3HBGA

Structure of recombinant chicken liver sulfite oxidase mutant c185s
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
373
structure length
353
Chain Sequence
b'QDPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQSAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDEPCVDWDTPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite Oxidase mutant C185S
publication title The structures of the C185S and C185A mutants of sulfite oxidase reveal rearrangement of the active site.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 93
structure length 353
sequence length 373
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hbgA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3hbgA01
3R19A 1OGPA 2A9BA 4PW9A 4PW3A 3HBQA 2BLFA 2XTSA 3R18A 2A99A 2BPBA 2A9AA 2A9CA 3HBPA 3HC2A 2BIHA 1SOXA 2C9XA 2CA3A 2A9DA 1XDYA 3HBGA 1XDQA 2CA4A 2BIIA
chains in the Genus database with same CATH superfamily
4LP4A 4QAMB 4G8GE 3U30B 3OLDA 4YSUA 1QLEL 4GUPB 3Q9PA 2WWNA 4KPHL 3MRNA 2WLZA 3Q5TA 4M3KB 4QHUB 2BDNL 2BM3A 1SN0A 4MXQC 1GJWA 4UM8B 4RMSA 3GZQA 1NZRA 2WZPA 1CXLA 1EGJA 1MNUL 1U8HB 1E40A 3OAWA 3UROR 2WVVA 4XZ4A 3FZUD 2XN2A 3NJHA 4OZGE 3VG0L 5DHDA 2DAVA 5GGUA 5E9AA 1Q94B 5LXVA 4JRXD 1U9KA 3KXFE 5F21B 4DKEH 1NIBA 3KS0H 2AJUH 3ZJAA 5FLUA 8FABA 1UZ8B 2OMUA 5JZ7C 5IUSA 1LK3L 1PYWA 4JANA 5KWYC 1G43A 1QLEH 4XH2A 2ATKA 3BEWA 3O2DA 4G7YH 4KPHH 2E75C 3SJVB 2BDNH 2Z3FA 1M2OA 2R2EB 4YDMA 3O3BB 1MNUH 4LLYA 1SEBA 2YR3A 1JE6A 4XCYA 3NJNA 3VG0H 1OE3A 4H26B 3UO8B 3JWNG 5E5RB 3EJZC 3MUGA 2APSA 1LK3H 3VUAA 3WTSA 2VLKD 2WBKA 3MRKB 1NMCC 5DYOA 2DB8A 1WFMA 2CRMA 3KPTA 4OZ4A 3SCMC 2YD8A 1XR9A 2DF3A 5F3BB 5IEHB 4M7KL 2EVJA 4GAYB 3RIKA 4MDJB 3OC5A 3QIWA 2K6ZA 3Q8AA 5EO9B 4I88A 2QELA 1COBA 1E27A 3LXBA 3N2JA 4H8UA 1II4E 1IX2A 4DP9X 1SHMA 2JCCB 4Q74A 3MJWA 3VXUA 1YEIL 5IFJB 1CT8A 2KL6A 3BT2L 2APFA 4NEHB 3ES6A 3TBSA 4PS4L 4ENED 3UZVA 4LLWB 1CUOA 3QE5A 4PRIB 5DHVB 4JCWA 1KJVB 2JQZA 3CSBA 4M1DL 3NRPA 3OKLB 4ZQKA 1E8XA 3JV6B 4M7KH 5D7IA 3CFCL 2HKFL 5ANHA 2WXLA 1R6VA 1O6TA 3R8BB 1IGCL 5HHQA 5FXCH 1LO4L 1CR9L 4M93C 1A4JA 1ZXQA 3BP4B 3BVVA 2DWDB 2WKGA 4NQDB 1IC4L 3WEXA 1YEIH 2QR0A 4XOCA 3EH3B 4E68A 3Q48A 3BT2H 3U25A 5MP6L 3TVMD 4LOUC 3GIVA 5F89A 4AITA 4JPSA 4PS4H 1R5VB 3RPBA 3MRJB 4B9PA 3NIFF 5GGRA 3QQ9C 4M1DH 2X40A 5J1AA 3DPBB 4DAGH 1QI5A 1U95B 2PYFB 2AV1A 1H5BB 2K78A 2X0VA 4H8HA 2VJXA 4F7PB 1ZPLA 4KK9C 2AP2A 1ITCA 4PB0H 1IGCH 4XO9A 3ZDYB 5A2IH 3GC3A 1ET8A 2CHZA 1AP2A 2FB4L 2PPAA 2UUDH 1GC1L 4FG6C 1IC4H 3OHMB 5D1ZI 5C2BH 2YEVB 3ENEA 1KPUA 3MUJA 3KM1A 2XICA 4CVUA 5MP6H 4NQED 4OLYL 1E4WL 1ZKAA 1HQRB 4XNZC 3NK4A 1DVFB 1JXKA 1Q9KB 5ESVA 3N1MC 4I9WE 3ZQWA 4CN4A 2ZX8A 5JIKA 3QZBA 1UKTA 3UABA 2F0CA 5B38B 4MTMA 5GZNA 4EIZC 3DIDA 1RZKC 3HG3A 3UBXB 4FG2A 3V7AG 4JDVA 1WCBA 2CRYA 3ULSA 3SDCC 4J3SA 32C2B 3D06A 2FB4H 1JF5A 2ZE0A 3CZKA 3B3IA 1GC1H 4IRSB 3T3ME 2ADIB 1ZVYA 3QRFM 3ZYJA 5C08D 2OMXB 5D1QA 1CE6B 1T1WA 1A1MB 4OLYH 1E4WH 2X05A 4NM8L 3IFLH 1U6AL 1YPZE 3SYAA 3TBWB 3AJ7A 4GXUN 2WVSA 1OAXL 2E7MA 1S7SA 3D39B 3DVGB 4HJJL 5A2CA 1HL8A 5D1ZA 5F2FA 2PTUA 3ZMRA 2VR6A 3AY4A 3DETC 3LXUX 2DI8A 1WS8A 4CC0A 2V9UA 3FJTA 4R4ND 5I1AA 3EXLA 4JZJA 2DL9A 5B7EA 1DN0A 5SWQA 4UM9B 4BV1A 3LN9A 4HU2A 4GNKB 1WPCA 2OMTA 5FKPA 1YRKA 2HT2C 2YPLD 3P77A 4FHKA 3DDFA 2ZSWB 1NAMH 5C3IA 2BO0A 3LPOA 4L1BA 2CPCA 4NM8H 5AKRA 1KYAA 1U6AH 2EDFA 4AJ0A 2P45B 4HJJH 1OAXH 3G6JE 3FCTA 3NQIA 2L8AA 1I3UA 3UO1L 1GGCL 1HHIB 3VFPA 1VSCA 3CFBB 3G6DL 3QQXA 4NUPA 2DTSA 2BP8A 3BQUD 4O2CB 5DQ9A 4PIRF 5T5FL 4PJCA 4ALAC 1UB5A 5EPMB 4NBZB 5DRWB 4E5XA 4OLZL 5AB9A 2GC7C 2Z1PA 1A7RL 1X7QB 2ZUQC 3EOTH 1L7IL 2PPDA 4LKXA 4JGUA 4LQFL 4BZ2L 5EIIB 5GGVL 3HI1A 4XHJD 3AUVA 3E3QC 2B3IA 3IMSA 1N0LA 4MA3B 3UO1H 1DFXA 1GGCH 4MJHA 2VR3A 2P5WD 3G6DH 4OD2B 5GSRB 3P11L 2AMGA 3EJSA 3PFQA 2XTJB 3WG7B 5BW7A 4K3EL 2WMPB 5FUCE 1ZA6A 3HE6B 4F7MB 5GJSL 2W9EH 2Y7NA 5ERWA 1MQ8A 3FU6A 1BBJA 2VKWA 3TBVB 2VN4A 4NO3A 4PYGA 2EUZA 1A7RH 1F45A 3RZWA 5DMKB 4WO0A 1N9PA 1URIA 3EGSA 4AK1A 5E6IB 1NBYB 3RDTA 1QFWH 3WMPA 4LQFH 5GGVH 1J8KA 1C12B 5L6YL 3FO2A 3IJEB 5KSAB 3VFNA 1Z1WA 2PXYA 2B4CH 3G5WA 1G1YA 2PYEA 5D7LE 1QX1A 3P11H 1MXGA 1XFPA 1RLBA 1WJ3A 4OZIE 1IGIL 2LTQC 3IJYA 4BRVA 1UJ3B 5A16A 3FTGB 4K3EH 2GTZB 3KGTA 3APFA 5GJSH 3V5DB 1JZ5A 3PCYA 2HB0A 5D93B 4U1IB 2CAKA 2IMNA 3NYKA 5BRQA 4ZUWA 2OR9L 1YDPA 2ADGA 3EYOA 3I85A 5LNGA 5L6YH 2DQ6A 1FP5A 1D9KB 3QNFA 3LNEA 4KXZI 3I6LE 3QQDA 4RRPM 5DSCB 4FGMA 3HG0A 2WO3B 1OKEA 3BEVA 3ZY7A 1FAIH 1PKQE 1L3WA 2XTSA 1A3RL 3UIYA 2X1QA 1YEWA 1F11B 4PJDB 2DQUL 1E9OA 5KZCD 4HLEA 2XV2A 1FORL 1LDSA 2QBWA 5EU4A 5L8JB 4QXUL 4JVWA 2B5IC 3IFPA 3Q1SL 5IIEB 4TVSa 1P0SE 2OTWB 3DX2A 1KPVB 3BIKB 4K0OA 4MAYA 4JPKL 4NN5C 4O2FB 4PWGA 3WE1A 1KCVL 1UFGA 4WWKC 4ELMF 2OMZB 4JKMA 3WL9A 4PJFB 1ZE3H 4WV1B 3GS4A 3MRRA 3F5WA 3QYCA 5KVFE 1C16A 2DWXA 2XZAL 3CZFA 3QUML 4WU7B 4XP1L 4LCWA 3EH2A 2ZXCA 1OGAB 1A3RH 1KCSL 3I3EA 4HEME 4J3XA 2AITA 3RBSA 4LF3B 4YS4A 4GXUM 5ISZE 5EZLB 1JXFA 5C09A 2W0PA 2DQUH 3Q06A 1FNEA 1M71A 3T0WA 5CGMA 2NY1B 2AABH 4QXUH 2E76C 2IXQB 1GSMA 3HG1E 3Q1SH 1CB4A 