECGC 5JJIA 2OC9A 4LYHA 3TQCA 2FZVA 5IAOA 1PT7A 3E6AA 2AWOA 4KTTE 4J94A 1DTSA 1N5IA 1O2DA 4KK4A 4Z9AA 2R65A 1HG1A 1I7LA 1VJDA 3MSCA 3B7WA 3PX3A 2F7SA 4LRSB 5CX1A 3UMJA 3PUWA 4PC2A 3W0LB 1K4MA 2RGCA 5CFNA 1SUAA 2EKLA 5JIBA 4KDCA 1FE8A 1DJQA 3JD0A 4ND2A 1IJKA 1P77A 4CF5A 1XDSA 2ZIGA 2NU6A 2YVUA 5GY7A 1PCXA 4F8YA 2PUDA 5FYQA 4RZ3A 4D7AA 1CT9A 2EIHA 5E4TA 4MLDA 5JXIA 1I30A 5C81A 2HLPA 4RM3A 3S8YA 5ARBA 3FDXA 3L49A 2HWUA 5G41A 5EHGA 1JDZA 4NYIQ 2NV2B 2WMYA 1ML3A 1J8VA 1NBHA 3K2EA 3TE7A 5C5EA 5B1DA 2NQ2C 2X22A 2Y68A 1KERA 1UFQA 1VGRA 3MOGA 3LP6A 4XWWA 1PWHA 3H1BA 4XARA 3H9QA 1IJFA 4S24A 3OKFA 4BNNA 3SX4A 2IBTA 2EW8A 2OHFA 1X7YA 2JHAA 4WBNA 1C9YA 2XMDA 2ODAA 3MERA 2R5FA 4NBSA 4OP1A 4RQBA 4U4AA 3W8RA 5I7AA 2IHUA 4HK4A 3I2YX 4I99A 4ZAGA 1SXJD 3ZY3A 4V39A 3A04A 1H69A 3ESRA 4BOYA 4H1TA 4JDPA 1CJMA 4M1YA 3ZE2B 4H7EA 1GPNA 2OHOA 1C3OB 5FBZA 4EOGA 1MP0A 1JIXA 2XZPA 5JD5A 1QQBA 1E9SA 1Z2AA 4FOPA 3ZJVA 4A36A 1C80A 4KEAA 4CUZA 4YP7A 5KNDH 4MVJP 4BYMA 1XCLA 1JWLA 3IHWA 1S6YA 1ZUD1 3MWLA 4H17A 2IXEA 2FWMX 5GAJA 2ZP1A 1EESA 1XRPA 3U7HB 4KK3A 4CUKA 3DC7A 2FOIA 2A30A 1H2EA 4XPIB 1UK7A 3M9LA 1NUHA 3IGFA 1PS0A 3E48A 1BXRA 4TRRA 3TJRA 4BC0A 4HGYA 2V55B 4Q9LA 3UN1A 4CZ2A 4ZVQA 2F3RA 2VJYA 1B15A 1ZIXA 5T67A 1SO8A 3WBKA 4BFVA 3ULKA 1PV2A 2X7JA 3U62A 4DIFA 4DR6B 4FUQA 1P60A 2QLMA 3IUSA 4GOKA 1V5GA 2YWXA 1B93A 2DJIA 3HCDA 5PGMA 4B4KA 3IQHX 4WA7A 4WCDA 4MK4A 1ZH6A 1AIPA 3R0QA 4JVSB 1QC5B 1U7OA 3JZAA 4R83A 3R7WB 3O73A 3F8WA 2NP6A 1PG5A 3VR1A 4HWKA 3F6YA 3GJ0A 2R4QA 4QJBA 1JHDA 4S1TA 2HR1A 2OAQ1 1YJCA 3BREA 1X39A 1XZGA 2ID7A 5IDYA 4US1R 4QL3A 4IMIB 4TRJA 2I7CA 4FFVA 5D3KA 5CAEB 2FPRA 3MMSA 4C07A 1ML4A 5JCJA 5JS8A 1P1BA 3A3KA 3DMPA 3DE5X 4LQDA 1QVVA 3T9BA 1KBOA 1UEJA 2PL1A 2JAQA 1R0WA 2QM0A 4CTOA 2HLDA 1DQPA 1U8CB 2I29A 3DVSX 3GJRA 5EMNA 2AOTB 3A31A 4QUGA 4KO2S 2WJZB 2YYAA 3KPUA 5HMLA 5I9LA 5JRDS 1OH7A 4ILEA 5ESWA 1RIFA 3SF0A 2JCVA 5LOVA 3BH0A 3GZNB 1MGOA 4FKZA 2G9NA 2WWVD 2BGJA 3EQ6A 3KUKA 3OQBA 1W8IA 3BSFA 3D8TA 3OJCA 4LOIA 4B6PA 4BUCA 3HGQA 1FUKA 4O8ZA 5DULA 1WV0A 1IUKA 1E9CA 2P9GA 1KMCA 3STUA 1ACMA 2LXNA 1AKWA 1N2XA 4L7VA 4EA8A 4C1NA 5BOSB 3O94A 2IA5A 1ENYA 4R9NA 3FVTA 1NC3A 4P38A 2LUOA 1D09A 2VDVE 4ZV4A 1YHNA 3DHEA 2XECA 3ZNNA 1IQ0A 5CD1A 3V8NA 1CQWA 2Z2IA 2IEZA 2IHKA 4GI3A 1SBHA 3S2EA 3QW2A 3DVAA 3ACBA 3TPCA 2VF7A 3PUJA 5LKAA 3BGIA 2GVNA 2JEOA 1KQGA 4KQKA 5TXGA 2GQ0A 3AIIA 3L7BA 4ZO7A 5HS6A 3I01A 3T15A 4EA6A 2AVNA 2QL7A 3DM5A 3M6AA 5I8ZA 5C35A 3PPYA 5KVAA 1O4VA 4UUPA 1BOFA 1CPYA 4UOZA 4PCAA 1FFHA 4NFHA 1CKEA 5TC4A 3H8SA 3WLEA 3SR3A 3EY4A 4QEZA 3GLIB 4FIZA 1IK4A 1RADA 2VEDA 4OBXA 4UHHA 1L4GA 4QYIB 4GI1A 3G7NA 3OLWA 4AQDA 5LDDC 5L40A 1MAAA 2IS2A 2EW2A 4Z4FA 2C29D 4RQTA 2XUIA 5FTKA 1DQSA 4ZAVA 4BTLA 3NIGB 3UENA 1NU6A 3JD2A 4ETMA 3RS5A 1G8SA 2IUSA 5G4KB 4W9NA 4ZYLA 4NH4A 3PI7A 2IV3A 5K4HA 1SJ9A 5LC1A 2RGBA 1C3OA 2PRZA 1E60A 2QTNA 1NGSA 3V4FA 3X43A 2PZ8A 2R47A 3HYTA 4P5PA 4Y0NA 1GL9B 3LGXA 1ISMA 4WZZA 1QG0A 1CZNA 1YCDA 3D8UA 3H5OA 1MAWA 3NKVA 4HUJA 3JQGB 4JJIA 4K6GA 4H3KB 5H68A 1UJBA 1VKZA 4JXXA 1DKNA 4Q16A 3CUKA 5F51A 2ZCJA 3D3EA 3BF7A 1DRJA 3EMVA 1GA4A 4F4JA 4M1QA 1BVHA 2SKDA 1CY7A 2D1TA 3VH4A 3IE1A 3SSOA 2R7MA 1KGSA 1MPTA 1ZGJA 1JKMA 3MJTA 5BRNA 2NTYC 4W5OA 2TYSB 2OCLA 3BSSA 4K6OA 3SEQA 4BJ3A 1NJ5A 2ZRQA 2A5FA 5B64A 2IQIA 5LD2B 3LO8A 2EX4A 1TIBA 2X5NA 3MYRA 4PR3A 3RSZA 4PAOA 4B6RA 1FC0A 2A5JA 3QE4A 3BERA 3CEHA 3EQ2A 1L5QA 1BO6A 4LRUA 3V7FA 1TD9A 3NNDA 3BTOA 3IUBA 2QGZA 3PGLA 2OV8A 4G0UA 2POQX 