3HBGA

Structure of recombinant chicken liver sulfite oxidase mutant c185s
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
373
structure length
353
Chain Sequence
QDPFAGDPPRHPGLRVNSQKPFNAEPPAELLAERFLTPNELFFTRNHLPVPAVEPSSYRLRVDGPGGGTLSLSLAELRSRFPKHEVTATLQSAGNRRSEMSRVRPVKGLPWDIGAISTARWGGARLRDVLLHAGFPEELQGEWHVCFEGLDADPGGAPYGASIPYGRALSPAADVLLAYEMNGTELPRDHGFPVRVVVPGVVGARSVKWLRRVAVSPDEPCVDWDTPAIQELPVQSAVTQPRPGAAVPPGELTVKGYAWSGGGREVVRVDVSLDGGRTWKVARLMGDKAPPGRAWAWALWELTVPVEAGTELEIVCKAVDSSYNVQPDSVAPIWNLRGVLSTAWHRVRVSVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfite Oxidase mutant C185S
publication title The structures of the C185S and C185A mutants of sulfite oxidase reveal rearrangement of the active site.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Oxidoreductase
total genus 93
structure length 353
sequence length 373
ec nomenclature ec 1.8.3.1: Sulfite oxidase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain
A PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain
A PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.650 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hbgA02
3.90.420.10 Alpha Beta Alpha-Beta Complex Sulfite Oxidase; Chain A, domain 2 Oxidoreductase, molybdopterin-binding domain 3hbgA01
2A9AA 4PW3A 3HC2A 3R19A 3HBPA 4PW9A 2CA3A 1XDQA 1OGPA 2A9DA 2C9XA 2BIIA 3HBGA 2BLFA 2BIHA 2XTSA 2A99A 2BPBA 2A9BA 2A9CA 2CA4A 3HBQA 3R18A 1SOXA 1XDYA
chains in the Genus database with same CATH superfamily
4MHHI 1XF2B 1HL4A 4QLWA 2OBGA 3QJHA 3ILEA 3PAVA 1MRCL 3QR2A 3QEQD 3L5HA 3EJJX 2J25A 3IAPA 4UYPA 1DDTA 5D1QE 5FECB 4N2NA 4PJGE 4YOKA 4HF5H 1R5VA 5DQDL 3MBEC 1CDIA 5DDHA 3BP6A 2CJTA 4K7FB 5I1DA 1QA9B 1QLFA 5EUOE 1PZSA 3FRPG 3MV9A 1BOGB 4HUWA 1EWHA 1DL7H 4P59H 3U9UA 2I69A 4P9HC 4KAQH 2EDFA 1K5NB 3FO2A 5E6IA 4F8NA 4IGBD 1A65A 3W2DH 1RFDH 1LXMA 4RRPA 5C0AE 4JN2B 4P4KA 4QGYA 4HISA 2EADA 4AX3A 1WP6A 3T4YB 3LN9A 3FN0H 3IDXH 1UEYA 2HKFH 3OJDA 2EE0A 4H0LC 1Z32X 4HGMA 3D6GA 4X6DA 4S1RL 1K6QL 1AKPA 5ADOH 3AB0C 3VH8G 4Q6IC 4JFHD 4RX4A 5I16B 4AVKA 2GUOA 4F9PA 1H6TA 2X9YA 2B20A 2LW3A 5DUBA 4O58L 5B3JF 4CBPA 3RTQA 2I5YH 3QIBB 2J8UB 1CQKA 2I24N 2L3BA 4HIIB 5CXPA 2QPDB 4TMPA 4AQEB 1OAXH 1OM3H 1FFTB 2ZOKB 2JKNA 1EEYA 2AJXH 2Y7OA 5F88B 3VFTB 5KN5B 5CCHE 1XGQA 1B9KA 3ATDA 1RJZB 1T6VN 3VX0A 2Q8BH 5KUMA 1RIHL 3KCWA 1BSIA 1JV5A 3VFMA 1M6OA 3QZWB 1JDDA 4W6WB 3D5OF 1SEBB 5I76A 1OB1A 1H19A 1NCCH 1TEFA 3SO3B 4KH2A 3WFHA 2A6JA 2P5EA 5BRZA 1SLUA 3KLAA 1U0QA 3MA9H 5IMLA 2EDKA 4KY1H 4QXVA 4LP8A 5I9QB 3GSOB 5IEKB 4LVNB 2ZKYA 1GYUA 4M8UA 3S4SG 1A66A 2MTPA 2J12B 4U1MB 5SWSE 1NCIA 2UVEA 2PR4L 5EUOA 3F7LA 5LAXB 2NQDA 1F0LA 5A2JH 5IQ9B 1ZJBA 5DRNB 2QGEA 3S88H 1BIHA 1AHWB 4EIZC 2CE6A 3DIVA 3PNWA 4XBMA 2MIZA 5IGXH 5AW3B 3MLYH 1FVDB 4B6ZA 4XAWH 3MOQA 5MERA 1D2PA 3I02B 2AITA 1MIEL 3IKCB 5DMIH 2Q87A 3WEAA 2ZONA 1NPNA 1BX2B 5D7JC 1AGEB 4LT7A 5KYXA 5C09D 4G3YH 1G4MA 4H13C 2AQ1A 3L3KA 3UTQA 4AEFA 1NUFA 2WKOA 5DK2A 4PGEB 4JO3L 5C08B 4JK0D 4PWEA 3BH8B 1ESOA 1M3IA 4KKPA 4NSKA 4QJ3B 2HT3D 3BW9B 3M17B 3WU1A 4AIOA 2LU4A 5AVRB 2YHGA 2OULB 5D5MB 1QWHA 3O8XD 3SYOA 2B9BA 1J8HD 2VDOB 3APMA 3WHE1 1BVOA 4HJEA 2OTWB 3PHOB 5ICZB 2LFGA 3W9EA 2IWEA 4D8PB 2V2XB 4G5ZH 3KWVA 3V5DA 5ID0B 1EMTH 1ZDQA 1MAML 2NNAB 4BFIA 4QHUA 5AL0A 2DDQH 1GZPA 3LY6A 3CVHA 3SB3A 3WUWA 1AGFA 4M5YL 1GIGL 1JZ4A 4WO4A 1D6VL 1DEEA 3MJ7A 3MSPA 4KFZC 3WNIA 2XCMC 3QUXA 4IRJA 5ISZD 3T3PE 3VSUA 3GHEL 3IDMA 1QKZH 2VJ0A 4M7ZB 3ML9A 4S1QL 4R8WL 2VJXA 5KVDE 4XP6L 3TZVA 2HKAA 5HDQH 3KYOB 3EGDB 1DSWA 2VZ3A 3RWHB 2ZNXA 2AP2A 4YHOH 1KC5H 4YDLB 1CFQB 1M6UA 1VDGA 2HYMA 3MMEA 5CEZH 1XF4A 2AJVL 4EI6A 1UYWL 1FH2A 3DIFB 1HXYB 3GKWL 2H2SD 4G6KH 4GW1A 5DFVC 1N12A 1CGSL 2GEEA 4N9GA 1UOLA 5DD6A 1KGXA 3SD5A 4JPSA 1JGVH 3QO0A 3AROA 4ZQKA 4LCUA 2A9CA 4L3ED 4UQ2A 3SKMB 1QLRA 1X44A 5J7CC 1U33A 1N26A 4FFVD 5L2JA 3VXUD 3QIWB 4Y7OC 3BIKB 1YYLL 1KJMA 2EEAA 5KG9B 4C59B 2QR0A 2FSDA 2YAOA 3MRQA 3DXAE 3BSZL 3DX9B 2HJFB 2JCCA 5SWZE 2OL3A 3K71B 4K15A 3T2NL 1BIIB 1EX0A 1KCKA 4G9DA 1HWHB 1A9BA 3WMSA 5FGBC 5IKCB 3QEUA 1RPQA 5AVZB 3K81A 4P04A 4L4VD 4UQIM 4N25A 5L88H 3WKML 2EXWC 2B5IC 4CVUA 2X41A 3UBXG 3QXDA 2BIQA 4YNYA 4BEIA 1RULH 1Z3RA 3CQFA 3ABGA 3OJMB 4DEUA 3WD5L 2HLFC 2J4WL 5CSBA 3VFUB 4YPGB 4JM2B 2APBA 3UTTE 4HZLA 4QRRB 5FYJU 4XO8A 1YAIA 2PYED 3VUAA 1XIWC 5F6HJ 3QHFH 5KSVB 5FUCE 1H6EA 1BVZA 5DJDA 5B39A 2PP8A 4MBOA 3KLSA 2MFNA 4DZ8A 4MQXD 2RAMA 4XO3A 5HJ3A 3X14A 5BJTA 4U6VL 4DNLA 1DYZA 2I07A 3HNVH 1FN4A 2V7NB 3BGFB 1PYWA 1ID5I 4HCFA 4KO5A 1ZKAA 4LLVB 3I6KA 5T1KA 5E2VH 4M29A 2QGDA 5GHWH 1OCCB 2NUTB 4AUYA 3EFOB 1I7UB 3LN5B 2DKUA 1D6EB 1TJMA 2X4PB 1DP0A 1RD6A 1UXSA 1V54B 3HC0A 3KGSA 3B9KB 2JJSA 2PW2B 1DBKL 4DSYA 3HS8A 3JWNE 4H88H 1QVOA 4P46C 4GW4A 5JHBA 2VDQB 1DQML 3OKDA 4AW4A 2NY4D 5GRYA 2JSFA 3ZPDA 1PLCA 1MCSA 1J10A 1WITA 3CC1A 2XY2A 4HIJB 5IMMA 4BQ9A 5C0IA 4N0UB 5E1QA 1G0DA 3OLEA 1BQRA 1MWAB 4CBZA 1ZGLA 2R4RL 5D93C 5TE7L 1A7QH 3OJVC 4JGUA 2C7UA 3C6LB 3CPUA 5I6XC 1OCOB 1VLXA 2IDUA 1JWUB 2NY1C 4I77L 1BXVA 1YUHB 4K07A 4XVJH 2FR4B 2K45A 3GSXB 3LN4B 4NQEE 4MJ4A 5GS0C 4QRTB 4G7YL 4M1DL 3WD5H 3RVWC 5CEYB 4PU2A 