3HBVP

Prtc methionine mutants: m226a in-house
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
419
structure length
380
Chain Sequence
NVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metzincin's canonical methionine is responsible for the structural integrity of the zinc-binding site
pubmed doi rcsb
molecule keywords Secreted protease C
molecule tags Hydrolase
source organism Erwinia chrysanthemi
total genus 123
structure length 380
sequence length 419
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3hbvP02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3hbvP01
3K7NA 3Q2GA 1HY7A 1CQRA 5BOYA 2YO1A 3WV2A 3ELMA 3OHOA 1PWUA 1IAAA 5L79A 4XCTA 3ZXHA 1EB6A 2RJPA 1GE5A 1HFSA 5I4OA 1C7KA 2QPJA 3HDBA 1ATLA 4WZVA 2J0TA 5D7WA 1O0QA 1CGFA 2W15A 4DV8A 1I76A 456CA 1MMBA 5LABA 1EUBA 5BPAA 3LKAA 3EHXA 1AKLA 2QUBA 1ND1A 4JIJA 2AYKA 2ML2A 1GXDA 2O3EA 4PKUA 4AUOA 3DNGA 4Q1LA 2X3AA 2E3XA 3LQBA 2OW2A 4WKEA 4QKZA 1D8MA 3GBOA 1Y93A 3OHLA 1K7QA 2JT5A 4JPAA 1HFCA 1IAGA 4JA1A 3LIRA 2K9CA 4J4MA 3KECA 2ZJ7A 4IN9A 3N2VA 4IJOA 3HBUP 2AGMA 1PWWA 3LJTA 3V96B 1G4KA 3L0VA 3A70A 4H1QA 3WP8A 3LJZA 1GO8P 1K7GA 5I12A 1JK3A 3TT4A 1G12A 1KBCA 2OY2A 2OW0A 3B2ZA 2W14A 5I3MA 3KMEA 1GKDA 1AYKA 2YO0A 1USNA 4R3VA 4WK7A 5D1SA 4CTHA 2HU6A 1SLMA 2MZHA 4I35A 1QUAA 1GE6A 4L19A 4XM6A 1A85A 1OS9A 2O36A 1XURA 2JT6A 3LEAA 3F16A 2JIHA 4H30A 1QJJA 4A7BA 5D2BA 1C8TA 4PKRA 3B8ZA 4H49A 1BZSA 1HOVA 3VI1A 3HBVP 1UTZA 1YP1A 2OY4A 5B5OA 2Z2DA 1G9KA 1ZTQA 2DDYA 4FXQA 4XBHA 1CIZA 1FBLA 1EAKA 5CXLA 4XM7A 1GO7P 3EDZA 2A8HA 3B92A 2AIGP 2D1NA 2X7MA 3EHYA 1YCMA 1ASTA 1PWVA 1J7NA 2XS3A 3DPEA 2Z8ZA 2OXWA 2XS4A 1SLNA 1D7XA 3LE9A 4PKVA 3KMCA 2YIGA 1AF0A 3AYKA 1MMRA 3N2UA 1JJ9A 1PWPA 3LAAA 4DPEA 3E8RA 2MZEA 2I47A 3NTNA 5I2ZA 1YOUA 1XUDA 4A3WA 3AIGA 1O0TA 5I43A 1CGLA 3LJGA 1IACA 3LGPA 2SRTA 1OM7A 3U1RA 4GR3A 1QICA 1Y0VA 3AYUA 3F18A 1JANA 5D1UA 3LUNA 2D1OA 2OVZA 2V4BA 1C3IA 4G0DA 1UEAA 2ERPA 2ZVDA 1BM6A 3MA2A 3DL1A 1ZVXA 3EDGA 3CKIA 1BKCI 2X3CA 2FV5A 1BKCA 1JAOA 1PWQA 3DPFA 1I73A 4AIGA 1L6JA 1JAPA 1CGEA 1Y8JA 3EDIA 1JAQA 1KUFA 1ZXVA 4H2EA 2DW2A 1BQQM 4GR0A 1G05A 1CAQA 2Y6DA 1BKCE 4HMAA 3K7LA 2JNPA 3F19A 1KUIA 2E2DA 5I0LA 5CZMA 1SMPA 1BUDA 2W12A 1OM6A 3HY7A 4GR8A 3DSLA 4XM8A 4ZR5A 1UTTA 4PKWA 3KRYA 1P9HA 2EROA 1BQOA 1JH1A 2MLSA 2USNA 4PKSA 1UMTA 1MNCA 1OM8A 4EFSA 4PKTA 2MLRA 2MZIA 3F17A 2TCLA 4GUYA 1QJIA 4JP4A 4IUWA 1R1JA 3ULTA 3ZUKA 3Q2HA 3A6ZA 2OI0A 3HY9A 2KRJA 1XFUA 4JQGA 3EWJA 1A86A 2FV9A 3L0TA 1FM1A 2WO8A 3S6LA 2ERQA 1KUGA 3KWVC 1XUCA 3G42A 1S4BP 1XFVA 2WO9A 3EDHA 3P1VA 1R55A 4H84A 1SRPA 4WKIA 4FU4A 4H3XA 5H8XA 1SU3A 3VTGA 4FVLA 1K7IA 1B8YA 1I1IP 1XFZA 2W13A 3HB2P 3LQ0A 3G5CA 1OO9A 1GE7A 1XFWA 3O2XA 3F15A 3KEKA 4FXYP 3RTTA 2J83A 1OS2A 3LK8A 4ON1A 3LUMA 1SATA 4ILWD 4H76A 3UVCA 4AXQA 3LA9A 1D5JA 5D1TA 1UMSA 2OXZA 1JKYA 3KHIA 3USNA 1IABA 2OW9A 1Z3JA 2DW1A 3RTSA 1KUKA 3LMCA 3HDAP 4I03A 2RJQA 1B3DA 830CA 