3HB8A

Structures of thymidylate synthase r163k with substrates and inhibitors show subunit asymmetry
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
PPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQKVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human thymidylate synthase R163K with dUMP, FdUMP and glutathione show asymmetric ligand binding.
pubmed doi rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Homo sapiens
total genus 92
structure length 281
sequence length 281
chains with identical sequence B, C, D, E
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3hb8A00
3BHLA 1DNAA 3DGAC 4KPWA 1LCEA 1BIDA 4H1IA 1BP6A 3EBUA 1BQ2A 1AIQA 2G89A 4EB4A 1BPJA 2RD8A 4UP1A 4O7UA 1TDAA 3N5EB 1KCEA 4PSGA 1JMGA 3CLBA 1NJEA 1TSMA 3IRMA 1F4EA 4IQBA 1RTSA 1F28A 1TSDA 2H2QA 3EAWX 2TDDA 4EZ8A 1TSVA 1TSWA 3NRRA 4H0UA 1AOBA 1JUJA 1AXWA 5H39A 3ED7A 2G8AA 3BFIA 4KY8A 1KZJA 1VZDA 1F4DA 1FFLA 4G2OX 1EVGA 3IX6A 1J3JC 2TSCA 1HW4A 1TJSA 2RDAA 4G6WX 1BQ1A 3N5EA 1NJCA 4XSDA 2FTNA 4Q0DA 1TVWA 1BKOA 1BSFA 5HS3A 1BJGA 1TDUA 1ZPRA 3EGYX 3HBBA 4FOGA 3INVA 1EV8A 1JMHA 4ECKA 1QZFA 2A9WA 1LCAA 1FWMA 3EF9A 1YPVA 2G8XA 1DDUA 3EJLA 1AJMA 4O1XD 4KNZA 3H9KA 1JMIA 4GEVA 1TSZA 4EINA 3C0AA 1HW3A 4F2VA 1B5DA 3UM8A 3B5BA 3BHRA 1BO7A 2TDMA 1NJDA 1F4GA 4ISWA 3IHIA 4LRRA 1AN5A 3DG8C 3QG2A 4TMSA 1CI7A 4IQQA 1HZWA 4JEFA 1B49A 3V8HA 1JMFA 2G86A 4EILA 1NCEA 3QGTA 3GH0A 4DP3A 1TRGA 1TVVA 4FGTA 4FOXA 3UM5A 1TSLA 4O1UA 2KCEA 2AAZA 3EDWX 5FCTA 3BGXA 2VETA 1TISA 1TYSA 1I00A 2OIPA 1VZCA 1F4CA 1SYNA 3QJ7A 1BO8A 1JG0A 2FTQA 3OB7A 4KYAA 4E5OA 3BYXA 3IK0A 3BNZA 3B9HA 4H0RA 1BDUA 5H38A 1JTQA 3DL5A 4E28A 3JSUA 1TLSA 3BZ0A 3DL6A 3GH2X 1KZIA 1THYA 3UWLB 4FOAA 1TVUA 2ONBA 1QQQA 1EV5A 1TSNA 5H3AA 1VZBA 5BY6A 4DPDA 3GG5A 4XSCA 1VZEA 1B5EA 1TDCA 1B02A 1JTUA 3K2HA 3IROA 1LCBA 4GYHA 3CL9A 1J3IC 4Q0EA 2G8DA 2BBQA 4GD7A 1NJAA 1SEJA 3HJ3A 3UM6A 4ISKA 1HVYA 3KJRA 4FQSA 1VZAA 1BKPA 3N5GA 1JU6A 1F4FA 1TSXA 2TSRA 3IK1A 2RD8B 3EHIX 5J7WA 1NJBA 2FTOX 3I3RA 3IRNA 3UWLA 1BP0A 1BSPA 1EVFA 3IJZA 1F4BA 3TMSA 2VF0A 4O1XA 5WRNA 4XSEA 4KY4A 1TLCA 1JUTA 1J3KC 3HB8A 3KJSA 3C06A 4IRRA 1TSYA 4DQ1A 3KGBA 1TDBA 4DPHA
