3HBVP

Prtc methionine mutants: m226a in-house
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
419
structure length
380
Chain Sequence
NVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted protease C
publication title Metzincin's canonical methionine is responsible for the structural integrity of the zinc-binding site
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 123
structure length 380
sequence length 419
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3hbvP02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3hbvP01
1D7XA 3MA2A 3U1RA 3OHOA 1XFYA 3KHIA 1BM6A 3LILA 2XQHA 2JSDA 1BSWA 5CZMA 3V96B 1JIWP 2MLRA 3B8ZA 2CLTA 2OZRA 1UMSA 1YOUA 1AYKA 2FV5A 4AXQA 1SLNA 2USNA 2QPJA 5L79A 2YO0A 1KUKA 4IJOA 5D7WA 1Y93A 2XS3A 1ATLA 1CGEA 3P24A 5B5PA 2OXUA 4PKRA 1I1IP 2Z2DA 1GE7A 1BIWA 1SLMA 1KUFA 2A8HA 3TS4A 5H8XA 1ZXCA 2OY4A 1BUVM 1UEAA 5CUHA 1R55A 3WP8A 1OM8A 2PJTA 3LE9A 1GO7P 3OHLA 2FV9A 3O2XA 1QUAA 1G9KA 4HX3A 3DWBA 3HY7A 1CQRA 1G49A 2DDYA 4GR8A 1Z3JA 1BKCA 1YQYA 1PWUA 3AYKA 2Z8XA 2Y6CA 4WF6A 3LAAA 1XURA 3LIRA 4JIJA 2AIGP 2WOAA 1JANA 4AIGA 2YB9A 3LJTA 4IUWA 1CK7A 1Y0VA 3B92A 1JKYA 2N8RA 2CKIA 4ILWD 4H30A 1SU3A 1XUCA 2ERPA 1JAOA 4XM6A 2YO1A 2QUAA 3Q2GA 1FM1A 1H71P 3S6LA 1BQQM 1G12A 4DD8A 5I3MA 1QIAA 1ZS0A 5BPAA 1HV5A 2E2DA 1GXDA 4WZVA 3EDHA 3N2VA 1IAAA 1C3IA 1XFXA 2TCLA 1SRPA 1MMPA 4I35A 4WK7A 3TVCA 3RTSA 3F19A 1HFCA 3WV3A 4PKUA 1QJJA 3ELMA 1R1HA 1CAQA 3O64A 1O0QA 1B8YA 5JMYA 2DW2A 3HDBA 4H3XA 1KAPP 1ND1A 3HY9A 1USNA 1C8TA 4WKEA 3KEJA 1EB6A 3HBVP 5D1UA 4DPEA 3EHXA 3KECA 5D3CA 1I73A 4EFSA 3DPEA 3TT4A 1Y8JA 5B5OA 1UMTA 4J4MA 5I12A 3ZUKA 4XBHA 4H84A 3LA9A 1CGLA 3A70A 2AYKA 3HBUP 2OVZA 4GQLA 4I03A 4PKTA 456CA 2ZJ6A 4JPAA 1B3DA 2YIGA 5BOYA 1YCMA 3LUNA 1KBCA 4A7BA 1IAGA 1OS9A 3B2ZA 1G05A 2X3BA 5I4OA 3SHIA 4L63A 1MMBA 3LEAA 3LUMA 3LQBA 5I2ZA 1XFZA 3TSKA 4JA1A 3N2UA 4JQGA 3AYUA 3F1AA 2AGMA 3HDAP 1QJIA 1I76A 3ULTA 4FVLA 1ASTA 1XFWA 1CIZA 3DL1A 1FLSA 2W12A 1IABA 3NX7A 3LKAA 4FU4A 5L7FA 4CTHA 1JH1A 4GWNA 2OW1A 1L6JA 1HFSA 1K7QA 2OW9A 3Q2HA 4GR3A 2J0TA 4Q1LA 2MZIA 3LGPA 5CXLA 1BUDA 2I47A 4H49A 2W15A 3CKIA 1KUIA 2X7MA 3WV1A 2POJA 4DV8A 2DW1A 4H2EA 1J7NA 4XM7A 1UTTA 3BA0A 3LMCA 3HYGA 4XM8A 1IACA 1OM6A 3UVCA 2D1OA 1WNIA 3ZVSA 5D1SA 2ZJ7A 2OW0A 1QICA 3K7LA 1K7IA 1AF0A 4ON1A 2EROA 1A86A 5D2BA 5D1TA 2OXZA 2WO9A 966CA 1JK3A 2K2GA 1RM8A 2JT5A 2SRTA 2X3CA 1ZP5A 2JIHA 2OI0A 1R1JA 4PKVA 4GR0A 3AIGA 1O0TA 3EDIA 1JAPA 1SMPA 1A85A 3KMEA 2W13A 1AKLA 4GUYA 2X3AA 2OY2A 5LABA 2RJPA 4ZR5A 5I0LA 1EAKA 2OVXA 5BOTA 1XUDA 2Y6DA 3KMCA 4AYKA 1XFVA 3NTNA 2RJQA 3VI1A 1OMJA 1ROSA 2MZEA 1RMZA 1GE6A 1R1IA 2O3EA 5CVWA 2MZHA 1ZTQA 1ZVXA 1G4KA 3A6ZA 2QUBA 2W0DA 3I7IA 1PWWA 1C7KA 2D1NA 1GO8P 1GE5A 1BZSA 2W14A 1D8MA 4L6TA 1OM7A 3VTGA 4DF9A 1Q3AA 3EDZA 4R3VA 1ZXVA 3L0TA 1HY7A 1CXVA 1CGFA 2O36A 3K7NA 3DPFA 4JP4A 3LQ0A 4PKSA 3KRYA 3LJGA 3F18A 1GKCA 3RTTA 2ZVDA 3F15A 2DDFA 