4XXDA 1ESOA 3KEDA 3QO0A 4UCFA 4JPKH 3HS0B 3KJ6H 4Y5VC 1KCVH 4HFWB 2HT3C 4XN1A 5HGAA 2EUWA 1MIEL 4I1RA 4CRPA 1TVHB 3W37A 3GZKA 3FQNA 1WFOA 4GLRI 4TUJA 4L3ED 2YARA 2XZAH 4XP1H 4LOEA 3HFFA 3OKOA 3FFDB 1Y1DA 2DMKA 2OMBA 1KCSH 4GI8A 1QSVA 4PRNA 1HJBC 4FXTA 1JWSB 1TTUA 2F54E 1TJIL 2XXMB 3UEZA 5G4MA 3D09A 1C5CH 1F3RB 1GZPB 2A74B 2DI9A 3KLAB 1L9SA 2WWMD 4PJ9D 3X2QB 3GJFH 4HETA 5CP7A 5B1CA 3GEFA 4AXWA 2VDMB 3C5SA 2CXGA 4ONHA 2W60A 1U8MA 4FCHA 3VXUD 5IW1B 1T20B 3ZE2F 4F15C 5MEND 5GPRA 3R06A 1HK6A 5LNDA 5CJBA 5INCB 1MIEH 5I8CA 3FW6A 4HJ0C 2K6YA 2GSGB 4NB7A 5ICUA 4QNPF 1YN7A 2EC9U 4QTHB 4ZFOB 1M7IA 1BLIA 3QRBA 5HYSG 1LO2L 4XWOD 3SPIA 1MHEA 3N1PC 3N43F 5K33A 3UL4A 4F5CE 4Z7OB 3QUYC 1TJIH 4HIHA 1F6AB 5FYKL 3ME0A 4O5LL 1L4IA 1FV1A 2IDUA 1UA6H 4N0RA 5IB1B 2WN3A 3PQYE 3FAWA 2ZX6A 4YSTA 3MV7E 2OL3B 3E6FA 3ULUE 1I9JH 3AITA 3VM5A 3H9SE 1X5XA 4G42B 1K4CB 2WCPA 2ZUSA 4M6OL 3V5KB 1YMMB 1LO2H 4UV7H 1EHNA 2DJUA 4ACTA 3NABL 2OXHA 5D55A 3QDHA 5HVGB 4IEFA 1SLWA 2Z4QB 4DP1X 3QJHA 2A7BA 5FYKH 2VITA 1OE1A 3DJTA 3HHSA 4O5LH 5TJWK 4BKLA 3C09B 5CZVL 1ASQA 2Y7MA 3Q43A 2K1MA 3OR6A 5IF0A 2FX8L 4EPSA 2AJXL 4MB5A 1WC7A 3K6NA 4N0UA 5AVTB 4DPRA 4EVNA 1E4XL 2XQYA 4ABWA 2D0GA 1WE5A 3RFZA 2Y7QA 5EF3A 4M6OH 3HMWL 4YFLF 2RR3A 3VMPA 4UILL 2GQHA 4JHUA 3QQ4B 4N2LA 1PU0A 3NABH 2NDFA 4CMMA 3F7LA 3L9RA 5GZND 4EN3B 4WIQA 4A2GA 4OZFA 5J6SA 1G9HA 2AXFA 4AYBA 5KAQF 2HLFD 2YBRA 3D52A 3LNDA 1SOSA 2HJLA 4HKBB 5CZVH 5BPPA 3QDJE 2P1YA 3S34L 4Z7QF 2AJXH 2CRZA 1I1AC 1AGDA 3HB3B 1HCFX 3NMEA 4LHUG 2H6PA 5D1QD 3V6OE 2A9DA 4QJ5B 4UNIA 2ERJC 4P2OB 4KK8D 2EILB 1IM9D 3HMWH 2QPDB 1EEZA 2R56L 3WNOA 1LP9E 4JPIB 4N6QA 4UILH 4Y5YB 5MEOA 3SPCA 3MCKB 3W5MA 5E8PB 2YAPA 1LM8V 1JNHB 4BE6A 4CSPA 2IGTA 2Z0BA 1NCCL 3VXSA 4L3AA 4PJ8A 2NY2C 3RGVB 3WDHA 3IBOA 2DQCL 3S34H 2HUEA 1GMEA 4IS6B 5H35B 2GHWB 4MNQD 3ZHNA 5JPMC 1TZGL 1AG6A 2Q86A 3QULA 1BAWA 3UYPA 4U2YA 4YPGA 1OWWA 1FZKB 2HTKC 4E36A 4Z3FA 4YLCA 1WWCA 1HEZB 4OD3H 4RDBA 3QJFA 2R56H 3IF1A 5I1EL 5HD8D 1NCGA 1EHLL 1MJ8L 5GZOA 3QDGE 2BHUA 1N19A 5D4HA 2ZIDA 4ZNEA 4OCRL 3UPRA 3WNNA 2FR4A 2NR6A 1NCCH 1CTMA 1F42A 5I1DA 1PLCA 1NCJA 4HAGA 2VLRA 4HH8A 5HYJE 2DV6A 4M7JL 2DQCH 4F92B 1XGPA 4JPQA 1KMGA 2EEDA 3RY6A 1OT4A 4Z7NB 3KHQA 4PCSA 4AM0Q 4HHWA 1TZGH 4MMZA 2YRPA 5I71C 4FFZL 1R3HB 3EOAA 2EDLA 3WEOA 4B41A 1CGTA 4P2RE 2ESVE 5I1EH 2MPAL 1H3UA 3AU1A 1EHLH 2RBLA 3HUJE 2D4FA 2P80D 4QXTB 1I7UA 2MOVA 2AJVL 4WK2B 5AZEL 1KB5A 1BZDA 2PP9A 2Y1ZA 4OCRH 3CUPB 3QQNA 4HK0B 4PP2B 1D6EA 2IANB 4ZO8A 5D7HA 2F1BA 4CKVX 3GHBL 2PP8A 2F5BH 2BHZA 3ABLB 2GI7A 1BZ9A 4M7JH 5J11B 2K7PA 4FLRA 2R51A 3UBFA 4O51B 1F97A 4BK8A 3JWNC 5I5JA 4R3SB 5EO0B 1MZZA 2CM5A 9PCYA 2JLPA 1BLNB 2BSBA 4YBQC 3T65B 5AW8B 3IE4A 4LFHG 1PLBA 1WAAA 4D0BB 2VXTL 4QPEA 5E5MB 2PXYD 2JK5A 1S7UB 2MPAH 4KUZH 4Q9QL 1ILUA 1S9KC 4UIMB 5FO7B 1J7VR 2PYED 1WHOA 2AJVH 3MU3A 5AZEH 3OJDA 1M2VA 3C6EA 4PG2C 1UD4A 4XN9A 4AIZB 2ZOTA 3ZBMA 2YXFA 5HSFA 2P44B 4ANWA 3BYTA 3GHBH 2W5PA 1L6XA 3IS0X 5EIQA 4UBDC 4OJCA 3V0WL 4WUKL 4EI5B 2YD2A 2YAQA 1MCEA 2V9QA 4NZUL 5CZRA 3ZDXB 4PP1C 5C0IA 4JO3H 4MMYA 5EC2B 1DCEA 1AS6A 2B0SL 3EJTA 1BWWA 1MFCL 5J5EA 4FYRA 2VXTH 4LDLB 4Q9QH 2WXFA 5BO1L 4JKNA 1G7IA 2BNUB 1RY7B 2V5TA 3QEHB 5DJ2A 4KKCD 2ZUXA 5LGJA 3SDDA 3N50A 4PLKD 2DMBA 5LVEA 1RZ7H 4YE4L 1ONQA 4OQTL 3RFRA 4MNGA 4ZODA 1S8DB 2J5WA 3EDFA 3UDWC 3V0WH 4WUKH 2X3CA 4BYHA 4DEPC 3P4NB 4IHOB 4RGNB 4NZUH 4MAYD 3BDBA 4HXBL 1O0VA 2CLZB 4ZBJA 4FQXC 3NEXA 1Q90A 2B0SH 1MFCH 4MJIA 1YY8A 1FVEB 3GPEA 5BO1H 1O9VA 4BGDA 1QRNB 2XWEA 4X98A 2BS8A 4LCWD 4C59B 2EUXA 1CTOA 5DEGB 2QMJA 1NUNB 2B2XH 3CSTA 4YE4H 3JTBA 4OQTH 4JDZB 1UOVA 4KDVA 1VADA 3S3SA 1ZRUA 2WLLA 5C09D 2NUPA 2CJSA 3WKYA 2BSTB 4L3CB 3I9AA 3LEXB 1IBBA 2FJHB 4JO5A 1VB9A 1P4IL 5D2LA 1NJ9B 1TYEB 3DIVA 3ZE1F 3ZL4L 3B3BA 2VN7A 1FCCA 1WYJA 1OALA 3D0VA 3KPMB 3O2VL 4URTB 3O9WB 2B59A 2DLFL 1SDDB 3D2UA 1EEQA 4G9FE 5ADPL 1HOCB 4N9GB 1VENA 3GWJA 1RUQL 2OM5A 3RWIA 2L7QA 3SDAB 4JAMA 1TQSA 4ZS6C 3KJ4C 5HVHB 2MEJB 3W3BA 4BDVB 4P5TB 4U6HB 1CFQB 1PIGA 5CUSL 3KYNB 1FNSH 1ZAGA 1BPVA 4A66A 1I9EA 1Z0NA 5T5NF 1ADQL 5CIPB 1WA2X 2BX5A 3L6FB 4ATTA 4OJFH 5HHME 4XMVA 2LAGB 2QV4A 1U8NB 4NBXB 1X4YA 4GI6A 4GRLA 3C5ZD 5I6LA 1J1PL 2VDNB 1HKLL 1UH3A 1QKZL 4GW1A 1X44A 4TMPA 3FL7A 4APXB 5ADPH 1RUQH 2MOQA 2NNAA 1G9ML 3CK0L 1CURA 5F7WC 1HWGB 1A9EA 1JCVA 4KNUA 1I53A 1JPEA 3FT0A 3QIUD 3UZQB 1RJYA 4GUPA 5CJXC 5FYLE 2ZYSA 2NX5D 1ADQH 3MRQB 3OF6A 2VDRL 3B2PA 3MRMB 1DQTA 5A43C 4QHUA 2Q8AH 1WD9A 4UM8A 4QWWD 5ID0A 3WHXB 1U8HA 5DVLA 1J1PH 2X0WA 1HKLH 4GAFB 5TE6L 4NWUL 4OM1H 2GT9A 4U0QB 2WLHA 2F2HA 1Q94A 3CK0H 3SDXB 2YJLA 4ODBD 1JIBA 3OPZL 3D3VB 1IIIA 3PHAA 1U8PB 1UZ8A 4PJIE 4WVRA 2FWOA 2I60L 3JZYA 4K94C 3AG3B 4DZ8B 1Q9OB 3LNHA 4LPUA 2VDRH 5DMIL 3SJVA 1HWHB 3JXAA 3O3UN 4B0MM 2KLSA 2R2EA 4WSKA 1CLOL 3O3BA 1G6RH 5ADOL 1QSFD 4W9KC 2EDKA 3MLPA 2RALA 5TE6H 4NWUH 3IS1X 1WITA 4LPTA 3C6LC 4H26A 4P46B 4PN6A 3NJVA 3NCXA 4OCWL 2NLJB 3OPZH 4XAKD 3Q13A 3TX4A 2ICES 3PS6A 3HKZA 1I8IB 4K5MA 1NGPL 2I60H 5A3IC 1KBWA 3HJ0A 3MRKA 2N1KA 1FHGA 3ARRA 4YDKL 1T89C 4FTVE 2FD6L 3EHBD 3OBAA 4M1GL 5IEHA 5DU7A 