1FMLA 1OV4A 4UTPA 3AM4A 4ZCQA 1SQGA 5JH7F 3K96A 4CL8A 5KPJA 1KZ4A 3FDJA 5IK2D 4RHUA 1QYWA 1VOTA 5K0ZA 5C5CA 2HSJA 4YJHA 3AX6A 2SICE 1AC5A 1NATA 1X0VA 2QB5A 3OJFA 4KNWA 3FPLA 3DL2A 5B7QA 3MJEA 1QIEA 4URWR 3VH1A 2B4AA 3K0AB 1KRHA 4TVOA 1C8LA 5D01A 3EFOA 2VPIA 3S3TA 2WSYB 3IP3A 3PIDA 4QPPA 1WF3A 1U4OA 1NP3A 5A3RA 1NTOA 2JW5A 1KO4A 2QAIA 1IHOA 2GB4A 2VK1A 3B85A 3GK3A 3H0KA 5EE5B 1SA0A 3MINA 1BWRA 2C8KA 3W6NA 2O3RA 1PKEA 3OWOA 1KI4A 2B99A 2VWGA 1P7YA 1Z18A 3EF1A 5INTA 4PPFA 4BVGA 5EIXA 3E05A 3NCHA 3A1WA 1Y6GA 3KEQA 5BO5A 1CR2A 1U5BB 3QOYA 4LPSA 4P36A 2JIOA 4M36A 3ZJTA 1FTQA 1LRLA 4PGGA 3RRZA 3ZZ0A 3MS4A 1U8FO 1V9CA 4N6NA 5C0OE 2H6EA 3DYVA 1KEKA 3FD8A 3R3UA 3WKDA 4AO7A 2GPAA 1Z12A 2JAOA 2WZQA 1E1DA 1W0CA 1T2NA 1XK6A 3LSYA 1R5JA 2NPOA 2ZTHA 2V7UA 3I53A 1ZXBA 2YN2A 1MOQA 2XQKA 2WWRA 4HAZA 4G24A 3CH7A 3T5BA 1GFZA 4DKXA 2HA7A 1OH6A 4WEOA 5THQA 1Q92A 4QOSA 2FK8A 1RKXA 1HL7A 3R0XA 4ZT5A 1JLLA 2P9FA 2WT4A 5CDUA 2RHOA 5J4HA 4YXFA 4FFBA 5AJYA 5DHQA 2HT6A 1QCYA 4KODA 2ACKA 2LKCA 1NUPA 2R8BA 3WHLA 3J81k 1FFEA 2MTBA 1E7WA 3GRRA 2TMDA 2VK4A 4IJQA 3TFQA 2CHVA 5LZ4A 2H1SA 1MW8X 1LW6E 2AZMA 2GZAA 4JU9A 4EGSA 3FDZB 3OX1A 2QZZA 2XWBF 2PLAA 2PMWB 3L46A 4WCVA 5JI3E 1VHQA 4AKGA 3O9VA 4OP3A 2DHDA 4LC0A 4G1CA 4BGVA 2V6GA 1T10A 4QLAA 3K6SA 1ISGA 4KQMA 1INLA 5H81A 1T1GA 4KI0A 3S55A 3X1YA 1I3OA 5LMZA 3WGHA 2EX0A 3P4YA 5JHGB 1MV5A 1CUGA 4QWWA 3QI7A 2PNFA 3OSUA 5ADVA 1JU4A 5AVJA 3U3XA 3DVQX 5FBVB 1YVUA 3FNBA 1JTEA 3PWKA 4DAOA 5F35A 4DCTA 4O4JF 4XB1A 1Z4JA 3Q1LA 4BWGA 4RVFA 1J33A 1JAIA 3KEFA 4A8TA 1K9SA 2VRCD 5FL7D 3WGMA 1C1YA 1BH6A 2NN3C 4F6RA 1Q1QA 1XFAA 3WYNA 1YZTA 2VTKA 3LS2A 4H7FA 4LXTA 1YBVA 5KC8A 3B12A 3NPAA 3GUUA 4CQNA 1OFHA 2FPIB 4DT1A 3GGSA 3UJCA 3PQ8A 2E7ZA 4JP2A 4MI6A 3ELYA 3STXA 3T3EA 4Q01A 3UICA 2Q07A 2GN0A 1WPQA 3E8XA 1H2WA 4X66B 3OX2A 1DAKA 1KFBB 1JKJA 4KH0A 5BNFA 3AZPA 1HYBA 4JJZA 1E0JA 2Z58A 1T9GR 2EFEB 2OUIA 3JPYA 2PBLA 2J9ZB 4JQSA 1QONA 4WUVA 3REQB 5A62A 3QFHA 2Q2OA 3HCBA 1R9NA 2GD2A 3F5FA 5BN5B 1O95D 3D4PA 2CZQA 1WXGA 2C88A 4CM3A 1Z6AA 4FN4A 4P3KA 3WYBA 1UINA 5AW8A 4C0BA 1D7OA 1EUCB 2RKBA 1TT7A 3AUSA 3P4UA 4HQRA 3WV5A 5J3JA 3PIRA 4TWZA 1W2HA 2CXPA 3Q4GA 1JV2B 2W7TA 3H5VA 1GKKA 2GO1A 2VLBA 4C7VA 5EHQA 4L3VA 1W1UA 2Q2QA 3KTAB 1GGJA 4JOQA 3ED1A 2Y0PA 1GNTA 4NCHA 3TWOA 5BMVA 2CXTA 1EVQA 4IGAA 5F7XA 1PL7A 3HLYA 3EQ9A 4L6CA 1KI9A 4MITA 1Y8QA 3RREA 1ZC3A 5FBLB 3RVDA 3KJNA 2YJ3A 3QVTA 1X7GA 2OLEA 3CLSD 5FDFA 1QJCA 3Q3VA 4NBRA 4AVYA 2ANCA 1NY6A 2YXLA 4BAUA 2G36A 3NGLA 1KR5A 1YKGA 3BQMB 4J4TA 4PYOA 1WMAA 4Q4JA 3ANYB 2E2WA 2P69A 2V6JA 3TD9A 1D0SA 5KKNB 2ZKLA 2TSYB 1MO6A 3SFVA 4HEJA 3ZWCA 1UBEA 2OORC 2G0NA 2DBQA 4H4DA 3VSCA 3B1FA 1RYFA 2Y1CA 3FZNA 1NHGA 2FR1A 4JN6B 1XCMA 5KDDA 1AKUA 1WSDA 3ITKA 4IS3A 2G4LA 4W6ZA 3T7RA 2H11A 5IAEA 5JNSA 1EFCA 1FUIA 2PDAA 3QXJA 2NZVG 1LDMA 1AQUA 3HYCA 2ROQA 4IV0A 3AEUA 2L0XA 2V7VA 2CEKA 4RY9A 2ODWA 1PR4A 2WU3A 4DEVA 1V5EA 3F96A 5EXEA 3ZD9A 4ZZ1A 1JH9A 1PYGA 4IMPA 1J9GA 1H1LA 5CFQA 5H16A 4E51A 2V0GA 1BXZA 3HVKA 5LQCA 1GRNA 2J08A 1R37A 2P3SA 3LVRE 4EHHA 5A7GA 2WWGA 1EGQA 4K8RB 1PJRA 2CVOA 2WWYA 2E18A 4E1BA 4P7GA 3TLGB 1TKCA 3WA6A 1NHWA 1HSZA 3DLAA 6NULA 5ALDA 5U9CA 3HADA 4IS2A 3HFSA 4ZDWA 1QMGA 3VTFA 1C0KA 1H2YA 2PJUA 3E1SA 3PF8A 5IAGA 3SE7A 4NARA 4BFSA 2WJ4A 3NYRA 3EOAI 2LE0A 3ETEA 1BROA 4US0R 3WB2A 3HL4A 4HFJA 2J5KA 1YB4A 3DR5A 5I47A 2G4CA 4GOMD 2AN3A 4DR5B 4WBXC 2RGDA 2XZTA 1VE1A 3I6YA 4R51A 5AI5A 1ZS9A 1U0RA 4QG3A 1VDZA 1C0EA 2X6TA 4J6EA 5EXXA 4AK9A 1FY2A 