1QIBA 2XS4A 3USNA 4H76A 2JT6A 4IN9A 1YP1A 1DMTA 2HU6A 1BQOA 2ML2A 2KRJA 2ERQA 3G5CA 1JJ9A 5I43A 3I7GA 2K9CA 2WO8A 3GBOA 1D5JA 2E3XA 2OXWA 3ZXHA 3G42A 1HTDA 1DTHA 1PWVA 4QKZA 4WKIA 1HOVA 3HB2P 4GWMA 4H1QA 2OW2A 4PKQA 1D8FA 3EDGA 3LIKA 4HMAA 1K7GA 3KEKA 1PWPA 1KUGA 2L0RA 1P9HA 1FBLA 3F17A 2JNPA 4GF1A 2DW0A 1S4BP 3LJZA 3DSLA 4AUOA 4A3WA 1IAEA 1R54A 3EWJA 1MMQA 830CA 4L19A 1OS2A 1BKCE 1PWQA 1XFUA 2MLSA 2V4BA 1SATA 4PKWA 1JAQA 3EHYA 1GKDA 3P1VA 1MMRA 3DNGA 4G9LA 1MNCA 4XCTA 2Z8ZA 4FXYP 1KUHA 1BKCI 1IADA 3WV2A 1EUBA 4H82A 2J83A 5CXAA 1JIZA 3LK8A 4FXQA 3L0VA 3KWVC 4G0DA 3E8RA 1OO9A 1UTZA 3F16A
chains in the Genus database with same CATH superfamily
1D7XA 1TVIA 3MA2A 3U1RA 3OHOA 1XFYA 3KHIA 1BM6A 3LILA 2XQHA 2JSDA 1BSWA 5CZMA 3V96B 1JIWP 2MLRA 3B8ZA 2CLTA 2OZRA 1UMSA 1YOUA 1AYKA 2FV5A 4AXQA 1SLNA 2USNA 2QPJA 5L79A 2YO0A 1KUKA 4IJOA 5D7WA 1Y93A 2XS3A 1ATLA 1CGEA 3P24A 4L7AA 5B5PA 2OXUA 4PKRA 1I1IP 2Z2DA 1GE7A 1BIWA 1SLMA 1KUFA 2A8HA 3TS4A 5H8XA 1ZXCA 2OY4A 1BUVM 1UEAA 3DTEA 5CUHA 1R55A 3WP8A 1OM8A 2PJTA 3LE9A 1GO7P 3OHLA 2FV9A 3O2XA 1QUAA 1G9KA 4HX3A 3DWBA 1XM5A 3HY7A 1CQRA 1G49A 2DDYA 3F16A 4GR8A 1Z3JA 1BKCA 1YQYA 1PWUA 3AYKA 2Z8XA 2Y6CA 4WF6A 3LAAA 1XURA 3LIRA 4JIJA 2AIGP 2WOAA 1JANA 4AIGA 2YB9A 3LJTA 4IUWA 1CK7A 1Y0VA 3B92A 1JKYA 2N8RA 2CKIA 4ILWD 4H30A 1SU3A 1XUCA 2ERPA 1JAOA 4XM6A 2YO1A 2QUAA 3Q2GA 1FM1A 1H71P 3S6LA 1BQQM 1G12A 4DD8A 5I3MA 3DTKA 1QIAA 1ZS0A 5BPAA 1HV5A 1OZ9A 2E2DA 1GXDA 4WZVA 3EDHA 2YUFA 3N2VA 1IAAA 1C3IA 1XFXA 2TCLA 1SRPA 1MMPA 4I35A 4WK7A 3TVCA 3RTSA 3F19A 1HFCA 3WV3A 4PKUA 1QJJA 3ELMA 1R1HA 1CAQA 3O64A 1O0QA 1B8YA 5JMYA 2DW2A 3HDBA 4H3XA 1KAPP 1ND1A 3HY9A 1USNA 1C8TA 4WKEA 3KEJA 1EB6A 3HBVP 5D1UA 4DPEA 3EHXA 3KECA 5D3CA 1I73A 4EFSA 3DPEA 3TT4A 1Y8JA 5B5OA 1UMTA 4J4MA 5I12A 3ZUKA 4XBHA 4H84A 3LA9A 1CGLA 3A70A 2AYKA 3HBUP 2OVZA 4GQLA 4I03A 4PKTA 456CA 2ZJ6A 4JPAA 1B3DA 2YIGA 5BOYA 1YCMA 3LUNA 1KBCA 4A7BA 1IAGA 1OS9A 3B2ZA 1G05A 2X3BA 5I4OA 3SHIA 4L63A 1MMBA 3LEAA 3LUMA 3LQBA 5I2ZA 1XFZA 3TSKA 4JA1A 3N2UA 4JQGA 3AYUA 3F1AA 2AGMA 3HDAP 1QJIA 1I76A 3ULTA 4FVLA 1ASTA 1XFWA 1CIZA 3DL1A 1FLSA 2W12A 1IABA 3NX7A 3LKAA 4FU4A 5L7FA 4CTHA 1JH1A 4GWNA 2OW1A 1HFSA 1K7QA 2OW9A 3Q2HA 4GR3A 2J0TA 4Q1LA 2MZIA 3LGPA 5CXLA 1BUDA 2I47A 4H49A 2W15A 3CKIA 1KUIA 2X7MA 3WV1A 2POJA 4DV8A 2DW1A 4H2EA 1J7NA 4XM7A 1UTTA 3BA0A 3LMCA 3HYGA 4XM8A 1IACA 1OM6A 3UVCA 2D1OA 1WNIA 3ZVSA 5D1SA 2ZJ7A 2OW0A 1QICA 3K7LA 1K7IA 1AF0A 4ON1A 2EROA 1A86A 5D2BA 5D1TA 2OXZA 2WO9A 966CA 1JK3A 2K2GA 1RM8A 2JT5A 2SRTA 2X3CA 1ZP5A 2JIHA 2OI0A 1R1JA 1XAXA 4PKVA 4GR0A 3AIGA 1O0TA 3EDIA 1JAPA 1SMPA 1A85A 3KMEA 2W13A 1AKLA 4GUYA 2X3AA 2OY2A 5LABA 2RJPA 4ZR5A 5I0LA 1EAKA 2OVXA 5BOTA 1XUDA 2Y6DA 3KMCA 4AYKA 1XFVA 3NTNA 2RJQA 3VI1A 1OMJA 1ROSA 2MZEA 1RMZA 1GE6A 1R1IA 2O3EA 5CVWA 2MZHA 1ZTQA 1ZVXA 1G4KA 2W0DA 3A6ZA 2QUBA 3I7IA 1PWWA 1C7KA 2D1NA 1GO8P 1GE5A 1BZSA 2W14A 1D8MA 3DTIA 4L6TA 