5F3BA 3WENA 4GAYA 5FYJE 2CM6A 4G3YL 4OF5A 1ZGLB 1CLOH 4LVOB 5EO9A 3QFJB 5CEZE 2CKBL 4CU7A 1JHTB 3V6ZB 4LARL 2JCCA 4MAUH 5J12C 2X5PA 3VXSD 4OCWH 5IFJA 3W82A 5E6SB 3K6OA 3T1FB 1URZA 1CLYL 5F7HA 5B39B 4W70A 3QH3B 1P7BA 1NGPH 1IC5L 2Z7WA 5DHVA 4PRIA 4KDTC 1KJVA 4TL5A 3OKLA 4M1GH 2BNQE 3DA0A 3JV6A 3FTYA 3AUWB 4G3YH 1HZHL 3Q01A 3GS7A 1VA9A 3AFLA 5GZOD 2GSIB 2CKBH 5F7UA 5C7XL 1KBKA 3D18A 2VLJD 5LBSA 4OCLC 1R4XA 3BP4A 2DWDA 4Y7MA 4YSDA 4HKZB 2XLLA 4NQDA 5EEUA 2EE9A 1R17A 1CLYH 4Y1AB 4B9GA 5K9KB 2VLRD 3NA9L 4C56E 3M1BB 1L7TH 1IC5H 4UINL 3IMUA 5E4EC 1S7QB 3MRJA 2X89A 4YHPB 1S4IA 1I3RB 1CPUA 3DPBA 3MLTB 4FNUA 3EJQA 3CHQA 1U95A 2PYFA 2ZWSA 4RFEB 1Y7VA 2VR7A 3JUZA 3RA7L 3CDFA 4XN5A 2R1WB 4F7PA 5AKSA 4BQCA 5C7XH 4DJMA 1PCXA 3TO4C 3B2MA 3JWDL 5C0GB 5JQ6L 4PU2A 4KZDL 4KO7A 1W72H 4F33B 3UTTE 1GA2A 3ARGB 4B9IA 5I74B 1XH3B 3NA9H 4OKDA 4V1DB 5AVSB 1CDHA 2ZTBA 1HQRA 4PGCB 1HHGB 2MQ0A 4UINH 1DVFA 5J56B 1Q9KA 5GRVK 2H2SC 1PG7W 1EJOL 1ASOA 1JV2A 2GIYA 2JI3A 4M6AA 2HT4D 2J71A 3RA7H 3BPLB 4X5PA 3FTUA 1B9KA 5D7IF 2LW3A 5AOIA 3SSGA 4EI6B 4K2UH 4PJEA 3JWDH 32C2A 5F1SA 2CCLA 4KZDH 4WFGE 1EGJL 2OMXA 1IC7L 3HNVL 3MROB 1CE6A 1MKFA 1A1MA 3B9EA 2AKRB 1DBBH 3D39A 1GZHC 3DVGA 3PREA 2GJ6B 1EJOH 3BAXA 3REWB 4JMXA 5B4MC 3K71B 1RP9A 4L37A 3BH8B 3HTLX 1J10A 2FVNA 4AZ8A 2EIZB 3O2DL 5F7DB 1WGVA 3SDDD 3UG3A 4KX7A 1XIWB 4L2LA 4TUUA 1EGJH 2G3NA 3BN3B 3IB4A 5DCCA 4GSXA 1IC7H 3HNVH 1MWOA 3SYQA 3KPRA 4PCTA 2ZSWA 1FNHA 1RU9L 3ZQXA 2QJDA 5E8NB 2MNJB 3L3GB 1OIOA 4U1HB 4M8RA 5D7KD 4UANA 1NMBL 4FNPA 2IH9A 1HHIA 1HAUA 2CJUH 3CFBA 1QEWB 1R0AH 1OB1B 4MQXC 1B4JL 1U3HD 2OULB 3O2DH 4ADIA 1JF1B 2QGEA 3MFFB 5HVFB 4O2CA 4WHDA 1A7BA 5F7AA 5EPMA 1BM3L 3ZVVA 3FUNA 1HDMB 5DC0A 3MOBL 2R1XB 1X7QA 1RU9H 1U21A 2E56A 1EV2E 1R3JB 4JMNA 5DK3A 1G7LB 4DGWC 1JL8A 3U7AA 3U0TB 3HRPA 1N3NB 4RWYL 3QWQB 2P52A 5EIIA 4ZFGL 1KELL 3N91A 5JHAA 4KTGA 3UMNA 2Z91A 4MA3A 4OD2A 4P2QD 1BWMA 5GSRA 4YIQA 5LO7A 5BV7C 4L29B 1KYFA 2OI9C 3QJUB 4JFOB 3NDZE 2WMPA 3N1FC 1FFNB 2O6CA 4AKOA 3MBWB 1BM3H 3D2UD 4F7MA 5IQ7L 3QDMB 3TBVA 2Q3ZA 1CTNA 5CBAB 3MOBH 4HAKA 2HUHA 3FQUB 3HPLB 2VABB 4Y8DC 1JK8B 1NBYA 4WI6A 5E6IA 4Q58C 1D2PA 3QYMA 4EZMA 1SUJA 4L8SB 4RWYH 2I9LB 3TU6A 1C12A 3S5YA 3IJEA 5KSAA 2NW2A 4ZFGH 4PV8A 3VGEA 2F9BT 4XN7A 3U9UB 1Q4NX 2EECA 4PD4K 5TDOB 1TQWA 3Q6GL 2BSEA 1JZ8A 1E4HA 2XG4B 1JWMB 3FTGA 4GRLD 1QI4A 3OSVA 2GTZA 4YFDB 3VXQB 3ZQ9A 4Q6YA 4BQ8A 3MLYH 2NUTB 5BCAA 3V5DA 1AMYA 5CCGE 4U1IA 3BP6B 3E1ZA 3MJ9A 4PJCF 2GIMA 3LPGA 3W11D 1RCYA 4KRPC 5B8CC 1ZXKA 4X6CE 2ENPA 4TPRL 1D9KA 1VEOA 2R9HD 5DZAA 1J9QA 5DSCA 3K2UH 2YAOA 2QPSA 1KTKE 2EIDA 3WDJA 1EHXA 4N6RB 4A7UA 3W39B 5D4IA 1IFRA 1QPPA 1F11A 4FKEA 2H47C 2WM0A 4PJDA 4AYEC 5FOJA 4BCZA 1NEUA 2X4NB 5J3HC 3NGBC 3GM8A 5FC9A 1CLZL 5IIEA 5EIVA 4WO4B 1KPVA 3LPWA 4RRPA 3CZSA 5C1MB 4IIQC 5T3ZD 1F4HA 2AFNA 1OAKL 4PJFA 3DMMD 4TPRH 1IKNA 2W92A 3CHRA 1MFNA 2WPGA 5CAYB 4WU7A 2A4CA 1PZCA 4X9BA 4G6AC 5FHBL 1KEGL 2BOBB 2CGZA 3CZNA 3G5XB 4LF3A 5EN2B 3RNQA 3VJ6B 4G2AA 5EZLA 4B60A 4YEEA 4DKFL 5TE4H 4N3TA 3CVBA 4BZYA 2IXQA 4FZEL 4NNYB 1CLZH 3CQQA 2BVPA 1M1XB 3LRMA 4ZD3H 4HFWA 4PGBB 3TYFA 1WF5A 4GRWH 2R7EB 4TS6A 5BZXA 1TVHA 4TVPL 3QI9B 3O0LA 2ZUWA 4BSJA 5BUGA 2FO4B 4S0SD 3VFVB 5BXFB 1TPXC 1HQ4B 5FHBH 3FFDA 1FSKB 2ARJB 5DD1L 5FUCC 5D8JL 1KEGH 4QY8B 4GS7C 1JWSA 5DUBB 1ZT4B 1HINH 3X1GA 2A74A 1GZPA 3KLAA 4H20L 4FZEH 5EZOL 3ORJA 1LQBC 2I9TB 1EDYA 5IW1A 1K6QL 4XNMB 5INCA 3H4FA 2GSGA 4TVPH 1HYSC 1C7SA 4K8RC 1BV8A 3HRZC 4PPTA 1CJYA 3SB3A 4PRID 4QTHA 4I87A 4ZFOA 5TH2A 5BZDB 2JJTC 1M42A 2H9GB 4NC1E 1GSKA 3GDBA 5EFIB 4L4TB 1F6AA 1FNGB 4JFFE 1UEMA 1H3XA 4MZIA 4H20H 4EUPB 1T0NB 5EZOH 5LN4A 2E27L 2C3WA 2X0UA 4KKRA 4NQDD 3V0FA 4U1SB 1QFOA 3ASNB 1JVOA 3MLZL 1MRCH 3FU9A 2OL3A 4G42A 1K4CA 4POYA 5DJXB 2X89D 1ORQB 1YMMA 2V3FA 4N0CD 5CLTA 3V5KA 5FM5O 3QWRD 1X5KA 3BIBX 1DQIA 2D3LA 1R24B 5HHOB 3LKQB 2IGLA 1G6VK 1IBDA 1PZ3A 3L5HA 4ZRGA 1BX2B 1UOKA 4FADA 4UQIM 4N9OB 1O6SA 2E27H 4X7TB 3DGCR 3MLZH 3X1FA 3QNZA 3Q2WA 4J4PD 1TSRA 4WTXA 4W6XB 5EDXA 5F6IC 2R69L 1ET5A 3BQVA 4I18B 4JREC 4JRYE 2YAHA 3FPYA 3QQ4A 2P8MB 4HPOL 2G3XA 4EN3A 1F3DH 2CZNA 3TTYA 1AD0A 1AFVL 2MKLC 4WTZG 4KKBD 2EC8A 4XNAA 3V4VL 4HKBA 3WS6C 2H6UA 4IRSD 4OIIL 2W91A 1ZV9A 1MAML 3MNWB 2ZYRA 3STZB 2KQMA 3UAEA 3T4AC 2NQCA 3P9MB 1BEYL 4QRAA 4P2OA 2GY7B 1U42A 1J1XL 2AVGA 3A4DA 1ECYA 2BSRB 3D39D 4MQ7B 4YDLC 5CM1A 4JPIA 4C54A 1J5HA 4Y5YA 1OANA 2VL4A 4QRFA 3FO9A 4GKNA 5E8PA 1AI1L 1JNHA 1XSIA 3CH1B 1AFVH 1I9IL 2M8XA 2HJFB 3KW8A 1AQMA 3H8NA 3RGVA 1IT9H 4UM9D 3IAGC 4OIIH 4YSQA 3O4LB 4IS6A 5H35A 3U4AA 1G7QB 2PWGA 4J28A 4YHZL 2VZ3A 1V54B 2WJ7A 1BEYH 3HN5A 1M3JA 4ZUSB 1FZKA 4HIEB 3S37X 2FUTA 1J1XH 3KDMB 1OCCB 2PN5A 3HFMH 3EBGA 2FT8A 4X4MA 5L88L 3DPDA 1CXHA 5FYKE 4OTXL 1A7NL 2IG2L 2IH8A 2XXFA 1MCJA 4NUJB 4XTRD 4G59C 3T3PE 1R46A 3Q0HA 3B8SA 3NSCA 3B9KB 3WIHA 4FA8A 1JFQH 4HIPA 5I1IH 4NYLB 1I9IH 3CVIL 2H1LM 3LQZA 4U3SA 2JQMA 4BH7B 3AABA 3DOSA 4PRAA 4IOSD 4OY9A 2HRPL 1IB5A 3HEIB 3ULUC 4OFDA 2HWZH 3VGAC 2X70B 2OMNA 5EDSA 4YHZH 4WHCA 4KXZH 2VO8A 3ARQA 1Y0LB 2V5SA 2NW3B 1QSEA 5DA0B 3KZ8A 1MF2L 2QGCA 2BXYA 