4GC9A 1JQ3A 1U11A 1C7EA 2BM9A 2OLKA 2QP4A 2VYVA 3JR3A 1GCOA 4RIHA 4GVLA 4NG5A 2RARA 2W2LA 5DCUA 3IUMA 1FNMA 4FR2A 3WYAA 3JWIA 2O3JA 2YR0A 4URYR 1UJCA 1MEOA 1ZDMA 3NIDB 3CLTD 4PG7A 2XYPA 3JQFC 4ARCA 4HEA6 1DE0A 2RK4A 3ZTTA 4DRZA 2GTHA 5AW1A 2AFHE 2WSLA 3Q8LA 3LL7A 1KAGA 5CM8B 2DHQA 1HE4A 2PSSA 2BKVA 3UKJA 1C7ZA 3UPDA 1GU7A 4PTZA 1KO8A 1J8FA 1OZ0A 4D9NA 2IXBA 4DGQA 4ZXFA 1UKEA 4LYEA 1RI3A 3A1VA 5C8DA 5T4BA 4KRGA 2HPAA 2QZ9A 3IPRA 2PGJA 1Q6ZA 1X7ZB 1SC1A 3TYXA 3D8NA 2C4WA 2XB8A 4YACA 5LYJA 4DA8A 2X0NA 4DMKA 2OXFA 3F3KA 4Y2SA 5LA6B 5IASA 2WTEA 3O0TA 5B1IA 3PE6A 1U7WA 2O8DB 3NBXX 1ZINA 1GLNA 3ZE8A 4ZCIA 1PEKE 2HXYA 3GZNA 5KTKA 4HO1X 4CTMA 1IN7A 4TT3A 2V7WA 4LJ7A 1DX4A 1OF1A 1PVVA 2ASVA 3C7DB 2Y6UA 5KQLA 4XSVA 2E55A 5IRCD 2AOTA 4MQFB 3EPLA 2JFVA 4YJHB 4L74A 1I80A 2FUG1 3B1XA 1ISHA 3TVDA 1W0JA 2SKEA 4Y2VA 3W9BA 3B3AA 2HIAA 3HE3A 2R6AA 4XWKA 5FUMA 2JG3A 2C58A 1VI5A 2FUG6 2I4NA 3V32A 5HZHA 3KAPA 2WJAA 5EPEA 4O4LA 4WK6A 5J47A 4B75A 4OGLA 3FNFA 5JO0A 4DIDA 4UJ5A 1HNXB 3C7AA 3EPRA 4R1SA 3O38A 3FAKA 3BA1A 3JWGA 5KSZA 1T15A 1E2GA 1RWMA 2OCPA 2GKSA 2AD5A 5AHOA 3T3NA 2ZE8A 1GG2A 1UXOA 1SCJA 2QI9F 1JT2A 2A7QA 3F4LA 1KMIY 3OFND 1QC5A 3OFNA 3TIIA 3H16A 1NMZA 1SBZA 3T52A 3TTYA 4QQ8A 3IBSA 1FDVA 3MJ4A 3OJEA 4TWRA 2ACEA 4Y9UA 3JYPA 1TUIA 3HJNA 4YREA 2JGRA 2Z6UA 1W52X 3ZTWA 1H05A 2WM8A 4C1BA 1OXTA 2IYLD 4KWEA 4Y98A 3EW7A 4F2WA 2QNIA 3AIMA 4ZD6A 5C2JB 2XA1A 1GKUB 4QGSA 4ARIA 1P9NA 1RBMA 2HJSA 2I3ZA 3KJIA 4MCAA 4RKYA 4YRBA 5KS2A 4PCUA 1P44A 2FSPA 1M7BA 2OM6A 3G8CA 4NS1A 1G6OA 4NDNE 2GXQA 4HGNA 2QW0X 4ZOAA 1CF4A 4UVGA 4RK1A 4P3YA 2O1XA 3BQNB 3MWFA 2YY7A 1SCQA 3EAGA 2AN1A 1CUAA 5JUWA 3ESQA 2EJCA 1VKHA 1G5PA 4FLEA 1WZ2A 8ATCA 4C4ZA 1BVRA 3GJ4A 1EUCA 5CIWA 3CXUA 4ESEA 5I7OA 3GLIA 1NAHA 2VTDA 4X3OA 2FRXA 1Z5OA 3W34A 1L5OA 1L7BA 1PQYA 2F3QA 2WJGA 2WJPA 3OZGA 2AQHA 2FVYA 1U2PA 3EIXA 1DTEA 4IR7A 4OK6A 4DJFC 3CEMA 1SUFA 4LOJA 1G0NA 5P8WA 3R1IA 2ZAIA 4G8DA 2C2OA 3LX8A 3HO6A 5BN1A 1X7YB 3VPHA 4FZ5A 3CLUD 1I4WA 4U2EA 4AZ0B 3BB3A 4IDBA 3BJZA 4N6OA 4DNFA 1UBOS 3RUAA 1SPXA 4QVKA 3VV3A 3AVTA 1ZFNA 5C7IO 4CEHB 3ZI4A 2KLHA 2Y76A 3ER6A 1WDKA 3U3JA 4QT4A 4QFDA 2O0KA 3RASA 1IHPA 1UZAA 2HMAA 4MR7A 1OWPA 4X1YA 5SZHB 4DL9A 2P6OA 5JDIC 1IHXA 3FXAA 4H1WA 5IF9A 1CUEA 1LBIA 1Q1NA 1S3FA 2MIIA 3GEHA 3HYLA 4CHGA 3AEQB 4ASUD 1PFWA 1P2TA 1RRGA 1UBFA 1Z0KA 4RPHA 2BSXA 1VIDA 3GFVA 3ANSA 3V97A 4PBTA 4EI9A 1DT3A 2I3GA 1RQPA 1UBUS 2ODQA 4GPAA 1K5DA 2J87A 3IIIA 4D9EA 3NDRA 2ZRCA 1G8PA 1IBLB 3I0NA 1UL1X 2P5SA 2PM8A 1Y5LA 2XYRA 2BDEA 5A5FA 1X13A 5A06A 1ACLA 1P4JA 3C1AA 3FJ1A 3W8NA 1UFOA 5K0CA 1Z26A 2QG6A 4G4IA 3UJPA 1PJ8A 3CR7A 4GZ6A 4D26A 2PZBA 4LDNA 1MOZA 4WLFA 5DM2A 4ODIA 2IRWA 2Z9DA 5L51A 1PNOA 3BMOB 2H2WA 4ENUA 3SR4A 2NIPA 3GPCA 5EN4A 5IWAB 1Y63A 2FN3A 1J8MF 3R8XA 3HLTA 4DCJA 3MG9A 1VSQA 1BQEA 1JNYA 2IYQA 3BD7A 1VP9A 5I9BA 5BY2A 1Q2UA 2IHVA 4KN8A 1A72A 1XDUA 2AKAB 1RYYA 1EP2B 3IJEB 4I9FA 5NULA 5TPWB 4QNRA 1QE5A 1Z6TA 5EQJB 4POOA 4V0RA 1ZESA 1BMDA 3ZGZA 3TQQA 2BGTA 3S0JA 1RI4A 1IN8A 3PWSA 2HHCA 4I5IA 4MS1B 4RLHA 2GFHA 5T4HA 1PAUA 1NXVA 1Q2XA 3A14A 3OEHA 4GNRA 3VR4A 3AUTA 3ZCVA 5IJWA 2Q4OA 3PVCA 1V5WA 4F12A 4EPRA 4HLCA 3PQFA 2EZTA 3RJTA 2MSEB 4CMGA 1HFKA 1WKCA 2JH9A 4J7UA 4BO1A 3IURA 3HFJA 4XYBA 4GF5A 3ZNPA 3IVCA 2E48A 3AV3A 5B2FA 4BNGA 1DT5A 5TE9A 1LQ2A 1QAQA 4A8PA 3UA4A 3REOA 2ZULA 4EI8A 2W6OA 2YNMC 1Y0BA 2R62A 4KQ2A 4OQYA 1IN1A 2CWWA 2IZ7A 4QULA 5HVNA 3PPVA 2DWQA 5JECA 2P9CA 4QFMA 4WLOA 1II8A 1XD9A 1JJVA 1UADA 3U5TA 3PHCA 1M1UA 