1OM7A 3VTGA 4DF9A 1Q3AA 3EDZA 4R3VA 1ZXVA 3L0TA 1HY7A 1CXVA 1CGFA 2O36A 3K7NA 3DPFA 4JP4A 3LQ0A 4PKSA 3KRYA 3LJGA 3F18A 1GKCA 3RTTA 2ZVDA 3F15A 2DDFA 1QIBA 2XS4A 3USNA 4H76A 2JT6A 4IN9A 1YP1A 1DMTA 4DT5A 2HU6A 1BQOA 2ML2A 2KRJA 2ERQA 3G5CA 1JJ9A 5I43A 3I7GA 2K9CA 2WO8A 3GBOA 1D5JA 2E3XA 2OXWA 3ZXHA 3G42A 1HTDA 1DTHA 1PWVA 4QKZA 4WKIA 1HOVA 3HB2P 4GWMA 4H1QA 2OW2A 4PKQA 1D8FA 3EDGA 3LIKA 4HMAA 1K7GA 3KEKA 1PWPA 1KUGA 2L0RA 1P9HA 1FBLA 3F17A 2JNPA 4GF1A 2DW0A 1S4BP 3LJZA 3DSLA 4AUOA 4A3WA 1IAEA 1R54A 3EWJA 1MMQA 830CA 4L19A 1OS2A 1BKCE 1PWQA 1XFUA 2MLSA 2V4BA 1SATA 4PKWA 1JAQA 3EHYA 1GKDA 3P1VA 1MMRA 3DNGA 4G9LA 1MNCA 4XCTA 2Z8ZA 4FXYP 1KUHA 1BKCI 1IADA 3WV2A 1EUBA 4H82A 2J83A 5CXAA 1JIZA 3LK8A 4FXQA 3L0VA 3KWVC 4G0DA 3E8RA 1OO9A 1UTZA 1L6JA
chains in the Genus database with same CATH topology
1D7XA 3MA2A 3U1RA 3OHOA 1XFYA 3KHIA 1BM6A 3LILA 2XQHA 2JSDA 1BSWA 5CZMA 3V96B 1JIWP 2MLRA 3B8ZA 2CLTA 2OZRA 1UMSA 1YOUA 1AYKA 2FV5A 4AXQA 1SLNA 2USNA 2QPJA 5L79A 2YO0A 1KUKA 4IJOA 5D7WA 1Y93A 2XS3A 1ATLA 1CGEA 3P24A 4L7AA 5B5PA 2OXUA 4PKRA 1I1IP 2Z2DA 1GE7A 1BIWA 1SLMA 1KUFA 2A8HA 3TS4A 5H8XA 1ZXCA 2OY4A 1BUVM 1UEAA 3DTEA 5CUHA 1R55A 3WP8A 1OM8A 2PJTA 3LE9A 1GO7P 3OHLA 2FV9A 3O2XA 1QUAA 1G9KA 4HX3A 3DWBA 3HY7A 1CQRA 1G49A 2DDYA 4GR8A 1Z3JA 1BKCA 1YQYA 1PWUA 3AYKA 2Z8XA 2Y6CA 4WF6A 3LAAA 1XURA 3LIRA 4JIJA 2AIGP 2WOAA 1JANA 4AIGA 2YB9A 3LJTA 4IUWA 1CK7A 1Y0VA 3B92A 1JKYA 2N8RA 2CKIA 4ILWD 4H30A 1SU3A 1XUCA 2ERPA 1JAOA 4XM6A 2YO1A 2QUAA 3Q2GA 1FM1A 1H71P 3S6LA 1BQQM 1G12A 4DD8A 5I3MA 3DTKA 1QIAA 1ZS0A 5BPAA 1HV5A 2E2DA 1GXDA 4WZVA 3EDHA 2YUFA 3N2VA 1IAAA 1C3IA 1XFXA 2TCLA 1SRPA 1MMPA 4I35A 4WK7A 3TVCA 3RTSA 3F19A 1HFCA 3WV3A 4PKUA 1QJJA 3ELMA 1R1HA 1CAQA 3O64A 1O0QA 1B8YA 5JMYA 2DW2A 3HDBA 4H3XA 1KAPP 1ND1A 3HY9A 1USNA 1C8TA 4WKEA 3KEJA 1EB6A 3HBVP 5D1UA 4DPEA 3EHXA 3KECA 5D3CA 1I73A 4EFSA 3DPEA 3TT4A 1Y8JA 5B5OA 1UMTA 4J4MA 5I12A 3ZUKA 4XBHA 4H84A 3LA9A 1CGLA 3A70A 2AYKA 3HBUP 2OVZA 4GQLA 4I03A 4PKTA 456CA 2ZJ6A 4JPAA 1B3DA 2YIGA 5BOYA 1YCMA 3LUNA 1KBCA 4A7BA 1IAGA 1OS9A 3B2ZA 1G05A 2X3BA 5I4OA 3SHIA 4L63A 1MMBA 3LEAA 3LUMA 3LQBA 5I2ZA 1XFZA 3TSKA 4JA1A 3N2UA 4JQGA 3AYUA 3F1AA 2AGMA 3HDAP 1QJIA 1I76A 3ULTA 4FVLA 1ASTA 1XFWA 1CIZA 3DL1A 1FLSA 2W12A 1IABA 3NX7A 3LKAA 4FU4A 5L7FA 4CTHA 1JH1A 4GWNA 2OW1A 1L6JA 1HFSA 1K7QA 2OW9A 3Q2HA 4GR3A 2J0TA 4Q1LA 2MZIA 3LGPA 5CXLA 1BUDA 2I47A 4H49A 2W15A 3CKIA 1KUIA 2X7MA 3WV1A 2POJA 4DV8A 2DW1A 4H2EA 1J7NA 4XM7A 1UTTA 3BA0A 3LMCA 3HYGA 4XM8A 1IACA 1OM6A 3UVCA 2D1OA 1WNIA 3ZVSA 5D1SA 2ZJ7A 2OW0A 1QICA 3K7LA 1K7IA 1AF0A 4ON1A 2EROA 1A86A 5D2BA 5D1TA 2OXZA 2WO9A 966CA 1JK3A 2K2GA 1RM8A 2JT5A 2SRTA 2X3CA 1ZP5A 2JIHA 2OI0A 1R1JA 4PKVA 4GR0A 3AIGA 1O0TA 3EDIA 1JAPA 1SMPA 1A85A 3KMEA 2W13A 1AKLA 4GUYA 2X3AA 2OY2A 5LABA 2RJPA 4ZR5A 5I0LA 1EAKA 2OVXA 5BOTA 1XUDA 2Y6DA 3KMCA 4AYKA 1XFVA 3NTNA 2RJQA 3VI1A 1OMJA 1ROSA 2MZEA 1RMZA 1GE6A 