5L88H 1L0QA 4OTXH 4XNDA 4M4PA 1A7NH 4QXTA 1VFBB 3MYJB 3CUPA 4HK0A 4ZUVA 2IANA 1TF4A 2XTJD 4JZNB 1TITA 3I02B 3MUHL 1QUPA 3CVIH 4HKXB 1UD3A 4M8QB 3NIDE 2HRPH 4Z7UB 3HE6D 3QJQB 4NP9A 3PUCA 2IPTL 4PJAE 2MHAB 4O51A 3E2HC 5FDWB 1KGWA 4KXCA 2NY6B 4R3SA 1ADWA 5EO0A 3RVTD 2KUTA 4J6IA 5E6ID 4M5ZL 5C3TA 1BLNA 4FTDA 3NJJA 2XVBA 1SYSB 3UBHA 4EI0A 3T65A 1MXDA 1MF2H 5KSAD 2OW6A 4IKIA 3NCYS 3F7QA 4D0BA 5E5MA 1L6PA 5EUOF 1S7UA 5DFVC 2QADC 4AVIA 4UIMA 2WGXA 5F96L 5FO7A 3V0IA 5LDSA 3VFSB 1IKFH 1L0XA 3AXLB 4AIZA 3F6LA 5HHPB 2XDHA 3S35L 2BSED 1CGXA 3RL2B 2I25N 2PTVA 1UQSB 2HVJB 2YEZB 3V6OC 3WOVA 2VDKB 4EI5A 1JV5B 3DNKA 2IPTH 3IMRA 2Z64C 3WYRA 4S1QH 1BDYA 3AREC 4GLRH 4LSUL 4Y16C 1IJNA 5HHNB 2XWXA 5L2KE 2D3NA 4M5ZH 4F9LC 3SIKA 4P59H 2FH8A 5EC2A 1Z3RA 2R15A 1D9KD 4LEBA 4LRIA 2F18A 5AZUA 4NOBA 4ESKA 2E9WA 3KCPB 2BNUA 3QEHA 1PX3A 4UZUA 2E8YA 3KLLA 5T1LB 1DQDL 1N0XL 4AJVA 1ACXA 3V79C 3S35H 5IB5B 4ODSL 1S8DA 3I2CL 3FQ2A 3DTDA 1WISA 4FG0A 3C60A 3P4NA 4IHOA 2NTFB 4LSUH 2C34A 2CLZA 2P5PA 5I2IB 3EJCA 4P9ML 2NT0A 2D73A 5JQIB 1D5BB 5I75C 1DFBL 5E4AA 3APMA 4LGPB 3H42L 1WAAF 3O8XC 1R5IA 3IAQA 4N90E 4D9LL 1OGAD 5DEGA 4Q4EA 4M1CC 1DQDH 5EBWB 3MLXL 3RJOA 4Q9RL 1PW3A 2P42B 4JDZA 1NMCB 4HFUL 2Y6SD 3SCMB 1E3FA 1S7WB 2BSTA 1Z3GL 3EIFA 4ZX6A 3LZFH 2NY1D 4GMSL 5B21A 3LEXA 3CMGA 4X9YA 5EULV 1NJ9A 1L9TA 1H6FA 4UI2A 4Z23A 2XWJB 2OCCB 2XRAL 2NRDA 4AC2A 3MCYA 2EE2A 4FULA 1Z9MA 2OYLA 4TTGA 1GZQB 3KPMA 3P3TA 3KL0A 5DMJB 2OV0A 3MVSA 3O9WA 3S3CB 3H42H 4K5LA 5F0JB 3ULVD 5CZXD 4QHNB 4D9LH 1SDDA 1HOCA 4N9GA 4FJ6A 3MLXH 1RHHB 3SDAA 4Q9RH 5ECGA 4KKLD 4XBPB 5DR5L 4BDVA 4P5TA 4DK5A 5JW4R 1AGBA 4U6HA 4UQBA 1CFQA 1CWVA 1KTDA 3MC0A 3MV9B 1ZVSB 2JJVA 2LR4A 3DECA 2WB1A 2ZKMX 3K8LA 4HBCL 2XRAH 1WDAA 4M93B 3IMVA 4NXKA 1U8NA 1AZRA 3CN4A 3TJPA 1HSAB 1YY9C 1DE4B 1ZIAA 4XN8A 1J88A 1N8ZB 4PREB 4APXA 4MKMA 3K4AA 2F61A 4N0FB 1AS8A 3OM3B 4BUQA 3OAYK 3SDYL 3SE9L 1KIPB 4UT9L 43CAB 1A65A 4DQOH 4EZJA 1XGYH 1FYTA 1YNLL 3K3QA 1CBVL 4JFVA 3UZQA 1SFDA 1AHWC 2X4PB 2YXWA 1CL7L 3QXVA 2X9YA 3MRMA 5D2LF 1TVDA 2HSIA 1A7PL 2IBGA 4I8DA 1AYRA 3VFGL 4GQPH 3ILPA 4OQ1A 3GMMB 1C7TA 1WBZB 4FFWC 1N5YL 4FYQA 4XNZB 4KUCD 3QGVA 5A7BA 5A6IA 1XH0A 1KN4L 3SDXA 2E7DA 3SE9H 2OA9A 3D3VA 2GITB 4UT9H 2ZCHL 1T2XA 4FQJL 1U8PA 1ETJA 1YNLH 7CGTA 3OKDB 1CBVH 1EXHA 4XAWH 1Q9OA 2BWDA 3DBSA 3SDCB 3FONB 5C6WH 4F37F 3MODL 1RZFH 1A7PH 3SY0B 2EUVA 3V6FB 4OLXL 4XPFL 4HV8B 1T7WA 3S98A 3RUGF 1N5YH 4EN3D 2BXZA 4P46A 4GIOA 5F72S 3FCBA 4JFEB 1P7QB 2NLJA 4ZQTA 2ZCHH 2K6WA 4JQIA 4FQJH 3TWCL 2BH0A 1VEMA 5IM7B 3ZKMD 1I8IA 4Q0XH 1WS7A 5DO2C 3HB3D 1DEEB 3GB7A 1ZEAL 2EQDA 4NAJA 1OTUD 1PZSA 3T77B 2QV2A 5B1KA 3R0NA 1F2XK 3PGCB 3D08A 3MODH 1WV7T 4P2OD 3TBCA 2KDGA 3GXIA 5GS1B 2BIOA 3A0OA 3ARZA 3QFJA 4O02B 3T9WA 4OLXH 3H0TB 4XPFH 2XJKA 4QLRA 1Z0MA 2FBRA 4KWUA 1ES0B 1BD2B 2FX9L 1JHTA 1NKRA 3GSVB 4FE9A 5C0AB 1MEXL 4NN7C 1GAFL 4Q6IC 2JXMB 3WTTA 4JNXA 3R7QA 3LAFA 3T1FA 3TWCH 2UZYA 2EDNA 3RGVD 5B39A 3QH3A 5CO1A 3TXAA 3UZEC 1OF0A 4A6YL 2QQLL 3QP3A 1ZEAH 1PZDA 3QUXA 3I6GB 3GK8L 1WA1X 5FPIA 3ROLB 4BGLA 1MG3C 1XCQB 3T6VA 1OF2B 3THML 4G8AC 3AW5A 4Z7WE 2ZUQB 2GSIA 4XPGH 2BY2A 4HLJA 5D1XE 5B7FA 2FX9H 3O6ML 3QNXB 1MEXH 1GAFH 4HKZA 4HJGB 5KS9B 1QQDA 4K23H 3I6SA 1NWPA 2NXZC 4B3EA 4TL4A 1KTBA 4Y1AA 5K9KA 3QZLA 1G7MB 3FBQA 5KJRL 4YL4A 4ES8A 4IHBA 1U8LA 5AAMA 4X6EA 2W95A 3M1BA 2FE0A 2QQLH 2ZD0A 3BO8B 1S7QA 5KANG 3ILQC 4YHPA 4AQOA 1I3RA 1JYXA 2G0LA 4IMLB 3RVVD 3GK8H 3MLTA 5AYUL 3G7TA 4RFEA 4FQCL 5FGSA 4FYSA 4WJG3 1RK7A 1F4WL 5JYMA 1JZ6A 2R1WA 3EF7A 2P7TB 3CLEL 4GBXB 2CO4A 2WY3B 2AQTA 3O6MH 3D5OF 5C0GA 4I1PA 2IAND 3BUIA 5FFLA 4R7DB 3ARGA 3CU7A 2JCCF 1XH3A 3WIAA 5KJRH 4V1DA 4QLWA 4PGCA 1HHGA 2D7NA 2LTQB 5SWSA 1HS6A 2V8LA 3SE3A 3T4YB 2R8SL 3BGAA 1DSFL 4FQCH 3H2PA 2CNYA 1JD7A 4C8XA 1E6JL 3UP1A 3CLEH 4RX4D 2NNCA 3S5LG 3BPNC 3K6DA 2V17L 4P5SA 3IWUA 5EZIH 2V7HB 3X3GL 2FLBT 2ZOLB 3ATBA 5JNYB 3U6RB 4X8GA 1FUNA 2XC8A 5CJQL 4TTDD 1NFDF 1OP9A 2XX1A 2AKRA 4HG4K 3KYMB 2YD5A 4JS7A 4E9WA 1TTRA 5FS5A 2GJ6A 4HF5H 3REWA 5JHBA 2R8SH 5I1GL 1GY1A 1DSFH 3BH8A 3ZKQD 1WSST 2B5IB 2BP5M 5IGXL 5L8LB 1E6JH 2EIZA 2GEQA 5F7DA 5IHLB 3KCWA 4NN5B 1O6VA 1W16A 3OKEB 1JNJA 2V17H 1KYOJ 4WWKB 5AYTA 1ZJAA 3ZDYF 3KPPB 2F8XC 2L7UA 3STLB 1SF3A 5I23A 2H3XC 4OAWB 5CJQH 5E8NA 1BIIB 4R83A 2NY5C 2E59A 3SD2A 3L3GA 1UB6B 3NIGB 3IFNL 1FE8L 2XNAA 3D4CA 4CMHB 4U1HA 4RGND 1UXLA 3K2MC 4U1MB 2OYMA 5T3ZH 4BFIB 4OCSL 1XBRA 5F7MC 1QEWA 5F0LB 1OB1A 2EXYD 4P0DA 5IGXH 4OZHB 3NSJA 3OB0K 1QRND 1JF1A 4Y5VB 1AG0A 3MFFA 1TEGA 5JIQA 1EBAA 2CBMA 2V2TA 4ODXB 2ALWA 3PP4L 1HDMA 2R1XA 4XXCC 1P1VA 3BZFB 3KH4A 1R3JA 5EA0L 1EJ8A 2DJMA 4LL4A 1G7LA 4O00A 2W8CA 2J25A 3WMQA 3UCQA 3IFNH 2EO1A 2KC0A 3LH2L 2I7SA 4DHLA 1MDTA 4AGNA 3IDNB 3NH7L 1THAA 3H9YA 3PY9A 1MOEA 4OCSH 4FXKC 2WP3O 4L29A 5E2UL 2LU4A 5F7FA 1MDAA 4H0GA 3O9WD 2CBQA 4PRPB 4QXGL 5CN2A 4JFOA 5E95B 3TA3C 4ADJA 4DFIA 4F15B 4KZEL 1RV6X 2FZ3B 3HPJB 3MBWA 3VI4E 3QDMA 2C26A 5GRZA 3PP4H 2VW7A 5CBAA 3FQUA 4JVUA 3HPLA 4RESB 1TCRB 5LBSL 2VABA 5EA0H 1JK8A 4P5TD 3HG5A 4L8SA 3LH2H 1T5WA 2JJSC 2R4RL 3NH7H 3FOMB 1AY1H 3UC0L 3U9UA 