3HC7A

Crystal structure of lysin b from mycobacteriophage d29
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
SKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMWPSVEKGVAELILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHILPPTGRLHRFLHRLKKVIFWGNPMRQKGFAHSDEWIHPVAAPDTLGILEDRLENLEQYGFEVRDYAHDGDMYASIKEDDLHEYEVAIGRIVMKASGFIGGRDSVVAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPHLYNRYPAVEFLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacteriophage Lysin B is a novel mycolylarabinogalactan esterase
pubmed doi rcsb
source organism Mycobacterium phage d29
molecule tags Cell adhesion
molecule keywords Gene 12 protein
total genus 90
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1120 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hc7A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hc7A01
1RYYA 4X6YA 2H1IA 3C6ZA 4QWMA 3FYUC 5EHZA 1ODTC 2QMQA 4V2IA 4C4ZA 1ZJ5A 3IDAA 2ZVDA 5CRIA 3STTA 5CXUA 1XRQA 2VAXA 3SWWA 2QVBA 4GWLA 4I4CA 1ACLA 4X97A 1GZ7A 3BXPA 3IBTA 4CG3A 1P0PA 4OB8A 2VAVA 4DMFA 1WPXA 4ZREA 1UWCA 5D3KA 3HI4A 1ZIYA 4BRZA 1XZIA 1IZ7A 3WI7A 1KU6A 3CXUA 5AM3A 5EHNA 5FLKA 5AI6A 1XROA 1HPLA 4WFJA 5CW2A 5LIPA 2VEOA 4AN0A 3R0VA 1XZFA 4QWWA 3H1AA 5A62A 1HQDA 4HZGA 2XMBA 4LHEA 1QO9A 2WFMA 2ZYSA 2DR0A 4B6GA 2JGKA 3IA2A 2VSQA 5JANA 3DOIA 1JMYA 2DHCA 2Z5GA 4LIPD 1ACJA 1XLVA 2OCGA 4ZV9A 4CCYA 4ZGBA 4G8CA 5IVHA 1T4MA 1VJ5A 2B20A 3C45A 1VKHA 1WM1A 5FRDA 2QTBA 1ZICA 1EH5A 4BB0A 4QDUA 5JAPA 1USWA 3E4DA 3U0VA 2P8SA 1WB4A 1WHSA 3WMRA 5I8PA 1JJFA 1WHTA 5ALRA 4OUKX 1DWQA 5CH5A 1EDDA 3LCRA 1TIBA 2HA6A 5AKZA 2Y6VA 4P92A 3NWOA 3D2CA 4QA9A 1JT2A 5I7UA 1G5FA 5C81A 5BOVA 4FLFA 3MVEA 3JYHA 1ORVA 4KRYA 1LNSA 1HBJA 2WSLA 3E1GA 3I2GA 3BDIA 4FMPA 2HIHA 4C87A 5LZ9A 4X6UA 3V9AA 4W63A 3TGLA 1QIHA 1XLWA 4BVKA 4CG1A 3FVTA 3R3UA 1AZWA 3JWEA 4UBKA 3H17A 2DQZA 1VXOA 1QE3A 1BU8A 3QMMA 5IVDA 4H7KA 