1R1IA 2O3EA 5CVWA 2MZHA 1ZTQA 1ZVXA 1G4KA 3A6ZA 2QUBA 2W0DA 3I7IA 1PWWA 1C7KA 2D1NA 1GO8P 1GE5A 1BZSA 2W14A 1D8MA 3DTIA 4L6TA 1OM7A 3VTGA 4DF9A 1Q3AA 3EDZA 4R3VA 1ZXVA 3L0TA 1HY7A 1CXVA 1CGFA 2O36A 3K7NA 3DPFA 4JP4A 3LQ0A 4PKSA 3KRYA 3LJGA 3F18A 1GKCA 3RTTA 2ZVDA 3F15A 2DDFA 1QIBA 2XS4A 3USNA 4H76A 2JT6A 4IN9A 1YP1A 1DMTA 2HU6A 1BQOA 2ML2A 2KRJA 2ERQA 3G5CA 1JJ9A 5I43A 3I7GA 2K9CA 2WO8A 3GBOA 1D5JA 2E3XA 2OXWA 3ZXHA 3G42A 1HTDA 1DTHA 1PWVA 4QKZA 4WKIA 1HOVA 3HB2P 4GWMA 4H1QA 2OW2A 4PKQA 1D8FA 3EDGA 3LIKA 4HMAA 1K7GA 3KEKA 1PWPA 1KUGA 2L0RA 1P9HA 1FBLA 3F17A 2JNPA 4GF1A 2DW0A 1S4BP 3LJZA 3DSLA 4AUOA 4A3WA 1IAEA 1R54A 3EWJA 1MMQA 830CA 4L19A 1OS2A 1BKCE 1PWQA 1XFUA 2MLSA 2V4BA 1SATA 4PKWA 1JAQA 3EHYA 1GKDA 3P1VA 1MMRA 3DNGA 4G9LA 1MNCA 4XCTA 2Z8ZA 4FXYP 1KUHA 1BKCI 1IADA 3WV2A 1EUBA 4H82A 2J83A 5CXAA 1JIZA 3LK8A 4FXQA 3L0VA 3KWVC 4G0DA 3E8RA 1OO9A 1UTZA 3F16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7X A;  3MA2 A;  3U1R A;  3OHO A;  1XFY A;  3KHI A;  1BM6 A;  3LIL A;  2XQH A;  2JSD A;  1BSW A;  5CZM A;  3V96 B;  1JIW P;  2MLR A;  3B8Z A;  2CLT A;  2OZR A;  1UMS A;  1YOU A;  1AYK A;  2FV5 A;  4AXQ A;  1SLN A;  2USN A;  2QPJ A;  5L79 A;  2YO0 A;  1KUK A;  4IJO A;  5D7W A;  1Y93 A;  2XS3 A;  1ATL A;  1CGE A;  3P24 A;  5B5P A;  2OXU A;  4PKR A;  1I1I P;  2Z2D A;  1GE7 A;  1BIW A;  1SLM A;  1KUF A;  2A8H A;  3TS4 A;  5H8X A;  1ZXC A;  2OY4 A;  1BUV M;  1UEA A;  5CUH A;  1R55 A;  3WP8 A;  1OM8 A;  2PJT A;  3LE9 A;  1GO7 P;  3OHL A;  2FV9 A;  3O2X A;  1QUA A;  1G9K A;  4HX3 A;  3DWB A;  3HY7 A;  1CQR A;  1G49 A;  2DDY A;  4GR8 A;  1Z3J A;  1BKC A;  1YQY A;  1PWU A;  3AYK A;  2Z8X A;  2Y6C A;  4WF6 A;  3LAA A;  1XUR A;  3LIR A;  4JIJ A;  2AIG P;  2WOA A;  1JAN A;  4AIG A;  2YB9 A;  3LJT A;  4IUW A;  1CK7 A;  1Y0V A;  3B92 A;  1JKY A;  2N8R A;  2CKI A;  4ILW D;  4H30 A;  1SU3 A;  1XUC A;  2ERP A;  1JAO A;  4XM6 A;  2YO1 A;  2QUA A;  3Q2G A;  1FM1 A;  1H71 P;  3S6L A;  1BQQ M;  1G12 A;  4DD8 A;  5I3M A;  1QIA A;  1ZS0 A;  5BPA A;  1HV5 A;  2E2D A;  1GXD A;  4WZV A;  3EDH A;  3N2V A;  1IAA A;  1C3I A;  1XFX A;  2TCL A;  1SRP A;  1MMP A;  4I35 A;  4WK7 A;  3TVC A;  3RTS A;  3F19 A;  1HFC A;  3WV3 A;  4PKU A;  1QJJ A;  3ELM A;  1R1H A;  1CAQ A;  3O64 A;  1O0Q A;  1B8Y A;  5JMY A;  2DW2 A;  3HDB A;  4H3X A;  1KAP P;  1ND1 A;  3HY9 A;  1USN A;  1C8T A;  4WKE A;  3KEJ A;  1EB6 A;  3HBV P;  5D1U A;  4DPE A;  3EHX A;  3KEC A;  5D3C A;  1I73 A;  4EFS A;  3DPE A;  3TT4 A;  1Y8J A;  5B5O A;  1UMT A;  4J4M A;  5I12 A;  3ZUK A;  4XBH A;  4H84 A;  3LA9 A;  1CGL A;  3A70 A;  2AYK A;  3HBU P;  2OVZ A;  4GQL A;  4I03 A;  4PKT A;  456C A;  2ZJ6 A;  4JPA A;  1B3D A;  2YIG A;  5BOY A;  1YCM A;  3LUN A;  1KBC A;  4A7B A;  1IAG A;  1OS9 A;  3B2Z A;  1G05 A;  2X3B A;  5I4O A;  3SHI A;  4L63 A;  1MMB A;  3LEA A;  3LUM A;  3LQB A;  5I2Z A;  1XFZ A;  3TSK A;  4JA1 A;  