4K5OA 2WUCH 3CSBA 3SE6A 5CEXA 3SJVD 2Y24A 1BVNP 1JTTA 1IC0A 2J8OA 3O6FA 2IQ9L 2G2RA 3MGAA 1URZA 2Q1EA 4MD4A 1IM3D 2ADIA 3I74A 4OLEA 4YHIA 3QWOB 1L6XA 1TMQA 3ZZ1A 4GKSA 3B6SB 1KGJA 5KTEH 3ULVF 3QNYA 5A43C 3GI8L 4D8OA 2OCJA 4O02A 4Q9QL 3V4PA 3R06B 1VERA 2AXFB 5C0DA 3UYRL 3RVVD 2R69L 2XV6B 5EA0L 5I19H 5L2KE 3V9FA 3EGXB 1FIGH 5EEYA 3D3VB 3ZE0E 2ZWLT 3QG6A 3RKDC 3S34L 1BFTA 5HHPA 4JPIB 2VLKB 4IRSA 5C0BB 5FKPB 4U3HA 4ANXA 4ABVA 2B08A 3A4AA 1TENA 4HKJA 2XXMB 2ENYA 3OMNB 2GFBA 3QPXH 3QI9A 3FT4A 5ESQB 3GS4A 3DRQA 5G4OA 3F6LA 1FNGA 4QAMB 4KH9A 4X2UA 1TQVA 3DX8B 3MRKB 3ZHNA 4XN9A 3B2PA 1IFRA 4BELD 4PP1D 3VFGL 1XCXA 5EBWA 1X5LA 2NX5D 4AH2A 1D5ZB 3G9AB 3TURA 4EIGB 3BD5A 4WWKC 4LL9A 3UCQA 3SZ6A 4X98B 2FJGB 4IKJA 4Z0XA 5FYLD 3DJZA 1GJUA 2Q5BA 2IQ9H 2ITDB 3SGKA 1DHKA 3F83A 3ZZLA 4ZMZA 1R1CA 1UWEH 5E08L 5ECJE 2HKHL 3EYUL 4ZXBC 1AS8A 3GPSA 2GJ6E 3QDMA 2X4UB 1KCBA 2Y9RT 3HAEG 2MQCA 5E5MB 2KQNA 1WA0X 1I85A 4MCZB 3UYRH 2R69H 4BH7A 4CU6A 4YO0A 5TDPB 2V4LA 3WLWC 1YEIL 1N6QH 4FQCH 5C0JB 4FQ1H 4NGHL 3QDJE 2P3YA 1FL5B 1S7WA 4B9YA 3SDDD 4QXUL 4F20A 5DJ6B 2EIZB 2GJJA 3EJUA 4U7KA 3SBQA 5L2KA 1OCZB 1AXTH 1HOCA 5CJBA 2ROXA 3M7FB 2X40A 3IPEA 4FQQA 3PWJB 2XV2A 1VEPA 4PJ7A 1NGXA 1DDHB 4DPRA 4MAYA 4AGLA 2OXHB 3S2CA 3M6DA 3QWRA 4GQRA 3KYMB 4GH7B 4NC1C 4ANKA 2GSGB 2DWEB 3X3GL 4MMZC 4NQQA 1HH6B 3ULSA 1NQBA 3U9PL 3R19A 5DTFB 3VFGH 2LHAA 5DEZA 4YSEA 4OI8A 5AOLA 5DJAB 1NMBL 5E03A 4XBPB 2HFFA 2YUVA 1T03H 3S3BB 5KSUA 1I8AA 4LF3B 4UUJB 2OMVB 4W9IC 4A7SA 6FABL 1U3HA 5IUCA 2V9QA 5KS9F 3FTSA 5IQLA 2YD3A 3ORJA 1JWSA 1TZHA 5DO2C 1F6AB 1KGUA 3ZHDA 3D06A 3V6FB 1S9KC 3JV4B 2BOCA 1S3KH 2ZUVA 1FFOB 4MD5A 1VACA 2BERA 4KKCC 1RZ8A 3C2SA 3O2VL 3ZGHA 1NINA 1ED3A 1M7UA 3E2HB 3MR9A 5F9OH 3O3DB 5INCB 3N40F 4AIZA 3MLZH 1N6UA 4AEIH 4GXVH 4Z7VE 3JZ7A 2F53D 4NGHH 4FXKC 2NSQA 3IDIA 2R0KH 5FO9A 5L4IA 2VXVH 1BMZA 1KENL 2K4AA 3BN3B 4XXWA 1INQA 4JFHE 1IC4H 4HAGA 1HL5A 4EEEA 5LQBL 2EDBA 4TUKL 3STLB 2P42B 2CDEB 1T66C 1A4KA 5EUKB 3PFUA 2VXSL 4LGSB 4M6OL 2DYPA 2WHVA 3WNMA 3HZVB 2NNCA 4K3DH 3MLXL 4YHPA 2HUHA 3AS2A 4QI3A 3SQBA 4LCWD 4DKDC 8FABB 3T09A 4W4NA 3S48A 2X89A 5L7XL 2ZSWA 3WL9A 4LXFA 3X2QB 1DBAL 1NWPA 2W38A 2WIMA 3ESMA 1OAKL 3EUDA 2BZDA 3FB7B 2YC1A 4NQVB 2JIXB 2E74C 5F21B 3VYNA 4U6XB 5EF0A 4FEIA 4YSCA 4HKBB 4OGYH 6FABH 1IQWL 5IB5B 4JQIL 3G5XB 3VE0A 3C6SB 5IW1A 3QEQA 2WO2B 1QHOA 2YMTA 2EE2A 1ETB1 5E70A 1NGWA 4JREB 5C2UB 1CG9B 4HS6A 2AJZA 4G8IB 3VFRA 1G9EA 5IJCC 2JI2A 4K3HA 4NZ8A 5H94B 2ZP9A 2BS9A 4Z5RB 4JFPB 1RURL 4W1TA 1HAWA 1RHHA 4OIAA 2EE6A 5HY9B 5CBEA 3ZQXA 1T0MA 3WNOA 4PG9A 4B7IA 5F7HA 3TO4C 1IGFH 3THML 2J6EH 3FONB 3A4EA 1HXMA 3PHAA 5KBLA 2BLFA 4LHUG 2WQXA 1QFWL 5C0FA 4P2OB 1VEOA 4H0IA 2I7OA 3ETBJ 3POCA 2Q6WA 2P7TB 3VXTB 2YWYA 1ZLEA 3FO9A 1XF5A 1HKLH 1NBQA 4JB9L 1QBLL 2CK0L 2X4TB 3ZMRA 2VXSH 3QQ9C 1YZZA 3EZ8A 3BD3A 3TIEB 3RNQA 3WJMA 3D4ZA 3T0AA 1KJ2B 2NT1A 5C9JA 1E3XA 4X7TB 2EXYD 3V4VA 5C09E 2ZCHH 4WNQB 1IAIM 1OT1A 2X4NA 2Z35B 3CVDA 5HGBA 4MXWH 3NQIA 4F93B 4JFDD 4R0LC 3US1A 1N5YL 4K55A 3MRDB 1LJMA 5F9WC 4PTUA 3BAEH 2WB7A 4L23A 4XNYL 3FBKA 1KT2B 2VDML 3PWVB 4HIQA 1MCDA 4G8GA 4JQIH 4HUKB 2BVQA 1J8HE 4APQB 5HYSG 3ZBMA 1E8YA 1BBDL 2YEZA 4TSBL 1AD0A 2VRQA 5DCCA 1NGZA 3DXAB 1ONQA 1ZLSH 1WV7T 1OW0C 1RZJC 5IB1A 3BUTA 2VITB 1Q90A 4L1HA 4X5RA 3AMKA 1UASA 3O9WD 2JF1A 4HK0A 2DYRB 4FJ6A 5IFAL 1C5DB 1J11A 2IDTA 3VAEA 2VXQH 3O3UN 3G6JA 5ISZE 3MRRB 2H1LM 2CZNA 5GS0L 1MHEB 4X4XB 1G9HA 2OCFD 4FMFA 1VPOH 2Z65C 3NDZE 5ESVA 4CW1A 3CN0A 3MJ9L 2X2YA 3Q6GH 3UTTB 3GRGA 1C9SA 1JPTL 1QBLH 4JKNA 2R83A 5DHXB 1NGYB 3DGCR 3QE5A 2BNRD 2UZPA 2YD1A 2C34A 3QAZC 4JVUA 5FM8A 2HVJB 1EV2E 2FE0A 5A3ID 4NM8H 3IMRA 1P4LA 2IH9A 1V3MA 1FE8L 3UAEA 5MEND 3NG5A 4LCIH 2RIKA 3H2PA 3KPNB 4XGZB 3ECWA 4YHZL 4B9CA 6PAZA 3C60D 5B1JC 4MNHA 2YUXA 5C09A 3S35L 3VXUE 4LSPL 4X7CC 1LEGA 4W4OA 4Z3GA 3T2OA 5IMOA 4M43L 1BD2A 3IN0A 4HGWA 3B5GA 2BVUA 5JHDD 3OSKA 1UJ3C 3QK0A 3FTGA 1A3LL 1DJYA 2HFGH 4UT7H 1Z2KA 4XMLH 2WBJA 5J89A 1RIVL 5D71L 2I60H 2WVVB 5AVUB 5GXBB 4C4KO 4UF7C 1J8HA 4L4VE 5F8QC 1TJHH 3OC8A 5I1KH 2ZQKA 2QVMA 5T8IA 3BLPX 1H6FA 1CICD 4NNXB 3ZDXE 4OCWH 3DSNA 1I9IH 4YXLH 4P4RA 3MJ9H 1S9WB 4JQXC 1JPTH 1BDYA 4KOCA 4ODUB 4RISL 2A7BA 5IQ7H 1HZKA 4PJIF 4PRID 4P23D 2XQBH 2Q8AL 5BNXD 3HZKB 5C3IA 4JN1L 2WZ0A 3UPCA 4M62L 2X4SA 4L18A 1L3WA 4ORZC 4YUEH 4MVBC 2BVOA 1G7HA 4I0PB 1X9UA 4I3RL 3GMRA 4JFXA 4JRYB 4C56B 2ZXWB 1N5AA 4OUUB 4PJCA 2SODB 3K4AA 1UZ6F 3BT2L 3GTTA 4RNRB 5GGQH 3EBIA 4MDJB 3S35H 4LPXA 3K72A 5F72S 2ZYIA 4FKKA 1SM3L 1JBJA 1SXBA 2OSLB 2OXGA 4BDVA 4JFTA 3KPOB 2FJSA 4L3EA 2IAMC 2YXVA 1S46A 1Z9MA 2D3JA 5F7BA 3VXUA 3PUUA 4XMXA 1RIVH 4HQQL 4PV9B 5D71H 4L8DB 4A38A 3JV6B 1KTRL 3P9LB 4IU2A 1BVNT 1HHKB 4HCRA 4K3JL 3QUZB 1SYVB 5ILTL 3KVPA 4MLSA 1LYQA 1KN2L 5HDWA 2CRYA 4IBWA 2C9SA 4Z7UA 4XC3H 5A2AA 1NL0L 3QFJD 1H8NA 1H9DA 3SJVE 4JZOA 4L4VA 5DJYA 3NN8A 2XA3A 4CVXB 4FNPA 1LDPL 3TL5A 1Z5HA 1B6UA 3TCLB 4J1UA 3O4LD 4QTIH 5DVPA 1RK1A 3DROB 3RLSA 1CLOL 2PYEA 2GJ6B 4JN1H 4N2BA 2J2ZB 3GSVB 1OVZA 4K8RD 4LU5L 3GSNB 4Y1AD 3QQXA 2QSTA 3SE3C 4MA1C 15C8L 3HLAB 3NPSC 5CJOL 3ZTNL 4ALAL 3NCMA 4YC2C 3BT2H 3P3YA 3NP3A 4XNZC 1GTFA 1Q1JH 2XN2A 2ALAA 4MSWB 3QDJB 