1Q3AA 4L6TA 1KAPP 2OVXA 5CUHA 4DD8A 3F1AA 5B5PA 3KEJA 1QIBA 4G9LA 1CK7A 5L7FA 4GWMA 1H71P 3TSKA 2K2GA 2CLTA 1R1IA 5D3CA 3SHIA 2YB9A 3BA0A 3P24A 1D8FA 1FLSA 3LIKA 1BUVM 966CA 2QUAA 2ZJ6A 4GWNA 2W0DA 2XQHA 1G49A 2PJTA 1DMTA 4H82A 4AYKA 1IAEA 1MMQA 2OW1A 1DTHA 4DF9A 4GF1A 3I7GA 3TS4A 4L63A 3WV3A 2CKIA 1R54A 1OMJA 2X3BA 1YQYA 1JIWP 3O64A 1ZS0A 2L0RA 1HTDA 3ZVSA 1XFYA 1XFXA 5JMYA 1ROSA 3NX7A 2POJA 4WF6A 2DDFA 1MMPA 1RMZA 1BSWA 2N8RA 4PKQA 2Z8XA 1HV5A 1CXVA 4HX3A 3I7IA 5CVWA 1R1HA 2OXUA 2OZRA 1IADA 1ZXCA 2Y6CA 3DWBA 5BOTA 1JIZA 2WOAA 2JSDA 3LILA 5CXAA 1WNIA 3TVCA 1ZP5A 1KUHA 2DW0A 1QIAA 3WV1A 1GKCA 1RM8A 3HYGA 1BIWA 4GQLA
chains in the Genus database with same CATH superfamily
3K7NA 3Q2GA 1HY7A 1CQRA 5BOYA 2YO1A 3WV2A 3ELMA 3OHOA 1PWUA 1IAAA 5L79A 4XCTA 3ZXHA 1EB6A 2RJPA 1GE5A 1HFSA 5I4OA 1C7KA 2QPJA 3HDBA 1ATLA 4WZVA 2J0TA 5D7WA 1O0QA 1CGFA 2W15A 4DV8A 1I76A 456CA 1MMBA 5LABA 1EUBA 5BPAA 3LKAA 3EHXA 1AKLA 2QUBA 1ND1A 4JIJA 2AYKA 2ML2A 1GXDA 2O3EA 4PKUA 4AUOA 3DNGA 4Q1LA 2X3AA 2E3XA 3LQBA 2OW2A 4WKEA 3DTEA 4QKZA 1D8MA 3GBOA 1Y93A 3OHLA 1K7QA 2JT5A 4JPAA 1HFCA 1IAGA 4JA1A 3LIRA 2K9CA 4J4MA 3KECA 2ZJ7A 4IN9A 3N2VA 4IJOA 3HBUP 2AGMA 1PWWA 3LJTA 3V96B 1G4KA 3L0VA 3A70A 4H1QA 3WP8A 3LJZA 1GO8P 1K7GA 5I12A 1JK3A 3TT4A 1G12A 1KBCA 2OY2A 2OW0A 3B2ZA 2W14A 5I3MA 3KMEA 1GKDA 1AYKA 2YO0A 1USNA 4R3VA 4WK7A 5D1SA 4CTHA 2HU6A 1SLMA 2MZHA 4I35A 1QUAA 1GE6A 4L19A 4XM6A 1A85A 1OS9A 2O36A 1XURA 2JT6A 3LEAA 3F16A 2JIHA 4H30A 1QJJA 4A7BA 5D2BA 1C8TA 4PKRA 3B8ZA 4H49A 1BZSA 1HOVA 3VI1A 3HBVP 1UTZA 1YP1A 2OY4A 5B5OA 2Z2DA 1G9KA 1ZTQA 2DDYA 4FXQA 4XBHA 1CIZA 1FBLA 1EAKA 5CXLA 4XM7A 1GO7P 3EDZA 2A8HA 3B92A 2AIGP 2YUFA 2D1NA 2X7MA 3EHYA 1YCMA 1ASTA 1PWVA 1J7NA 1TVIA 2XS3A 3DPEA 2Z8ZA 2OXWA 2XS4A 1SLNA 1D7XA 3LE9A 4PKVA 3KMCA 2YIGA 1AF0A 3AYKA 1MMRA 3N2UA 1JJ9A 1PWPA 3LAAA 4DPEA 3E8RA 2MZEA 2I47A 3NTNA 5I2ZA 1YOUA 1XUDA 4A3WA 3AIGA 1O0TA 5I43A 1CGLA 3LJGA 1IACA 3LGPA 2SRTA 1OM7A 3U1RA 4GR3A 1QICA 1Y0VA 3AYUA 3F18A 1JANA 5D1UA 3LUNA 2D1OA 2OVZA 2V4BA 1C3IA 4G0DA 1UEAA 2ERPA 2ZVDA 1BM6A 3DTKA 3MA2A 3DL1A 1ZVXA 3EDGA 3CKIA 1BKCI 2X3CA 2FV5A 1BKCA 1JAOA 1PWQA 3DPFA 1I73A 4AIGA 1L6JA 1JAPA 1CGEA 1Y8JA 3EDIA 1JAQA 1KUFA 1ZXVA 4H2EA 2DW2A 1BQQM 4GR0A 1G05A 1CAQA 2Y6DA 1BKCE 4HMAA 3K7LA 2JNPA 3F19A 1KUIA 2E2DA 5I0LA 5CZMA 1SMPA 1BUDA 2W12A 1OM6A 3HY7A 4GR8A 3DSLA 4XM8A 4ZR5A 1UTTA 4PKWA 3KRYA 1P9HA 4DT5A 2EROA 1BQOA 1JH1A 2MLSA 4L7AA 2USNA 4PKSA 1OZ9A 1UMTA 1MNCA 1OM8A 4EFSA 4PKTA 2MLRA 2MZIA 3F17A 2TCLA 4GUYA 1QJIA 4JP4A 4IUWA 1R1JA 3ULTA 3ZUKA 3Q2HA 3A6ZA 2OI0A 3HY9A 1XM5A 2KRJA 1XFUA 4JQGA 3EWJA 1A86A 2FV9A 3L0TA 1FM1A 2WO8A 3S6LA 2ERQA 1KUGA 3KWVC 1XUCA 3G42A 1S4BP 1XFVA 2WO9A 3EDHA 3P1VA 1R55A 4H84A 1SRPA 4WKIA 4FU4A 4H3XA 5H8XA 1SU3A 3VTGA 4FVLA 1K7IA 1B8YA 1I1IP 1XFZA 2W13A 3HB2P 3LQ0A 3G5CA 1OO9A 1GE7A 1XFWA 3O2XA 3F15A 3KEKA 4FXYP 3RTTA 2J83A 1OS2A 3LK8A 4ON1A 3LUMA 1SATA 