3N2U A;  4JQG A;  3AYU A;  3F1A A;  2AGM A;  3HDA P;  1QJI A;  1I76 A;  3ULT A;  4FVL A;  1AST A;  1XFW A;  1CIZ A;  3DL1 A;  1FLS A;  2W12 A;  1IAB A;  3NX7 A;  3LKA A;  4FU4 A;  5L7F A;  4CTH A;  1JH1 A;  4GWN A;  2OW1 A;  1L6J A;  1HFS A;  1K7Q A;  2OW9 A;  3Q2H A;  4GR3 A;  2J0T A;  4Q1L A;  2MZI A;  3LGP A;  5CXL A;  1BUD A;  2I47 A;  4H49 A;  2W15 A;  3CKI A;  1KUI A;  2X7M A;  3WV1 A;  2POJ A;  4DV8 A;  2DW1 A;  4H2E A;  1J7N A;  4XM7 A;  1UTT A;  3BA0 A;  3LMC A;  3HYG A;  4XM8 A;  1IAC A;  1OM6 A;  3UVC A;  2D1O A;  1WNI A;  3ZVS A;  5D1S A;  2ZJ7 A;  2OW0 A;  1QIC A;  3K7L A;  1K7I A;  1AF0 A;  4ON1 A;  2ERO A;  1A86 A;  5D2B A;  5D1T A;  2OXZ A;  2WO9 A;  966C A;  1JK3 A;  2K2G A;  1RM8 A;  2JT5 A;  2SRT A;  2X3C A;  1ZP5 A;  2JIH A;  2OI0 A;  1R1J A;  4PKV A;  4GR0 A;  3AIG A;  1O0T A;  3EDI A;  1JAP A;  1SMP A;  1A85 A;  3KME A;  2W13 A;  1AKL A;  4GUY A;  2X3A A;  2OY2 A;  5LAB A;  2RJP A;  4ZR5 A;  5I0L A;  1EAK A;  2OVX A;  5BOT A;  1XUD A;  2Y6D A;  3KMC A;  4AYK A;  1XFV A;  3NTN A;  2RJQ A;  3VI1 A;  1OMJ A;  1ROS A;  2MZE A;  1RMZ A;  1GE6 A;  1R1I A;  2O3E A;  5CVW A;  2MZH A;  1ZTQ A;  1ZVX A;  1G4K A;  3A6Z A;  2QUB A;  2W0D A;  3I7I A;  1PWW A;  1C7K A;  2D1N A;  1GO8 P;  1GE5 A;  1BZS A;  2W14 A;  1D8M A;  4L6T A;  1OM7 A;  3VTG A;  4DF9 A;  1Q3A A;  3EDZ A;  4R3V A;  1ZXV A;  3L0T A;  1HY7 A;  1CXV A;  1CGF A;  2O36 A;  3K7N A;  3DPF A;  4JP4 A;  3LQ0 A;  4PKS A;  3KRY A;  3LJG A;  3F18 A;  1GKC A;  3RTT A;  2ZVD A;  3F15 A;  2DDF A;  1QIB A;  2XS4 A;  3USN A;  4H76 A;  2JT6 A;  4IN9 A;  1YP1 A;  1DMT A;  2HU6 A;  1BQO A;  2ML2 A;  2KRJ A;  2ERQ A;  3G5C A;  1JJ9 A;  5I43 A;  3I7G A;  2K9C A;  2WO8 A;  3GBO A;  1D5J A;  2E3X A;  2OXW A;  3ZXH A;  3G42 A;  1HTD A;  1DTH A;  1PWV A;  4QKZ A;  4WKI A;  1HOV A;  3HB2 P;  4GWM A;  4H1Q A;  2OW2 A;  4PKQ A;  1D8F A;  3EDG A;  3LIK A;  4HMA A;  1K7G A;  3KEK A;  1PWP A;  1KUG A;  2L0R A;  1P9H A;  1FBL A;  3F17 A;  2JNP A;  4GF1 A;  2DW0 A;  1S4B P;  3LJZ A;  3DSL A;  4AUO A;  4A3W A;  1IAE A;  1R54 A;  3EWJ A;  1MMQ A;  830C A;  4L19 A;  1OS2 A;  1BKC E;  1PWQ A;  1XFU A;  2MLS A;  2V4B A;  1SAT A;  4PKW A;  1JAQ A;  3EHY A;  1GKD A;  3P1V A;  1MMR A;  3DNG A;  4G9L A;  1MNC A;  4XCT A;  2Z8Z A;  4FXY P;  1KUH A;  1BKC I;  1IAD A;  3WV2 A;  1EUB A;  4H82 A;  2J83 A;  5CXA A;  1JIZ A;  3LK8 A;  4FXQ A;  3L0V A;  3KWV C;  4G0D A;  3E8R A;  1OO9 A;  1UTZ A;  3F16 A; 
#chains in the Genus database with same CATH topology