1F0YA 4RH1A 3SYLA 4AJIA 4MV4A 2I6FA 1VPLA 1GKYA 4Q82A 2J5QA 3DCJA 3SFZA 3F9CA 2I4TA 4JQYA 4WKBA 5DJ5A 3DLHA 3KT3A 4RD6A 1EHYA 3I09A 4B6EA 3SXJA 4AJPA 2MYNA 1VGQA 2AE1A 3IEMA 2UZ4A 5EWMA 2QUHA 4KYVA 1WNFA 1K68A 3CNEA 4CODB 1SZPA 2HRBA 1IXKA 5GINE 1SKYE 3FCYA 3H2KA 4I55F 1O95A 2WVJA 4PYLA 4RIFA 4YWHA 1T9AA 2MR6A 2CW5A 5HK9A 1BX0A 1MEJA 3SWWA 5EJGA 4NCBA 1QQ6A 1CXZA 1WU7A 3QWFA 4IGIA 1NBMA 2VHZA 3WJ1A 4LOAA 1SCBA 2VG8A 3GL9A 3ZWOA 1YH3A 5HQ3B 3PC4A 3M4YA 1ZM2A 1TJ4A 2PFKA 2XE4A 4HFRA 1UFVA 1EFUA 1O5TA 2NZWA 3H8JA 3IBCA 1WP4A 4B83A 1K8ZB 1RYBA 2E3JA 3BHMA 1HDIA 2WJYA 3GR6A 3MNFA 4KVFA 2R6ZA 1Y37A 1L8OA 1N5MA 2IPLA 4OKNA 2OG2A 2ZUTA 1N2IA 4C5CA 1CB0A 2X14A 3AHGA 4Q1CA 5BVHA 1QHXA 1CQJA 3DZIA 5C80A 1K06A 3KD3A 2IY9A 1DQNA 2C5LA 2J6BA 1ZL2A 2BFNA 3NHLA 1G2IA 4B7UA 4LE2A 1UQTA 1GAJA 3CJQA 3DAYA 3QNUA 3R3HA 3LQ1A 4PPGA 4Q0MA 4AQ7A 4X3CA 1EGAA 5IJ0A 1E8NA 3O95A 3GT0A 4DWVA 1Y8RA 4A2WA 2ZJ8A 4MW1A 3AYZB 3GFSA 4F6LA 2WYIA 4DMCA 3NETA 4EZBA 2H8KA 3UHJA 1VXOA 2CUZA 3DFKA 3ZUPA 4OI1A 3GFRA 3R5HA 4HQKA 3ADDA 2IE8A 2KMLA 4JMPA 3LJKA 5AJHA 5HDBB 1ODIA 3Q40A 4YRRA 5FPQA 1RFGE 4A2QA 3ZGOA 4QBHA 3TDNA 1R5BA 1CETA 2HC9A 1TTTA 4CMHA 3DNPA 5LP6C 4IXDA 3GQBB 3KR2A 4BMOB 2V96A 4X20A 3DDHA 4FFBB 4PLZA 3OPMA 4UAJA 1XPJA 5EJIA 4NCIA 3VYTB 4DBVO 3LA8A 5CHYA 4EUSA 3EJWA 5CITA 4MAAA 1E7RA 1LU9A 1GY8A 1Z45A 2GEKA 3EMDA 4GE3A 2ISSD 3NIFB 1W4LA 3H0EA 1R7RA 4Y18A 3H1AA 3LY7A 1WB5A 2A1UA 3N76A 1DEOA 1T0BA 1W6UA 2FZEA 2ODNA 1QRDA 3B1JA 3CKYA 4MYCA 2FW7A 3X1MA 3ZQJA 4CIWA 5KOIA 3DO6A 3JAKA 4O59O 3NONA 4F0JA 2O5RA 4RA6A 4KFSA 4M9QA 4R2LA 4YY3B 5KQMA 4MLZA 4RZXA 1FTYA 4JI2B 1OC4A 1UJ6A 2NSDA 3RYFB 1NUUA 2VHXA 2F62A 2XUHA 3HFGA 1KQFA 1ZN2A 3EASA 3EQ8A 3H2GA 4EW1A 4FYXA 3B82A 3GYGA 1LDNA 1VLJA 3A3YA 7ABPA 1FP1D 2NV0A 4K3VA 4OLHA 1AXEA 2QY9A 1XLWA 3MINB 3QITA 2FAXA 3RSOA 3VU3A 3RUCA 1FLDA 1I0ZA 3HEMA 5D3MB 3HR8A 1KI7A 4G8JA 1RKUA 1N9ZA 4LV5B 1P9RA 3BGSA 3PQ6A 3VO2A 3PA6A 5CUQA 5JSZB 3RYCA 4RDIA 3EFOB 2VI5A 3PXBA 4PZLA 5CFOA 5IN5A 4CJXA 5LOVB 1W29A 2HIHA 3QWHA 1XQVA 4CVNA 4XAQA 4AMBA 4C06A 3E3AA 3NWBA 2UYQA 3I2GA 1EGVB 4TM7A 3RV3A 2IXAA 4CYMA 1OTXA 4NNJA 4TV8A 1F8GA 2IGTA 1WW2A 2W70A 1RMQA 1TU0A 3NHYA 2O1EA 2D7JA 2Q4RA 3UAVA 2OCDA 2WM9B 1ISPA 4V1CA 1QXSA 2B69A 3WLKX 4KJXA 2HRQA 2ZRGA 4K6MA 1RYZA 3G7SA 1RVV1 3VVCA 2UUAB 3JVUA 3HSSA 1M34B 1MO3A 5IKPA 1C7JA 1Z62A 3DBLB 4LGMA 4OO3A 4Y6LA 2QAGB 4KN6A 1S8OA 3GP8A 2DSTA 3NBFA 4V3BA 3FZGA 3DCIA 5JSKA 4E7OA 1R50A 4UZFA 4QC2A 4JJAA 1MZPA 1T4GA 1PBTA 1V8PA 1Y6JA 2C0QA 2O3SA 3G5MA 4O2BF 3HMQA 4XX0B 2ZJ0A 4KXQA 5JJ5A 2XQFA 5GV8A 5FPKA 2W43A 4G81A 5I7EA 2AMYA 1Y3BE 2I1QA 3D6MA 4IIJF 2HJRA 2WOJA 3HZRA 1EA7A 2PFGA 3G8AA 3A6GA 2CL0X 4EUNA 4C4SA 2UDPA 4DCOA 1U7PA 4Z4QA 4PWYA 1RRCA 1BGXT 2WI8A 3BD6A 4O02B 4E2XA 4MNTA 3TQTA 5MN5A 3HY6A 4CU5A 1RVDA 4TKLA 4PAWA 1O0BA 3SHOA 5BT8A 4D97A 4F2HA 4FFNA 1JHZA 3FTPA 3KVNA 1SVNA 1TZJA 2YBEA 4Q9HA 5DRTA 2I22A 1DFHA 1BA3A 2BC9A 1N7JA 4NJEB 1D03A 2H4HA 4K9QA 3GP3A 4G37A 2IQ5A 4EF5A 1J06A 1GPJA 2O2CA 4X95A 4XQ9A 4EVQA 2A88A 1NKVA 5B6PA 4UM9B 3OU2A 5IC5A 4OUDB 3S5JA 3M6MD 2VF4X 3GZ4A 4AG3A 1IUNA 3H8WA 5AKHA 1DO2A 4G5QA 4REOA 4UVHA 3EGVA 3U60B 2H0QA 3ICOA 1DCFA 2CD9A 3OZIA 2PT5A 4R9UC 1GJRA 2VXCA 4TQ9A 4UUQA 1ZU5A 4GU5A 1SY7A 2A5DA 2LTAA 4PFQA 1D2GA 2IU0A 1FYEA 1V8FA 1KRXA 1Q1ZA 4ND6A 2LBPA 5CJPA 2MINA 4UXIA 4IUCS 2PH7A 4TMXA 2EBFX 4XASA 3V3TA 2VN8A 3F1KA 3NTXA 2I67A 2LZ0A 1A27A 4B6GA 3KPVA 2ZANA 4LYDA 1NZFA 1WF6A 3B6JA 1YULA 2ZJ4A 4N5MA 1ZMTA 