4ILWD 4H76A 3UVCA 4AXQA 3LA9A 1D5JA 5D1TA 1UMSA 2OXZA 1JKYA 3KHIA 3USNA 1IABA 2OW9A 3DTIA 1Z3JA 2DW1A 3RTSA 1KUKA 3LMCA 3HDAP 4I03A 2RJQA 1B3DA 830CA 1Q3AA 4L6TA 1KAPP 2OVXA 5CUHA 4DD8A 3F1AA 5B5PA 3KEJA 1QIBA 4G9LA 1CK7A 5L7FA 4GWMA 1H71P 3TSKA 2K2GA 2CLTA 1R1IA 5D3CA 3SHIA 2YB9A 3BA0A 3P24A 1D8FA 1FLSA 3LIKA 1BUVM 966CA 2QUAA 2ZJ6A 4GWNA 2W0DA 2XQHA 1G49A 2PJTA 1DMTA 4H82A 4AYKA 1IAEA 1MMQA 2OW1A 1DTHA 4DF9A 4GF1A 3I7GA 3TS4A 4L63A 3WV3A 2CKIA 1R54A 1OMJA 2X3BA 1YQYA 1JIWP 3O64A 1ZS0A 2L0RA 1HTDA 3ZVSA 1XFYA 1XFXA 5JMYA 1ROSA 3NX7A 2POJA 4WF6A 2DDFA 1MMPA 1RMZA 1BSWA 2N8RA 4PKQA 2Z8XA 1HV5A 1CXVA 4HX3A 3I7IA 5CVWA 1R1HA 2OXUA 2OZRA 1IADA 1ZXCA 2Y6CA 3DWBA 1XAXA 5BOTA 1JIZA 2WOAA 2JSDA 3LILA 5CXAA 1WNIA 3TVCA 1ZP5A 1KUHA 2DW0A 1QIAA 3WV1A 1GKCA 1RM8A 3HYGA 1BIWA 4GQLA
chains in the Genus database with same CATH topology
3K7NA 3Q2GA 1HY7A 1CQRA 5BOYA 2YO1A 3WV2A 3ELMA 3OHOA 1PWUA 1IAAA 5L79A 4XCTA 3ZXHA 1EB6A 2RJPA 1GE5A 1HFSA 5I4OA 1C7KA 2QPJA 3HDBA 1ATLA 4WZVA 2J0TA 5D7WA 1O0QA 1CGFA 2W15A 4DV8A 1I76A 456CA 1MMBA 5LABA 1EUBA 5BPAA 3LKAA 3EHXA 1AKLA 2QUBA 1ND1A 4JIJA 2AYKA 2ML2A 1GXDA 2O3EA 4PKUA 4AUOA 3DNGA 4Q1LA 2X3AA 2E3XA 3LQBA 2OW2A 4WKEA 3DTEA 4QKZA 1D8MA 3GBOA 1Y93A 3OHLA 1K7QA 2JT5A 4JPAA 1HFCA 1IAGA 4JA1A 3LIRA 2K9CA 4J4MA 3KECA 2ZJ7A 4IN9A 3N2VA 4IJOA 3HBUP 2AGMA 1PWWA 3LJTA 3V96B 1G4KA 3L0VA 3A70A 4H1QA 3WP8A 3LJZA 1GO8P 1K7GA 5I12A 1JK3A 3TT4A 1G12A 1KBCA 2OY2A 2OW0A 3B2ZA 2W14A 5I3MA 3KMEA 1GKDA 1AYKA 2YO0A 1USNA 4R3VA 4WK7A 5D1SA 4CTHA 2HU6A 1SLMA 2MZHA 4I35A 1QUAA 1GE6A 4L19A 4XM6A 1A85A 1OS9A 2O36A 1XURA 2JT6A 3LEAA 3F16A 2JIHA 4H30A 1QJJA 4A7BA 5D2BA 1C8TA 4PKRA 3B8ZA 4H49A 1BZSA 1HOVA 3VI1A 3HBVP 1UTZA 1YP1A 2OY4A 5B5OA 2Z2DA 1G9KA 1ZTQA 2DDYA 4FXQA 4XBHA 1CIZA 1FBLA 1EAKA 5CXLA 4XM7A 1GO7P 3EDZA 2A8HA 3B92A 2AIGP 2YUFA 2D1NA 2X7MA 3EHYA 1YCMA 1ASTA 1PWVA 1J7NA 2XS3A 3DPEA 2Z8ZA 2OXWA 2XS4A 1SLNA 1D7XA 3LE9A 4PKVA 3KMCA 2YIGA 1AF0A 3AYKA 1MMRA 3N2UA 1JJ9A 1PWPA 3LAAA 4DPEA 3E8RA 2MZEA 2I47A 3NTNA 5I2ZA 1YOUA 1XUDA 4A3WA 3AIGA 1O0TA 5I43A 1CGLA 3LJGA 1IACA 3LGPA 2SRTA 1OM7A 3U1RA 4GR3A 1QICA 1Y0VA 3AYUA 3F18A 1JANA 5D1UA 3LUNA 2D1OA 2OVZA 2V4BA 1C3IA 4G0DA 1UEAA 2ERPA 2ZVDA 1BM6A 3DTKA 3MA2A 3DL1A 1ZVXA 3EDGA 3CKIA 1BKCI 2X3CA 2FV5A 1BKCA 1JAOA 1PWQA 3DPFA 1I73A 4AIGA 1L6JA 1JAPA 1CGEA 1Y8JA 3EDIA 1JAQA 1KUFA 1ZXVA 4H2EA 2DW2A 1BQQM 4GR0A 1G05A 1CAQA 2Y6DA 1BKCE 4HMAA 3K7LA 2JNPA 3F19A 1KUIA 2E2DA 5I0LA 5CZMA 1SMPA 1BUDA 2W12A 1OM6A 3HY7A 4GR8A 3DSLA 4XM8A 4ZR5A 1UTTA 4PKWA 3KRYA 1P9HA 2EROA 1BQOA 1JH1A 2MLSA 4L7AA 2USNA 4PKSA 1UMTA 1MNCA 1OM8A 4EFSA 4PKTA 2MLRA 2MZIA 3F17A 2TCLA 4GUYA 1QJIA 4JP4A 4IUWA 1R1JA 3ULTA 3ZUKA 3Q2HA 3A6ZA 2OI0A 3HY9A 2KRJA 1XFUA 4JQGA 3EWJA 1A86A 2FV9A 3L0TA 1FM1A 2WO8A 3S6LA 2ERQA 1KUGA 3KWVC 1XUCA 3G42A 1S4BP 1XFVA 2WO9A 3EDHA 3P1VA 1R55A 4H84A 1SRPA 4WKIA 4FU4A 4H3XA 5H8XA 1SU3A 3VTGA 4FVLA 1K7IA 1B8YA 