 1D7X A;  1TVI A;  3MA2 A;  3U1R A;  3OHO A;  1XFY A;  3KHI A;  1BM6 A;  3LIL A;  2XQH A;  2JSD A;  1BSW A;  5CZM A;  3V96 B;  1JIW P;  2MLR A;  3B8Z A;  2CLT A;  2OZR A;  1UMS A;  1YOU A;  1AYK A;  2FV5 A;  4AXQ A;  1SLN A;  2USN A;  2QPJ A;  5L79 A;  2YO0 A;  1KUK A;  4IJO A;  5D7W A;  1Y93 A;  2XS3 A;  1ATL A;  1CGE A;  3P24 A;  4L7A A;  5B5P A;  2OXU A;  4PKR A;  1I1I P;  2Z2D A;  1GE7 A;  1BIW A;  1SLM A;  1KUF A;  2A8H A;  3TS4 A;  5H8X A;  1ZXC A;  2OY4 A;  1BUV M;  1UEA A;  3DTE A;  5CUH A;  1R55 A;  3WP8 A;  1OM8 A;  2PJT A;  3LE9 A;  1GO7 P;  3OHL A;  2FV9 A;  3O2X A;  1QUA A;  1G9K A;  4HX3 A;  3DWB A;  1XM5 A;  3HY7 A;  1CQR A;  1G49 A;  2DDY A;  3F16 A;  4GR8 A;  1Z3J A;  1BKC A;  1YQY A;  1PWU A;  3AYK A;  2Z8X A;  2Y6C A;  4WF6 A;  3LAA A;  1XUR A;  3LIR A;  4JIJ A;  2AIG P;  2WOA A;  1JAN A;  4AIG A;  2YB9 A;  3LJT A;  4IUW A;  1CK7 A;  1Y0V A;  3B92 A;  1JKY A;  2N8R A;  2CKI A;  4ILW D;  4H30 A;  1SU3 A;  1XUC A;  2ERP A;  1JAO A;  4XM6 A;  2YO1 A;  2QUA A;  3Q2G A;  1FM1 A;  1H71 P;  3S6L A;  1BQQ M;  1G12 A;  4DD8 A;  5I3M A;  3DTK A;  1QIA A;  1ZS0 A;  5BPA A;  1HV5 A;  1OZ9 A;  2E2D A;  1GXD A;  4WZV A;  3EDH A;  2YUF A;  3N2V A;  1IAA A;  1C3I A;  1XFX A;  2TCL A;  1SRP A;  1MMP A;  4I35 A;  4WK7 A;  3TVC A;  3RTS A;  3F19 A;  1HFC A;  3WV3 A;  4PKU A;  1QJJ A;  3ELM A;  1R1H A;  1CAQ A;  3O64 A;  1O0Q A;  1B8Y A;  5JMY A;  2DW2 A;  3HDB A;  4H3X A;  1KAP P;  1ND1 A;  3HY9 A;  1USN A;  1C8T A;  4WKE A;  3KEJ A;  1EB6 A;  3HBV P;  5D1U A;  4DPE A;  3EHX A;  3KEC A;  5D3C A;  1I73 A;  4EFS A;  3DPE A;  3TT4 A;  1Y8J A;  5B5O A;  1UMT A;  4J4M A;  5I12 A;  3ZUK A;  4XBH A;  4H84 A;  3LA9 A;  1CGL A;  3A70 A;  2AYK A;  3HBU P;  2OVZ A;  4GQL A;  4I03 A;  4PKT A;  456C A;  2ZJ6 A;  4JPA A;  1B3D A;  2YIG A;  5BOY A;  1YCM A;  3LUN A;  1KBC A;  4A7B A;  1IAG A;  1OS9 A;  3B2Z A;  1G05 A;  2X3B A;  5I4O A;  3SHI A;  4L63 A;  1MMB A;  3LEA A;  3LUM A;  3LQB A;  5I2Z A;  1XFZ A;  3TSK A;  4JA1 A;  3N2U A;  4JQG A;  3AYU A;  3F1A A;  2AGM A;  3HDA P;  1QJI A;  1I76 A;  3ULT A;  4FVL A;  1AST A;  1XFW A;  1CIZ A;  3DL1 A;  1FLS A;  2W12 A;  1IAB A;  3NX7 A;  3LKA A;  4FU4 A;  5L7F A;  4CTH A;  1JH1 A;  4GWN A;  2OW1 A;  1HFS A;  1K7Q A;  2OW9 A;  3Q2H A;  4GR3 A;  2J0T A;  4Q1L A;  2MZI A;  3LGP A;  5CXL A;  1BUD A;  2I47 A;  4H49 A;  2W15 A;  3CKI A;  1KUI A;  2X7M A;  3WV1 A;  2POJ A;  4DV8 A;  2DW1 A;  4H2E A;  1J7N A;  4XM7 A;  1UTT A;  3BA0 A;  3LMC A;  3HYG A;  4XM8 A;  1IAC A;  1OM6 A;  3UVC A;  2D1O A;  1WNI A;  3ZVS A;  5D1S A;  2ZJ7 A;  2OW0 A;  1QIC A;  3K7L A;  1K7I A;  1AF0 A;  4ON1 A;  2ERO A;  1A86 A;  5D2B A;  5D1T A;  2OXZ A;  2WO9 A;  966C A;  1JK3 A;  2K2G A;  1RM8 A;  2JT5 A;  2SRT A;  2X3C A;  1ZP5 A;  2JIH A;  2OI0 A;  1R1J A;  1XAX A;  4PKV A;  4GR0 A;  3AIG A;  1O0T A;  3EDI A;  1JAP A;  1SMP A;  1A85 A;  3KME A;  2W13 A;  1AKL A;  4GUY A;  2X3A A;  2OY2 A;  5LAB A;  2RJP A;  4ZR5 A;  5I0L A;  1EAK A;  2OVX A;  5BOT A;  1XUD A;  2Y6D A;  3KMC A;  4AYK A;  1XFV A;  3NTN A;  2RJQ A;  3VI1 A;  1OMJ A;  1ROS A;  2MZE A;  1RMZ A;  1GE6 A;  1R1I A;  2O3E A;  5CVW A;  2MZH A;  1ZTQ A;  1ZVX A;  1G4K A;  2W0D A;  3A6Z A;  2QUB A;  3I7I A;  1PWW A;  1C7K A;  2D1N A;  1GO8 