chains in the Genus database with same CATH superfamily
3BHLA 1DNAA 3DGAC 4KPWA 1LCEA 1BIDA 4H1IA 1BP6A 3EBUA 1BQ2A 1AIQA 2G89A 4EB4A 1BPJA 2RD8A 4UP1A 4O7UA 1TDAA 3N5EB 1KCEA 4PSGA 1JMGA 3CLBA 1NJEA 1TSMA 3IRMA 1F4EA 4IQBA 1RTSA 1F28A 1TSDA 2H2QA 3EAWX 2TDDA 4EZ8A 1TSVA 1TSWA 3NRRA 4H0UA 1AOBA 1JUJA 1AXWA 5H39A 3ED7A 2G8AA 3BFIA 4KY8A 1KZJA 1VZDA 1F4DA 1FFLA 4G2OX 1EVGA 3IX6A 1J3JC 2TSCA 1HW4A 1TJSA 2RDAA 4G6WX 1BQ1A 3N5EA 1NJCA 4XSDA 2FTNA 4Q0DA 1TVWA 1BKOA 1BSFA 5HS3A 1BJGA 1TDUA 1ZPRA 3EGYX 3HBBA 4FOGA 3INVA 1EV8A 1JMHA 4ECKA 1QZFA 2A9WA 1LCAA 1FWMA 3EF9A 1YPVA 2G8XA 1DDUA 3EJLA 1AJMA 4O1XD 4KNZA 3H9KA 1JMIA 4GEVA 1TSZA 4EINA 3C0AA 1HW3A 4F2VA 1B5DA 3UM8A 3B5BA 3BHRA 1BO7A 2TDMA 1NJDA 1F4GA 4ISWA 3IHIA 4LRRA 1AN5A 3DG8C 3QG2A 4TMSA 1CI7A 4IQQA 1HZWA 4JEFA 1B49A 3V8HA 1JMFA 2G86A 4EILA 1NCEA 3QGTA 3GH0A 4DP3A 1TRGA 1TVVA 4FGTA 4FOXA 3UM5A 1TSLA 4O1UA 2KCEA 2AAZA 3EDWX 5FCTA 3BGXA 2VETA 1TISA 1TYSA 1I00A 2OIPA 1VZCA 1F4CA 1SYNA 3QJ7A 1BO8A 1JG0A 2FTQA 3OB7A 4KYAA 4E5OA 3BYXA 3IK0A 3BNZA 3B9HA 4H0RA 1BDUA 5H38A 1JTQA 3DL5A 4E28A 3JSUA 1TLSA 3BZ0A 3DL6A 3GH2X 1KZIA 1THYA 3UWLB 4FOAA 1TVUA 2ONBA 1QQQA 1EV5A 1TSNA 5H3AA 1VZBA 5BY6A 4DPDA 3GG5A 4XSCA 1VZEA 1B5EA 1TDCA 1B02A 1JTUA 3K2HA 3IROA 1LCBA 4GYHA 3CL9A 1J3IC 4Q0EA 2G8DA 2BBQA 4GD7A 1NJAA 1SEJA 3HJ3A 3UM6A 4ISKA 1HVYA 3KJRA 4FQSA 1VZAA 1BKPA 3N5GA 1JU6A 1F4FA 1TSXA 2TSRA 3IK1A 2RD8B 3EHIX 5J7WA 1NJBA 2FTOX 3I3RA 3IRNA 3UWLA 1BP0A 1BSPA 1EVFA 3IJZA 1F4BA 3TMSA 2VF0A 4O1XA 5WRNA 4XSEA 4KY4A 1TLCA 1JUTA 1J3KC 3HB8A 3KJSA 3C06A 4IRRA 1TSYA 4DQ1A 3KGBA 1TDBA 4DPHA
chains in the Genus database with same CATH topology
3BHLA 1DNAA 3DGAC 4KPWA 1LCEA 1BIDA 4H1IA 1BP6A 3EBUA 1BQ2A 1AIQA 2G89A 4EB4A 1BPJA 2RD8A 4UP1A 4O7UA 1TDAA 3N5EB 1KCEA 4PSGA 1JMGA 3CLBA 1NJEA 1TSMA 3IRMA 1F4EA 4IQBA 1RTSA 1F28A 1TSDA 2H2QA 3EAWX 2TDDA 4EZ8A 1TSVA 1TSWA 3NRRA 4H0UA 1AOBA 1JUJA 1AXWA 5H39A 3ED7A 2G8AA 3BFIA 4KY8A 1KZJA 1VZDA 1F4DA 1FFLA 4G2OX 1EVGA 3IX6A 1J3JC 2TSCA 