1I1IP 1XFZA 2W13A 3HB2P 3LQ0A 3G5CA 1OO9A 1GE7A 1XFWA 3O2XA 3F15A 3KEKA 4FXYP 3RTTA 2J83A 1OS2A 3LK8A 4ON1A 3LUMA 1SATA 4ILWD 4H76A 3UVCA 4AXQA 3LA9A 1D5JA 5D1TA 1UMSA 2OXZA 1JKYA 3KHIA 3USNA 1IABA 2OW9A 3DTIA 1Z3JA 2DW1A 3RTSA 1KUKA 3LMCA 3HDAP 4I03A 2RJQA 1B3DA 830CA 1Q3AA 4L6TA 1KAPP 2OVXA 5CUHA 4DD8A 3F1AA 5B5PA 3KEJA 1QIBA 4G9LA 1CK7A 5L7FA 4GWMA 1H71P 3TSKA 2K2GA 2CLTA 1R1IA 5D3CA 3SHIA 2YB9A 3BA0A 3P24A 1D8FA 1FLSA 3LIKA 1BUVM 966CA 2QUAA 2ZJ6A 4GWNA 2W0DA 2XQHA 1G49A 2PJTA 1DMTA 4H82A 4AYKA 1IAEA 1MMQA 2OW1A 1DTHA 4DF9A 4GF1A 3I7GA 3TS4A 4L63A 3WV3A 2CKIA 1R54A 1OMJA 2X3BA 1YQYA 1JIWP 3O64A 1ZS0A 2L0RA 1HTDA 3ZVSA 1XFYA 1XFXA 5JMYA 1ROSA 3NX7A 2POJA 4WF6A 2DDFA 1MMPA 1RMZA 1BSWA 2N8RA 4PKQA 2Z8XA 1HV5A 1CXVA 4HX3A 3I7IA 5CVWA 1R1HA 2OXUA 2OZRA 1IADA 1ZXCA 2Y6CA 3DWBA 5BOTA 1JIZA 2WOAA 2JSDA 3LILA 5CXAA 1WNIA 3TVCA 1ZP5A 1KUHA 2DW0A 1QIAA 3WV1A 1GKCA 1RM8A 3HYGA 1BIWA 4GQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7N A;  3Q2G A;  1HY7 A;  1CQR A;  5BOY A;  2YO1 A;  3WV2 A;  3ELM A;  3OHO A;  1PWU A;  1IAA A;  5L79 A;  4XCT A;  3ZXH A;  1EB6 A;  2RJP A;  1GE5 A;  1HFS A;  5I4O A;  1C7K A;  2QPJ A;  3HDB A;  1ATL A;  4WZV A;  2J0T A;  5D7W A;  1O0Q A;  1CGF A;  2W15 A;  4DV8 A;  1I76 A;  456C A;  1MMB A;  5LAB A;  1EUB A;  5BPA A;  3LKA A;  3EHX A;  1AKL A;  2QUB A;  1ND1 A;  4JIJ A;  2AYK A;  2ML2 A;  1GXD A;  2O3E A;  4PKU A;  4AUO A;  3DNG A;  4Q1L A;  2X3A A;  2E3X A;  3LQB A;  2OW2 A;  4WKE A;  4QKZ A;  1D8M A;  3GBO A;  1Y93 A;  3OHL A;  1K7Q A;  2JT5 A;  4JPA A;  1HFC A;  1IAG A;  4JA1 A;  3LIR A;  2K9C A;  4J4M A;  3KEC A;  2ZJ7 A;  4IN9 A;  3N2V A;  4IJO A;  3HBU P;  2AGM A;  1PWW A;  3LJT A;  3V96 B;  1G4K A;  3L0V A;  3A70 A;  4H1Q A;  3WP8 A;  3LJZ A;  1GO8 P;  1K7G A;  5I12 A;  1JK3 A;  3TT4 A;  1G12 A;  1KBC A;  2OY2 A;  2OW0 A;  3B2Z A;  2W14 A;  5I3M A;  3KME A;  1GKD A;  1AYK A;  2YO0 A;  1USN A;  4R3V A;  4WK7 A;  5D1S A;  4CTH A;  2HU6 A;  1SLM A;  2MZH A;  4I35 A;  1QUA A;  1GE6 A;  4L19 A;  4XM6 A;  1A85 A;  1OS9 A;  2O36 A;  1XUR A;  2JT6 A;  3LEA A;  3F16 A;  2JIH A;  4H30 A;  1QJJ A;  4A7B A;  5D2B A;  1C8T A;  4PKR A;  3B8Z A;  4H49 A;  1BZS A;  1HOV A;  3VI1 A;  3HBV P;  1UTZ A;  1YP1 A;  2OY4 A;  5B5O A;  2Z2D A;  1G9K A;  1ZTQ A;  2DDY A;  4FXQ A;  4XBH A;  1CIZ A;  1FBL A;  1EAK A;  5CXL A;  4XM7 A;  1GO7 P;  3EDZ A;  2A8H A;  3B92 A;  2AIG P;  2D1N A;  2X7M A;  3EHY A;  1YCM A;  1AST A;  1PWV A;  1J7N A;  2XS3 A;  3DPE A;  2Z8Z A;  2OXW A;  2XS4 A;  1SLN A;  1D7X A;  3LE9 A;  4PKV A;  3KMC A;  2YIG A;  1AF0 A;  3AYK A;  1MMR A;  3N2U A;  1JJ9 A;  1PWP A;  3LAA A;  4DPE A;  3E8R A;  2MZE A;  2I47 A;  3NTN A;  5I2Z A;  1YOU A;  1XUD A;  4A3W A;  3AIG A;  1O0T A;  5I43 A;  1CGL A;  3LJG A;  1IAC A;  3LGP A;  2SRT A;  1OM7 A;  3U1R A;  4GR3 A;  1QIC A;  1Y0V A;  3AYU A;  3F18 A;  1JAN A;  5D1U A;  3LUN A;  