P;  1GE5 A;  1BZS A;  2W14 A;  1D8M A;  3DTI A;  4L6T A;  1OM7 A;  3VTG A;  4DF9 A;  1Q3A A;  3EDZ A;  4R3V A;  1ZXV A;  3L0T A;  1HY7 A;  1CXV A;  1CGF A;  2O36 A;  3K7N A;  3DPF A;  4JP4 A;  3LQ0 A;  4PKS A;  3KRY A;  3LJG A;  3F18 A;  1GKC A;  3RTT A;  2ZVD A;  3F15 A;  2DDF A;  1QIB A;  2XS4 A;  3USN A;  4H76 A;  2JT6 A;  4IN9 A;  1YP1 A;  1DMT A;  4DT5 A;  2HU6 A;  1BQO A;  2ML2 A;  2KRJ A;  2ERQ A;  3G5C A;  1JJ9 A;  5I43 A;  3I7G A;  2K9C A;  2WO8 A;  3GBO A;  1D5J A;  2E3X A;  2OXW A;  3ZXH A;  3G42 A;  1HTD A;  1DTH A;  1PWV A;  4QKZ A;  4WKI A;  1HOV A;  3HB2 P;  4GWM A;  4H1Q A;  2OW2 A;  4PKQ A;  1D8F A;  3EDG A;  3LIK A;  4HMA A;  1K7G A;  3KEK A;  1PWP A;  1KUG A;  2L0R A;  1P9H A;  1FBL A;  3F17 A;  2JNP A;  4GF1 A;  2DW0 A;  1S4B P;  3LJZ A;  3DSL A;  4AUO A;  4A3W A;  1IAE A;  1R54 A;  3EWJ A;  1MMQ A;  830C A;  4L19 A;  1OS2 A;  1BKC E;  1PWQ A;  1XFU A;  2MLS A;  2V4B A;  1SAT A;  4PKW A;  1JAQ A;  3EHY A;  1GKD A;  3P1V A;  1MMR A;  3DNG A;  4G9L A;  1MNC A;  4XCT A;  2Z8Z A;  4FXY P;  1KUH A;  1BKC I;  1IAD A;  3WV2 A;  1EUB A;  4H82 A;  2J83 A;  5CXA A;  1JIZ A;  3LK8 A;  4FXQ A;  3L0V A;  3KWV C;  4G0D A;  3E8R A;  1OO9 A;  1UTZ A;  1L6J A; 
#chains in the Genus database with same CATH homology
 1D7X A;  3MA2 A;  3U1R A;  3OHO A;  1XFY A;  3KHI A;  1BM6 A;  3LIL A;  2XQH A;  2JSD A;  1BSW A;  5CZM A;  3V96 B;  1JIW P;  2MLR A;  3B8Z A;  2CLT A;  2OZR A;  1UMS A;  1YOU A;  1AYK A;  2FV5 A;  4AXQ A;  1SLN A;  2USN A;  2QPJ A;  5L79 A;  2YO0 A;  1KUK A;  4IJO A;  5D7W A;  1Y93 A;  2XS3 A;  1ATL A;  1CGE A;  3P24 A;  4L7A A;  5B5P A;  2OXU A;  4PKR A;  1I1I P;  2Z2D A;  1GE7 A;  1BIW A;  1SLM A;  1KUF A;  2A8H A;  3TS4 A;  5H8X A;  1ZXC A;  2OY4 A;  1BUV M;  1UEA A;  3DTE A;  5CUH A;  1R55 A;  3WP8 A;  1OM8 A;  2PJT A;  3LE9 A;  1GO7 P;  3OHL A;  2FV9 A;  3O2X A;  1QUA A;  1G9K A;  4HX3 A;  3DWB A;  3HY7 A;  1CQR A;  1G49 A;  2DDY A;  4GR8 A;  1Z3J A;  1BKC A;  1YQY A;  1PWU A;  3AYK A;  2Z8X A;  2Y6C A;  4WF6 A;  3LAA A;  1XUR A;  3LIR A;  4JIJ A;  2AIG P;  2WOA A;  1JAN A;  4AIG A;  2YB9 A;  3LJT A;  4IUW A;  1CK7 A;  1Y0V A;  3B92 A;  1JKY A;  2N8R A;  2CKI A;  4ILW D;  4H30 A;  1SU3 A;  1XUC A;  2ERP A;  1JAO A;  4XM6 A;  2YO1 A;  2QUA A;  3Q2G A;  1FM1 A;  1H71 P;  3S6L A;  1BQQ M;  1G12 A;  4DD8 A;  5I3M A;  3DTK A;  1QIA A;  1ZS0 A;  5BPA A;  1HV5 A;  2E2D A;  1GXD A;  4WZV A;  3EDH A;  2YUF A;  3N2V A;  1IAA A;  1C3I A;  1XFX A;  2TCL A;  1SRP A;  1MMP A;  4I35 A;  4WK7 A;  3TVC A;  3RTS A;  3F19 A;  1HFC A;  3WV3 A;  4PKU A;  1QJJ A;  3ELM A;  1R1H A;  1CAQ A;  3O64 A;  1O0Q A;  1B8Y A;  5JMY A;  2DW2 A;  3HDB A;  4H3X A;  1KAP P;  1ND1 A;  3HY9 A;  1USN A;  1C8T A;  4WKE A;  3KEJ A;  1EB6 A;  3HBV P;  5D1U A;  4DPE A;  3EHX A;  3KEC A;  5D3C A;  1I73 A;  4EFS A;  3DPE A;  3TT4 A;  1Y8J A;  5B5O A;  1UMT A;  4J4M