1HW4A 1TJSA 2RDAA 4G6WX 1BQ1A 3N5EA 1NJCA 4XSDA 2FTNA 4Q0DA 1TVWA 1BKOA 1BSFA 5HS3A 1BJGA 1TDUA 1ZPRA 3EGYX 3HBBA 4FOGA 3INVA 1EV8A 1JMHA 4ECKA 1QZFA 2A9WA 1LCAA 1FWMA 3EF9A 1YPVA 2G8XA 1DDUA 3EJLA 1AJMA 4O1XD 4KNZA 3H9KA 1JMIA 4GEVA 1TSZA 4EINA 3C0AA 1HW3A 4F2VA 1B5DA 3UM8A 3B5BA 3BHRA 1BO7A 2TDMA 1NJDA 1F4GA 4ISWA 3IHIA 4LRRA 1AN5A 3DG8C 3QG2A 4TMSA 1CI7A 4IQQA 1HZWA 4JEFA 1B49A 3V8HA 1JMFA 2G86A 4EILA 1NCEA 3QGTA 3GH0A 4DP3A 1TRGA 1TVVA 4FGTA 4FOXA 3UM5A 1TSLA 4O1UA 2KCEA 2AAZA 3EDWX 5FCTA 3BGXA 2VETA 1TISA 1TYSA 1I00A 2OIPA 1VZCA 1F4CA 1SYNA 3QJ7A 1BO8A 1JG0A 2FTQA 3OB7A 4KYAA 4E5OA 3BYXA 3IK0A 3BNZA 3B9HA 4H0RA 1BDUA 5H38A 1JTQA 3DL5A 4E28A 3JSUA 1TLSA 3BZ0A 3DL6A 3GH2X 1KZIA 1THYA 3UWLB 4FOAA 1TVUA 2ONBA 1QQQA 1EV5A 1TSNA 5H3AA 1VZBA 5BY6A 4DPDA 3GG5A 4XSCA 1VZEA 1B5EA 1TDCA 1B02A 1JTUA 3K2HA 3IROA 1LCBA 4GYHA 3CL9A 1J3IC 4Q0EA 2G8DA 2BBQA 4GD7A 1NJAA 1SEJA 3HJ3A 3UM6A 4ISKA 1HVYA 3KJRA 4FQSA 1VZAA 1BKPA 3N5GA 1JU6A 1F4FA 1TSXA 2TSRA 3IK1A 2RD8B 3EHIX 5J7WA 1NJBA 2FTOX 3I3RA 3IRNA 3UWLA 1BP0A 1BSPA 1EVFA 3IJZA 1F4BA 3TMSA 2VF0A 4O1XA 5WRNA 4XSEA 4KY4A 1TLCA 1JUTA 1J3KC 3HB8A 3KJSA 3C06A 4IRRA 1TSYA 4DQ1A 3KGBA 1TDBA 4DPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHL A;  1DNA A;  3DGA C;  4KPW A;  1LCE A;  1BID A;  4H1I A;  1BP6 A;  3EBU A;  1BQ2 A;  1AIQ A;  2G89 A;  4EB4 A;  1BPJ A;  2RD8 A;  4UP1 A;  4O7U A;  1TDA A;  3N5E B;  1KCE A;  4PSG A;  1JMG A;  3CLB A;  1NJE A;  1TSM A;  3IRM A;  1F4E A;  4IQB A;  1RTS A;  1F28 A;  1TSD A;  2H2Q A;  3EAW X;  2TDD A;  4EZ8 A;  1TSV A;  1TSW A;  3NRR A;  4H0U A;  1AOB A;  1JUJ A;  1AXW A;  5H39 A;  3ED7 A;  2G8A A;  3BFI A;  4KY8 A;  1KZJ A;  1VZD A;  1F4D A;  1FFL A;  4G2O X;  1EVG A;  3IX6 A;  1J3J C;  2TSC A;  1HW4 A;  1TJS A;  2RDA A;  4G6W X;  1BQ1 A;  3N5E A;  1NJC A;  4XSD A;  2FTN A;  4Q0D A;  1TVW A;  1BKO A;  1BSF A;  5HS3 A;  1BJG A;  1TDU A;  1ZPR A;  3EGY X;  3HBB A;  4FOG A;  3INV A;  1EV8 A;  1JMH A;  4ECK A;  1QZF A;  2A9W A;  1LCA A;  1FWM A;  3EF9 A;  1YPV A;  2G8X A;  1DDU A;  3EJL A;  1AJM A;  