3M3DA 3H19A 3D7RA 1LPBB 2HRQA 3WYNA 4Q3KA 1EK1A 2XMQA 3IURA 1LPMA 1TKRA 4D9JA 1UOPA 2QOEA 2HA5A 5ALYA 2HM7A 1QTRA 4U2FA 1L7RA 5HF6A 3RARA 4AO7A 4W1PA 3O0DA 5EHXA 5DYWA 2QS9A 1EXWA 1IVYA 3DQZA 2DHDA 4INZA 3ZPXA 1XZMA 3WL6A 4H7EA 3YASA 5D6OA 1YB7A 4XX1A 1RP1A 2XDWA 3C70A 3W9BA 2WQZA 1QFSA 3MUOA 4B9EA 1WPRA 4UFPA 1XRMA 1ZI9A 4Q82A 1QIDA 2I78A 4Y2JA 2IX9A 1ZD4A 1OXMA 4QDTA 4RPCA 4UHEA 3QPDA 5C8VA 1ISPA 3I1IA 4E11A 4DMHA 2RONA 1N8SA 2CJPA 3R41A 1EVQA 4CIAA 3G0GA 3W04A 2OQIA 1R1DA 5AKIA 1TK3A 5LZ8A 2WUGA 2Y6UA 1QONA 3N2ZB 4UBLA 2XUQA 5ALOA 1VA4A 2XMRA 3BF7A 3G0CA 5HZGA 4QZVA 4OYLA 1VOTA 2GYUA 1SCKA 1A8UA 5DYYA 4K5QA 4YX9A 2WG2A 4BTVA 1XZGA 2PBLA 4WY8A 1XZDA 1UOQA 2OXEA 1QTIA 2BUAA 5JIBA 3A6ZA 1JKMA 3OPMA 3DJYA 5JZ9A 1BCRA 2ACKA 2ECFA 3I2JA 2XUGA 5ALHA 2RGUA 2CB9A 5A7GA 1O6GA 4C01A 4B7ZA 4J0KA 4UBMA 3QPAA 2RAUA 2O7RA 4E14A 2JBWA 5JALA 3ICVA 5HQ3B 3IUJA 1OCEA 1N5MA 1GKKA 1UKAA 2JGLA 4DNPA 3EIOA 3DYIA 3M81A 4M0FA 5T4HA 3SK0A 5J3JA 5AO9A 2IITA 3M82A 4X00A 2EDCA 1UK6A 1UZAA 5K3AA 1UT6A 5ALXA 1XZEA 5AOBA 1EX9A 4EY7A 4JEIA 1WOMA 1XZBA 5ALFA 5LZ4A 1N1MA 2BKLA 2PSJA 1XZAA 5AM0A 4AB1A 2WIGA 2V97A 4BZZA 4X95A 1B6GA 2XQKA 5BWBA 5AI9A 3ZLUA 1ZJ4A 5AIAA 4IHAA 1R9NA 1N5RA 3HABA 2BUBA 4FFWA 4W1RA 1W1IA 2WIJA 1CEXA 3G0DA 5BWCA 3O4JA 4JYPA 1QJ4A 4XVCA 4X93A 1Q0RA 1TCBA 2PU7A 5ALWA 3C43A 5CT5A 3IUMA 4XIIA 1SCQA 2XMGA 4HS9A 4RE6A 2CZQA 2PSFA 1VLQA 3H18A 3KSRA 1MX9A 1AUOA 1SC9A 3AILA 5AHXA 4C4XA 1F0NA 5AKHA 2HA2A 5K3DA 4C6HA 3FOBA 1S8OA 3O4IA 1F6WA 2AJDA 4PO3X 5EHQA 5HKBA 4DYHA 4GEGA 5FP0A 1PV1A 1QIKA 2I3ZA 2JGIA 4EZIA 4Q34A 4N8EA 2H9YA 4UHFA 2J4FA 3MUNA 5JYCA 3VKFA 1CLEA 4FHZA 4DLNA 3PDCA 3D4LA 4OU5A 4QLOA 4P08A 4AXBA 3ZV7A 4AZ0A 1AQLA 1CUWA 5LZ5A 1CFJA 3UUFA 1C7IA 4BVLA 4MEAA 2HU5A 1GQSA 4DGQA 4AMZA 2VATA 5AM1A 2HU8A 7YASA 1BCSA 4QDZA 4DSZA 3I2IA 4HTAA 4WDRA 5JADA 5FPQA 3RKSA 3QVMA 1H23A 5JZSA 2AXEA 4B0PA 3QZUA 4BAUA 4MEBA 