1T6BX 3PU7A 1U8QB 1XMEB 4NRYB 3T0XA 2VSDA 2R0WL 1F56A 3AACA 4HUUB 4JMXA 5FYKU 3A4DA 2EDNA 3P3TA 4OLUL 3CC5B 1QPKA 1TTGA 4GFXA 5AAWC 1HQRA 4E9YA 3G5YA 1BQHB 2WTPA 1P7QD 3D4CA 3O3AA 4K9EH 4PS4L 2FJFA 3UBHA 3EFDL 2F74A 5KSBB 4HQQH 3EJZC 5DC0A 5E4EB 1P6WA 5KVGL 3HZMB 2XACC 3B7SA 4ZTEA 1HHJB 3LDBC 5HHMB 1KXVA 1OSYA 3RJDA 3ZHLA 4AE0A 5IHZA 3BRFA 3KWTA 2RGSA 2CO3A 4WUKL 3GMOA 4KVNL 1F6FB 4JGJA 1BGXH 3GEWB 1G7JA 1MJUH 3AQDA 4OJFL 1OPGL 1IL1B 4NKQB 4ZMNA 1ZT1A 4AQ1B 4AL8H 1QWUA 2J1YA 3FH7A 4HJIA 3KG5A 4P2QD 4M93B 4U1IA 3RWEA 2WLLA 3BQUC 1Z9PA 4LAQL 4BFJA 3EO1B 4RESB 5JLZA 1EO5A 3MBED 3UJIH 3JUYA 4LSVH 2FGWL 4YDIH 3BSGA 3ME0A 4FP8L 2GSIB 5KYYB 2WWOA 4DT2A 4GSDL 4PGBB 5TFSL 1EXUB 4IKLA 4LU5H 5CS7A 5KJ7E 4U7MA 4FTVD 1GZHA 2P8LB 5INDA 3VXMD 4ALAH 2J5WA 1U3YA 3IPBA 3AXLA 2J21A 4L1SA 4UMSA 3ARDC 1Y6NR 2ADJB 3W1ZA 3NFNB 5DS1A 1BZ7B 4EE2A 1U8OA 3P77A 3PL6C 4LGPB 1ZSDB 3DKHA 4PRAB 4BIKA 1I1YA 4FLRA 4PS4H 1X9QA 5IWLA 4ZMXA 1E9PA 1GYCA 2P5WD 1MHHB 2H0JA 4TQPA 5KVGH 1KYDA 1MZZA 3OJ2C 2IV8A 5FYJE 3RI5F 1CLZH 2F1BA 1N0XL 1DVXA 3QAQA 4N6RB 1EHAA 3GHBH 5ANMB 4Z0BL 1CTOA 2E56A 2GTZA 1CB4A 3BSHA 5CWSA 1BM3H 2H6UA 1AR1B 1L7IL 1W0WA 4X7EC 1BQSA 4Q89A 4XI5C 3KWXA 5EOCH 4UBDC 5IW6A 2HVBA 2BHZA 4OCYL 3UAJC 1YN7A 4L8BB 4LPWA 2NX5A 3JYBA 3K0YA 4I18C 4N2CA 5DJXB 2VLLA 4MYPA 1PLBA 4FP8H 4N90D 3WNPA 1RUAL 2EDTA 1RZJL 4FX5A 1JZHA 3J8F7 5TE6H 1MY7A 4GSQA 2BIOA 2GTWB 1WYJA 4IDJL 2XBZA 5KZCD 2V0AA 1JF1A 3L5IA 1U8HB 2OJZL 2XVGA 2UWEE 4RGOL 3SEPA 4DIXA 1QZNA 2O5YH 1XHHA 1YMMD 2XWTA 3HRZA 2F53E 3NGBB 3ZT5A 2BSSB 5J9PB 1PKQA 1BFOB 3IFLL 2MCPL 2AI0L 5HYFA 1A8ZA 5LGKA 1BVLB 3BJ91 3O0RH 4I48A 1GXEA 3DBXA 4RGNC 2F61A 3VQLA 2HPTA 3ZE2B 2ICEB 4ZNEE 1NFDA 3HUJA 3PJLA 2AQ3A 1NTDA 1H8SA 4LCWE 4NPKA 4PJ6A 3PP4H 4ZSOB 4JY6B 1H0DA 4ODSL 1LK3H 1H3UA 4NYLA 2O6FA 3ZOAA 5IBTH 3IBEA 4GQ9L 3MYJB 5D7JD 2WNWA 1FPTL 4PJXF 4GKLA 1FJ1B 3B3BA 3VG0L 5FO7A 4TRPL 5IIEA 3NIFF 4KKRA 2HJLB 4OZFG 4WI2A 1NKRA 4V2CB 2KZ1B 3JWDL 1IGJA 1L7IH 1EGJL 1GCFA 5DC2A 3L9RB 5C0EB 1E9QB 1ZHBB 2AANA 2JB6A 3CCHA 2OP4L 3QSKB 5HD8C 4WV1A 2YPKB 4R26H 5KAQG 5LGJA 1HXKA 2KLRA 1MQKH 1XDQA 1RUAH 5I1JH 3B9EA 2X09A 2EUVA 3KYAA 1P5VA 4AGQA 2JCWA 1NAKH 3BKYL 4WY7L 4XVOA 1EA9C 3CH1B 4KUCD 4NXKA 4PCTA 2VDPB 4KJQC 3SN6N 3IXAB 3JWOH 1FCCA 2AK1H 3HOGA 2XWCA 2RALA 5F1NA 2WVUA 3CIQA 4N4YB 3ULVC 2Y6SC 2DOCA 4S1SL 5ALCH 2XYBA 1T21A 3GBNH 2D31A 2UWEA 3MLSH 5IB2A 1PGRB 2OW7A 3BP4B 5AWNL 3N85H 5LLIC 2F53A 3EYFB 2WXPA 2Y06H 5BCAA 4P2AA 4NQCB 4ENEC 4ODSH 3P54A 3FSZA 5DD5H 3PQYB 2YD2A 3N9GL 5LVEA 5M7QA 2N4IA 2V5RA 2X6CA 3QCTH 2RTTA 1P69B 3KR3H 4ZFQA 1CDJA 5DFVD 4NQDD 1PU0A 4Q97A 3L3OB 3IDNB 4JFDE 1MW3A 2D2CC 2A6DA 2LV4A 2EVHA 3Q3GA 2R56H 1JZ5A 4FMKA 1IBHA 1TR7A 3S3JA 2Q7AA 4KQ3L 12E8L 4DP8X 5JORB 1FWXA 4Z7WE 3AM8A 4IK6A 4OD3H 1G7QB 1MRDL 1T3FA 1CFSB 3DUUA 1YEDA 2ROYA 2ZXQA 2YD4A 4IW4C 3MO1B 1OF2A 1VADB 2OMUA 3BLKA 4OGXL 4HA1A 4LQFL 4YBLC 4AY0A 3IGAA 5T1LB 3Q8FA 2E9JA 2VDQH 1N64H 4K4KA 3NA9L 3N43B 3KM1A 4QHNA 3BKYH 3HN3A 3QQ3A 1MI5A 4WY7H 4XMPL 5CGYD 2F7PA 1HS6A 3LQZB 5CJXC 1ZLUK 1DVZA 1SFHA 3NZSA 2EXWD 1O5PA 4YWGL 1Z9NA 2XZCH 4OD2B 3ZDXB 3KMDA 1DSYA 2G5UA 1CXKA 4Y16B 3OHXA 5AVQB 1H5BC 1S7SA 4OBSA 5J6GB 2HLFD 2CKNA 4YDVB 2HX7A 3MRJB 3MTXA 4LLUB 4Z95H 3FQ1A 1U8PA 3P3SA 5IJKC 4KZEH 4QRPA 1OGTB 2XJKA 3RL2B 3X12A 2BNRE 2I25N 2X44D 1XIWD 3SDYL 3RGVB 3KM2A 2EDJA 3RFZB 1DQDH 3D39A 3NCEB 1IC7L 3N9GH 1KIRA 4KXZI 2G4GA 3CHRA 5E6UB 3UG3A 5E5RB 4ZMPA 1DJWA 1DVQA 1P5UB 4X6EA 5TQ0H 1RU9L 2C3GA 3VMPA 2G5BB 4H1LG 4M8RA 5JMOC 3LEYH 5HBBA 3D52A 1NLBH 2PPCA 4PRBB 2FNWA 3ZE1E 1JZGA 1WCBA 1E4JA 32C2A 4JFDA 1PLGL 5JHDE 1RZIA 1S4IA 1YAZA 3MV8A 2ZX5A 2EIKB 2I85A 4OZFH 5EU7C 5ERWB 4OGXH 4P46D 4GQPH 4LQFH 4MMXA 2IDSA 5E7FA 4U3SA 2IWGA 1SLVA 2NLJA 3E1ZA 3WNJA 3ZYJA 1UWGL 4FULA 4LGRB 2JI3A 1A9EB 5AENA 2CK2A 5ESAB 4PJAE 2OI9C 1J7VR 5ITFB 1SOQA 4JL2A 3UEQA 4M7JH 1DFBH 3L1EA 1I8LC 3H2QA 1JYNA 2NY1D 3SCMB 1TYRA 3O9WA 3F6JA 4XBGA 2FD6H 2HTLC 2X2IA 3CBJB 3PGCA 4FQLL 2X4QB 4NO3B 3NJKA 1QI5A 3FRPA 3LKOA 1ADQL 2YSSB 3GSRA 1ZT4B 3U4EB 1W72H 3SDYH 4PLNC 1UWXK 4FXGA 2XWDA 2P8MA 1TCRA 5AZEH 4ORGB 1CLVA 1DFXA 2IQAA 5JXAL 2C4FU 1BZDA 1IC7H 3FN3A 3IS1X 3UBXI 5FGSA 3EDEA 4NI6A 3CLEH 1WGOA 2BNRA 5T1DL 4L8CB 3LRSA 3LEXB 3LRMA 4YQXL 1I8KA 1I7TB 4XWGL 2YAQA 2A3TA 1J05A 1OOWA 5DZNA 2IGFL 2IPTH 3R0NA 5LGHL 3VM5A 3IJ9A 4HP5A 1SDDB 1ZMYA 2W65B 5MENA 3ZMEA 1CFNA 1XXFC 1AP2B 1MREH 3SDAC 4BQ8A 4JCLA 1G9NC 2WINB 3C60A 5I6MA 4LZKA 3HR5B 3F7YA 3NJMA 2EYRA 4X5QA 4AYBA 1DVTA 1JZEA 5E8OB 1GS7A 1ZANH 2EDWA 3VVWA 4U4IA 2WLYA 1V5JA 3MJ8A 3KAAA 4DW2L 5FUOL 2O5XH 2MCG1 3O4OC 3OLDA 1S9VA 3IF1B 2F1EA 1WIOA 4RA0C 3NVQA 2LAAA 1OF0A 3M8OH 3O11A 3QXWA 2FTAA 1INEL 3RBGA 3KPQA 3HHSA 1ZIAA 1XQ4A 3NSXA 1PG7X 3BIBX 1YG9A 3KJ4C 3QFJE 2BHFA 3K8KA 4N0YL 3UL4A 5F0LB 1UENA 3JUZA 4WWKD 3X1FA 1GAFH 1KULA 1CICA 5E1AB 4QOKE 1EXGA 3DOHA 3O4LE 1R3IL 4NBYB 4ZUWA 3V5HB 2EYTA 3QNZB 4GAJL 3D0AA 3TBYB 4M5ZL 1PQZB 2HPOA 1O9ZA 4HSAC 2AV7B 2Y2YA 1FZMB 1JVKA 5DU7A 4PLJC 2AJ3A 4RIRB 4XXDA 1N0LB 1NCHA 1U3JA 5FW7A 4PRIA 1OT2A 5T1DH 4YQXH 4NZDA 4L29A 5C0CD 1IVLA 1TU2A 3UO8B 4M8QB 3BWAB 1NC4D 4HYTB 4H8WH 1F4WH 4X80L 5BZDA 4JJHA 