4O1X D;  4KNZ A;  3H9K A;  1JMI A;  4GEV A;  1TSZ A;  4EIN A;  3C0A A;  1HW3 A;  4F2V A;  1B5D A;  3UM8 A;  3B5B A;  3BHR A;  1BO7 A;  2TDM A;  1NJD A;  1F4G A;  4ISW A;  3IHI A;  4LRR A;  1AN5 A;  3DG8 C;  3QG2 A;  4TMS A;  1CI7 A;  4IQQ A;  1HZW A;  4JEF A;  1B49 A;  3V8H A;  1JMF A;  2G86 A;  4EIL A;  1NCE A;  3QGT A;  3GH0 A;  4DP3 A;  1TRG A;  1TVV A;  4FGT A;  4FOX A;  3UM5 A;  1TSL A;  4O1U A;  2KCE A;  2AAZ A;  3EDW X;  5FCT A;  3BGX A;  2VET A;  1TIS A;  1TYS A;  1I00 A;  2OIP A;  1VZC A;  1F4C A;  1SYN A;  3QJ7 A;  1BO8 A;  1JG0 A;  2FTQ A;  3OB7 A;  4KYA A;  4E5O A;  3BYX A;  3IK0 A;  3BNZ A;  3B9H A;  4H0R A;  1BDU A;  5H38 A;  1JTQ A;  3DL5 A;  4E28 A;  3JSU A;  1TLS A;  3BZ0 A;  3DL6 A;  3GH2 X;  1KZI A;  1THY A;  3UWL B;  4FOA A;  1TVU A;  2ONB A;  1QQQ A;  1EV5 A;  1TSN A;  5H3A A;  1VZB A;  5BY6 A;  4DPD A;  3GG5 A;  4XSC A;  1VZE A;  1B5E A;  1TDC A;  1B02 A;  1JTU A;  3K2H A;  3IRO A;  1LCB A;  4GYH A;  3CL9 A;  1J3I C;  4Q0E A;  2G8D A;  2BBQ A;  4GD7 A;  1NJA A;  1SEJ A;  3HJ3 A;  3UM6 A;  4ISK A;  1HVY A;  3KJR A;  4FQS A;  1VZA A;  1BKP A;  3N5G A;  1JU6 A;  1F4F A;  1TSX A;  2TSR A;  3IK1 A;  2RD8 B;  3EHI X;  5J7W A;  1NJB A;  2FTO X;  3I3R A;  3IRN A;  3UWL A;  1BP0 A;  1BSP A;  1EVF A;  3IJZ A;  1F4B A;  3TMS A;  2VF0 A;  4O1X A;  5WRN A;  4XSE A;  4KY4 A;  1TLC A;  1JUT A;  1J3K C;  3HB8 A;  3KJS A;  3C06 A;  4IRR A;  1TSY A;  4DQ1 A;  3KGB A;  1TDB A;  4DPH A; 
#chains in the Genus database with same CATH topology
 3BHL A;  1DNA A;  3DGA C;  4KPW A;  1LCE A;  1BID A;  4H1I A;  1BP6 A;  3EBU A;  1BQ2 A;  1AIQ A;  2G89 A;  4EB4 A;  1BPJ A;  2RD8 A;  4UP1 A;  4O7U A;  1TDA A;  3N5E B;  1KCE A;  4PSG A;  1JMG A;  3CLB A;  1NJE A;  1TSM A;  3IRM A;  1F4E A;  4IQB A;  1RTS A;  1F28 A;  1TSD A;  2H2Q A;  3EAW X;  2TDD A;  4EZ8 A;  1TSV A;  1TSW A;  3NRR A;  4H0U A;  1AOB A;  1JUJ A;  1AXW A;  5H39 A;  3ED7 A;  2G8A A;  3BFI A;  4KY8 A;  1KZJ A;  1VZD A;  1F4D A;  1FFL A;  4G2O X;  1EVG A;  3IX6 A;  1J3J C;  2TSC A;  1HW4 A;  1TJS A;  2RDA A;  4G6W X;  