A;  5I12 A;  3ZUK A;  4XBH A;  4H84 A;  3LA9 A;  1CGL A;  3A70 A;  2AYK A;  3HBU P;  2OVZ A;  4GQL A;  4I03 A;  4PKT A;  456C A;  2ZJ6 A;  4JPA A;  1B3D A;  2YIG A;  5BOY A;  1YCM A;  3LUN A;  1KBC A;  4A7B A;  1IAG A;  1OS9 A;  3B2Z A;  1G05 A;  2X3B A;  5I4O A;  3SHI A;  4L63 A;  1MMB A;  3LEA A;  3LUM A;  3LQB A;  5I2Z A;  1XFZ A;  3TSK A;  4JA1 A;  3N2U A;  4JQG A;  3AYU A;  3F1A A;  2AGM A;  3HDA P;  1QJI A;  1I76 A;  3ULT A;  4FVL A;  1AST A;  1XFW A;  1CIZ A;  3DL1 A;  1FLS A;  2W12 A;  1IAB A;  3NX7 A;  3LKA A;  4FU4 A;  5L7F A;  4CTH A;  1JH1 A;  4GWN A;  2OW1 A;  1L6J A;  1HFS A;  1K7Q A;  2OW9 A;  3Q2H A;  4GR3 A;  2J0T A;  4Q1L A;  2MZI A;  3LGP A;  5CXL A;  1BUD A;  2I47 A;  4H49 A;  2W15 A;  3CKI A;  1KUI A;  2X7M A;  3WV1 A;  2POJ A;  4DV8 A;  2DW1 A;  4H2E A;  1J7N A;  4XM7 A;  1UTT A;  3BA0 A;  3LMC A;  3HYG A;  4XM8 A;  1IAC A;  1OM6 A;  3UVC A;  2D1O A;  1WNI A;  3ZVS A;  5D1S A;  2ZJ7 A;  2OW0 A;  1QIC A;  3K7L A;  1K7I A;  1AF0 A;  4ON1 A;  2ERO A;  1A86 A;  5D2B A;  5D1T A;  2OXZ A;  2WO9 A;  966C A;  1JK3 A;  2K2G A;  1RM8 A;  2JT5 A;  2SRT A;  2X3C A;  1ZP5 A;  2JIH A;  2OI0 A;  1R1J A;  4PKV A;  4GR0 A;  3AIG A;  1O0T A;  3EDI A;  1JAP A;  1SMP A;  1A85 A;  3KME A;  2W13 A;  1AKL A;  4GUY A;  2X3A A;  2OY2 A;  5LAB A;  2RJP A;  4ZR5 A;  5I0L A;  1EAK A;  2OVX A;  5BOT A;  1XUD A;  2Y6D A;  3KMC A;  4AYK A;  1XFV A;  3NTN A;  2RJQ A;  3VI1 A;  1OMJ A;  1ROS A;  2MZE A;  1RMZ A;  1GE6 A;  1R1I A;  2O3E A;  5CVW A;  2MZH A;  1ZTQ A;  1ZVX A;  1G4K A;  3A6Z A;  2QUB A;  2W0D A;  3I7I A;  1PWW A;  1C7K A;  2D1N A;  1GO8 P;  1GE5 A;  1BZS A;  2W14 A;  1D8M A;  3DTI A;  4L6T A;  1OM7 A;  3VTG A;  4DF9 A;  1Q3A A;  3EDZ A;  4R3V A;  1ZXV A;  3L0T A;  1HY7 A;  1CXV A;  1CGF A;  2O36 A;  3K7N A;  3DPF A;  4JP4 A;  3LQ0 A;  4PKS A;  3KRY A;  3LJG A;  3F18 A;  1GKC A;  3RTT A;  2ZVD A;  3F15 A;  2DDF A;  1QIB A;  2XS4 A;  3USN A;  4H76 A;  2JT6 A;  4IN9 A;  1YP1 A;  1DMT A;  2HU6 A;  1BQO A;  2ML2 A;  2KRJ A;  2ERQ A;  3G5C A;  1JJ9 A;  5I43 A;  3I7G A;  2K9C A;  2WO8 A;  3GBO A;  1D5J A;  2E3X A;  2OXW A;  3ZXH A;  3G42 A;  1HTD A;  1DTH A;  1PWV A;  4QKZ A;  4WKI A;  1HOV A;  3HB2 P;  4GWM A;  4H1Q A;  2OW2 A;  4PKQ A;  1D8F A;  3EDG A;  3LIK A;  4HMA A;  1K7G A;  3KEK A;  1PWP A;  1KUG A;  2L0R A;  1P9H A;  1FBL A;  3F17 A;  2JNP A;  4GF1 A;  2DW0 A;  1S4B P;  3LJZ A;  3DSL A;  4AUO A;  4A3W A;  1IAE A;  1R54 A;  3EWJ A;  1MMQ A;  830C A;  4L19 A;  1OS2 A;  1BKC E;  1PWQ A;  1XFU A;  2MLS A;  2V4B A;  1SAT A;  4PKW A;  1JAQ A;  3EHY A;  1GKD A;  3P1V A;  1MMR A;  3DNG A;  4G9L A;  1MNC A;  4XCT A;  2Z8Z A;  4FXY P;  1KUH A;  1BKC I;  1IAD A;  3WV2 A;  1EUB A;  4H82 A;  2J83 A;  5CXA A;  1JIZ A;  3LK8 A;  4FXQ A;  3L0V A;  3KWV C;  4G0D A;  3E8R A;  1OO9 A;  1UTZ A;  3F16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...