5EFZA 2OY0A 3QYJA 2P6PA 2DBVO 2C3OA 3BIFA 5KINB 1A9YA 1U5CA 4ZC1A 2HDOA 1C50A 4KQWA 1PVOA 1FXSA 2J45A 1T1EA 3DUWA 1DB3A 3NDIA 1MN6A 1TUBB 2PKEA 2Z5FA 3F73A 1A9RA 1ND5A 2PU5A 3FFTA 1HLDA 1MJGM 1RYNA 1XD2A 3DOFA 1IY2A 2YOHA 3G1UA 3HV2A 2F3PA 3KYBA 4JB3A 4NZPA 3BJEA 5KYWA 2GAFA 2B5WA 2H1FA 3BA6A 3H1GA 5JTUA 4AW9A 2AQIA 2YWBA 3HJTA 3JZIA 3DV0B 4J7XA 1UMBA 5KBYA 3ONNA 1E4VA 2PHZA 3PJFA 3FWZA 3K1AB 4L5JA 4R2IA 1C1XA 1D07A 2H9YA 2Q3DA 2NT3A 3IDQA 4JCCA 4PSDA 3DZCA 1HMYA 3MT0A 4BAZA 3R7DA 3OMXA 4CEIA 3D5TA 3HPRA 1GG8A 4KGZA 3REFA 3T95A 5C7LO 3ZLBA 4G5GA 4RORA 2EJUA 4NWIA 4LCEA 2Z4TA 3PDJA 1N2ZA 3HCEA 1YFZA 3A6KA 3IODA 3MAJA 3LZDA 4LHYA 5G53C 2VQEB 4LF4B 3DG9A 2C4UA 4B3JA 3BOSA 2X5XA 4UHFA 3R7NA 1GGMA 1D0IA 2I4RA 4Z0PA 1EZ4A 1TGYA 2NQ8A 3TTTA 5C9ZA 2B4RO 2HWYA 3HUFA 1Q95A 1PD1A 1MTOA 4ZEVA 3AR5A 1W0KD 1CG6A 3EVBA 4P82A 5F3DA 1XVLA 3UGJA 2ZPTX 4UMEA 5H8WA 3PPWA 3KHSA 2AG1A 4M9SA 4D9KA 1HDCA 1BE1A 1NNI1 1FX0B 2FPLA 3RVQA 1G3IA 2EW1A 2RC5A 1N5KA 1DEAA 3LNTA 3DEHA 1SOVA 4E08A 1IXZA 4Z0TA 4TS3A 2PANA 4XWAA 1PR9A 3FSJX 4U7DA 1GZVA 1R0CA 3I1FA 3H5WA 1WQ4A 4IWXA 4OSEA 5IDVA 3T5TA 3T3IA 1GRVA 3VU1A 1TAQA 1BMQA 4IXTA 4WCFA 4Q4CA 221PA 4U7JA 3ZGXA 1O9HA 2EL7A 1G3UA 1Z16A 1EE2A 3DOEA 1VHWA 3ADKA 1MLDA 3EGOA 4QPZA 2V5VA 3VJMA 2JGDA 3WLNA 3EGEA 3EXEA 4QU5A 2PYDA 1JDBB 3ISTA 1MB3A 4C6TB 2CV1A 4FFOA 2WA1A 2JVIA 3MHPA 4YGXB 1R6AA 4PHGA 5DWVA 4WN9A 4LY3A 4DQ0A 3ZDAA 3JYHA 3TLGA 1ULUA 1F6DA 1FQKA 2E89A 1KJIA 3KB6A 4H6PA 2ZLBA 2ZYRA 4L07A 2GD0A 5GM2A 5LXTF 1T0IA 2YC2C 2ECFA 1H2FA 3EG9A 1G8FA 2XUOA 5DK6A 2PIAA 1KKMA 3D0OA 2ECPA 1YJ8A 1OJLA 2W93A 3VFDA 2P5TB 4E33A 4HPWA 3DXZA 3D8RA 4HPJB 1QO0D 2ZE5A 4IRMA 4L4RA 4L2IA 4KUHA 3WLTA 2QZ4A 2V4MA 5JATA 2GN2A 5HMMA 1Z06A 5CLGA 4IUDS 4LYGA 5G0SA 4D9GA 1VJ1A 3OT4A 1DUIA 3UANA 1IXSB 1H0RA 4JIMA 5AO9A 4WERA 2QY6A 3N1UA 3RU7A 1W6RA 3R4CA 2CBZA 2FMXA 5CLQA 3TQFA 5EWJB 1TVKA 2PYZA 2YXPX 4KLNA 2B37A 3KZVA 3VR6D 3E1GA 2MMGA 3D3KA 4QQNA 1I14A 1CS0B 1LY1A 3LH5A 3NW9A 4G3XA 1I7NA 3NUZA 1J1UA 2ORIA 4C2AA 4O2AA 4XJSA 2WAYA 3CTMA 3C8DA 2CXHA 1P2DA 4FHDA 3TTUA 2YXDA 1X74A 4DCMA 2B1IA 3KEGA 1SUCA 4FZVA 1S4QA 3SC2B 4DOMA 1ESDA 4CM4B 3CW8X 3JQ6A 5FR2A 4H77A 1YRBA 3KXDA 4HX2A 1XUOA 5IKXA 2E5LB 3NVMB 4S1NA 2F8LA 4TLDA 3WNVA 1MB4A 4Z99A 2FZCA 2YZGA 4C6SA 5L95A 1EAYA 4M0EA 5LMCA 3K9LA 2QN3A 4HDKA 2ZVDA 5KOHB 1U81A 3NATA 4P9NA 1ZUNB 2AJCA 1KIFA 2I3BA 2QLJA 2RKWA 3AU9A 3HSKA 4QE3A 2ZQYA 4AJJA 5JNTA 2R00C 4CI0B 3LZ6A 4LK3A 4HTFA 1BOOA 1EVZA 2BI4A 1Y89A 3K9NA 3NM5A 3WNBA 5MF6A 1ENPA 3TDKA 1G2OA 3WNCA 1RRPA 3TFWA 3VKUA 2VIIA 3Q6MA 5CVDA 3V42A 4BQQA 2J4DA 5EJ4A 3CX7A 2C2ZA 4TKUB 3C5WP 1E9RA 2VWPA 3CPEA 1GLVA 3DE7X 1C81A 1OIVA 4HH4A 4W1SA 3QLVA 2KYRA 3GG9A 2ZI4A 3E3OA 3HB1A 5CA0A 2H4XA 3BIWA 1I7QB 1RP1A 1Y9DA 2IYZA 2ZS8A 1DIBA 3EIQA 3I3SR 3L0CA 2B78A 3SBEA 3HH8A 3E9CA 5IXYA 3L4KA 4N41A 1RQNA 3SYMA 4BNJA 3OCXA 5CBKA 4A7PA 3GFFA 5CB4B 2FQQA 2J30A 3LPDA 1T4BA 4KQ9A 3THXB 3COPA 3IESA 3FLMA 3MF4A 3GVCA 2XE7A 1ORRA 1XSEA 3FRHA 4P3XA 4Q1VA 4R8MA 5GGYA 4EI7A 1OMOA 2O7SA 3HA3A 2PAAA 5AK3A 1IM8A 1DCMA 4TL8A 3WDMA 3AKZA 2PRSA 1Y9AA 2PT7A 1O1YA 4CLDA 5BR8B 1SCUB 5U4XA 3RC9A 3TBHA 2DX7A 1MA3A 3BGOS 3MQ2A 5FWXB 3ESCA 1JKXA 3GELA 3IPYA 4AY2A 5BT9A 3QEJA 5L3VA 1T0UA 4DUPA 2GRAA 3H9JA 2I6SA 2JIQA 4MRNA 3KQNA 3IT0A 1L9XA 4LI3X 3E18A 2JL1A 3LUFA 1TEVA 3A9RA 2YQ5A 4WUTA 3AVUA 1LTHR 1QO9A 3JQ7B 1Z22A 4HG2A 1L4FA 1OA1A 3UOGA 4DUZB 2QUJA 1EWKA 3T99A 1KVQA 1TQHA 4FDLA 2OD9A 3TFOA 1KZGB 1DCKA 5ECDA 1L4BA 