3TEXA 1MLCB 2D8KA 3H2WA 4X0KB 3VXOA 4A2FA 2VDQB 2ZAHA 5DHVH 4JE4B 5E2UH 5TDOA 1T2QH 1UT1A 4BK5A 5CD3B 2H32B 4QXGH 2XG4A 5DJ8B 3PF2A 1KGCE 3VXQA 1ZLEA 1O5DT 2NUTA 3RWFB 2KPNA 1GGBL 1TTAA 5DI8B 5AW1B 3US0A 4NQVB 3HNSL 3BP6A 4CGUB 3GBML 5LBSH 4WI4A 5GS0D 2NDGA 2FGWL 3MOAL 4A63A 5FW7A 4F58L 2WBWB 5CGYD 3QUKB 2KI6A 2RHEA 4M3HA 2W9DL 2R4RH 4V33A 3ZO0A 3UC0H 3QHFL 3NRQA 1FGVL 2Y5TB 2WXHA 1AMXA 4N6RA 3HBQA 2ZKYA 4J3OD 3COOA 1WVZA 2OZ4A 5C07B 4KY1H 5GIRB 2VYRE 4M6ML 1T7YA 4G5ZL 5KBLA 2Q10A 5F7BA 3SOBL 4ZO9A 2HKAA 4JY4B 3HNSH 3GBMH 3BISA 4XMLL 4WO4A 4F2ME 4Y2OB 4MB3A 5F7KC 1Y18B 1UXSB 2FGWH 4M43H 3D3VD 3MOAH 4MVBC 3SE8L 4UMGA 4F58H 1LL1A 3IE9A 4PWFA 2W9DH 2D7TL 5ANMB 3T0BA 4GQZA 1UM4L 3QHFH 4NGHL 1FGVH 1SXAA 4KK6D 4HCRL 4PGJA 4X5LA 2BOBA 3VJ6A 5LQBH 5EEVA 1QR4A 4NPJA 1I1AB 3AXIA 5IHUH 1RLWA 5EOCL 3SOBH 2ERJB 2KKQA 1X9QA 1KNOB 2BSCA 4PVBA 4NKMB 4U4IA 3FSVA 4XMLH 2FK9A 5DMGC 3SE8H 1M1XA 2I24N 4PGBA 2R7EA 4J3BA 1OVZA 5HJ3A 3QI9A 1XT5A 2D7TH 4FDWA 5BXFA 2FO4A 4Y88A 3HHRB 1A4AA 1HWWA 3VFVA 2PR9A 2NY2B 4IMKC 4AYID 2ARJA 4HCRH 4ZPTB 3T6QC 2JKTM 2AAVA 4XCCL 4KI5D 5DUBA 2Y7LA 4X83A 1ZT4A 4WI7A 5EOCH 1QTYT 1XDTT 1INQB 5JPMB 3L3IB 2VMJA 4PJDF 4KXDA 1S5HB 3MA9L 4D8OA 2I9TA 5GISL 2ZKWA 4LLUB 3ESNA 4WGVB 4XNMA 4J12A 3ZTNL 1BG1A 4YSAA 3GBEA 2VB5A 5BZDA 5MERB 4PJFF 1GIGL 1PFCA 5EFIA 2Z1KA 4XCCH 4JM2A 3UTZB 4L4TA 3RJDA 1HT6A 1FNGA 5I71B 4XN4A 1QSZA 3BN9C 3OZKA 3X13B 1R47A 3U48A 4EUPA 2H0PA 3UPAA 1T0NA 5KBPA 3MPCA 4TSCL 3MV8E 3MA9H 3POCA 5GISH 4Y1AD 3SGKA 3W0WB 5AW0B 3MRLA 4Z3GA 4LSSL 4E9TA 1LVEA 3ZTNH 4L2YA 2OSLA 1X3DA 3TJEL 5DJXA 2W0FB 4AVHA 3M88A 4MXWL 3DK0A 3DOIA 1T6WA 1L6ZA 1R24A 3N1QC 5HHOA 4NM4L 3WN6A 2QFRA 1NOAA 1IM3B 3RJQB 3ULVF 1E2WA 3C12A 4DOHB 3A4AA 1IAKB 1BX2A 2AMUA 3P3UA 4A37A 3OWEA 1TQUA 2BERA 4NP4L 4X7TA 4GRWE 4TSCH 4K7PL 2EDOA 3FUKA 2QKIC 2VLME 1WZAA 3ARGD 4AX3A 3BHBA 4UZSA 5FYJU 4V1DD 2Y06L 2YFNA 1ZTMA 2WZ0A 3LCYA 4JUSA 1M6UA 4GT0A 4WJ5B 4I18A 3TJEH 4A7TA 2XWDA 5EEWA 4OF7A 3KLQA 1L9NA 2XY2A 3NIFB 4MXWH 3WELA 3E80A 4NSKB 4NM4H 4XBGB 4Y19D 2WLIB 4YHIB 3FK3A 4Z7OF 1TT6A 3BPCB 2TRYA 4NP4H 2M1KA 1PEWA 3MNWA 4K7PH 4TVPE 4AIXA 3FU0A 3DX0A 4H88L 4HIJB 3P9MA 1M9SA 4ZW5A 4CNIB 2Y06H 1V3JA 2IFGA 2WQXA 5F9WC 4G8EB 4L0PB 4P06A 5GGTA 2GJ6D 4MQ7A 4YDNA 3TJHC 3BI9X 3FF8A 5CJOH 3EJUA 2WXJA 4AE1A 4CKQA 2MQCA 1J8HE 1BBDL 1GRWA 3CH1A 5EC1A 2NYKA 1SXZA 4M8UA 5F6HJ 4DEPB 1OPGL 2Y1AA 5T5NG 1P4BL 2VC2B 1NM9A 4WF7A 5F1NA 5LGYA 1IC0A 3LPFA 4KUCF 4FQXB 3GF8A 2HJFA 5CLZA 1JNLL 1NLBL 1MCNA 4G43B 1XIWD 3O4LA 1KJ2L 3EOYG 4NPKA 3QXUA 2KLRA 4U1KB 4ZUSA 4N1EA 3KDMA 4FF9A 4NC1C 3GHEL 4TV3A 1D5MB 3HS9A 4ZDHB 1NSNH 3BH9B 1JZIA 4S11A 3L08A 3NP3A 3H4HA 2JLLA 2N59A 2GTWB 4NUJA 1BBDH 1UKSA 1JHLL 1OPGH 1X5JA 3B9AA 4CN6A 1P4BH 2YPVL 3B9KA 1J12A 1GW0A 4ZX5A 1ZE3C 2KMWA 5TDPB 4NNXB 4BH7A 3OC8A 1JNLH 4XOEA 3EYFB 4IU2B 4J7RA 2YAEA 2PMZA 2X70A 3QEQE 4PY8I 2EXTA 3MO1B 2ZWZA 1Y0LA 2GJRA 1ZSDB 3EJYD 5D96C 3TC9A 4H8PA 1TFPA 2VZSA 3RURA 2EDTA 3S4SA 2QVIA 3AZUA 5DJDA 4PY7B 1VFBA 1NAKL 1IGMH 1H6TA 1ZHBB 2AQQA 2WOBA 2QVMA 3KPLB 5EU6B 5AFAA 2YPVH 3H54A 4JZNA 1MSPA 2Z7ZA 3B9VA 3I02A 3ULVH 3G04B 2K7QA 4HKXA 3GXFA 4Z7UA 3QDMD 4OF8A 1QFUL 1V8HA 2OR8A 1WIUA 1CQKA 1G4RA 1PAZA 5FDWA 3VFWB 4KKAC 3WHE1 2AEWA 2YWZA 5E2WL 2EYSB 1PMYA 2J20A 3F84A 1SYSA 3QARA 4LLVA 4XCEB 2DM3A 1OCRB 3U7YL 2QPFA 2C4XA 1KCRL 1FG2B 4AMWA 3ZZSA 1NAKH 3VFSA 5DS1A 4GXVL 3HBZA 1AVAA 4X6DE 4XNBA 5HHPA 2X4RB 2BK8A 2BLFA 3RL2A 5HI3C 1QP1A 1UQSA 2DLIA 2HVJA 2YEZA 4JKPH 4Y4HC 5L4FA 3L95A 4IDLA 1JV5A 1DR9A 5KOVC 3TCLB 3ZYIA 1EAOA 1QFUH 2EDWA 4F9PC 3ZYZA 1MWAB 3LX9A 1SXCA 2BP0B 1JK9B 2IGFL 1SMAA 1J18A 3TBTB 5E2WH 3GUFA 2VLLA 4Z7NF 2J8UA 2ZCKL 1FWXA 2BFVL 2EDHA 3OAYH 3BAEH 4FLSA 4KMTL 3U7YH 3B4NA 1U58A 3DO4A 4MHHG 3KCPA 1KCRH 5FHAL 4OGXH 4GXVH 4RSYA 1A4BA 5T1LA 1XEDA 1OGSA 1L9OA 2FSDA 2VMCA 5IB5A 3T6ZA 2UX7A 1RIVL 3RVXC 1BOGB 4E41B 4HUUB 1R33A 1WD8A 3X3FH 2NTFA 4WO4D 4PJGA 4JFDD 3QZWB 5I2IA 1OTTC 4GINA 2ZCKH 1D5BA 2BFVH 2IQAB 4FXGC 1OHQA 5AVXB 3MAWA 1IE4A 3C6LB 3VFUB 3ARUA 3Q7JA 2B7DT 2CHNA 4FNQA 5FHAH 5EOQL 3WEMA 1RK1A 4Y2DA 1QVOB 2E46A 1TO4A 2R0ZL 2CUHA 3D50A 5AVYB 3VXME 2WV3A 5EBWA 4J1UB 2WZ5A 3KPSA 2H2PC 3QSKB 3BRGC 2GI0A 1RIVH 4BXSV 1S7WA 3DTXB 4BFFA 2F53B 3SHSA 1NFIB 4LKCB 3OLEA 2Y2WA 3JUYA 1N2RB 3MXVL 1Z9NA 5DC9B 3SKJL 4PJBB 4I77L 2XWJA 3L16A 1U3JA 3ZDXF 3RRQA 3QI9D 3AXHA 4TNVK 5J12B 1UA7A 3H6JA 3MZTA 5JR1L 2IC2A 4QHNA 1CICC 4QRRE 2R0ZH 2VUYA 4ODUB 4GQRA 5DVKA 1RUKL 4GW5B 4X6BB 1K5WA 4LASH 3RX5A 1BP3B 3JVFC 2HMID 3PWVB 3I50H 4XBPA 3IDJA 3DX9B 5BS0E 4OV5B 4L1DA 3MXVH 3MV9A 1ZVSA 2RA1A 2ZOUA 2EZ0C 3LRLA 3SKJH 4QJ4B 3CE1A 4I77H 5KBDA 4OLUL 5AVRB 3IGAB 2FO8A 4G8GB 1P7HL 1HSAA 3TFBA 5JR1H 1N8ZA 2A6JB 3A67L 1OCZB 5E4EB 3T04D 4N0FA 4L4TD 5FUZH 5HY9B 5J89A 3B2UC 4JRFA 1M6OB 3QXAB 4MD5B 1KIPA 2BVQB 3FH8A 43CAA 4A38A 4OZGB 3WIHH 2OJ1A 5IVOA 1BVZA 5JHMA 4HU8A 2WZ6A 2X4PA 3MMEB 4K3GA 3RY4A 4DGYL 3KXFB 3X12B 4NXSA 2HKHL 3ZE2B 4OLUH 5DFWH 4XBMA 4XR8C 1GYWA 2X4QB 2C9PA 1TQTA 3GMMA 4Z7VE 1WBZA 3A67H 5HHOD 3VRJB 2E47A 1TO5A 3CGTA 3IJSA 3H1ZA 1DHKA 1WBYB 2GITA 1XCTB 