2D1O A;  2OVZ A;  2V4B A;  1C3I A;  4G0D A;  1UEA A;  2ERP A;  2ZVD A;  1BM6 A;  3MA2 A;  3DL1 A;  1ZVX A;  3EDG A;  3CKI A;  1BKC I;  2X3C A;  2FV5 A;  1BKC A;  1JAO A;  1PWQ A;  3DPF A;  1I73 A;  4AIG A;  1L6J A;  1JAP A;  1CGE A;  1Y8J A;  3EDI A;  1JAQ A;  1KUF A;  1ZXV A;  4H2E A;  2DW2 A;  1BQQ M;  4GR0 A;  1G05 A;  1CAQ A;  2Y6D A;  1BKC E;  4HMA A;  3K7L A;  2JNP A;  3F19 A;  1KUI A;  2E2D A;  5I0L A;  5CZM A;  1SMP A;  1BUD A;  2W12 A;  1OM6 A;  3HY7 A;  4GR8 A;  3DSL A;  4XM8 A;  4ZR5 A;  1UTT A;  4PKW A;  3KRY A;  1P9H A;  2ERO A;  1BQO A;  1JH1 A;  2MLS A;  2USN A;  4PKS A;  1UMT A;  1MNC A;  1OM8 A;  4EFS A;  4PKT A;  2MLR A;  2MZI A;  3F17 A;  2TCL A;  4GUY A;  1QJI A;  4JP4 A;  4IUW A;  1R1J A;  3ULT A;  3ZUK A;  3Q2H A;  3A6Z A;  2OI0 A;  3HY9 A;  2KRJ A;  1XFU A;  4JQG A;  3EWJ A;  1A86 A;  2FV9 A;  3L0T A;  1FM1 A;  2WO8 A;  3S6L A;  2ERQ A;  1KUG A;  3KWV C;  1XUC A;  3G42 A;  1S4B P;  1XFV A;  2WO9 A;  3EDH A;  3P1V A;  1R55 A;  4H84 A;  1SRP A;  4WKI A;  4FU4 A;  4H3X A;  5H8X A;  1SU3 A;  3VTG A;  4FVL A;  1K7I A;  1B8Y A;  1I1I P;  1XFZ A;  2W13 A;  3HB2 P;  3LQ0 A;  3G5C A;  1OO9 A;  1GE7 A;  1XFW A;  3O2X A;  3F15 A;  3KEK A;  4FXY P;  3RTT A;  2J83 A;  1OS2 A;  3LK8 A;  4ON1 A;  3LUM A;  1SAT A;  4ILW D;  4H76 A;  3UVC A;  4AXQ A;  3LA9 A;  1D5J A;  5D1T A;  1UMS A;  2OXZ A;  1JKY A;  3KHI A;  3USN A;  1IAB A;  2OW9 A;  1Z3J A;  2DW1 A;  3RTS A;  1KUK A;  3LMC A;  3HDA P;  4I03 A;  2RJQ A;  1B3D A;  830C A;  1Q3A A;  4L6T A;  1KAP P;  2OVX A;  5CUH A;  4DD8 A;  3F1A A;  5B5P A;  3KEJ A;  1QIB A;  4G9L A;  1CK7 A;  5L7F A;  4GWM A;  1H71 P;  3TSK A;  2K2G A;  2CLT A;  1R1I A;  5D3C A;  3SHI A;  2YB9 A;  3BA0 A;  3P24 A;  1D8F A;  1FLS A;  3LIK A;  1BUV M;  966C A;  2QUA A;  2ZJ6 A;  4GWN A;  2W0D A;  2XQH A;  1G49 A;  2PJT A;  1DMT A;  4H82 A;  4AYK A;  1IAE A;  1MMQ A;  2OW1 A;  1DTH A;  4DF9 A;  4GF1 A;  3I7G A;  3TS4 A;  4L63 A;  3WV3 A;  2CKI A;  1R54 A;  1OMJ A;  2X3B A;  1YQY A;  1JIW P;  3O64 A;  1ZS0 A;  2L0R A;  1HTD A;  3ZVS A;  1XFY A;  1XFX A;  5JMY A;  1ROS A;  3NX7 A;  2POJ A;  4WF6 A;  2DDF A;  1MMP A;  1RMZ A;  1BSW A;  2N8R A;  4PKQ A;  2Z8X A;  1HV5 A;  1CXV A;  4HX3 A;  3I7I A;  5CVW A;  1R1H A;  2OXU A;  2OZR A;  1IAD A;  1ZXC A;  2Y6C A;  3DWB A;  5BOT A;  1JIZ A;  2WOA A;  2JSD A;  3LIL A;  5CXA A;  1WNI A;  3TVC A;  1ZP5 A;  1KUH A;  2DW0 A;  1QIA A;  3WV1 A;  1GKC A;  1RM8 A;  3HYG A;  1BIW A;  4GQL A; 
#chains in the Genus database with same CATH topology