1BQ1 A;  3N5E A;  1NJC A;  4XSD A;  2FTN A;  4Q0D A;  1TVW A;  1BKO A;  1BSF A;  5HS3 A;  1BJG A;  1TDU A;  1ZPR A;  3EGY X;  3HBB A;  4FOG A;  3INV A;  1EV8 A;  1JMH A;  4ECK A;  1QZF A;  2A9W A;  1LCA A;  1FWM A;  3EF9 A;  1YPV A;  2G8X A;  1DDU A;  3EJL A;  1AJM A;  4O1X D;  4KNZ A;  3H9K A;  1JMI A;  4GEV A;  1TSZ A;  4EIN A;  3C0A A;  1HW3 A;  4F2V A;  1B5D A;  3UM8 A;  3B5B A;  3BHR A;  1BO7 A;  2TDM A;  1NJD A;  1F4G A;  4ISW A;  3IHI A;  4LRR A;  1AN5 A;  3DG8 C;  3QG2 A;  4TMS A;  1CI7 A;  4IQQ A;  1HZW A;  4JEF A;  1B49 A;  3V8H A;  1JMF A;  2G86 A;  4EIL A;  1NCE A;  3QGT A;  3GH0 A;  4DP3 A;  1TRG A;  1TVV A;  4FGT A;  4FOX A;  3UM5 A;  1TSL A;  4O1U A;  2KCE A;  2AAZ A;  3EDW X;  5FCT A;  3BGX A;  2VET A;  1TIS A;  1TYS A;  1I00 A;  2OIP A;  1VZC A;  1F4C A;  1SYN A;  3QJ7 A;  1BO8 A;  1JG0 A;  2FTQ A;  3OB7 A;  4KYA A;  4E5O A;  3BYX A;  3IK0 A;  3BNZ A;  3B9H A;  4H0R A;  1BDU A;  5H38 A;  1JTQ A;  3DL5 A;  4E28 A;  3JSU A;  1TLS A;  3BZ0 A;  3DL6 A;  3GH2 X;  1KZI A;  1THY A;  3UWL B;  4FOA A;  1TVU A;  2ONB A;  1QQQ A;  1EV5 A;  1TSN A;  5H3A A;  1VZB A;  5BY6 A;  4DPD A;  3GG5 A;  4XSC A;  1VZE A;  1B5E A;  1TDC A;  1B02 A;  1JTU A;  3K2H A;  3IRO A;  1LCB A;  4GYH A;  3CL9 A;  1J3I C;  4Q0E A;  2G8D A;  2BBQ A;  4GD7 A;  1NJA A;  1SEJ A;  3HJ3 A;  3UM6 A;  4ISK A;  1HVY A;  3KJR A;  4FQS A;  1VZA A;  1BKP A;  3N5G A;  1JU6 A;  1F4F A;  1TSX A;  2TSR A;  3IK1 A;  2RD8 B;  3EHI X;  5J7W A;  1NJB A;  2FTO X;  3I3R A;  3IRN A;  3UWL A;  1BP0 A;  1BSP A;  1EVF A;  3IJZ A;  1F4B A;  3TMS A;  2VF0 A;  4O1X A;  5WRN A;  4XSE A;  4KY4 A;  1TLC A;  1JUT A;  1J3K C;  3HB8 A;  3KJS A;  3C06 A;  4IRR A;  1TSY A;  4DQ1 A;  3KGB A;  1TDB A;  4DPH A; 
#chains in the Genus database with same CATH homology