4JFYB 5KBMA 4RRPM 1HWWA 1KGCD 1DZ0A 1EAOA 5EO1A 2FH8A 3JBG7 1KTLA 3UZQA 1PZ5A 4MMYA 3US0A 4H1LH 3HVDA 2DLHA 4TQEH 5EU6B 4LBEB 3LZFL 5DXWA 4PPTA 3EFFB 2YKKA 3M1OA 3VJ6A 5DLMH 3ARBB 3ABKB 5T33L 2B0SL 4PWIA 2NSXA 4FI6A 3ZDZE 4L4TD 1SJVA 1U8CA 3MNVA 3BSZA 4RLDA 3U0TB 3WN5B 1LD9B 3IAGC 1AKJB 2CLVB 3RIFF 1LEIA 3D1MC 2W8CA 5GRWA 3BJLA 2DYSB 2ICWB 4OZHA 3ULUF 1FDLH 3BAXA 1G7IA 1A2YB 4P2QE 3FFDB 1E4WH 4BFFA 3N6YA 3T8XA 1NANI 2PCPB 2ZX9A 4JM2F 4TUOA 3ZQWA 3MLPA 5FX3A 3MRCA 3O6ML 3QFJA 3AG3B 4ADGA 1T4KB 1SN0A 1KEGL 2PR9A 1MN4A 3LKNB 4O2FB 4WAFA 1A5FH 4OKDA 1MLCA 3RB5A 3OR6A 4EOWL 3TJEL 2Y72A 4FTVE 2GY7B 2D4FA 4KKCD 1F8TL 2VLMD 3AWGA 3IJYA 3KDMA 3SOTA 3VXME 3CVIL 2AVGA 3MKGA 4NFBA 4Z9KB 3EBGA 4X8CA 4Q2ZB 4Y1AA 1JD7A 4BZ1L 3MRBA 1A6ZA 4IBYA 3ULVL 3H42L 4OZIB 2P24B 1AO7D 3EG9A 3S5LB 3MODH 4AI7A 1FHGA 1V7NL 2HP4A 1ZT7A 1E3FA 1IGTA 3AY4C 4XX1E 1QHQA 1T66D 2P5WE 4NQSB 3KXFB 4NO2B 4OTXL 2CO6B 2Z31B 1FGVH 1FCGA 3X13B 1ZHNB 1T6WA 5H8DA 1YUKB 4OGQC 1P7QA 2HCZX 2VNCA 2HTKC 5CO1A 4HS8H 2CJUL 5D1ZC 3C08H 4N2FA 2K7PA 4GIOA 3PFQA 2PTUA 3HI1B 3LZOA 2AKRA 2YJLA 3MNZA 4FFZL 1OCWH 4Y5YC 1U91A 4CN6A 1WEJL 4F7TA 2CGRL 1JNJA 1J1OH 4N90E 2QJDA 3FB8A 1S78C 1KV7A 4KFMA 2Q7YB 4Z7OE 2NYZA 4LARH 3RP1A 3WIHH 3NSJA 4BSVB 4RDBA 2IJ0C 4P2QA 4IU3B 5B1BB 4O51A 1GGCH 4LOUC 3MBEA 2HLAB 3UBXA 4LKXA 5HHOD 3ARGC 1MIMH 1UADC 1YMME 1YY8A 2FB4H 1JD9A 4ZX3A 3TEYA 5E23A 3TO4D 4WCYL 4RFOL 1UH2A 4KZDH 2RR3A 4X0NA 4GG6B 1HJBC 4X5PA 3VXMA 4LCCC 3UYPB 1QFWI 3N41B 3CZGA 1OWRM 2HVKA 1I1CA 4N9OB 1EFQA 1S8DB 1U8IB 1OTUC 1ZVSB 1FHNA 1ZWIA 4M48L 4OJDH 5DEFA 4MXQC 5F7EL 3FQXA 2E7LA 4NUMA 1PFOA 3RKPA 4HOZA 2CIKB 3N1PC 4AQAB 4AMWA 3BYTA 5FAAA 3MNDA 5F3HA 3LIZL 1JMXA 4Q6IA 4Y9BA 3MRMB 1OSPH 3V9EA 4Q6YA 1S9YA 1HZHL 2VXTH 2VB5A 3KYKL 1R47A 3VRJB 3DX7A 3QEHA 4YSRA 1TLKA 3RU8H 2WIIB 1NMCC 4FQXC 1ZA3A 4UZUA 1A1NA 1UXWA 1WEJH 5I26A 1NUDA 1R3JB 3ZKMC 1PG7W 4HPYL 4XPHL 1ID2A 4XWOD 4B50A 4PJGF 5EZLA 3P9MA 3WIFB 4AKPA 1N70A 3HPLA 2I27N 3HCVB 1DUZB 4TVUA 2CLZB 1THCA 3JT2A 1NM4A 1E5BA 1U8LB 3WY2A 1TDQA 3IB4A 4PJEB 3B5TA 4LEOA 3S37H 2OAAA 4WCYH 5EBMA 1GH7A 2UYLA 4HIXL 1CE1L 3K6SB 4IIQB 3H4HA 3QQDB 4XBEH 4QAWA 1H6UA 3IK2A 1D5IL 2QKIC 5F7NC 5DS2A 2FO4B 1S7UA 2XNAA 3BZEA 4AQ8C 3MCLH 1OM9A 3QUML 1GZQA 3BVXA 3ATFA 3TBWA 1QW8A 2YAEA 4OFPA 1F4YL 2IG2H 1NJ9B 4GEJA 1MEXL 2EH7H 2VERA 2YAMA 2J56A 1ZJAA 1M71B 4NQDE 3AQYA 1F3JA 4BXVA 5DQ9B 4X6CE 5AW0B 1E5CA 3V0EA 4XOAA 4ZT1A 4BHUI 4F3FB 2WXJA 3ZHKA 3BO8A 4HOXA 2OV0A 4JFOB 4YFEA 3FNKA 1BJ1J 2C3VB 3CZKA 1M7XA 1EDQA 2W80C 1JZ2A 5D7JA 4LIQL 4GBXB 4IBSA 2X7LB 3KYNA 4NKIH 2B59B 4O4YL 5C7XL 4AM0A 1BYNA 4R90H 3ZE1B 4XO4A 1RXLA 1G9NL 3HKFA 2ENJA 4HPYH 1UVQB 1FZKB 2XFXB 2MEJB 3ZYOA 4CVZA 1ND0A 3NJIA 3HE6D 3NACH 4A2EA 3AMLA 3Q9QA 5A2BA 4UV4L 3PV6B 1MHPH 4JO5A 3PNRB 4NRXB 2J55A 4LEXL 4ZFOL 1G84A 3PIQB 1QNZH 1J48A 3ARFC 5T3XD 4PJAB 3TIDA 2QSCL 3NJVA 7PCYA 1CE1H 1ZGLM 3VXNB 3HHMA 1BLNB 3L6FB 3MBXL 3VB8A 5A40E 5A6LA 2K1MA 5EO0B 5FHBH 3WTYA 2MHAA 1FYTD 1SEQH 4JZJB 1MVUB 4LASL 1SGKA 3DI2B 3HAEA 2BK8A 5BRQA 3MV7B 1FRGH 1PEZA 4OAWB 4U1SB 2H47C 3GSWB 1FVEA 4HALA 5KWYC 4YHYB 2BFVL 1IE5A 2R4SL 2Y2WA 5E8EB 5F7WC 3DPBB 3MOAL 4MVBD 1EJOH 3JTSB 3BGMA 3GSQB 4KY2A 4RGMB 3UZVB 4OB5H 4FZEL 3E6HA 5AVWB 4Y4HB 1BZQK 1DLFH 3BKJH 5GS1C 1FFNB 4FYTA 5A1AA 4HT1L 4LIQH 4BQ6A 3GSUA 5BXFA 1WH0A 1IGIL 2I7SA 2W0FB 5C7XH 2FDBP 1I8MB 2EUWA 2WYZA 1Z5LB 2C9QA 3HNTL 3PV7A 3WHXA 1JXGA 1LQSR 2FQEA 4ZUVA 1G1CA 3FBQA 1P2CB 4KX7A 4YK4C 1OAUL 2IAMD 1E6JH 4HJGA 3ZIYA 2PWEA 1JK8A 4R2GB 1KIPB 3EH4B 1DBJH 1OP4A 4LEXH 3WAJA 3O45B 4FQJH 1GR7A 5EU5A 3SY0B 4F8OA 3CLFH 1F90H 3DGGB 2HRHA 4KJWC 5G4NA 4FHBD 1HZLA 3WTXA 3AGVA 2B1HL 1SBBA 2RH0A 4TULL 3X1EA 3OKLB 4B0MM 3EO9L 3MBXH 1MXDA 3P4MA 3GI9H 4HWUA 4XB3A 4XP1H 5FGBA 2NTFB 5BZWB 5JDSA 5I6NA 2OYMA 1TO4A 2XTJC 2JTDA 1I9EA 1VHPA 5KW9L 2M8XA 1OAYL 5EO9B 4A55A 5C6TH 3AAZB 3NRQA 1R24A 2DAVA 3BP5B 3P0VH 4NENB 4F7PB 5I0XA 3FQNA 4ZX6A 3OZ9H 4N2EA 2GIYA 2VZUA 4J3OG 5J06A 5JW5B 1PY0A 2BFVH 1XIWA 5CD3B 5KEZA 4WDIB 4N0FA 3TP4A 1KLGA 1GGTA 1OT4A 3UERA 3UJJH 3CXDL 1I9JH 4AK1A 4LSRL 4LLYA 4NJAH 5ACZA 1UGKA 3QJHB 1B0RA 4IOIA 4ONFH 2WK2A 1JNHA 1IGIH 3GRWA 3L5XH 1CGTA 3QORD 1N3NA 5FCUL 5JPMB 5DA4A 5KJRL 2DMCA 5KVEH 1IM9B 2X2HA 3S5ZA 1JNLH 3L3GB 3JV0A 1XGTA 3VXOA 2NW2A 4TSAH 5F89A 4D0DA 1R5VB 2DQ6A 5E4IA 1S5IH 1B0GA 1NIDA 4C4BA 3BP6B 3QFDA 3U4AA 1F3RB 1MCIA 1HTYA 3EJZD 3VWJC 1QLFB 1NGPL 1X4ZA 5I1DB 4M9OA 3MV9B 4RMWA 5HI4C 5IG7B 5GGSA 1AQHA 2QMJA 3IVKB 3U9UB 4P46A 4R4BB 3V7AG 3ZDZB 3FO2B 1T04A 3T0EB 4ONHB 5E6IB 2Y36L 1GGBL 2EE3A 3EO9H 1D5XA 1L5GA 1IBZA 2RCSL 5AB9A 1JWMB 3WEXB 5G5DB 2FWOA 5FO8B 1RSFA 2Z0UA 4I3SL 2CM6A 2YAHA 1J0IA 4HOMA 1KN4L 3CMOL 4CRPA 2IAND 5TJWK 4X6DB 3OJDB 2C9PA 1AXSB 1OAYH 4I8DA 3BQUD 3BWSA 3QDHA 4JVWA 3G5VA 2LVCA 2Y5TA 3ECBA 1WT5C 1OHQA 3FMGH 5KVFE 2UX7A 2X0VA 4MQ7A 5DUBB 2IH3A 5C0CE 4AUJA 4BHUA 5IJVB 3RDTD 3RGHA 5LJYH 3RTQB 1XGPA 3GJFK 4YGAB 3DO7A 4LSRH 1KGCE 4JRXA 5EPMA 5IVZB 1I1FB 5F96H 3ARDD 4GLRH 2XWJA 4YBQC 4OCLC 3RQ3A 2YD5A 4NUGL 1IGML 1DJGA 4X9FA 2EVGA 1SLWA 3ZT6A 3PL6D 4JO1L 4IMKA 4GG8B 4LSUH 2VAAB 3KEHA 4DVRL 5BMFL 3QNFA 5SX4H 4ZI8A 4JKPL 3RX9A 3WFHB 