3M1OA 2NCEA 7FABL 1WTLA 3B2VL 1MJ7L 3VX1A 3WNPA 2VXVL 1FF5A 4DGYH 3SDCA 2HKHH 3FONA 4DKTA 4GFTB 5IVXE 2HPOA 5KYWB 2VIRB 3T0AA 3SY0A 1OW0C 2YQBA 1DUZB 2BP3A 2EKSB 4HV8A 5IMKB 4I2XA 5H94B 2WBJC 3BW9B 3KWTA 1O75A 4JFEA 1P7QA 2FBJL 4XOBA 3OGOE 5AW5B 2WYZA 3OMZA 5IM7A 7FABH 2ZP9A 5JTWA 4WENB 1LO0L 3B2VH 3CVHB 3G5YB 4XNQB 4GUOA 1MJ7H 3LTVA 3QG6B 3RIFK 5HYSB 1DEEA 3T77A 1E3XA 2W65B 4FQQB 3AADB 3PGCA 4PJXE 5H4ZA 4G82A 1X4ZA 3NZ8B 1HHKB 2OSYA 2QTEA 5GS1A 3H3PH 1AXTH 3U4KA 1JZ3A 1CZ8L 4O02A 5ACZA 4J3OF 3H0TA 3CVCA 1KEML 1KCUH 5IMLB 4HWBA 2A4EA 2MCG1 1JPTL 3QVAA 4XMWA 4ZNEE 1OAZL 2JXMA 1PY0A 3IDMA 3R8QA 2F7QA 3FFCA 5FWRA 2OTUB 3ZOAA 4OB5L 2SEBB 2FBJH 3FN0L 3IDUA 3SDXF 3WJLC 1BF5A 2LVCA 2NQDA 1LO0H 3O4LD 5AAPA 3ZHDA 3ZYOA 4TSBL 4XPHL 4MRCA 3VDCA 4FI7A 3LPPA 1UZ6E 3I6GA 1KIQB 3ROLA 1LE9B 3EF4A 1L5GA 2J4WL 1XCQA 3V5HA 4BHUI 1OF2A 3L1FA 4E5XG 1T03L 3DHUA 1SGKA 1DANU 3K4DA 3Q2VA 1KEMH 2APVA 4JO2H 3AM8C 3QNXA 4JN1L 1OAZH 5E00B 4HJGA 4OJDH 1W0WB 5KS9A 4N86A 3B9KD 2A9BA 5AZ2L 1ZLWK 2DH3A 2YRLA 1G1OA 3OGCB 3FN0H 1G7MA 4BFRA 3G08B 2YRBA 4ETQA 3H3KA 4F8PA 1E2ZA 4K3DL 1BGXH 4AE0A 4ANXA 5BV7B 2OI9B 2YIHA 5IBLD 3OB0H 3BO8A 3CSYB 4N5ED 4TSBH 4XPHH 1K8IB 1HHHB 2PO6C 4IMLA 3VM7A 1U4FA 4Q97A 3P0VH 2FT6A 2J4WH 4PJ5E 1ZPUA 3ZKNC 3OHXC 3DYPA 4ZTPL 1T03H 2P7TA 1BZQK 4GBXA 3FQ4A 3B34A 1QMUA 1QHPA 3L3DB 4KI5F 4RFNC 1DTUA 1U33A 3ISYA 5DRZB 4JN1H 1NKGA 1JPST 2APTA 1DQJB 1KT2B 1XO8A 2JKRM 1JPFB 3QG7L 2ZYHA 3TT3L 5DD0L 5KSBE 3Q6FB 4R7DA 4KXBA 1KJMA 4BHUA 4LPYA 1QZNA 3Q2CA 4K3DH 2V33A 5JO5B 2QVFB 4K73A 2F58L 2NYYD 3T3MB 1KTCA 5KVMC 5I76B 4D0DB 2NY6D 1WBXB 3T4YA 4JFSA 2VLKB 2WJ5A 4HIQA 4NQCE 1YPZB 4ZTPH 4LCUA 2N56A 1WIOA 1Q1PA 4OJEH 5JXEC 3ATAA 1CDCA 4S1DD 4YGVB 4XVTL 4KRPB 2V7HA 2G3MA 3TT3H 3IEAA 2ZOLA 1I8MB 5JORB 5DD0H 3U6RA 1A6AA 2VDNH 4EE2A 4U1LB 4HJ1A 4X7CC 3V10A 4I3RL 4IKJA 5BVJA 4ZO6A 2LT9A 1KTRL 1H3WM 1G7PB 3SQBB 1AOZA 2F58H 2E7LC 4MXQD 3U2SB 3KYMA 1KN2L 4QGYA 1CXFA 4ZMYA 1UD8A 4S0TD 5FYKU 2MSPA 3MREB 5C71A 3CN1A 4P4KC 3NGBB 4MJIE 1S78C 1PDKA 5DUPH 4D9QD 1VPOL 1U91B 1XGZA 3G6JB 4WK0B 3SE6A 2XWBB 2J72A 3OKEA 4IIQB 4WWKA 4XVTH 4M7LT 3DHPA 5JZ7D 5T1LD 3KPPA 1A64A 3GBDA 3JVGC 1GH7A 3STLA 3UJTL 4S2SB 4OAWA 1BIIA 1JHKL 4I3RH 3T08A 2CBPA 3H2QA 1UB6A 2FHBA 2A9CA 1AGEA 1KN2H 2CSPA 2VOTA 2ZJSH 4ETYA 3KWXA 4U1MA 1I1FB 1D7BA 4LEXL 4BFIA 1G9MC 3LHPL 2WIIB 5BOZG 5D1XC 1XZ0B 2QSQA 4N2DA 1M57B 4OZHA 1P84J 4P48A 5I8EA 1LWJA 3KS0J 2D7OA 4M5YL 4NOFA 3EJZD 3MRDA 5BRPA 4ODXA 4FHJA 5TK2A 5HDQL 3U36B 4NRXB 5T1MB 1E7VA 3AS2A 3UJTH 1CK0L 3BZFA 2CE6A 3SCMD 1EDHA 1TPXB 1JHKH 2COQA 1JUFB 3L4ZA 2B1HL 4GS7B 4HCFA 1UCBL 1J9CT 1T22A 3IDNA 4NQEB 3LNFA 4LEXH 1OAQL 2GABA 3LHPH 5F88B 2A4ZA 4M00A 1QHOA 3TCTA 3DRTB 5JIPA 3N0PB 4PRPA 5IP4A 1NDTA 1ASPA 1SY6A 1AHKA 4M5YH 4XNXL 1F86A 2DYPB 2FZ3A 3HPJA 5HDQH 2ZG3A 4ZYKA 3HRZB 4OJAA 3FT3B 5HI4C 5KYYB 1CK0H 1TEYA 1HILB 3GSXB 3BD4A 3GSOB 1OK0A 2WXGA 3I74A 5C08B 2B1HH 4PM1A 5L2JB 1DBMH 3LZOA 1UCBH 4HK3J 3MV9D 5CLWA 5KG9B 3FOMA 2K8QA 1UASA 1OAQH 3ZSSA 1TNMA 4X0KA 4BXVA 1ZD6A 3SZ6A 3C5XA 4EF3A 1OZUA 2H32A 2YXMA 4XNXH 5DK0B 1X5LA 5GS3A 3VDBA 1G0YR 4LSQL 4BSWB 4FRWA 4LOUD 2AEPL 1PKQB 4JDEB 3A6BL 5DI8A 4NQVA 4FNRA 1MCLA 2LLNA 3V4PB 3QQ9D 2IAAC 5KOMC 4PGEB 3Q5OA 3EZJB 1NBVL 1MFDL 1IAIL 3QUKA 3DO7B 3PGDB 3M17B 2O5YH 5A2AA 4KK9D 3T0EE 1OOWA 2UY6B 3B7SA 4OCXL 2AQPA 1ID5I 1DJSA 2Y5TA 2PLTA 3IDGB 3SJVE 2CR0A 1U3NA 4P5KB 4FG6D 3AGWA 3GPSA 4UU9A 2X7LB 3ARDB 4LSQH 4FD0A 5F6IB 4JY4A 2AEPH 1IQDB 4ACPA 3GQFA 3C9NB 4JREB 3ZIMA 5ISZB 3SODB 1Y18A 1P5VA 1UXSA 5J1SC 2GYSA 3JTTB 4LVNC 1NBVH 2A38A 1MFDH 1SFHA 4NKOB 1RSYA 5ANMA 3H85A 3HG1B 2W1NA 3B1UA 3V8CA 1VFAA 4N2MA 4OCXH 3SDCD 5DVPA 3WXWL 5FM5M 1G0XA 3ILDA 1MJJB 1RK0B 3ESOA 1EAPB 1I1AA 1YQVH 2VL5B 3T4AB 5DWPA 4Z7AA 3MNMA 4JFHE 1KNOA 2CO1A 4I7ZC 3NBNA 3LVTA 4NKMA 1SJEA 2F54B 1PAMA 3DHJA 3N1GC 1P7QD 3DC0A 4JFED 4V11A 3SYCA 4YDLB 4KVPA 1NOFA 3DETD 1AD9B 3JWDC 1YEFH 2JCWA 4LAJH 5EBMB 2GW5A 2W9LA 1XD0A 2EE0A 4KKZA 3G3LA 4ZPTA 3EOBB 4BZ1A 4A04A 4GW4B 2ZWKA 1A6TB 1UT2A 1EVTC 1YNTB 2HT2D 3H9ZA 3FPXA 3MX0B 2YUVA 4N22A 4GY4A 4PYHA 1INQA 1QLFB 5BQ7A 3L3IA 4ATWA 2WXOA 2VN3A 1H8LA 3RIAK 1BD2D 2H4EA 5C0AD 4WKZB 3KDPB 3NSDA 3CBJB 1S5HA 3K72B 3K74B 2PPFA 4LLQB 4LLUA 1A6ZB 3A47A 4OCNC 2X1XR 1MQKL 4YJZL 1QR1B 5E1QA 3EH1A 3PQYB 3DVIA 3VWKC 5E2JA 1YUHB 5MERA 4IGBC 1SJMA 3MV7B 2GK2A 3VWJC 3L7EB 5KVEH 2VUKA 3H9SB 3L3OA 3UTZA 1IGTB 2C7FA 4L9LC 4FXLA 2Z4TA 3CV5A 5A7EA 1JZ7A 1I7RA 1A9BB 3IMWA 2PETA 4GAAA 2EC9T 2FDBP 5B3NA 2APWA 4QRUB 3W0WA 5DZLA 1SRDA 2ZXQA 3ERXA 1MQKH 4F57L 4QKTA 3LMJL 2QPEB 4M02A 3OXSA 2W0FA 4LVEA 5KBMA 5JMRA 4ODTH 1KTLB 4AM0B 3NZUA 1YLBB 1ZT7B 4JK0D 1KZYA 3V9CA 3OV6A 1IM3A 1MI5D 3ARBC 3E2HB 4B96A 4B95C 4PJEE 5IR1A 5EF2A 3RPIB 2YA0A 4WUUE 1V7ML 2XWRA 2R1YB 2WQWA 4KROC 2QADB 5D7EA 4E9YA 2W80C 5JHLA 2C9RA 2VGLM 4F57H 5GXBB 2ZWLT 1TSHA 3LMJH 4JPVL 4R5XA 3QDJB 3II2A 1TZIB 4WJ5A 1BYOA 3QIWC 1PVHA 3QXTA 3STBA 3FC8A 2BVTA 5CSBA 3IRPX 3MJ8B 2RACA 4NSKA 4DZBB 2H1PL 2WLIA 3AREB 4Y16B 2E8ZA 1LP9B 5EOTB 4QRQA 3BPCA 2X42A 1DVUA 2VKXA 1V7MH 2OZ4L 1ZV5A 1VZIA 