2OQ2A 2FW0A 3MJFA 2OK8A 1PQWA 1T8YA 2PX5A 2YN4A 3C3YA 3EDYA 2YV1A 3N7UA 4OY3A 3RODA 1CIPA 4L72A 2VHQA 3MT8A 1FEZA 5EE0A 1X1BA 4RULA 5CLFA 4Q7LA 5CLLA 5IJ9A 2G82A 5BUZA 1IRIA 2YASA 5EKDA 4BO2A 4QTXA 4R8SA 3HGTA 3HEAA 1ZEJA 4FUTA 4IDFA 4PLGA 2DM6A 4Q6WA 1FRZA 1V8OA 4YQFA 2NMVA 3PDHA 3TZCA 3HVJA 3PHGA 4AJ1A 1SQ6A 3C6KA 4LRYA 4JXKA 5D1HA 3ETCA 4MH0R 4WE3A 4AURA 3LQQA 3EEBA 1WCIB 3GJZA 4RE5A 4GR5A 3D02A 5BRAA 4ETIA 2MINB 4ARSA 5LA6F 5KKAA 1UM9A 1NQVA 3M4ZA 4ZU3A 3RLIA 1KQOA 4OQNA 2FSVA 3ZGVA 4CCAA 4L8FA 2ZVJA 4B6OA 1KETA 3FOBA 5K7SA 1VL6A 4I1SA 4IF4A 1UBHS 2GGSA 3BE6A 4P98A 5A6SB 1F2TB 1GNPA 1OXVA 1CEQA 3FMFA 2ZCUA 4IIVA 1ONSA 4INJA 3HHEA 1AF7A 1JDJA 3LC1O 4DB4A 2Q2VA 1ADJA 4YC7A 2JFZA 4FYIA 4GNKA 4MV1A 5TQ2A 4Q6BA 4CFSA 4LWZA 2VNSA 3AXTA 4BP1A 3M1AA 4MPJA 3FPEA 1KJQA 2PZMA 4XA8A 3HYSA 2F43A 3Q1KA 1N7IA 2WYHA 1YQQA 3Q6IA 3VZRA 4AXBA 1L5WA 1PQUA 4HNUA 3LOPA 3GRVA 4QBTA 3DZDA 4NAVA 5E38A 1FFSA 5IEBA 2M6SA 5ELMA 4FYWA 2B3DA 3K0BA 4YXWA 4BFCA 2D4AA 3TOXA 3T61A 4OQEA 1BZYA 4FW8A 1NC1A 3GRFA 5H3LA 1F4VA 1XTSA 3ITEA 1VM6A 4XIYA 1YCGA 3L8FA 4YDRA 4NNOA 4KO4S 1VKNA 2NV6A 2LPMA 2KLBA 1E79D 1DTWA 2OVFA 1K6XA 4PSAA 3QFRA 1NVMB 2YVAA 1SUBA 2ONCA 3BC1A 4ZARA 1ZVJA 5GMOA 2VBGA 4IJKA 1FYWA 2A1TS 3H2JA 3NO4A 1UZLA 1P72A 1YE8A 4BLOA 5MN4A 4G0QA 2B9EA 2JATA 2X0JA 4OBEA 3ZC3A 4TMFA 1EJ2A 2LNDA 3ZDZB 2I6UA 3AY3A 4CI9A 3IOEA 5J2UB 3UQYS 4PRLA 1VJ0A 3N2GA 4FR0A 5IVIA 3B6KA 2Y9MB 1L7NA 5DF1A 5GP1A 1YS9A 2B0JA 1LX6A 3OZVA 2R85A 4YCMA 1Z56C 1JIKA 2C5EA 2P7HA 4KE7A 3T1YB 4AT1A 2JF0A 1W5BA 1V35A 2RBGA 3ABOB 4PYIA 3AP3A 3NDJA 3MWDA 3O93A 4MVJA 1MC8A 4BU1A 2A9VA 2X9NA 4ED9A 3VPXA 4C7JA 3RD5A 1J97A 1Z4OA 1L4HA 4N3CA 4UREA 1CYDA 4YLEA 2V6FA 2B30A 1FYVA 2JD0A 2OBYA 4BFUA 2QTZA 2XUQA 4IW3B 4RC9A 4P0QB 4L4ZA 4NK4A 3R7SA 4KJZA 1U9IA 4YJGB 4CKZA 1EFPB 1LX7A 1P80A 4Z0HO 3GBPA 1Z6XA 1ZJ5A 1H6DA 2VQSA 1EWQA 1QM5A 4HLNA 5TT1A 1L8AA 4WK4B 2PVSA 2L19A 4H1UA 2CNKA 4KPUA 5DTEA 1XP5A 3RYIB 4FCTA 4P0TA 4U02A 2ZIZA 4RU1A 1R0XA 3OQMA 1EAMA 1XMQB 1WVMA 2NUPB 3IV9A 1UPBA 4Y1RB 4E2WA 5EUQB 3VBEA 3BX1A 2AF4C 3EGXB 1XPOA 4JBNA 4ENSA 3R3ZA 4IVQA 4QPNA 4F6CA 5LQDA 3BE5A 3CGWA 3QLUC 2WFZA 1YB6A 1K1EA 1XCBA 3MCVA 1GCIA 1LS6A 1U9ZA 3DH0A 4NU6A 4RFVA 4WN3A 2FXIA 5LBIA 3ZG6A 1LWOA 3GJ3A 1G1AA 1NT4A 3QKSB 3UMFA 1YNOA 4RESA 2A3NA 4A27A 5ARDA 1Z0FA 2ZU0C 1LJ8A 3DL0A 5FR1A 4BBPA 4MW2A 1XTRA 3AUXA 3GHYA 3CBQA 1UJ5A 5TARA 5DX8A 3BWBA 4MIOA 3MD0A 4EK9A 5CH5A 1RAHA 1UH5A 1WHTB 1JEYA 1LLUA 4M8NE 4CRWB 2DFLA 3DEZA 3OTGA 5IZCC 2FPOA 1IULA 4I8DA 4IPTA 4QDJA 1F1BA 4AZTA 1UOEA 3FFAA 5JS7A 2CXXA 2R8ZA 3GJSA 1RWKA 1S01A 4MVWA 3IJ5A 4BO4A 2JLXA 2AF3C 5CA1A 2O2JA 1NU8A 2YWHA 3GUHA 3R6TA 3WVNA 2VP0A 1KFJB 4D81A 2WNIA 4L8LA 1T2FA 4H3HB 2FLVA 1DARA 2JHGA 4EB6B 2YQ4A 2O2IA 1X9IA 3RJZA 1TJYA 1WCXA 1NT2A 4Z51A 5K01A 3V1NA 5BMOA 2W2PA 3FYUC 4PG6A 1LNSA 1JT9A 5GJCA 4UAGA 2IYYA 1XRNA 3PNKA 3MWDB 1JBEA 3CUYA 3KK0A 1I2MA 4G5YA 3LQFA 4KR9A 1F1JA 1KRWA 1RQXA 2OD2A 2YHIB 1JG7A 3GG2A 1WPXA 1ESEA 3HNOA 5D5PA 3RKSA 5AKKA 1CQJB 3PFWO 3PXGA 4BN0A 1P5FA 1VHTA 2YRXA 3P9QA 3W9YA 3ZXYA 3N2GB 3JYLA 4JNKA 3KKZA 4XDGA 4D4LA 4LGCA 1SEPA 4F97A 3DMHA 1B7GO 2DP4E 4RY2A 4HNGA 2NZXA 1D3AA 1KMMA 1Y8CA 2VSNA 3E7PA 4PLCA 4Q3KA 4CW7A 4OJYA 2FFAA 1OAOA 3WAKA 3U31A 4DV0B 3C98A 3M7IA 3OWXA 3D31A 4B40A 10MHA 1FP2A 3CURA 4LSZA 2A1IA 4RIEA 1AG9A 1UMCB 3N0XA 5FTLA 1YGYA 3M8KA 1PFVA 3P45A 4EJFA 2VHCA 9LDBA 2EKDA 1SN7A 5T4EA 2LWIA 4I1IA 1KZHA 1O9BA 3X1XA 1C3EA 5JOQA 2XUPA 3RLFA 1ZBQA 3OHSX 