 3K7N A;  3Q2G A;  1HY7 A;  1CQR A;  5BOY A;  2YO1 A;  3WV2 A;  3ELM A;  3OHO A;  1PWU A;  1IAA A;  5L79 A;  4XCT A;  3ZXH A;  1EB6 A;  2RJP A;  1GE5 A;  1HFS A;  5I4O A;  1C7K A;  2QPJ A;  3HDB A;  1ATL A;  4WZV A;  2J0T A;  5D7W A;  1O0Q A;  1CGF A;  2W15 A;  4DV8 A;  1I76 A;  456C A;  1MMB A;  5LAB A;  1EUB A;  5BPA A;  3LKA A;  3EHX A;  1AKL A;  2QUB A;  1ND1 A;  4JIJ A;  2AYK A;  2ML2 A;  1GXD A;  2O3E A;  4PKU A;  4AUO A;  3DNG A;  4Q1L A;  2X3A A;  2E3X A;  3LQB A;  2OW2 A;  4WKE A;  3DTE A;  4QKZ A;  1D8M A;  3GBO A;  1Y93 A;  3OHL A;  1K7Q A;  2JT5 A;  4JPA A;  1HFC A;  1IAG A;  4JA1 A;  3LIR A;  2K9C A;  4J4M A;  3KEC A;  2ZJ7 A;  4IN9 A;  3N2V A;  4IJO A;  3HBU P;  2AGM A;  1PWW A;  3LJT A;  3V96 B;  1G4K A;  3L0V A;  3A70 A;  4H1Q A;  3WP8 A;  3LJZ A;  1GO8 P;  1K7G A;  5I12 A;  1JK3 A;  3TT4 A;  1G12 A;  1KBC A;  2OY2 A;  2OW0 A;  3B2Z A;  2W14 A;  5I3M A;  3KME A;  1GKD A;  1AYK A;  2YO0 A;  1USN A;  4R3V A;  4WK7 A;  5D1S A;  4CTH A;  2HU6 A;  1SLM A;  2MZH A;  4I35 A;  1QUA A;  1GE6 A;  4L19 A;  4XM6 A;  1A85 A;  1OS9 A;  2O36 A;  1XUR A;  2JT6 A;  3LEA A;  3F16 A;  2JIH A;  4H30 A;  1QJJ A;  4A7B A;  5D2B A;  1C8T A;  4PKR A;  3B8Z A;  4H49 A;  1BZS A;  1HOV A;  3VI1 A;  3HBV P;  1UTZ A;  1YP1 A;  2OY4 A;  5B5O A;  2Z2D A;  1G9K A;  1ZTQ A;  2DDY A;  4FXQ A;  4XBH A;  1CIZ A;  1FBL A;  1EAK A;  5CXL A;  4XM7 A;  1GO7 P;  3EDZ A;  2A8H A;  3B92 A;  2AIG P;  2YUF A;  2D1N A;  2X7M A;  3EHY A;  1YCM A;  1AST A;  1PWV A;  1J7N A;  1TVI A;  2XS3 A;  3DPE A;  2Z8Z A;  2OXW A;  2XS4 A;  1SLN A;  1D7X A;  3LE9 A;  4PKV A;  3KMC A;  2YIG A;  1AF0 A;  3AYK A;  1MMR A;  3N2U A;  1JJ9 A;  1PWP A;  3LAA A;  4DPE A;  3E8R A;  2MZE A;  2I47 A;  3NTN A;  5I2Z A;  1YOU A;  1XUD A;  4A3W A;  3AIG A;  1O0T A;  5I43 A;  1CGL A;  3LJG A;  1IAC A;  3LGP A;  2SRT A;  1OM7 A;  3U1R A;  4GR3 A;  1QIC A;  1Y0V A;  3AYU A;  3F18 A;  1JAN A;  5D1U A;  3LUN A;  2D1O A;  2OVZ A;  2V4B A;  1C3I A;  4G0D A;  1UEA A;  2ERP A;  2ZVD A;  1BM6 A;  3DTK A;  3MA2 A;  3DL1 A;  1ZVX A;  3EDG A;  3CKI A;  1BKC I;  2X3C A;  2FV5 A;  1BKC A;  1JAO A;  1PWQ A;  3DPF A;  1I73 A;  4AIG A;  1L6J A;  1JAP A;  1CGE A;  1Y8J A;  3EDI A;  1JAQ A;  1KUF A;  1ZXV A;  4H2E A;  2DW2 A;  1BQQ M;  4GR0 A;  1G05 A;  1CAQ A;  2Y6D A;  1BKC E;  4HMA A;  3K7L A;  2JNP A;  3F19 A;  1KUI A;  2E2D A;  5I0L A;  5CZM A;  1SMP A;  1BUD A;  2W12 A;  1OM6 A;  3HY7 A;  4GR8 A;  3DSL A;  4XM8 A;  4ZR5 A;  1UTT A;  4PKW A;  3KRY A;  1P9H A;  4DT5 A;  2ERO A;  1BQO A;  1JH1 A;  2MLS A;  4L7A A;  2USN A;  4PKS A;  1OZ9 A;  1UMT A;  1MNC A;  1OM8 A;  4EFS A;  4PKT A;  2MLR A;  2MZI A;  3F17 A;  2TCL A;  4GUY A;  1QJI A;  4JP4 A;  4IUW A;  1R1J A;  3ULT A;  3ZUK A;  3Q2H A;  3A6Z A;  2OI0 A;  3HY9 A;  1XM5 A;  2KRJ A;  1XFU A;  4JQG A;  3EWJ A;  1A86 A;  2FV9 A;  3L0T A;  1FM1 A;  2WO8 A;  3S6L A;  2ERQ A;  1KUG A;  3KWV C;  1XUC A;  3G42 A;  1S4B P;  1XFV A;  2WO9 A;  3EDH A;  3P1V A;  1R55 A;  4H84 A;  1SRP A;  4WKI A;  4FU4 A;  4H3X A;  5H8X A;  1SU3 A;  3VTG A;  4FVL A;  1K7I A;  1B8Y A;  1I1I P;  1XFZ A;  2W13 A;  3HB2 P;  3LQ0 A;  3G5C A;  1OO9 A;  1GE7 A;  1XFW A;  3O2X A;  3F15 A;  3KEK A;  4FXY P;  3RTT A;  2J83 A;  1OS2 A;  3LK8 A;  