The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
93
|
sequence length |
373
|
structure length |
353
|
Chain Sequence |
QDPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQSAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDEPCVDWDTPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The structures of the C185S and C185A mutants of sulfite oxidase reveal rearrangement of the active site.
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Gallus gallus
|
molecule keywords |
Sulfite Oxidase mutant C185S
|
total genus |
93
|
structure length |
353
|
sequence length |
373
|
ec nomenclature |
ec
1.8.3.1: Sulfite oxidase. |
pdb deposition date | 2009-05-04 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00173 | Cyt-b5 | Cytochrome b5-like Heme/Steroid binding domain |
A | PF00174 | Oxidored_molyb | Oxidoreductase molybdopterin binding domain |
A | PF03404 | Mo-co_dimer | Mo-co oxidoreductase dimerisation domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
Alpha Beta | Alpha-Beta Complex | Sulfite Oxidase; Chain A, domain 2 | Oxidoreductase, molybdopterin-binding domain |