5HK9A 1EI9A 3GZJA 4J0GA 5HCUA 3FBWA 2WKWA 1P0QA 2FUKA 3V1MA 4UFNA 1UOOA 3CCBA 2BFNA 3QH4A 1R3DA 1F8UA 1QIMA 4QDXA 3N0TA 5AM5A 2WG1A 3ESDA 5K5EA 4M0MA 4OB6A 1YS2X 3AIMA 4A16A 3R3VA 5ALVA 3G0BA 3DDUA 1YAHA 5DLPA 4EUSA 1H2ZA 3DL4A 5ALLA 5DTIA 3DYVA 4DM7A 3C8DA 2VA9A 1UKBA 4KAFA 5AM4A 4AO8A 2X76A 5IH7A 2I3DA 3KXPA 2C5GA 1BEZA 4B0OA 4UFOA 2PX6A 5AKXA 1DTEA 3HEAA 2FX5A 1L7QA 1SFRA 4Y9SA 4BBZA 5ISMA 2QKYA 3DNMA 1ZGBA 2OGTA 1YAJA 1EINA 2XUIA 2ZSIA 4X90A 5IVKA 4FFVA 2QM0A 2PL5A 1IZ8A 1DQZA 2OAGA 3QMVA 2PSDA 2XUAA 3O9VA 4HXFB 1YS1X 3H0CA 4C89A 4S0XA 3OTQA 1R4ZA 3H2JA 3ZWQA 3EQ9A 5AI5A 2ROQA 3STWA 1EDEA 4BDSA 2VJDA 4PQEA 2QJWA 4BAZA 5JAUA 1CUCA 2HFJA 1WB5A 1Y7HA 2OGZA 4J3JA 1E8DA 5HFAA 1JMKC 1C4XA 5AJHA 1E66A 1YA4A 4BC1A 5EIHA 1XZKA 3I6ZA 4MYDA 3WYDA 3H2GA 4F60A 4ZI5A 3FSGD 2QXUA 4L0CA 2XMSA 1UXOA 3WK8A 4NS4A 3C8HA 1GKLA 1XRNA 4KRXA 1VZ3A 5E4TA 3WKEA 2BGRA 4KAAA 2ZSHA 1K4YA 3STXA 5CH8A 1YASA 2XMDA 1CPYA 3F98A 3G9ZA 1E8MA 4BVJA 3F67A 3DKKA 5DNVA 1NU8A 3UUEA 5FXMA 4KYVA 1LPOA 1CUJA 5JAHA 4K6HA 5LKAA 4G9EA 1DWPA 2CKMA 2WFLB 5ALQA 4DNFA 2J3QA 2JEZA 2XUPA 3PFBA 1LPPA 3TJMA 2HU7A 5IVIA 3VXKA 3BIXA 2PPLA 5ALPA 3ESBA 4GLBA 4HXEB 1LBSA 3LIPA 3ICWA 1CQWA 1TCCA 5HF8A 5ALDA 1XKTA 1IMJA 4AZ3A 1QOZA 2XUDA 4J0JA 2K2QB 3FWHA 2Y1KA 2H7CA 5ALUA 1OILA 1JFRA 4BC0A 3TRDA 1DT5A 2XUOA 3U1TA 4P93A 3G0IA 1R50A 3ILSA 5AKKA 1SCIA 4IH1A 4DMCA 1ZI8A 3C6BA 2RHTA 1HDEA 2XMZA 3H1BA 2H7XA 1QGED 4QLAA 3GBSA 1XZLA 1ZD3A 2WIKA 2CUTA 1MAAA 4JUIA 3GA7A 2WHPB 3IVMA 4UHHA 1Q84A 4CCWA 2G4LA 4U2GA 1EB8A 2VF2A 2BAGA 5K3EA 2D5LA 3HLKA 4FLEA 3ZLTA 3G8YA 1MAHA 4J0CA 1BEEA 3FLEA 2UZ0A 4FDMA 1CUDA 5KWIA 3HACA 5CT8A 3IIIA 1IUOA 4X94A 1WCYA 5ESRA 3WLAA 5H3HA 5E4YA 5HF5A 3EQ8A 2PU5A 4GECA 5D3ZA 5EIEA 4EBBA 1CUBA 1ZD5A 1BRTA 4BYMA 5AOCA 4X7BA 4PSDA 1LZKA 3PE6A 1CV2A 2XUKA 1GPNA 1A88A 5CTAA 3D2AA 4B85A 2WIFA 5T4FA 4Y2VA 1R88A 2BJHA 3PUIA 4FKBA 2FJPA 3MGAA 5D7BA 