3NOIA 5E2TH 4NC1E 4GRMA 4L4TE 5BRZB 2HAZA 3KLAB 4XTRC 3AWEA 4YHMH 1OP5K 1WAAE 4JM4H 1YLBB 3KWWB 2XXGA 1U36A 3UGUA 2IDFA 2CHDA 4JBSA 3QPQD 1G7LB 2FJHB 1FFPA 3HI6H 3U82B 3N1GC 1SHXA 2E7HA 1FNAA 4N8VA 5HI5C 4IBVA 4U1JA 2GI7A 4S2SA 5IEHA 5BVJA 2QQLH 2XPYA 3B9VA 4XI5D 4AOFA 1MQ8A 4UBDD 4JY5H 4WHTA 4XPAL 3ROOB 3UAJD 5IFHH 3PLYA 4WWKA 4L0PB 4Z7OB 1RUPL 5AW2B 1VZGA 3UMTA 5CD5C 4A6YL 3Q8AA 1HU8A 4LOFA 1GSKA 1D7CA 1XTMA 4ZXBA 4NS0A 1SXAA 1CFTA 5JA9A 4B96A 1FO0B 1SRDA 2BP3A 4R7NA 1IAIH 4J3OH 5DK2B 4WEMB 2DQTH 1AO7E 1Q72H 3STZA 4NSKB 3V4UH 3DSFL 1URIA 2BDNH 4RGND 3ZE0F 5LXGL 1CE6A 2YD9A 1DQTA 3SGDH 2W0KA 3QIBC 2JKWA 4FNLL 1DSFH 2J71A 5BS0D 2V2WA 4WO0A 2IH1B 2R23B 2PF6A 3L17A 1A1OA 3W9EB 4KHTH 3PGFL 3US9A 5BZXA 2V2TA 3DX1A 1TKWA 5E8PB 4APXA 1WG3A 2Y4SA 4R5TA 5TH2A 1NA8A 4Z8FL 4AT6A 2JELL 3UDWC 1IBYA 4NCC2 5CZKA 2XPZA 3SO3C 3BE1H 1XR9B 3KD4A 4MMZA 4QCIB 4F80A 5TGBB 4KXDA 2DTSA 3TNNA 5I9QC 1AS6A 3NSFA 4L3FA 4GRLB 4LVNC 4UMGA 3CHQA 4RMTA 5HD8D 2NXZB 1QBBA 3WNKA 4XAKE 2AJYL 3TZVB 1GHFH 3ILDA 1YMHA 4MA7L 3RZCB 4R9HA 4KUZL 4QRAA 5HHOE 4LE8A 3TN0C 2ATAA 1XF4B 4EI6B 4DKEL 1AHWC 4JFZL 4Y5XB 3P9WB 1Z3GL 2X70A 4M8VA 2IPKA 1Q9OB 4GW1B 3DYPA 4KROC 1YJDC 3Q44A 4A66A 4N9GB 2DD8L 2EDRA 4KJQD 2XQ0A 3H4FA 7FABL 3S9DB 1SVCP 3P0YL 1RZFH 3HC2A 4R96B 5EEWA 5J6HA 2AQRA 4J4PA 1DJZA 2Y6SD 4LCUB 4XRCA 1QLRB 2WTRA 2BP8B 5L2JB 4HU2A 1TVHA 3VTTA 3VFNA 4FXKA 5B7MA 2QR0B 3MLVL 4P57A 3T8VA 1NPUA 1AO7A 5EOQH 3NJNA 4MYWB 3ZTDC 3QJSB 2JCCB 2OL3B 1U8JA 4X6CB 4G9DB 1HSAB 5IB3A 5F7AA 4QHMA 1F02I 5H2BB 4AE1A 4KPHH 5BOJA 1D5BA 2Q3ZA 1NFIA 3OXSA 5KBNC 4QXTB 1O7SA 1OB0A 4PGJA 3DNKA 2KBGA 1DN0B 3IU4H 4KK8C 5F1SA 2ENSA 4ZPVA 4HC1L 3CSPA 5DF0A 2C4XA 3AREB 3WS3B 2QPUA 4UQCA 1WICA 5KBDA 3OAYH 2LGNA 2N1KA 2GC4C 5B39B 1XR8A 3FFCE 2UV3A 4YDMA 4DZ8B 5BJTB 2GI0A 4G8FA 1L3NA 3GIVA 1Z3GH 3B8SA 2JI1A 2VUOA 4NZTL 1FN4B 2WW8A 2DD8H 3T77A 3LS4H 5HHOA 5TE4L 3D2UD 3OPZL 4HJ1A 3KPSA 3TO4A 4YDLC 4EQ2A 3LXAA 4Z7VF 1JCKA 1XCTA 2JQAA 3LQAH 1SF3A 1J1XH 3BPCB 3HC0B 1BZEA 2P8PA 2VR6A 4U6TA 3BVNA 3BUPA 3RWFA 3MLVH 1C8PA 4U0RC 3SOBL 4TM9A 2X4OA 3WBDA 3KPPB 4HIEB 3S7GA 3TA3D 4GW4B 2WOBA 4M61A 1YEKL 3E8UL 1VGEH 3K3QA 5GGRY 3ILQC 1FQ9C 5ICYA 2H45A 4GAGH 4TLUA 2OMWA 3TVMC 5I8OL 3K2KA 1I9RH 3QIWC 3QUHA 1E5UI 1KBVA 2C7UB 2WQVA 1IQDA 1R3HA 5AOIA 2W9EH 3DJSA 4M7KH 2YPLD 4FQ2L 3H0TA 3ETSA 3NCBB 4B9JA 1DE4A 1BBJA 1WA2X 2B77A 4NKOA 5KYUA 4AGOA 2BRRH 4R0LA 5DEGA 3DVGA 1NC2B 3NAAH 3AS0A 3O6FB 1MF2L 5E2JA 2G2RB 1UJTA 2B1AL 2BNQD 4MD4B 3VWKB 4ZOBA 4F9LC 1EK3A 1XSOA 4YHIB 5EV7A 3ULUC 5F2FA 5T3XE 1Q0XL 1QO3B 5ETUA 3V95A 2VQ1B 3WIIL 3V4PB 4QXGH 2CKBL 4JM2C 2X2JA 1EIBA 3DO3A 1LMKA 1OW0A 3IMTA 1QFPA 2NUPB 4MBRA 2QL1A 2IV9A 2WNGA 4URKA 2FBJH 4XC1H 5E1HB 1HK6A 4PR5A 2VDLH 4WKZA 3MBWA 1FYTE 5GJSH 2HTLD 2HX9A 3AU1B 4B9FA 1DQJA 2R2HA 3FF8A 3ALXA 4HFUL 4V2BA 2FT7A 4F27A 3PAYA 2KT6A 2J1WA 4NERA 4MB1A 2W91A 4IJ3B 3ZE2F 3NTCL 3BGFC 2XG5A 3FC8A 2B1OA 1A6AA 2BIPA 1B4JL 2GFBB 4TVPH 1ITBB 3C8HA 2NY2B 3LXCA 1LQBC 4XP4H 5DMKB 3RVXD 1K4CA 2YRPA 2JVUA 3B9KC 3H1ZA 1FNGB 2YPVA 3MRLA 2D0HA 3OAZH 2WD0A 4WNSA 4YDKL 4ACPA 4Y9GA 3C6EA 3GZQA 3DOSA 4M6NL 1MAKA 2WOYA 4ONGL 1ZS8A 4HJJH 1CD1B 5EBWB 5DRXB 3ZZQA 3SDAD 3FSAA 1RZPA 1IAKA 5GISH 5DSCA 3V0AC 5D7SH 4Z0XB 2KLSA 5B1JA 1EGJA 4P8QA 2B1AH 3JTTB 3KBFA 4IEFB 3HHRB 3JT0A 1XVSA 2EKJA 1J88A 2JV6A 1Q0XH 3QDMB 4KNSA 1FG9C 3RTLA 5CUSL 1YPZE 1UJ3A 4A2GA 4IS6B 1KB5B 2CG9X 5CP3A 2FYYA 4HD9A 1A7PH 4H26B 5AD0A 2OPCA 1MCRA 2EE9A 3U7AA 2E3VA 5AW7B 4Q9RL 4YO0B 2DIAA 1HQ4A 3BPNB 3Q8CA 3W0WA 2F8XC 2H8PB 4ZPTA 1PIGA 5F9JA 4JG1L 3BUYA 3WS6C 4WI0A 1S7WB 2F5BH 4GPVA 4P48A 3EJTA 2Z4TA 4F57L 4YGVA 2FBRA 3ZUNC 3HKZA 4CU7A 1FYTA 2WXRA 3FQ4A 1XO8A 2JB5H 3SE8L 3MGOB 4JQXA 1B4JH 2AQPA 2WBXA 4PJ7B 4U31A 2Z92A 1IFHH 3V6OC 3C5ZC 2BP5M 4H5SB 4MAYB 1B2WL 2DMKA 4MNQD 1F3DJ 5IJDC 3RZWA 3H7LA 2EVJA 2NXYB 1YNTB 4YHKL 1SJEA 1QSEA 3EOBB 3R4DA 2ARJA 1IIIA 3APCA 1JHLH 5LO7A 3MV01 1Q8MA 2YGPA 2GW5A 3IRZA 4ONGH 2FWUA 2VL5B 4LPYA 5H37G 3BWZA 2CIIB 4IHOA 1YN6A 2XG4B 3UH8A 2FK9A 3D4GA 5HDOA 1A7RH 3FCSA 3NDYE 1U3HB 3PWPA 4G42A 4RFEB 2F18A 5DFWH 3FSOA 4ZYKA 4DOHE 1JWSB 1TZHB 4EDXB 4DO6A 3NFPA 2YN3A 1IJ9A 4GKZB 2BOCB 4RA3A 4WTWA 5EEVA 2YQBA 4PTTB 1QP1A 3NZHH 1KEML 3S3PA 3ZKQD 4MA3B 4GO8A 1RZ8B 3HZYA 4MJHA 4NPJA 4U49A 4DAGL 1ED3B 4QLRA 1KLUB 5D1QC 3MR9B 4Y4FB 3S36L 2QPEB 4K94C 5CMAA 4AIZB 4FQIL 4NP4H 5FM5O 2DQFB 3REWA 5F71A 3ZDXF 4HK3J 2IANE 3IDIB 1KG0A 4OZ4B 2R29L 1INQB 5I6OA 1N8ZA 4XR8C 1Z5YD 3OKEA 1AGCB 1HX0A 3FT9A 3UTZA 1GC1H 5H4YA 5DHEA 1B2WH 4FNSA 3SQBB 1WWCA 2VGLM 1KLFA 1JGEB 3BVTA 3KPRA 3QUYB 3N3EA 1HVXA 5I1LB 1YJDL 3SPHA 2D3LA 3DX6A 3SE3A 1CS6A 2COVD 2ZIDA 4HETA 1J0ZA 2YC1B 2JK5B 3SSGA 2NQ3A 5IHUL 2E76C 4WHYG 5AOZA 1FAKT 3GJFA 3D8MA 1MW1A 4PRHD 4DP2X 1RI8A 4WSKA 2OZ4L 5DYOB 3VE0B 5IW1B 4HAKA 2HX8A 1T7WA 4MCYA 4NN7B 4P2RD 4M56A 2OSWA 1ZDSA 4J3TA 5E95B 5CCKL 2YBRB 5AAWA 4XN4A 4F15B 1E42A 3S0PA 4L5FE 2EDDA 1KJ3L 4LPTA 4DAGH 1RHHB 2R1XB 5D1ZD 4EO5A 5CBEB 4PG9B 5DVLA 1E28A 3KPMA 5JIKA 1A3RH 1DJSA 1HXMB 4FQIH 4PGDB 1F42A 2VDOL 3F5WA 1CDHA 1OTTC 4KI5C 4ODBD 2G2PA 5C0FB 3BVVA 5D4IA 2H26B 2CXGA 3DJTA 1CZ8H 2B4CC 2W9DH 4BK8A 2NW3B 2QQNL 