4GMTL 3KPRE 1S7RA 2GUYA 4HIJA 4MJ5B 3GXDA 5C3LD 2EABA 2LU3A 1HL9A 4JPVH 2CIIB 3BZ4B 3QBTB 4EIBA 1SVCP 1CI5A 4G8EA 4V2CB 5HJGA 1QNIA 4LGSB 3PL6C 3L2MA 4OKVB 2H1PH 4HOZA 5DLLA 4OVUA 1CXKA 4FA6A 1H3VA 1T1YB 2J6EA 4W9HC 4PJHE 4WWKD 3QDGB 3RI5K 4I0PC 1IGYB 2OZ4H 4G43A 5I75B 3TZVA 3BOVA 1EO8L 4GMTH 2H45A 2W81C 4A1RA 2AQ2A 1W91A 3OKKA 2DWEB 3O8XB 3QORA 4U1KA 4LOFA 1EH9A 3ARPA 1G5GA 4L05A 1T21B 2VJ0A 1IVTA 2X2UA 3BH9A 4ZDHA 1U8OB 2JB6B 4UZGA 3PP3H 2GTWA 2HTLC 2ZYIA 4NO0B 2AJYL 3U6XS 2Z31A 3LZQA 4GI9A 1PZ2A 3MV01 5GRYA 3VSUA 4BIKA 1JGVL 4P2RB 1RH8A 2ESVB 5TDPA 4NNXA 2OSWA 2E0PA 2HT3D 3P9WB 4ZMOA 4PBXA 3EYFA 4YZFE 3IK2A 4IU2A 4YLBA 3UGXA 1A6VL 4CADB 1EO8H 2K70A 2WXKA 3MO1A 1GYUA 3AC0A 4AQAB 1NBCA 3IT8D 4KZ0A 1RERA 4HWEL 1ZSDA 5F7EL 4ZW3A 2Y5QA 2R2BB 2H26B 1RUMH 1BXXA 3DROB 4N2EA 3DIFB 4K9EL 4PY7A 1P9MC 2AJYH 4XP5L 5HTSA 3KPLA 5EU6A 1IIKA 3DGGB 1JBJA 3K6FA 4Y9EA 1IZKA 3TIEB 3L2NA 4PRPD 3C75A 3G04A 4FFTA 4GQ9L 5F70A 2R4SH 2R83A 1ZLUH 3CFQA 2B08A 3ARYA 4HJ0D 4XN2A 2VAAB 5AOMA 3VW3L 4A68A 1A6VH 4FFVC 3VFWA 1CGSH 1KPRA 4C83B 4HWEH 2EYSA 5D1ZC 5F7EH 1NGZA 3GSQB 3AY4C 5F9JB 3K81A 3QUYD 4XCEA 2E6QA 2MQGA 2HA1A 1QO3A 1KOAA 1S7VB 3S8WA 2D31A 1EMTL 4K9EH 1IM9B 1ZHKA 1P69B 1JWUB 2AQSA 1TZOA 1IGFL 5FKAB 1AHWB 4MKTA 5CJXA 4GQ9H 3QCVH 5T3XD 1DQLH 4FQIL 2FLRT 3MLRH 1ROWA 5E99L 3TCLA 4ZMLA 3K6SB 3VW3H 4XXWC 4AVJA 1OO2A 1MWAA 5B3JE 1TJGL 3B7RL 4L1SA 1JK9A 4BE5A 4ZMAT 4EUPH 3TBTA 1OV8A 1OP5H 2Y23A 4F8QA 4TQEL 1LO3H 4RZKA 2X2HA 3VE0B 3NFPB 1H9VA 1IBFA 3GRBA 1OHZA 2YUZA 1EMTH 4PTUA 4TSAL 5EWIL 3T8MA 4X7EC 2HX8A 4IBLT 2P9RA 3DV6B 5BOPA 2AQ1A 2A5UA 2OPCA 3F6IA 2QFPA 3BVWA 4FQLL 3BLKA 1IGFH 1NC2B 5C07D 2CO7B 3F00A 1KLFB 4G6ML 2ATPB 4ZOCA 2K3HA 4JRLA 1BOGA 1CXIA 4E41A 3E1F1 5E99H 2WQRA 4HUUA 3GBLA 1UT9A 2AJSL 4R26L 1JPSH 5I26A 4N4YB 3VGHA 1TJGH 4Z7UF 4R2GC 5E51A 3Q8EA 3QZWA 1N67A 3TPUB 4L4VE 2P5EE 4TQEH 2IQAA 4E9SA 1JGLL 1KULA 3WD5L 3C6LA 1BOYA 1REIA 3MLWL 4KO6A 3VCLB 4MJJA 1ZGLP 4AKPA 4TSAH 5EWIH 4N2IA 3T0XA 5BW7C 5JLZB 4HZLB 3WKNA 3F12B 1EFQA 1QVOA 4YDIL 3IU3B 2XIIA 4J1UA 1T83A 4FQLH 1I1AD 1XZWA 4U6YB 4G6MH 4A2EA 1I3VA 1T89A 2IIJA 3DTXA 4QUOA 5I0WA 1KJ3L 1NFIA 3RDTC 4LKCA 3UH8A 4GUQA 2ENJA 2AJSH 2X28A 3O41B 1CDJA 4G9FB 1NINA 2Z35B 4R26H 1MHPH 1N2RA 2VQTA 4PJBA 4ZJ9A 2X4OB 4LL1A 2NTSP 4W68A 2ZWYA 5GGVY 4ELMA 5PAZA 2BY3A 1KC5L 1JGLH 2PCPB 3QQ3B 1FZMB 1IQWH 1Z5LB 4IOFC 3MLWH 2WUBH 2BVOB 1XF3B 3WD5H 1PJ9A 5F3FA 5I16B 4M7ZC 2F7IA 1B9ZA 4HK3N 2NY2D 1VIWA 4ODUA 3UP6A 3RB5A 1I8AA 1NPJA 4GW5A 4X6BA 5HHMB 2EP6A 5GGTH 2AXGB 3KW7A 4A7GA 4YE0A 2Q76B 3PWVA 2DWSA 3LV3B 2DS4A 3FUEA 4JFPB 3WTUA 2HTKD 4DN4L 3DX9A 3KLDA 3MGTB 4B9JA 4OV5A 1CVSC 5IJVB 3RKDC 1X5AA 3CBRA 1E65A 1UOWA 2O6PA 4KRLB 3IGAA 2WOYA 5ALBL 4N2CA 4LLDB 1BW8A 1YG9A 1YMME 2NXZB 4G8GA 1NANI 1CD1B 3GIZH 1ZS8A 1Z9LA 1KB9J 2G9KA 2P8PB 4Z76B 1JS4A 2HN7B 1M6OA 2DOCA 4KGJA 3SKOB 3QXAA 1W0YT 1U92A 2BVQA 3PHQB 4YSPA 4DN4H 4OZGA 3BMWA 4D9RD 1U8KB 1QBAA 2Y0SA 4JJOA 3RYMA 3MMEA 4KTEL 3X12A 1J5DA 3FU8A 3W0WD 3QJSB 1Y6MR 4PJIB 5ALBH 1TQCB 4QRPE 1OLZA 1ZLWH 3VRLE 3EG9B 5D6CB 4XO8A 3LH8A 3CU1A 4JJHA 4ZOEA 1JCKA 1BEXA 5FO2A 3CSGA 1JSYA 3DO3A 5BRZE 4Q56A 5IW6A 1OZTG 3QEUB 1IM3D 4YHKL 2E9IA 3VXNB 2C9QA 3RL1B 1XCTA 3MNZB 2WXQA 4A2LA 5K59E 4CILA 2ICWJ 3PIQB 3QHZH 5IT2L 5CZKA 4YBQD 4M9PA 1J86A 4KTEH 2VDKL 5BVPL 3BPNB 3D87B 2MCPL 1JGDB 3TF4A 2O93L 4P23A 2VIRA 5KYWA 4ZZKA 3BRFA 3LB6C 5C0FB 3C8KB 5C0BE 5HP5A 1DUZA 4FTVB 4MCYB 1D7CA 3CNKA 4UBDD 5H94A 2W59A 3FB7B 4CSSA 2B16A 4YHKH 3BW9A 1GZHA 2ADYA 4PP1D 4YQXL 1OM3L 3FOLB 3UGEA 5IT2H 3B1TA 4J6RL 1Z2KA 1XB3A 3CVHA 3IPBA 5HDLA 1BJMA 5DUML 3BMVA 1OSPL 2VDKH 4M61B 4MXVE 5BVPH 1PL3A 2W65A 2MCPH 1OPOA 1L9MA 4UOW0 5IOKA 1PF3A 2YWYA 1PNDA 4RMBA 2V3DA 3NZ8A 1HHKA 3LNIA 1CS6A 2DQFB 1TVBA 4OFIA 4N8CL 3A4EA 2ZUTA 3MBEA 5IMLA 2WWKO 2BNQB 2FAUA 4N25A 4NENB 4BQ6A 3EUUA 4NZJA 1KGXA 3RZCC 4WDIB 4ZX4A 2OTUA 2SEBA 1OM3H 4Z0XB 2ZXBA 4FQXD 3PV6A 4J6RH 4HA1A 5LCVL 5ELIA 5KSUB 5DUMH 1A7QL 4MLIA 3ZHFA 3W57A 1KIQA 3Q3GB 1LE9A 4C56B 1QSEE 2GAZB 5CBEB 2ICEC 2JELL 2VT0A 2C9UA 4PLJC 4N8CH 4U7MA 3VNZA 2F08A 5IB2B 2NZ1A 5IZ7A 2FQFA 2F7PA 5E00A 2CKNA 4Z18A 3VI3F 1W0WA 8PAZA 1OOAA 3V9EA 2IOIA 3IYLW 4JHVA 5E4OA 3BSZA 3WFHB 4ZMNA 1PX8A 3O6LH 2DN7A 3OGCA 3G08A 1FFPB 5LCVH 1AJ7L 5KJ7E 3FXIC 4FXKB 3RFZC 4JRXA 5F9OL 3CSYA 2EO7A 1K8IA 3TA3B 3UTTB 4G6JL 1I7ZA 1HHHA 5DD6B 1A4KB 4OF0A 1T66C 3PWNB 3S97C 2JELH 3OKMB 4ZS6D 4JM0A 2E86A 4NPYB 4JZOB 4QTIL 5GGSA 15C8H 1YECL 4K3JL 4RA0C 2WLMA 5DRZA 1DQJA 1KT2A 1JPFA 1GGUA 5SX5H 4ORZC 3BFWA 3Q6FA 1BVNT 3CN2A 4X2UA 3N5AA 2QVKA 1AJ7H 4ZUTB 1HIML 2BC4B 5JO5A 5H4YA 4EDXA 3BAKA 5ICZB 3TNMB 2DEXX 2KT6A 4G6JH 4WU5B 5I76A 1DDHB 1T0MB 1TETL 2J43A 2C1PB 2VLKA 3HE7C 4HUCA 4UV4H 3LKOB 4Z78B 1YPZA 4HS8L 5IG7B 3EDJA 1ACYL 1XR8B 4QTIH 1BG9A 4PJ8C 3L13A 1YECH 3GJFK 4K3JH 3V0HA 4DP5X 5CLYA 2Y72A 3RGHA 4XVSL 2CHWA 1MCFA 4FL4C 5JORA 2DQIL 4GKZB 1I8MA 4HXAH 3KBEA 4LBEB 4U1LA 4J23A 5KS9F 1HIMH 3HJEA 3SQBA 4JFUA 3U2SA 2A6DB 1OAYH 2EIMB 5I18L 1TETH 4ZXBC 3MREA 1M56B 2Y2YA 4HUNB 4PLOB 4RFOL 3QUHA 4HS8H 1T4KB 3PG2A 1AZVA 4LP5A 