4ON1 A;  3LUM A;  1SAT A;  4ILW D;  4H76 A;  3UVC A;  4AXQ A;  3LA9 A;  1D5J A;  5D1T A;  1UMS A;  2OXZ A;  1JKY A;  3KHI A;  3USN A;  1IAB A;  2OW9 A;  3DTI A;  1Z3J A;  2DW1 A;  3RTS A;  1KUK A;  3LMC A;  3HDA P;  4I03 A;  2RJQ A;  1B3D A;  830C A;  1Q3A A;  4L6T A;  1KAP P;  2OVX A;  5CUH A;  4DD8 A;  3F1A A;  5B5P A;  3KEJ A;  1QIB A;  4G9L A;  1CK7 A;  5L7F A;  4GWM A;  1H71 P;  3TSK A;  2K2G A;  2CLT A;  1R1I A;  5D3C A;  3SHI A;  2YB9 A;  3BA0 A;  3P24 A;  1D8F A;  1FLS A;  3LIK A;  1BUV M;  966C A;  2QUA A;  2ZJ6 A;  4GWN A;  2W0D A;  2XQH A;  1G49 A;  2PJT A;  1DMT A;  4H82 A;  4AYK A;  1IAE A;  1MMQ A;  2OW1 A;  1DTH A;  4DF9 A;  4GF1 A;  3I7G A;  3TS4 A;  4L63 A;  3WV3 A;  2CKI A;  1R54 A;  1OMJ A;  2X3B A;  1YQY A;  1JIW P;  3O64 A;  1ZS0 A;  2L0R A;  1HTD A;  3ZVS A;  1XFY A;  1XFX A;  5JMY A;  1ROS A;  3NX7 A;  2POJ A;  4WF6 A;  2DDF A;  1MMP A;  1RMZ A;  1BSW A;  2N8R A;  4PKQ A;  2Z8X A;  1HV5 A;  1CXV A;  4HX3 A;  3I7I A;  5CVW A;  1R1H A;  2OXU A;  2OZR A;  1IAD A;  1ZXC A;  2Y6C A;  3DWB A;  1XAX A;  5BOT A;  1JIZ A;  2WOA A;  2JSD A;  3LIL A;  5CXA A;  1WNI A;  3TVC A;  1ZP5 A;  1KUH A;  2DW0 A;  1QIA A;  3WV1 A;  1GKC A;  1RM8 A;  3HYG A;  1BIW A;  4GQL A; 
#chains in the Genus database with same CATH homology
 3K7N A;  3Q2G A;  1HY7 A;  1CQR A;  5BOY A;  2YO1 A;  3WV2 A;  3ELM A;  3OHO A;  1PWU A;  1IAA A;  5L79 A;  4XCT A;  3ZXH A;  1EB6 A;  2RJP A;  1GE5 A;  1HFS A;  5I4O A;  1C7K A;  2QPJ A;  3HDB A;  1ATL A;  4WZV A;  2J0T A;  5D7W A;  1O0Q A;  1CGF A;  2W15 A;  4DV8 A;  1I76 A;  456C A;  1MMB A;  5LAB A;  1EUB A;  5BPA A;  3LKA A;  3EHX A;  1AKL A;  2QUB A;  1ND1 A;  4JIJ A;  2AYK A;  2ML2 A;  1GXD A;  2O3E A;  4PKU A;  4AUO A;  3DNG A;  4Q1L A;  2X3A A;  2E3X A;  3LQB A;  2OW2 A;  4WKE A;  3DTE A;  4QKZ A;  1D8M A;  3GBO A;  1Y93 A;  3OHL A;  1K7Q A;  2JT5 A;  4JPA A;  1HFC A;  1IAG A;  4JA1 A;  3LIR A;  2K9C A;  4J4M A;  3KEC A;  2ZJ7 A;  4IN9 A;  3N2V A;  4IJO A;  3HBU P;  2AGM A;  1PWW A;  3LJT A;  3V96 B;  1G4K A;  3L0V A;  3A70 A;  4H1Q A;  3WP8 A;  3LJZ A;  1GO8 P;  1K7G A;  5I12 A;  1JK3 A;  3TT4 A;  1G12 A;  1KBC A;  2OY2 A;  2OW0 A;  3B2Z A;  2W14 A;  5I3M A;  3KME A;  1GKD A;  1AYK A;  2YO0 A;  1USN A;  4R3V A;  4WK7 A;  5D1S A;  4CTH A;  2HU6 A;  1SLM A;  2MZH A;  4I35 A;  1QUA A;  1GE6 A;  4L19 A;  4XM6 A;  1A85 A;  1OS9 A;  2O36 A;  1XUR A;  2JT6 A;  3LEA A;  3F16 A;  2JIH A;  4H30 A;  1QJJ A;  4A7B A;  5D2B A;  1C8T A;  4PKR A;  3B8Z A;  4H49 A;  1BZS A;  1HOV A;  3VI1 A;  3HBV P;  1UTZ A;  1YP1 A;  2OY4 A;  5B5O A;  2Z2D A;  1G9K A;  1ZTQ A;  2DDY A;  4FXQ A;  4XBH A;  1CIZ A;  1FBL A;  1EAK A;  5CXL A;  4XM7 A;  1GO7 P;  3EDZ A;  2A8H A;  3B92 A;  2AIG P;  2YUF A;  2D1N A;  2X7M A;  3EHY A;  1YCM A;  1AST A;  1PWV A;  1J7N A;  2XS3 A;  3DPE A;  2Z8Z A;  2OXW A;  2XS4 A;  1SLN A;  1D7X A;  3LE9 A;  4PKV A;  