2FJUB 3K46A 1ACYL 3E2HC 3OKOA 4P5MA 2OA9A 4P05A 1ECYA 2XWZA 4GP4B 1ADQA 2IANA 2CLRA 3LHPH 5CGMA 2Q2LA 3BQUA 3I9IA 2OSXA 4LOUD 3WJMB 5DT1L 2E4TA 2R1YA 3ARGD 5F3FA 5I8KL 1RIUL 3REVA 3F01A 5A2FA 3OKMA 2AEPH 5B1CA 1MCWM 5AW1B 4EI5B 4HEME 1G6RL 3M46A 1Q9KA 1HEHC 4G43B 3OHMB 1JRHH 4JPQA 3EO0A 4S0HA 1O9WA 4MNGA 3B7YA 1J1PH 5IHUH 4PTUB 1ZXKA 1X7SA 2FL5A 4N8CH 1ZA6B 1OTUD 1DCLA 3ARDA 4MXQD 4C55A 3O2DL 4G8GB 5BS0E 3WGVB 4R3SA 3BZ4A 3ABZA 4KQ0A 2YEZB 5H37H 4ADIA 3PL6A 4F7MA 5CCKH 4N28A 5I8CA 1OY3B 2NT0A 2ZP0T 4PREA 1NAMH 3MUZ1 1KJ3H 2XI9A 2EKSB 1M9SA 1MFCH 2QHRL 4ZG1A 2EEDA 4OCXL 1S6NA 4ZMAT 4RDQG 4NN6B 4PMFA 2Y2TA 3U48A 2WY3B 3G6JB 4JREC 1LO0H 4YSUA 1SHSA 2A9DA 4FQXD 5EOTA 3NK3A 1X5ZA 2JXMA 2PWFA 2GABA 4ZS7L 3WTSA 1HJCA 1MJJA 1YEHH 3VD9A 5LHDA 4CW1B 1XAUA 3ZKMD 4CDHA 1D5MB 3A5VA 4QRUB 5IM7B 3AT0A 1Y18A 3RWDA 1D7FA 1NBVL 4ERSH 4G9FB 4PG2A 4LEBA 3CLWA 5DA0B 4JPWL 1ZEAL 2IWKA 4LFHG 4I18A 4OKVB 4GKOA 4P2OC 3FFCB 3M1CA 5HVHB 3F3HA 4PJ9B 1PPIA 3V52H 3TJPA 1J9CT 4RRPG 4DUWA 3TF4A 2W0PA 5DD0H 5D2LB 1BZ9A 3HR6A 1BZ8A 2ZOUA 4Y89A 3U1SH 3ZRCC 1X7TA 3BN9C 4PV1C 1KFAH 4Q74A 5I1GL 1Y6MR 4MNHB 1VSCA 1RZQA 1ETZA 3ATEA 3D0LB 2FEDD 2VDKL 1KELH 4WUUE 1BD2B 5JXEC 2ZD0A 1QQDA 2RQ8A 3I9GL 4JDVB 5D55A 5AYQA 5HHVH 1XBDA 5I8EA 4BSWA 1A4CA 1K2DA 2EDXA 3FTGB 4X4KA 4H40A 2X1XR 2WBJB 2C3WA 4WHYH 2X12A 4CUCA 1XCQA 3CPLB 1DN2A 3BH9B 2F7RA 4OCNC 1AGBA 5DZVA 5BS0A 4XB7A 3MACL 2F19H 4KKQA 4XXCC 3N91A 4APQC 4UAHA 1OKEA 1KCLA 3BD4A 1WS8A 4ZFGL 2ZXDA 2HH0H 3QHTC 1JDAA 3GMPB 4GXUN 4KMTH 3RG1C 1ZK9A 4OF6A 3FU7A 4P4RB 3MUGA 4LMQE 5BO1H 4JGNA 3ZKNC 2QADB 2OMNA 3K2UL 2E6PA 3Q5OA 2G75A 1WFMA 4K3GA 2AJSL 4QHPA 3WSQL 5L6YL 2V5MA 5IESH 1VKXA 1KCRH 4PMEA 1SXCA 5GJTH 2F08A 3ARFD 2BVOB 3D09A 1UD5A 2R2BA 4JFXB 2GHWB 4N26A 4QHLA 3MNWA 2BJMH 1BVKB 4FFYL 4PJCB 5TPWL 3EGSA 5C0GA 3FXIC 4DETA 5FUCC 2K4WA 4L3CB 2VLRE 2E7MA 3K72B 4X7SH 1TZIA 35C8L 1DO6A 2VDKH 2E86A 4LBAA 4BZ1A 4EKXA 3RPIB 3NABL 1WUNT 1IBBA 1NFAA 4ZOEA 3FT1A 5AUMA 2WXQA 4UM8B 3TNMB 3EYQC 4J8RA 1IB5A 3RNKA 1JZDC 4JANA 3BC9A 4YZFF 5C92A 1MNNA 4IU2B 1CL7H 3CSYA 2A6IB 4NPYB 1WBXB 5EC2A 3SKNA 5JHLA 2V5SA 3NESA 4YHNA 2YPLE 3O6KL 1ZGLP 5CILH 3TXAA 4Z7UB 3SE9H 1UTDA 1YECL 5I73C 4U1HB 3VA2C 5JNYA 4B60A 1NOLA 1M05A 4HBCL 3QJFB 3NN8B 5I0ZA 3O41A 2MOGA 2BNQE 2Y1VA 4FFZA 3G6AB 4YVNA 2BWIA 4M3KB 2AJSH 2WXFA 1RK1B 3G9VA 4YAQB 2D3VA 5BZZA 5L6YH 5KS9E 1AHKA 4X4YB 2W60B 4KJWD 4WVRA 1DVFC 3WUWG 1WZ1L 2P49B 3FZUC 3IU3A 3FQYA 1ZLWH 3IDUA 3TU6A 4K94L 2BP0A 4G6FB 3A67L 4XP9L 4QTHA 4GG6F 1W0VA 2VSKB 4ANWA 5A2IH 1NCDL 3A6BH 5CJXA 4D7PA 4C8XA 1OQXA 3N41F 1SHWA 1IEAA 2WQSA 3D2UA 4I0PC 2XXFA 3LEVL 5CIPA 4PWKA 2NSMA 1H5BA 3GMQA 5CINL 3ALWA 1UZ8A 5AZ2H 5I1EH 3VXPA 5IJKA 3SZKC 3KHQA 1WBYB 5EORL 2ZJSL 2YFNA 1KXQE 5DUML 3P3UA 4MRCA 4MHHG 1QRNA 1AHMA 5IHHA 4X4ME 3MQIA 5JA8B 1C5CH 3LIZA 3NJXA 5LCVL 4BUHA 3CFDA 3GMOB 3PP3K 5T5NG 2D03H 3RI5K 3W9DA 5C3LD 2BC4B 1G7JB 2JTYA 3CFIC 1NM9A 1QSVA 5FGCB 4PRNB 3L2NA 5CGBA 1X4XA 2WKGA 1LO3H 4NZRL 4Y4KB 4YFDB 1UQSA 4GRWH 2KH2B 4G1MB 4ODXA 5KUKA 4DGUA 4CVWA 2WLLB 2Z9TA 3QUZC 4LDEB 4EUPA 5JR1L 5ID1A 3C09B 3CX5K 2BSTA 4U6YB 4FF9A 3VWJD 5GQBA 3ME0B 4AYID 4M3HA 5HI4D 5DRWB 3E7JA 3L4XA 1OAZL 3CFMA 2BNQA 5GSVA 2ZWKA 5INDB 4DGWC 1RLWA 4NDMA 1SPDA 1V7MH 3AXLB 2FATH 1EO8L 1QLEB 3A67H 4XP9H 5D1ZI 3V55A 5KS9A 2YKLH 4PJDE 1OV8A 4NC0B 3IS0X 1EHNA 3L7EA 1E2WA 1I8LA 3JSSA 3VD1A 4M7LL 4Y19B 4QT5A 4DK6A 1U8OB 5F7YC 5JPNB 2B4CL 3P77B 5B39G 2EIEA 3QUMA 2IVFC 1EHKB 1D9KB 3CDGA 5CINH 2N7SA 5A2KH 1EJ6A 2VN5A 3QRFM 1M2VA 1E4HA 4JRLA 4UIMB 5DUMH 2EC9U 2PPDA 5KYWA 4IK7A 1Y07A 4W9FC 2H1XA 4X8XA 2AVFA 4WU7A 3BYYA 2ZICA 2HWZL 4PGZA 3W5MA 5LCVH 1XGRA 1UB5B 3NCJH 4DK3A 2PPAA 3WXWL 2YRZA 1SBSL 1KTCA 2GUYA 4P5TA 4MAUL 4YBQD 4RQQA 1W0WB 5E4EC 1KXTA 2YFOA 3H9SD 4KTDL 3BLBA 5EU4A 3ZE1F 1R46A 4Z77A 4QRQB 4XPTL 5DJ0A 5MP6H 2R0ZL 3SDAA 4R5VA 2QMKA 2L7JA 2WBWB 2VLLB 3G5ZB 4YLQT 5DK3A 2VDNB 3GUTB 2ENQA 4XTRD 4UU9A 3C8KA 1OAZH 2WLNA 2DWXA 3G6DH 5GRVL 3OM3B 1N59A 3U0WL 4FD0A 4AQ1C 2BINA 3QW9A 1L4IA 4PJAF 4M93C 4ZFOA 4JR9H 1CTNA 2XWTB 3HRZB 2FSEA 2XZAH 1I3GH 4HG4K 4GQZA 4ZUSA 1PKQB 2WO4A 2YLKA 1WZMA 4F7KA 1CXIA 3CVHH 3FU5A 4MJ6A 1TEGA 2WCPA 1RUML 1RZGB 1CT8B 3HUJB 4J28A 4RMSA 4AZ8A 4MWFB 3X3FH 1B6DA 5CD5D 1J8SA 3CZLA 1IT9H 2N0MA 2LABA 3F7RA 4D3CH 2EILB 1A25A 5E6ZA 5JQIB 2P1YA 1CBVH 1JCVA 5FYKH 5DMJB 2GG1A 4MNQA 4ZO8A 5I66B 4U7SA 5EIVA 1LE5A 2JNZA 1IGJB 1PAMA 3BRDA 4PRHE 1NDTA 4LSTH 3CCHB 3HC4L 3HPJA 4AQZA 2E75C 2VAJA 4UAOC 1IKOP 4P2RE 1P53A 2ZCLH 2E47A 3QIBD 4WV1B 3L4TA 1KPVB 2BCMA 2BCKB 4FZ8H 1K3ZA 3V0WL 3A6CL 3G08A 2DQEL 4CSTA 1TZGH 4ETYA 3JWNG 3FO0L 1AR1C 3IFOA 3QT2A 3IM1A 2A4CA 1R5IB 4G7VL 3T9WA 1R17A 3U0WH 1C7TA 2OL3H 3A21A 1MPAH 3QDAA 1C1EL 3I6GB 2GKIA 4KRLB 2G4EA 3O2WH 3IEAA 4KXCA 2NNRA 2Q0ZX 3KS0J 4DO5A 1J9QA 1YEFL 4AW7A 4UIKH 3K1KC 1H3GA 4C54A 4ECNA 3L8QA 4BKSC 4KRMB 5ES4B 1LO4H 3OR7A 3HBQA 5IB2B 1X6LA 2Z7ZA 4HV8A 1U93A 3NCCB 1EZVX 2FWSA 2CR0A 1W91A 3HFFA 3NGBC 3VCLA 1IKFH 4U6HA 3S8FB 1NMAL 1L0XA 2BVPA 4DQOL 5AYUH 1SJMA 2EACA 1RZ7L 2H3NA 2ZWNA 3IXTA 4GO6B 5AG9A 5BPPA 5I1HL 5I15L 2HRPL 4PJIE 4YIQB 2H9GB 5T5FL 1PVHA 5KVDH 3QDGA 1WFUA 3Q3GB 1BWWA 