4UD6A 3OO0A 3VX3A 1U0SY 4MUJA 1NG1A 3V7UA 2Y92A 1N2SA 2EGHA 1VBMA 4RPIA 3FFXA 3SI7A 4DLYA 3K6RA 4JL8A 3JQPA 2BMJA 2IY7A 1GXSA 1DX9A 2QTWB 1U1IA 4V3CA 2P67A 1L8XA 4RANA 2BY4A 2NTVA 5A02A 3KWFA 1W76A 1UKZA 3FZYA 4HH0A 4NCAA 2WAAA 1P1FA 3D3QA 1LVGA 2FX5A 4FDAA 4MCHA 2Q49A 1UDAA 5AESA 3Q7TA 3M83A 5KU1A 4E30A 2EFYA 2XNHA 4CIDA 3U7JA 3TW6A 6AT1A 3GLFB 5AW6A 2A9JA 3IMGA 1G64A 1T3TA 3DEFA 3NBAA 4N0MA 4W5WA 5CYFA 3VDMA 3W6OA 1G38A 3HVRA 2H1CA 1DBWA 3AG6A 4GZMA 2QM7A 4Y1GA 4F3YA 1QGAA 2PUJA 1TMOA 1KOJA 2J48A 1KZ1A 4F8JA 1PX0A 9LDTA 4HSGA 1OLXA 4B1FA 3OURA 4JBLA 2PFSA 1DDGA 2EGGA 4CQMD 3A1EA 2XCQA 4N49A 3CO5A 5I4IA 1J20A 3FPSA 3GBVA 3LNCA 3OM9A 3GW8A 2DU8A 4L75A 2IPNA 2CYCA 4TS9A 1ANKA 2HK6A 3WGVA 3K70D 1M0EA 2IIQA 2QRKA 1Q74A 1Z6GA 1DKUA 1AKVA 3N2NA 3EIOA 1OV6A 4JBIA 3AI1A 2WJIA 2Y1KA 2D59A 3P2YA 2PWPA 1VYHA 4P4SA 4QUBA 4RA9A 5TSDA 3WWYA 4HVCA 2K4MA 1AK9A 4FLMA 4JXZA 4X9XA 3USZA 3IAEA 5CJJA 5JZVA 4CKCA 3ZZNA 5KDLA 3TOSA 2E5WA 4OTZA 1A8SA 1NVVQ 1TW3A 3IVGA 3IUNA 3NALA 1J0BA 5EOVA 3RRXA 4CKEA 4HVLA 121PA 1GCAA 2HSDA 3HBJA 2FSIA 2HBQA 3M89A 4TYYA 4UKDA 1QGED 1T1IA 3L7CA 4MVXA 3N28A 1NG9A 5AM4A 5EP4A 5LQRA 1GP2A 1O7JA 2IY8A 3QF4B 2UYYA 4QRHA 2Y3IA 3I05A 3DUFB 3JTEA 1SUWA 1BU5A 2GM3A 1Z0SA 3NEAA 3Q0EA 5KX5A 1JBKA 4MDFA 1P9OA 2XI4A 1R0YA 5CG1A 3QKWA 1R27A 2AI2A 4U7PB 3MWJA 3Q9NA 2HA2A 3N74A 4D3YA 2XPCA 2H57A 1BKSB 4QO7A 1W1IA 2WV9A 1Y5MA 3GJ7A 4IVPA 4D2IA 2B34A 5H4GA 4L22A 4YYEA 1Z34A 2MYTA 4BMYA 3KUCA 3UO8B 4YPFA 4D4JA 4IOLA 4HDCA 1NLZA 2GZHA 2FMKA 4WK0B 5ALNA 4IZ6A 4ZV9A 3ZWVA 2R1UA 3U09A 5KQPA 3OP1A 5K0TA 2I8AA 4M38A 3T7AA 4GM4A 3AVYA 4NULA 2DTDA 2QU7A 1ATZA 2QTBA 2YNMA 4B7ZA 3KFLA 1TNDA 3G2OA 4XOIA 5DISB 2OXTA 3VZPA 1KEUA 1Z4QA 1WAMA 2FG5A 4MR8A 1FL9A 1NWHA 5AM2A 1LNZA 3I3OA 4JLSA 3V4VB 3GVIA 4EWLA 5EJ6A 2AH5A 4YV7A 1BW9A 4QHYA 2PQ2A 1D1QA 1HT1E 1LPAB 4ZCMA 3GLHA 1P4HA 3RS9A 4BGIA 5JFOA 2EDAA 3ZHTA 2WB4A 4KRXA 4LJ4A 2B98A 1NUTA 1ZITA 2ZSUA 4H0CA 2X13A 2PWZA 3EA0A 1PUIA 1W0JD 3O83A 3MWYW 2DWUA 4KLCA 3TZLA 5JBNA 4DLPA 5K8CA 4YJGA 3LCCA 2IOQA 3JWPA 2J9GA 3D6HA 5BYJA 1ZYUA 4EGCB 3WK5A 2QRHA 3KVVA 1C1XB 3CX4A 3PNBA 1NMYA 4N12A 4TLCA 4EP1A 1X1CA 3HY4A 4I9NA 4RVHA 1W581 5F5LA 2IEAA 3T9FA 2WJHA 4R41A 2EP7A 3DNFA 3FHTA 3M1YA 2EDCA 3CZRA 3ZW8A 3DZKA 1ZOPA 3H18A 4HDNB 4RDHA 3U6BA 4ZQIA 3AUKA 3EWIA 4Y6GB 3VR2D 3A9SA 4HYTA 3JRNA 4RZIA 3ZU6A 2WWFA 1KMQA 1TM2A 3IQDB 1CUJA 2PZFA 3M4NA 3EWAA 3RFUA 3QE9Y 1Y1RA 2W4QA 4IJ5A 2B8EA 1QVRA 5JISA 4RYDA 5H0IA 1DZIA 1XQ1A 2GLXA 1MX9A 5DN9A 3S2SA 4UARA 1NR7A 1F3LA 2H4YA 5BYKA 3SAJA 4DR4B 2Y66A 4MRMA 4TZTA 3UTCA 5GVSA 4ZKDA 3DV9A 3CISA 2AN5A 5H7XA 3L84A 1B0ZA 2PD6A 2ZPUA 3D3JA 4NAUA 4F96A 4PNEA 1YIAA 1W47A 1ZQ9A 1GFIA 3GAMA 1F0KA 1TOAA 1E1LA 1HOTA 1PLJA 5FQOA 1NRIA 4JT4A 3EG9B 1F48A 4TYMA 5JHHB 2V3VA 4LCJA 5G0UA 4B84A 2C8JA 4M0DA 4DUYB 2I2DA 3ODGA 3HCAA 3B7PA 2RHHA 3EAFA 1YGPA 1HZZC 3LBHA 4O33A 3UH1A 3MWKA 3JVVA 1JR3D 4LXIA 4LVOA 3G1WA 4MR9B 4O0MA 4WN9B 2FZLA 1PNQA 1TLLA 4BTEA 4CLRA 5DSXA 2GEUA 1KE2A 1NDQA 2OO5A 3GMDA 5KTOA 1DAMA 4QREA 1FP6A 3OPNA 5FLKA 3VOAA 1PJAA 3IPLA 3QVWA 4KN5A 1GR1A 1E77A 2EEPA 3CH4B 4BNHA 1XMSA 2ESRA 4RIGA 4XVHA 3QSYA 1K0FA 2Z43A 1UIMA 3BMNB 3I5YA 1ETUA 5FULA 1HE8B 2PKRA 3NC0C 2BKEA 1XL1A 2J3HA 1Z3IX 3UPTA 3WMRA 4IIFA 2AQ8A 1M6WA 4PW0A 3VDNB 4DCPA 3CU5A 5BV0A 4RF4A 3UG6A 2GCNA 4RPCA 1VG1A 4LI0A 1NN3A 3NDBB 1HEUA 5EJ2A 2W71A 2XSZA 2R84A 2XSZD 4URZR 1OX4B 1U7XA 2PL9A 2PGDA 3L7NA 1E3EA 5DHTA 4EHLA 5HXAA 1KWGA 1P33A 1I7DA 2VRNA 2EFCB 