 3BHL A;  1DNA A;  3DGA C;  4KPW A;  1LCE A;  1BID A;  4H1I A;  1BP6 A;  3EBU A;  1BQ2 A;  1AIQ A;  2G89 A;  4EB4 A;  1BPJ A;  2RD8 A;  4UP1 A;  4O7U A;  1TDA A;  3N5E B;  1KCE A;  4PSG A;  1JMG A;  3CLB A;  1NJE A;  1TSM A;  3IRM A;  1F4E A;  4IQB A;  1RTS A;  1F28 A;  1TSD A;  2H2Q A;  3EAW X;  2TDD A;  4EZ8 A;  1TSV A;  1TSW A;  3NRR A;  4H0U A;  1AOB A;  1JUJ A;  1AXW A;  5H39 A;  3ED7 A;  2G8A A;  3BFI A;  4KY8 A;  1KZJ A;  1VZD A;  1F4D A;  1FFL A;  4G2O X;  1EVG A;  3IX6 A;  1J3J C;  2TSC A;  1HW4 A;  1TJS A;  2RDA A;  4G6W X;  1BQ1 A;  3N5E A;  1NJC A;  4XSD A;  2FTN A;  4Q0D A;  1TVW A;  1BKO A;  1BSF A;  5HS3 A;  1BJG A;  1TDU A;  1ZPR A;  3EGY X;  3HBB A;  4FOG A;  3INV A;  1EV8 A;  1JMH A;  4ECK A;  1QZF A;  2A9W A;  1LCA A;  1FWM A;  3EF9 A;  1YPV A;  2G8X A;  1DDU A;  3EJL A;  1AJM A;  4O1X D;  4KNZ A;  3H9K A;  1JMI A;  4GEV A;  1TSZ A;  4EIN A;  3C0A A;  1HW3 A;  4F2V A;  1B5D A;  3UM8 A;  3B5B A;  3BHR A;  1BO7 A;  2TDM A;  1NJD A;  1F4G A;  4ISW A;  3IHI A;  4LRR A;  1AN5 A;  3DG8 C;  3QG2 A;  4TMS A;  1CI7 A;  4IQQ A;  1HZW A;  4JEF A;  1B49 A;  3V8H A;  1JMF A;  2G86 A;  4EIL A;  1NCE A;  3QGT A;  3GH0 A;  4DP3 A;  1TRG A;  1TVV A;  4FGT A;  4FOX A;  3UM5 A;  1TSL A;  4O1U A;  2KCE A;  2AAZ A;  3EDW X;  5FCT A;  3BGX A;  2VET A;  1TIS A;  1TYS A;  1I00 A;  2OIP A;  1VZC A;  1F4C A;  1SYN A;  3QJ7 A;  1BO8 A;  1JG0 A;  2FTQ A;  3OB7 A;  4KYA A;  4E5O A;  3BYX A;  3IK0 A;  3BNZ A;  3B9H A;  4H0R A;  1BDU A;  5H38 A;  1JTQ A;  3DL5 A;  4E28 A;  3JSU A;  1TLS A;  3BZ0 A;  3DL6 A;  3GH2 X;  1KZI A;  1THY A;  3UWL B;  4FOA A;  1TVU A;  2ONB A;  1QQQ A;  1EV5 A;  1TSN A;  5H3A A;  1VZB A;  5BY6 A;  4DPD A;  3GG5 A;  4XSC A;  1VZE A;  1B5E A;  1TDC A;  1B02 A;  1JTU A;  3K2H A;  3IRO A;  1LCB A;  4GYH A;  3CL9 A;  1J3I C;  4Q0E A;  2G8D A;  2BBQ A;  4GD7 A;  1NJA A;  1SEJ A;  3HJ3 A;  3UM6 A;  4ISK A;  1HVY A;  3KJR A;  4FQS A;  1VZA A;  1BKP A;  3N5G A;  1JU6 A;  1F4F A;  1TSX A;  2TSR A;  3IK1 A;  2RD8 B;  3EHI X;  5J7W A;  1NJB A;  2FTO X;  3I3R A;  3IRN A;  3UWL A;  1BP0 A;  1BSP A;  1EVF A;  3IJZ A;  1F4B A;  3TMS A;  2VF0 A;  4O1X A;  5WRN A;  4XSE A;  4KY4 A;  1TLC A;  1JUT A;  1J3K C;  3HB8 A;  3KJS A;  3C06 A;  4IRR A;  1TSY A;  4DQ1 A;  3KGB A;  1TDB A;  4DPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...