5CFHA 4DO4A 1PD0A 3TBVA 1BEYL 1X3DA 4UNUA 2D4DA 3HC4H 1F1DA 4XO9A 4F2FA 1YQ2A 2PPFA 1YEDB 3CH8A 3DUUB 1SXZA 4PVLA 4PB9H 4WUUB 4XPBH 4DGIH 1AZBA 2MMXA 3DHJA 1OF2B 1LO2L 3ARYA 1WD9A 3V0WH 4ZX4A 2DBLH 3WFBL 5DFAA 2VMFA 5C08D 1VCBC 3IJ7A 2H2PC 2EABA 4M7LT 5CLXA 3FO0H 4ZO9A 4MZ2A 3AY4A 5AW9B 3EYSH 4ZUUA 4WFGD 2R2CA 4YHLH 1PFCA 3FOMA 2R0LH 4PB0L 3ZDZF 2AS5M 3H2WA 3O8XC 1A14L 1I4FA 2IIJA 1MI5B 3SKJL 1G9ML 3MUY1 3QR1A 4KK8D 4TF4A 5DVOA 3PF2A 5D1ZA 2E27H 3QZOA 1SYSA 3BEWA 1AZRA 2JKIS 4HHAB 3OHXB 1S7SB 1R33A 5IHWA 5F7MC 4UDUB 4TVSa 3FB6A 3NCWA 4QRPB 4UDTA 2A77H 1NCBL 3WE1A 4CILA 3X12B 4Y5YA 3GUFA 4BFGA 1FL6A 4PJBE 3D39B 3TT1H 1NEZA 2XXCB 1CXHA 1GPOL 1K8DA 5LBVA 2OK0L 3GBLA 3LH2H 4GUPA 2P80A 4X6EB 5JYMA 4NNPL 1AIFB 1FVCA 1NOFA 4O02H 3V4PH 3ARGA 4OSUH 3V7MA 8PAZA 4RMVA 3U7WL 1LEKB 1OSEA 3H9HB 2O30A 2YAFA 5T1JA 1UXLA 1KCVH 1OGAE 2VLRB 4PJIA 4ODWA 2YXWA 1WCBB 4PRPB 1L0QA 1PG7L 2G3XA 32C2B 4LCCA 3MV8B 3L3OC 1JFQL 1VFAB 2NRDA 4IM8A 1QASA 3P2BA 4MTMA 1P0SE 5DMGC 2Y1ZA 3ILQD 2VIRA 4OLYL 1VZHA 3FRUA 3ARZA 2OMTA 3UO1H 3QIWD 4AIEA 4AJVA 1BFSA 2BHYA 1IEBA 3PHSA 3JWNH 3IPFA 3LNFA 4MAZA 1KXHA 3O3BB 3ZRFC 3MFGB 1RUKL 3FRPB 2AV1A 1ZHKB 4FG0A 1FORL 4FQXA 2QQKH 1J5IA 2OKMA 4HPOH 4Z78B 4FXGB 1TQBB 1TCRB 4XMTA 4Z7OF 3ULUD 5EZOL 1L9TA 4FG2A 1GPOH 1JV2A 1R3KA 2YD8A 2N56A 4LRNL 2EP6A 3FOLB 3M1BB 2OK0H 1OARH 4ELME 5B8CB 2RMNA 4JM2D 5EIIA 2ZXBA 2DN7A 3QZBA 4NWUH 4QRRD 4A6YA 1ZRUA 1N7ML 1FC1A 3K6OA 1J05B 1LO5B 1CU4H 3SYAA 2DQJL 3U7WH 4XP5L 2CRZA 1AD9B 4MQXC 4PJFE 4R7XA 5K9OB 4NO0A 3VH8B 1O6SB 4PCKA 1CFNB 1PZ3A 2F2HA 5HP5A 2QV4A 4XB8A 2QKIA 5IUSA 3FCTA 3GSNL 1QFWM 4BFOA 1P5UC 4AQ8A 4DJMA 4OF3A 4DP9X 1E8ZA 1BCIA 3F7YB 2EYRB 1EAPA 2C5DC 3VFVB 1T5WB 2BIIA 2ZWYA 5GSRA 2YQGA 3DRTA 1FLRH 3VA6A 2MKWA 5MI0B 5CZVH 4OGAC 2WN3A 5I1CH 4S1DC 5K9QG 1S9VB 4NZFA 3B9KD 2YLHA 1J5OH 4AXWB 2X53A 2VC2H 4IHBA 3VVVA 4PJ8B 4I2XA 5JHAA 1P7BA 2IBZX 1AOZA 2NY4C 4G1EA 1AYRA 1RJYA 1JNNL 4U05A 4G6MH 4E5XA 1NDMA 3CZUB 1QACA 3RIFK 5FDWA 1CYXA 5AAPA 2BOBB 1JXJA 1ZV2A 4ZFZA 4FG6C 3GMMA 4WQOA 3C6LD 3S4SB 3ZTJH 3DYMA 3CDFA 3SCMC 3ILPA 1JYVA 3LQAC 4YEEA 4XXDB 2NQCA 2Y07L 4BBWA 1OGSA 1RZKH 3L48A 4KUCF 4L29B 2ZPKL 1RP8A 5AAMC 1FNEB 3ARFA 4NZUL 2DQCH 3TFKD 2Z0BA 4AUUA 1G7PA 1AQDA 4OV6F 4PJDB 3UZQB 1KTLB 1GW6A 3H3BC 1PZ5B 1PCSA 2LR4A 4A2FA 3L45A 3BCFA 3QA3A 5F70A 3RVVC 4LOEA 3LKRB 4YN3A 3G04B 4J6RL 2ORBL 3Q5YA 4EN3C 3BX7C 3BHBA 3KJ6L 3VJ6B 5EEUA 1IJNA 1ZTXE 1SQ2N 5GZOD 3D3VD 2JCCF 4F1ZA 1MY5A 1Q94B 2LAGB 4X6CF 2LT9A 4OFYD 2VLKD 5C0BD 3T6ZA 1AMYA 4JDZA 2VUKA 4N1EA 3V4VL 4DN3L 1ES0A 2K6ZA 3VFWB 4ELKA 3UROR 3MLTB 3HN5A 4XNUH 1JNNH 2BSRA 3D08A 2Z4QB 4PJXE 2GY5A 5GS1A 4RH4A 3T8XB 3NIFE 3Q6FA 2VISA 3MRCB 2DL9A 4KITB 4HC1A 7CGTA 1T1YA 1HL8A 4LDLB 3CWGA 1DJIA 1XFPA 1FBIL 4QIRA 3VGEA 4XPFL 1JK9A 3FQRA 3D69B 1PEWA 2OQJA 1I8IA 1NIAA 4K7PX 1R6VA 4NJ9H 4NN5B 4Y8DC 5BQ7B 3HG3A 5JQ6L 3MRBB 3W39B 2Y1AA 3PUCA 4AYMC 4P5SA 2ZXAA 3RAJH 1H3XA 4PYHA 1IGCL 2YGOA 5CBAA 4U3CA 3QR0A 4PRDA 2OFQA 2CDGA 1ZT7B 1E43A 1IGTB 2H6OA 4P5KA 4N5EC 4XMZA 5FFLA 1YDPB 4KQ4L 5GRUH 3INUL 3O6LH 3SPVB 4B5EA 1GSMA 1P1ZB 2ESVB 2A38A 2UUDK 5HHXL 5D70L 2V17L 3U4BH 1UM4L 1H8LA 4X6FA 5TDNA 1LK2B 3A47A 3V4VH 3F2LA 4JHVA 3C2AL 3EAKA 4P2CG 4XZUB 3U36A 3HZ3A 4I87A 1NCAH 4NZJA 3D0VB 5DD1H 2Y23A 3ARBC 3M86A 4H8HA 4HLJA 5F7UA 4JJ5A 1U91B 1C08A 3TEUA 2R51A 3WN5C 1MAJA 3OD3A 3VU1A 3VXRA 4DN4L 3FB8B 4ETQB 4OLXH 3SKUD 2Z3FA 2XUWA 5E9NA 2HRGA 5D2NE 4PJXA 4LHJB 3MREA 2DKSA 2X4RB 3RUGB 4A7GF 1XGUA 4WK0B 4A7VA 5JUEH 3UBXB 4LKXB 4NKDB 2YGQA 1NWOA 2D9QB 3IJHA 3T65B 3W57A 1Y0LA 4ZODA 4OT1L 4F7CA 4Y5VC 3L95B 4Q0XL 2CKBA 1IV8A 2VXUL 4DVBA 1OTTD 5L8LB 1A4BA 4KI5D 3DUHA 1LM8V 1NCJA 2DJMA 4PUBH 4RSVA 2IOMA 4YR6A 1IGCH 3C75A 3VI4A 1FZOB 2Q86A 5DEFB 4QRSA 3FQXB 5GGVL 3IDJA 3VFSB 4MB3A 4U33A 2QV2A 3GC3A 3RL1A 2VDPL 2QGCA 3OMAB 3FHQA 3T71A 5HDBE 2GCYA 5F3HB 2VWEE 4Q6IB 3HG1E 1EJFA 1WT5A 3R8QA 4PWJA 5IQNA 1A6UL 1GVIA 1SOKA 1S9YB 3EADA 5HPMA 5C86A 4HDIA 3MRGA 3QHZL 5E2WL 3K1DA 4LLDA 2DPKA 1ZA3B 4UINL 2VMJA 1L7TL 4KO7A 4YXKL 1U8NA 1KCUH 2G3MA 2J8UE 5EN3A 4F92B 4ZMVA 1M7DA 4LSQH 5F8RC 3L1OH 2YMXL 5EZLB 2WCSA 3KHOA 4ODTH 1AC6A 2VDRL 3H9SA 1LNUA 3GBMH 2FHBA 5D72L 2GQHA 2JIXD 1J8RA 3AITA 4GAYA 4WFFD 1BQLL 1WBZB 3CSTA 2Y5QA 4C83B 4MZIA 1CDBA 5TQ2L 1SXNA 4OT1H 5LAPA 3D25B 4UOJA 5E9DB 4Q0XH 3GXDA 1XF3B 3SQOH 1BAGA 5FECA 3ARQA 1HINL 3BZEB 3EOAA 2J88H 4XVTL 3BH4A 1RUQH 4KZ0A 5GPRA 3TBWB 2BZ7A 1QA9A 1MWOA 3HG4A 1XX9C 3WAKA 4OFIA 1BOGA 5C2BL 1QMUA 4JPKH 1YA5A 4RETB 1TYEB 3HFML 2ZE0A 1EANA 4PJ7F 1CO1A 4P2OD 3WEOA 5AKRA 2HJKB 2IH8A 4XNXL 3VD3A 2ZUTA 1YNTF 1VFUA 3VXSA 3BO8B 1A6UH 1MUJB 4RAUA 5HYJE 5I30L 1NCUA 2BVEA 2W1NA 4ATTA 4LVOC 3N0AA 3T4YA 3BN9D 4BFEA 2M1KA 3N1FC 3RIKA 4UTAL 1OD7A 2A2QT 4IYKA 2EXYC 4YXKH 3DARA 5SV3A 1YSOA 4GO9A 5I16A 3MZTA 5G4MA 4ZUTB 5JXED 4JVPA 5C08E 3I2CL 4JL1A 2APSA 2VDRH 1P84J 4E9QA 3PXHA 4PWGA 5HYEA 5GRVK 3WTUA 3MDJA 4BGDA 2YRLA 1E67A 3MXVL 4NWTH 4O5LL 2ARWA 4JGMA 4HIIA 2UY6B 5IHBA 4AQEA 4F58L 1WAAF 5D5ME 5CR1A 2ZOKA 2XZZA 5GRJL 3VFTA 5F88A 5KN5A 1SOXA 4APQD 4UTBL 5DI8A 5KYNA 4HCRH 3T0DA 1T20B 3DXAD 1HINH 3QEGL 4X4ZA 3S8WA 1E4XL 3UPRB 1HSBB 2C9RA 3CQPA 