1HQYE 2A67A 3QXSA 5EGSA 2N9UA 5LMUB 5HDQA 3ORRA 2AFHA 5L9AA 1DEKA 1EE1A 3ESDA 3HVHA 1I8TA 1P7CA 4CGYA 5AJUA 1SC4A 4XYEA 2D5CA 2ON6A 2DQKA 3I9JA 5GTDA 5IWCA 3G0OA 3NC1C 3KKQA 1WDMA 2D0PB 4NOJA 4RMGA 2XMCA 2G06A 4Q47A 3BCRA 4C5AA 3UBTA 3SZGA 1ZJZA 3FJYA 1XU7A 1IM5A 1LGYA 3T9AA 4DA7A 5IH7A 1XJCA 1BCSA 4Z49A 2RHDA 3ZYZA 3AR9A 3LUJA 2HUPA 4B48A 5KMGA 2V0NA 5EWLA 4XRGA 3EY9A 5K2OA 1A71A 1N5JA 4UM8B 1MJNA 3R44A 2WLTA 3W3AH 2G9UA 3C4JA 5CFMA 1L8LA 3QENA 3UKDA 4CM7A 1DC8A 3JQEA 4KI7A 3TF5A 4L5YA 1BDHA 2JLBA 1J7JA 1E5XA 1TGVA 1VCMA 1G98A 2WKRA 1GTL1 2H3EA 3VNQA 3ZHCA 4P3OA 7AT1A 2M98A 3OQIA 1U7UA 4HDQB 4UHEA 3EE6A 5DCLA 1AOXA 3T5CA 5MFZA 3HWX1 4G4GA 5AI8A 4M6WA 2H9IA 2OBBA 3E3NA 3TNYA 3O8OA 5DNAA 3LBAA 1XC7A 3VVMA 1OAAA 2VJLA 4PIVA 1K7XB 2NG1A 5CD9A 2R0QC 2ZYTX 5GZ3A 1IXRC 1AS2A 1DJLA 1G5FA 1H1LB 2HLDD 3H42B 3QY0A 7REQB 5LZ2A 1AD2A 3KQVA 4AS1A 2JJ2D 3NHZA 2PZJA 1TUBA 5KOJB 2E4UA 3JRWA 4JWKA 3UA3A 4DSUA 1U3CA 5CIQA 4FHCA 3CEPB 4EPXA 3MRVA 1K63A 3AEUB 2ZJZA 3C15C 4ALJA 1AHNA 4GP6A 3COZA 4PZUA 3PFHA 3QUCA 3LE8A 1P3DA 5I8PA 1ZJWA 4KTVE 3S68A 1T8PA 1XQXA 4NATA 4TS4A 2WU4A 1M73E 4TGLA 4FT2A 3ONWA 1XXLA 4QU9A 5JS1A 3KAQA 2BPOA 2JGNA 2LD4A 3M9XA 2D1RA 4KYUA 2F3TA 3A9UA 4S35A 4KHPB 2OBXA 1BH2A 3FE2A 4RDCA 2JBHA 3WYFA 4I4TB 3ZHBA 4IICA 5FWAA 5I4CA 2ZE6A 2PKYX 3HKBA 4BP3A 1TTQB 2QJTA 2QUKA 1T1SA 4K9KA 4WTOA 1XZPA 3R0ZA 2GXSA 1T26A 3C45A 1KO5A 5AVKA 2R4TA 1XDWA 1FNBA 4QDKA 4XIGS 4Y1EA 2C3UA 1J9ZA 5HK8A 2JLWA 4PANA 1JFTA 3AY7A 3GQBA 3V2UA 2Q5QA 3R77A 4AMUA 4I4LA 1CJUC 4U3JA 3MRXA 2C1XA 4ZOLA 3T1VA 1FK8A 4Z7QB 4LF5B 4E5NA 3LHKA 5BMVB 2Q5OA 3H5TA 4CIAA 4C4TA 4IZHA 2C95A 2BF7A 1K08A 4C4AA 4GZ3A 2C4TA 2PMFA 2XA2A 2V7QA 3ZJYA 4B2LA 4AX4A 5JV5A 4RY0A 2IP2A 3USCS 1W25A 3FPAA 1J0XO 1K27A 1O94D 1Z2NX 5B3LA 3PLAE 3E15A 4KAXA 1TZKA 1JQDA 1IONA 1KMHB 5JAPA 2O0LA 1A5SB 4P4SB 4ZI7B 4DA9A 2GAJA 2ZTSA 2VOEA 2DPGA 4ESHA 4ZGGA 5SYAA 1E6EA 1SOMA 2JEZA 3CN7A 2ST1A 3FPHA 3NKLA 4X6YA 5AM5A 5LR6A 1ZZEA 3G2MA 3GJ6A 2QE7D 4R6WA 5LVAA 4AYTA 2BFBA 3KZXA 3OLZA 3FVVA 1XLVA 3BT7A 1ZK1A 2YN0A 3VVBA 4PGMA 1PLLA 3D4IA 1GPH1 2ZB8A 4JC8A 3TLAA 3QYAA 5HCIA 5IJ9B 4EI2A 2QAGA 4TX1A 5HUJA 2EF1A 4ENRA 2DFDA 3EQZA 1BIFA 2IKQA 2CJYA 4M3NA 3EA5A 3IQFA 2QX7A 2C3PA 2OOSA 3JZMA 3KFXA 4HFNA 1FFAA 3AL0C 2NYAA 5D51S 4QAJA 1TU4A 4NFLA 4CM1A 3AR3A 1KDPA 1KZ9A 4KX5A 3EVDA 3TS1A 3B48A 4MYUA 4HWOA 1VECA 1TK9A 1MX5A 1XEAA 1Z2EA 2VYCA 3VOTA 1E7QA 2Q2WA 2CHUA 1L4KA 2FR0A 2R6CA 1EZ1A 4FS3A 4OB6A 4RUKA 5AVOA 5ITZA 5A5GA 5DT2A 3D7RA 1NF8A 2DKFA 2YVLA 3H9GA 4QD3A 1P2SA 2EWMA 4WMLA 4R1TA 4NECA 1XMPA 1TYZA 6REQB 2QLLA 2ANBA 3EXHC 2F3UA 2R1VA 3I30X 4II7A 4LXGA 4M1KA 1U2SA 3NHUA 5FAKA 4MKIA 5LP1A 4J3NA 2C5GA 2XW6A 2VP2A 2IH2A 2B4TO 4RM2A 4ZVVA 4A9AA 1KARA 3TRDA 4JJ4A 2N0SA 3PFNA 1QHYA 1XEXB 4BYGA 4EY5A 2HYIC 4K6KA 1VSTA 1RJEA 1FS4A 2HO4A 3H2HA 4LNHA 5IPFA 2ZCVA 1YDMA 2QYTA 2C1ZA 4FEGA 4DSOA 3H6KA 2BN4A 3OZFA 1NXQA 1I1OA 2BGLA 3DDCA 3FM9A 3LCRA 1CNEA 2RGGA 2VJMA 1VIAA 3U1BA 4EY3A 4DSTA 1CJTC 1XQWA 1DL5A 1GQRA 2XUDA 1QDUA 3C8ZA 3PCTA 2VRWA 1R6DA 2COKA 2Y99A 2GR9A 3OOJA 4MJ7A 3QUQA 4EJSC 4ZVUA 3S4YA 5IKEA 2PMDA 3ZZ1A 2VXOA 1QKJA 3KJQA 3RO7A 4YO8A 5ALTA 3UC9A 1IPHA 3LPAA 2O14A 1E79A 2JCXA 1A4UA 1Q0PA 3EVTA 1ZSYA 4FGWA 4RXMA 3CVXA 3KC2A 4DM4A 4RBNA 3LIIA 4ZIRA 3DL7A 3LKBA 1ZD9A 3C4QA 2PUGA 2NPFA 1R10A 3LP8A 3QOWA 3HRIA 5ALQA 5CCDA 3AKEA 1VB5A 4M9XA 4A8JA 2IEYA 5F1KA 2G04A 3QQPA 2RI0A 2Y4OA 4YAUA 1AQYA 3HA2A 3PHJA 2Z5LA 1GAXA 3KSDO 1NNLA 1UR5A 3KIPA 3NANA <