2NR6C 2XWBA 3RG1C 4UT7H 4RRPG 4DERA 3P30H 4IIQA 1UJTA 1IEAB 4O58L 4XVSH 2NOYA 2ILLA 1IEHA 1RUPL 4LB8A 1BVLB 1Q9LB 4S2SA 1MNNA 4MMZC 4E41D 3CPLB 4G5AA 2FO1A 1L0YA 2PPEA 3NESA 3DLQR 4TYUA 1E5AA 1A66A 1I1FA 2OS7A 2WIIA 2Y1VA 3U4EB 4AH2B 4KDWA 5E6UB 1XZ0A 1JN6B 3C6LD 1Q0YL 4DUVA 5E1AA 3VMNA 1MHCB 2FIRT 2R27A 4RMRA 5L9DL 2WQVA 3ATEA 1PGRB 3PWLB 2Y36L 3M1CA 4TM9A 4NRXA 3U36A 1FN4B 2QQQA 4LCIL 1RUPH 5T1MA 3VH8A 5A3ID 5FEBA 4IKLA 2AS5M 1UGKA 2CO2A 2XZCH 2L7EA 2F53D 1NWOA 4CVXB 1JUFA 3DXAE 1GOFA 4NLHA 2GFBB 3CHOA 3DKHA 4IJ3C 3BWSA 4J3UA 3DVNB 4NQEA 2CCWA 4YC2C 4KJQC 5JYLA 4YPJA 1CFVL 5E6ZA 6CGTA 5F88A 4RISL 3FHQA 5F7NC 3HG4A 5ETUB 2BY1A 3N41B 2EYRB 2JKWA 1KG0B 1Q0YH 4QCIB 2V7NB 4DP4X 2E7CA 5HDBE 4QHKJ 5L9DH 1OARL 3QWOB 4GOSA 1KIUA 1I8KB 1R19A 1Z9OA 3HRZA 4O02H 2DYSB 3FT3A 4L5FL 5GJTL 5KYYA 1ERNA 1HILA 2IOOA 3GSXA 3GSOA 2JJTA 3PWPE 4GEIA 4NJ9L 5EZPA 5J13C 3WSQL 5C08A 4TOYL 3WAKA 4FABL 5L2JA 1FYTE 5AVUB 1ZMYA 4N3UA 4AQ8A 3EBAA 5KG9A 3PWUB 3NIGF 1CFVH 4C58B 1W8OA 4RISH 1I85C 2IH1A 4X6CB 5EHFA 2UY7B 4ZX3A 4G8GD 5E2VL 3ZO9A 5DK0A 4B97A 3GI8L 1A6UL 1OARH 3HZVA 4LU5L 2BFGA 4OZHF 3AROA 2BSSB 2LOEA 2DQDL 4PTTB 3F7VB 4JDEA 4RCAA 4L5FH 3N6YA 3BH4A 1TTFA 4NJ9H 1EXUB 4PGEA 4RAUB 3WSQH 4I13B 5I1HL 2H3KA 4YR6A 2ROYA 1KWKA 3QS3A 5DD5L 3DO7A 3PGDA 2PTTB 5EU5B 1RZPA 3M17A 3RDJA 2VDLB 4C4BA 2UY6A 3KXFD 3TO4D 3HMXA 3IDGA 1XVSA 2X1OA 1XB6A 4P5KA 5F6HI 1A14H 3V6BR 2EDBA 3CX5K 2X7LA 2BS9A 4AVKA 5E2VH 3GI8H 1A6UH 2MH4A 3ARDA 3QXWA 4LU5H 3UPCA 4YAQB 4GKSB 4YHNA 3WY2A 1U3HB 2DQDH 1RZ8B 4G7VL 2XI9A 1IQDA 4HEMA 2H2SD 1IC1A 3C9NA 2VDPB 5ISZA 3BWZA 3JTTA 4WFEE 5I1HH 4NKQB 3GDCA 4FLQA 4H5SB 2ZCLL 4NKOA 5DD5H 1QFHA 3HG1A 1DSYA 4PMEA 3QR2A 3WS6A 2G9HB 1MJJA 3GRWA 1RK0A 1AR2A 2XZZA 4R9HA 3QFJE 3B5GA 4P2QB 3R4DA 1G0DA 3D7PA 3UIZA 1QWUA 1UCTA 3D51A 3EO1B 4G7VH 1S9WB 4P07A 3BSHA 2WXIA 5F9WB 1JYNA 4D0CB 2F54A 3CFDB 3HLKA 3CFNA 4I9XA 1ZLDA 5B4MD 4DPCX 4EZKA 5C0RL 4L8BB 4NRYA 3IRCA 1AD9A 1XH1A 5EBMA 1KXVC 1T6BX 2FQGA 1ZDQA 1DO6A 2D03L 1JZ4A 3UTOA 4GW4A 1A6TA 1YNTA 4KVNL 3MX0A 1D5XB 3GINA 1QHQA 1QLFA 3PDOB 4WFFE 1HJCA 4F5CA 2K9UA 3JTSB 4WKZA 3EUDA 5DK2B 3D85B 3K72A 5GHWH 4LLQA 3VXTB 2NY4C 1JZDC 3WEAA 4JFFB 1JVLA 4YGAB 1MCPH 1HAWA 1H8NA 1QR1A 4MQXD 3TYGL 1NFAA 3PQYA 4RMQA 1ODAA 1YUHA 3MRCB 3OG4B 3TBBA 4ZFFA 2D03H 3MV7A 1VKXB 2DQMA 1RP8A 5LAXB 2CUMA 3H9SA 3ETSA 2QLVB 4IBZA 4KVNH 4NJAH 4G7YL 5E8EB 4F3FB 1NCIA 1IGTA 2FL5A 1X5IA 1UWYA 2YLHA 4N2KA 4B9ZA 5D96B 1SMDA 1JERA 2VAJA 5I6NA 1RJCA 3KWUA 2IQ9L 2O30A 1C5DB 3T0EC 4QRUA 4HHAB 1NLDL 3FB5B 5C0EB 4XHQA 3TYGH 2IPUG 2P28B 5ESQB 5SWSE 4WGWB 5D9SB 3D69B 1NGWB 2UWEE 5C6PB 2R0LH 3DMMB 3QUMB 1J9TA 4GXFA 2ZUUA 4M29A 3FKUS 2OW7A 2QZ5A 4I9WD 3ARFC 4JRYB 3B7UX 1FQ9C 5I8OL 2RJMA 3RPIA 3QYNA 3T6WA 3AB0C 2IQ9H 4LHUD 1QLRB 2WW8A 4JFZL 4FHBD 3ZDZE 4YSCA 1NLDH 5FA4B 1GHFH 1BF8A 3I9PA 1TZIA 2R0KH 2VRQA 4Y4HB 3V6OA 1ACZA 5C0CE 4KK5C 3MJ8A 4L3EA 4DZBA 1JF6A 3KBFA 1NBZA 1VERA 3AREA 3FO0L 3UAJC 1FJ1B 5EOTA 1LP9A 5I8OH 3O81A 4J39A 2VDQH 4KRPD 4B9YA 1XF5B 2H32H 4PJ9A 4JFZH 2CK0L 4MJ5A 2QT6A 3FYIB 4KAQH 4PB9H 5TDNB 4JL1A 3EYSL 2OYKA 2ED7A 3FU5A 3TA4D 2CIIA 2FQEA 3EBIA 3GZPA 5MENA 1V7NL 4NHUB 2BIPA 5AWNL 2R39A 2QVTA 3Q9QA 3SE4A 4DF9A 3ESPA 4X42A 4AGMA 3ALXA 5J3HD 4NX0A 1MREL 4OKVA 1CD0A 3DURB 5KYXB 4DAGL 3FO0H 3NCMA 3BKCL 3AS0A 1T1YA 5E23A 3QDGA 4CVZB 3WIIL 2DIAA 1IGYA 3T3PB 4FXGB 1SHWA 4QRTB 4QGTA 1HFUA 4PB0L 5D2NE 2CDEA 2F74B 4HBQA 1A0QL 5E0QA 2CK0H 2DWEA 4G6AD 3O8XA 5C2BL 2BCKB 1S9YB 1NFDB 1QPXA 3EYSH 3WMSA 1T21A 1X6NA 1V7NH 1U2YA 1ZT1B 3CCHB 4AC4A 1U8OA 5AWNH 4HCGA 2JB6A 4XWGL 5T1DL 1MREH 3GMNB 1Q72L 25C8H 1G84A 4HCIA 3ZRFC 4P2RA 3KE0A 2ESVA 2Q2LA 3BKCH 4MS8C 3WIIH 4IK6A 5FUOL 3MLSL 4RGMC 4CADA 1DVFC 1E9PB 1A0QH 5JDSB 4L1HA 4X0NA 2V0AA 4AQAA 1AZCA 2B1AH 4XGZA 5TPWL 3P2DA 1I4FB 1CICB 1UM6L 4N2HA 3NIDB 1NCWL 4LFHD 1S5IH 2R2BA 2Q0ZX 2H26A 2YKLH 3S5LB 3LQMA 4XWGH 4GSRA 1DL7L 2J3SA 3S88H 3IFLL 5T1DH 2XZQL 3WAJA 1Q72H 3MV11 3X1EA 1E5BA 1SJHB 3K0WA 4JKWA 3BZEB 4UB0L 3TIEA 2ZOKB 1Z7JA 4JO4L 2IWGA 2WXMA 2FYVA 5G55A 1LILA 2DYPD 5FUOH 7PCYA 3BX7C 3MLSH 2VAAA 1HYSD 5D7LD 4K8RD 2OJZL 3ETBJ 4EBQL 4ODHL 4K9JA 4UQDA 4L9DA 3TT1L 5TPWH 3FT4B 4C83A 4UTCA 1UM6H 5HPMB 1NCWH 3GSQA 3GYRA 4M56A 4QD2E 2PPCA 5F9JA 1LGVA 1NAML 4HT1L 1DL7H 1WUZA 5L2KB 3WGVB 5DGQA 2XZQH 3AT9A 1IM9A 5SX4I 3TNNB 1FBIH 3B37A 1JWUA 2X6VA 3N42B 1OY3B 4UB0H 5FKAA 4JO4H 3I6LD 2TAAA 4A67A 3N40F 4MBRA 1P53A 5I66A 3VD4A 4N8VG 3K6SA 4EIUA 3TF7C 2OJZH 4EBQH 4ODHH 4OV6F 1UEYA 2MQ3A 5BZWA 2EE3A 3N9GL 4WNQB 3ZMEA 3TT1H 2Z7YA 3SY6A 3GUTB 1HH6B 3MTXA 1BECA 4MNQA 3VE0A 3NFPA 4HT1H 1ED3A 3CSFA 3EOTL 1WGOA 2ICWB 4KFZC 1AQ8A 1HZKA 4HS3A 2VZUA 2WN2A 3BESR 4MCZB 4UQ3B 3DV6A 3CFKB 5DEJA 4DP6X 4R90L 1AE6L 1RUAL 2MCMA 2N7BA 2XFXB 3FUHA 1NC2A 2CO7A 1KLFA 1NKOA 2FWUA 1IFHL 3HCVA 1ZHLB 3ARDD 1E4KC 2FUQA 5M7QA 3X17A 5L0QC 1FHNA 2XKNB 5HVWA 3DUSB 3N9GH 5ISZD 1HHJB 3TPUA 2W9EL 4LSVL 2AXWA 3ZK0A 1EEUA 1FO0B 2X41A 1MW1A 3HG1D 2EVIA 1T1ZB 1QFWL 1EX0A 4F7EB 2A6KB 3EYVB 1LJMA 3F12A 3QZOA 4HZLA 5DJ0B 2EDDA 3VMOA 3IU3A 4R90H 1AE6H 1RUAH 3AACA 2I07B 4GKLA