2ED8A 1SEBA 4JG9A 5EF3A 3HNSL 5CM1A 5BUPA 1UKSA 3EHBB 3HAEB 4JQVC 4TNFA 4RAHA 5C2BH 1OGPA 5E2UH 3VM7A 3GSOA 1J9TA 2R29A 3HFMH 5IEKA 5KSAB 3SDCB 3FPXA 4U1MA 4XNXH 3KLHD 4ELMB 5LAXA 3U7YL 3UTTD 2AEQH 3TN0A 5IQ9A 3UZEC 5DRNA 3E6HB 4XMKL 1AHWA 4MJ5B 3DVFA 3OXRB 2BY3A 5EZJB 4Z23A 5JW4M 5T3ZH 3GNMH 4U1LA 1XB3A 1PZBA 3EOTL 1ADWA 3UIYA 4N2GA 3OBAA 1FVDA 4ZUVB 1ML0A 3I02A 2C9XA 3IKCA 3KLDA 3UGEA 3NIDB 1JK8B 3EYQD 4OM1L 1AGEA 2OZ4A 4GBXC 1CI5A 2OYLA 5EU5B 4D9LH 2HT2C 3RDJA 5FC9A 4A68A 2WWNA 1QG3A 2NZIA 2WZAA 3UPAA 2HMIC 5FK9B 3BW9A 4UI2A 4F7EB 3GIZH 3ESPA 3QEGH 2IMMA 3L4WA 5JDSB 4XVSL 3MLWL 2ZUWA 1RJCA 3C9NB 2F8OA 3J27A 2B5IB 5I1IH 1B4LA 2YR3A 3PHOA 5ICZA 2Y3AA 3ULUE 2V2XA 1AY1L 3C8DA 3ENEA 4JAMB 4G80A 2NNAA 4TV3A 1FG2B 4I13B 4RFNB 4WU5B 5EZIH 4OUOA 1E6OH 1XIWB 2AQNA 3PABA 3A0OA 2EO7A 4JZJC 4J3XA 4ZBJA 4N0FB 2NZ1A 1DVFD 3AJ7A 3WJJC 1YYMH 5HHQA 1KLGB 2EXTA 2O5NA 4FL4C 3VRIA 1QW9A 1J8KA 4ZO6A 4P23C 4P06A 1B0RB 3MXWL 3S5YA 3VO0A 4PW9A 1MCPL 1JNHB 2C1OB 1I53A 4JHZA 4TNGA 4YHYC 1P6AB 1N18A 2OSYA 1G6RA 3EGDA 2V33A 2VZOA 4I0PD 2AFNA 4FE9A 2ZCKH 4QXWA 4NHCL 4JJOA 4RGMC 3RWHA 4JRYD 1XGTB 4C56D 1YQVH 3CDYA 5F89B 3WFCH 4BCZA 1JYXA 4Y4HC 3UAAA 3DIFA 1HXYA 4JFEE 4C4UA 3O2DA 1BJ8A 2WJ7A 1CVSC 1A6VL 5GGSB 2CMRL 3H9YA 3GHPA 2WAQA 5HGGS 3RE0A 3E3QC 3LRKA 1T04B 2WXGA 1X5YA 3SKMA 1D5XB 3TVMA 4AEHL 3G6JF 4QYOB 3QIWA 4R2GC 1A7OH 1TQCB 2FWOB 1RHFA 1N2RB 4JCWA 5KG9A 1IKNC 4N0UE 2Q76B 2RA1A 4ZMQA 5I6XB 2CBMA 3ZU8A 3LZQA 4XCEA 4X7FC 5FYJL 1XDTT 2VRKA 5DURB 2NYKA 2XTSA 2MCMA 4B9ZA 1Q0YL 1UACL 2HJFA 3QUZD 4IRZL 4L1TA 3K71A 3G5VB 1UM5L 1BIIA 1IC1A 2VO5A 3NA4A 5E99L 4PEEA 2AK4B 1MJ8H 4EBQH 2OTPA 3IMWA 5LGYA 3KLQA 1BOYA 4LHUB 4YSSA 3NIGE 2VDNH 2WUBH 2CUMA 2HT4C 5FYLH 2IH3B 4BRJA 3B7UX 3EBAA 3DO7B 4GIPD 5D2LF 4ABUA 4JRXB 5EPMB 1NCTA 5CU9A 4TQHA 3HEIB 4YPGA 1BQ5A 5LWYH 4QRRA 2B3IA 2XWJB 3OKNA 2GJ6D 4HH8A 5KSVA 2UXFA 1N9PA 4DKTA 4NHCH 1QYGL 3VYPA 3V6OE 1Q38A 5JYLA 5CHNA 3D3VE 3ZHFA 1BPLB 2Q9OA 2V7NA 2XPGA 3ZUCA 2ZOLA 1F2XK 2VLKE 3QDJD 1CDUA 1ORQB 5C0BE 5JPMC 4PP2B 1INDH 5E8DL 1WISA 1CD9B 4BKTC 5K5YA 3HS0C 3LN5A 2X4PA 4KKLC 1DANU 3T3MB 1MJ7H 3B9KA 5FHAH 4N8VB 4TUJB 2IADB 3GBEA 4U1JB 1YHPA 5ADPH 1RH8A 4S2SB 1HEZB 5BVJB 5CSGA 3UTOA 3FTYA 3WFEH 5HHMD 4JO2H 1I31A 5MEOB 1TQSA 4KZCA 2YD6A 1UACH 3HS9A 3L3HA 3T0EC 1MFAH 2PMZA 2WYIA 3SD2A 2VTFA 3WXVL 3LNDA 4MCNA 2MWCA 2XVKA 2WP3O 3LPFA 4IDLA 2J7LA 4HIJA 4MKTA 5IOPA 5E6SB 1EUUA 1MWAA 5D2NB 2I32A 1IZJA 3QO1B 1MCCA 4WW2B 4ZD3L 3KVQA 4B41A 1JWUA 3WKYA 1MFEL 2O5ZH 3LN4A 3GSXA 4ZXBB 1CFTB 3V0GA 2Q7NA 4DEPB 3QCUH 4CSPA 3E9UA 5EZPA 2Z7UA 1ZPLA 2E46A 2PYFB 5CP7A 4QJ4B 2KKQA 1W16A 3HC3L 4HWEL 3T8MA 3RVUC 5IOKA 4FFYA 3SGJC 1ET5A 2KI6A 3MV11 1F4AA 5EWIH 3NFSH 4M6AA 4LL4A 3FAWA 2QPSA 3B6SA 3WS6A 1A22B 2XKNB 3V2AR 4OZGB 1BXXA 2ERJC 2DQHH 43C9A 2FYVA 3W38A 2AXFA 3ET9F 5HDBB 4WEBL 3EJCA 5DK0B 2ATPB 2V2TB 3HG1B 3V0JA 1ZHLA 3RPBA 1SN2A 2WZPD 3V6OA 1OCRB 3C5ZA 4APXB 3Q06A 1PKOA 1AG6A 2JWYA 2ZSVB 1R5WA 3D3VA 2VMDA 3R1GL 4LNRB 2BS71 2J1XA 1XGYH 4JPIA 4OFYA 3VGDA 3TBTA 1VB9A 4DFIA 2JFCA 3GLZA 5FKPA 1UT1A 4ODHL 1NLDL 4WI7A 4FABL 1BP3B 3ZGIA 2EH8L 3TNNB 2JQZA 4GSRA 3RFRA 2AERT 3H3PL 5AZUA 2EZ0C 3A4FA 2FWLB 5J1SC 5ESQA 2EYSB 1MRCH 2IPUK 3MGTB 4OR1A 4IKIA 3N42B 5CZRA 3DX8A 5F9AC 1AR1D 1QPPA 3MRKA 4X50A 1OXYA 2CO7A 4POZC 4KNTA 3VGHA 1UCTA 3BKML 2CR3A 2X70B 2AXGA 2IPKB 4S0SD 3P73B 1NIFA 1YPZF 3CU7A 5DQDH 1D5ZA 4NQTA 4HUVA 4F5CE 2R1WB 4KI5E 1TJIL 5E56A 3V10A 4X98A 1SY6L 1S7RA 1WA1X 3F05A 4Q8BA 4L0ZA 5D1QA 5J6HB 4PJGA 4LDCA 3E0GA 4XRCB 2WNXA 4KI1A 2YK1L 3I85A 4WI6A 4DP4X 4XMVA 5AG8A 5KANI 3CDZA 4AGNA 2FX9L 3KW7A 1TVHB 2DH2A 2X4UA 4NP9A 1XSJA 3GWJA 1EFXD 3RURA 2MPAL 2CBOA 3DIDA 3V0VB 3MRPB 5IT2L 4DGVL 2YGVA 5E5MA 4NNYB 3NJGA 5H35B 1MCOL 3WHE0 3HBGA 3ZW3A 4MCZA 4XNDA 4C58B 1U8JB 3DJRA 3K7UA 5TDPA 2XWXA 1K6QH 4S1RH 5IB3B 4QHMB 5K9KA 5C0AA 5C0JA 1D5BB 3DBSA 1JF6A 5HYJB 1FL5A 1VENA 4IKKA 5FOJA 1GOGA 2ZOTA 4IBZA 2EIJB 4QTFA 3GTVA 4HKXB 5DJ6A 2DMHA 1J18A 4O58H 3DTXA 1KNOB 4KTEL 5LCVA 4PW3A 4ATWA 3VXQB 2Z34A 2VKWA 3PWJA 1DDHA 4JCMA 4N3UA 5AW5B 1KBKA 4KX9A 2OZNA 3BAJA 3B2DC 3IGUA 4WFFE 2H2PD 1WJ3A 4JFQA 2GSGA 1RIHH 3CIAA 4UZSA 3V6BR 3BKMH 3GIVB 2BH0A 5DTFA 2DICA 4HZAA 1NCWL 4GRLC 4JDTL 3QJRB 4XBPA 1EHLL 1KJVA 1KYFA 1TOXA 2OMVA 4XN8A 4FC3E 3OL2A 1WAPA 3PDGA 3RZCC 3D07A 2PO6B 3KPSB 3UMNA 5CCGE 2YK1H 1F6AA 2XN9B 4LLMB 4Y5XC 1U6AL 2VR9A 3V6FA 3JV4A 3RWFB 2PR4H 1PCXA 2X4OB 1YNKL 2VH5L 2MPAH 4ZDHA 5HYIA 4M61B 3WKNA 4M4PA 3CV5A 1COBA 5SWSA 5INCA 2WQWA 4FA8A 1PTZA 3OZLA 5DUPL 1IZKA 3FQTB 3OLGA 4GW5A 5M94B 1SF5A 3D50A 3ZYZA 5DJ8B 4P0DA 3N44B 1R3HB 1WGVA 5K9JL 3IFNL 2A6KB 1MIEH 2E7CA 2H6PB 3II2A 4NQCD 3PQYD 3FUDA 4JFFB 3STLA 4ZMYA 3VW3L 4R0LB 4Z7IA 4PQXA 3DVGB 3HZVA 5JW3L 3CE1A 1CIDA 3FT2A 4JO3H 1MRFL 2XA8L 8FABA 1FGNL 5DMGD 5A2LH 5IZ7A 3OWRA 2XWRA 1AE6L 5TF0A 2E6QA 3F65A 1BJ1H 3R7QA 1OPOA 1AZVA 3P0GB 3FB7A 1UOKA 4NQVA 3AREC 4AV4A 4NBZB 1NBYA 4C57C 4Y2OB 1Z9OA 4RWYL 3QCVL 2ETWA 1EAJA 1MHCB 5L9DL 3MBWB 5K33A 1T2QL 2JLLA 5IB5A 5T1LD 4K2UL 5FEBA 3G5XA 2BMKB 2V5TA 3C6SA 5D9SB 1MAMH 2CCVA 2P52A 1XZWA 2ZWZA 4HWBL 5HTSA 2OTUA 1CG9A 4G8EB 3ELAT 4KMQA 2FCBA 3LSOB 3OB8A