3KMC A;  2YIG A;  1AF0 A;  3AYK A;  1MMR A;  3N2U A;  1JJ9 A;  1PWP A;  3LAA A;  4DPE A;  3E8R A;  2MZE A;  2I47 A;  3NTN A;  5I2Z A;  1YOU A;  1XUD A;  4A3W A;  3AIG A;  1O0T A;  5I43 A;  1CGL A;  3LJG A;  1IAC A;  3LGP A;  2SRT A;  1OM7 A;  3U1R A;  4GR3 A;  1QIC A;  1Y0V A;  3AYU A;  3F18 A;  1JAN A;  5D1U A;  3LUN A;  2D1O A;  2OVZ A;  2V4B A;  1C3I A;  4G0D A;  1UEA A;  2ERP A;  2ZVD A;  1BM6 A;  3DTK A;  3MA2 A;  3DL1 A;  1ZVX A;  3EDG A;  3CKI A;  1BKC I;  2X3C A;  2FV5 A;  1BKC A;  1JAO A;  1PWQ A;  3DPF A;  1I73 A;  4AIG A;  1L6J A;  1JAP A;  1CGE A;  1Y8J A;  3EDI A;  1JAQ A;  1KUF A;  1ZXV A;  4H2E A;  2DW2 A;  1BQQ M;  4GR0 A;  1G05 A;  1CAQ A;  2Y6D A;  1BKC E;  4HMA A;  3K7L A;  2JNP A;  3F19 A;  1KUI A;  2E2D A;  5I0L A;  5CZM A;  1SMP A;  1BUD A;  2W12 A;  1OM6 A;  3HY7 A;  4GR8 A;  3DSL A;  4XM8 A;  4ZR5 A;  1UTT A;  4PKW A;  3KRY A;  1P9H A;  2ERO A;  1BQO A;  1JH1 A;  2MLS A;  4L7A A;  2USN A;  4PKS A;  1UMT A;  1MNC A;  1OM8 A;  4EFS A;  4PKT A;  2MLR A;  2MZI A;  3F17 A;  2TCL A;  4GUY A;  1QJI A;  4JP4 A;  4IUW A;  1R1J A;  3ULT A;  3ZUK A;  3Q2H A;  3A6Z A;  2OI0 A;  3HY9 A;  2KRJ A;  1XFU A;  4JQG A;  3EWJ A;  1A86 A;  2FV9 A;  3L0T A;  1FM1 A;  2WO8 A;  3S6L A;  2ERQ A;  1KUG A;  3KWV C;  1XUC A;  3G42 A;  1S4B P;  1XFV A;  2WO9 A;  3EDH A;  3P1V A;  1R55 A;  4H84 A;  1SRP A;  4WKI A;  4FU4 A;  4H3X A;  5H8X A;  1SU3 A;  3VTG A;  4FVL A;  1K7I A;  1B8Y A;  1I1I P;  1XFZ A;  2W13 A;  3HB2 P;  3LQ0 A;  3G5C A;  1OO9 A;  1GE7 A;  1XFW A;  3O2X A;  3F15 A;  3KEK A;  4FXY P;  3RTT A;  2J83 A;  1OS2 A;  3LK8 A;  4ON1 A;  3LUM A;  1SAT A;  4ILW D;  4H76 A;  3UVC A;  4AXQ A;  3LA9 A;  1D5J A;  5D1T A;  1UMS A;  2OXZ A;  1JKY A;  3KHI A;  3USN A;  1IAB A;  2OW9 A;  3DTI A;  1Z3J A;  2DW1 A;  3RTS A;  1KUK A;  3LMC A;  3HDA P;  4I03 A;  2RJQ A;  1B3D A;  830C A;  1Q3A A;  4L6T A;  1KAP P;  2OVX A;  5CUH A;  4DD8 A;  3F1A A;  5B5P A;  3KEJ A;  1QIB A;  4G9L A;  1CK7 A;  5L7F A;  4GWM A;  1H71 P;  3TSK A;  2K2G A;  2CLT A;  1R1I A;  5D3C A;  3SHI A;  2YB9 A;  3BA0 A;  3P24 A;  1D8F A;  1FLS A;  3LIK A;  1BUV M;  966C A;  2QUA A;  2ZJ6 A;  4GWN A;  2W0D A;  2XQH A;  1G49 A;  2PJT A;  1DMT A;  4H82 A;  4AYK A;  1IAE A;  1MMQ A;  2OW1 A;  1DTH A;  4DF9 A;  4GF1 A;  3I7G A;  3TS4 A;  4L63 A;  3WV3 A;  2CKI A;  1R54 A;  1OMJ A;  2X3B A;  1YQY A;  1JIW P;  3O64 A;  1ZS0 A;  2L0R A;  1HTD A;  3ZVS A;  1XFY A;  1XFX A;  5JMY A;  1ROS A;  3NX7 A;  2POJ A;  4WF6 A;  2DDF A;  1MMP A;  1RMZ A;  1BSW A;  2N8R A;  4PKQ A;  2Z8X A;  1HV5 A;  1CXV A;  4HX3 A;  3I7I A;  5CVW A;  1R1H A;  2OXU A;  2OZR A;  1IAD A;  1ZXC A;  2Y6C A;  3DWB A;  5BOT A;  1JIZ A;  2WOA A;  2JSD A;  3LIL A;  5CXA A;  1WNI A;  3TVC A;  1ZP5 A;  1KUH A;  2DW0 A;  1QIA A;  3WV1 A;  1GKC A;  1RM8 A;  3HYG A;  1BIW A;  4GQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...