4X6XA 1PJAA 3OC0A 2QRUA 4AO6A 2AJLI 3B12A 2WJ4A 5DNUA 3BWXA 4WFKA 3RLIA 2X8BA 2JEYA 3B3QA 2OG1A 2XLBA 3BIWA 3WQHA 2O7VA 2WILA 1NU6A 1BN6A 3C87A 4B81A 4TPKA 4NZZA 1LPNA 3WWPA 3FNBA 2WHQA 4UPDA 5EFZA 4LXGA 1AC5A 1W4LA 4U2BA 1GPLA 4ARBA 3CN9A 3WZMA 2GZRA 1O6FA 2PKYX 1TCAA 3HRHA 4BCBA 3PUHA 1FFCA 5CT9A 4BCCA 1RWQA 2HFKA 2RI6A 1X2BA 1D07A 2C0PA 3HYSA 5LP1A 3G9UA 3AINA 3E0XA 3WK9A 4K6GA 4L72A 2G5PA 2XQFA 3ANTA 4BATA 2WLSA 3OOSA 3FYTA 4UHBA 3D5EA 1B41A 5AIBA 4MXDA 1YCDA 3QBJA 4PF1A 3I2KA 2CEKA 1MX1A 3PICA 3HSSA 4X91A 1CUHA 4IQ4A 3L1JA 1EK2A 4GW3A 4EY4A 4I3FA 4W1SA 5K3CA 3VVLA 3K6KA 4OPMA 5DWDA 3A70A 4B80A 1AX9A 4BZWA 4KR0A 4J0HA 3BL8A 1BE0A 5CXXA 4C4YA 4G8DA 2VJCA 1CUFA 1DINA 2PM8A 5JATA 3VJMA 1A7UA 1MPXA 3VDXA 1ZGCA 4LXIA 4EY8A 2WTNA 4BDTA 2XUFA 1ORWA 4HRXA 4AN1A 2YASA 3DCNA 4Y2QA 4JYMA 2HL6A 1JJBA 2LIPA 1K6EA 3BE8A 3ESCA 4RE5A 1Y7IA 3G9XA 2VJAA 1Z68A 2QR5A 4G9GA 2C7BA 4EHBA 4N5IX 1E89A 3BF8A 4MQLA 1CVLA 2OAEA 1XRRA 4UUQA 2XQGA 3HC7A 1W75A 4H0CA 4FBMA 1H2YA 1I6WA 1VZ2A 4B82A 1XKLA 3H2HA 5DNWA 1XQVA 3KDAA 3O95A 4FNGA 3SC2A 1W6RA 2I03A 2D0DA 3WWEA 1K63A 2J4CA 2JGMA 4K2AA 4UBOA 5E4JA 4LXHA 4TGLA 5ALMA 3BJMA 4CCYB 1AKNA 4KJXA 5K3FA 3O4HA 3WK5A 3I6YA 5K3FB 3AZPA 3DL7A 4BCDA 2ZJ7A 3D0KA 1KU0A 3NGMA 3G02A 2XB6A 4HAIA 3PFCA 2EDAA 1FFAA 1MNQA 2GYWA 3WL8A 3C5VA 1XFDA 1AURA 5AKYA 3M83A 1DX6A 4G4IA 4B9AA 1QIIA 4DNQA 2FJ0A 3QM1A 3FYUB 3WKCA 1M33A 1YA8A 5JARA 3WK6A 3EBLA 3STVA 2XLCA 5CURA 3BJRA 4PSUA 2C5FA 1P0MA 3IB3A 1J06A 2V96A 5AOAA 2BCEA 1UFOA 4J0DA 4ZV7A 4H35A 4GDMA 3I2HA 3R3ZA 5AICA 3WKAA 5BV7A 1WB6A 5JD4A 5DYTA 5SYNA 2RHWA 1JI3A 4LYEA 1DX4A 4P9NA 3DLTA 3RM3A 3HZOA 4E15A 4Q3OA 4ZRDA 1VA5A 1XQYA 4EB0A 2O2HA 2WUEA 3WKBA 5ALZA 5FV4A 3NOXA 3B5EA 1QIEA 4KE8A 4UBJA 4X92A 4F21A 5A7FA 2ZYRA 4LYDA 3FYUA 4H7JA 4H77A 3O4GA 5ALTA 4W9RA 2OCLA 3W2TA 4G4GA 3FCXA 1LBTA 3V1KA 3S8YA 5JD6A 2Q0XA 1A8SA 3D59A 3IULA 1XZJA 3FSGA 2B9VA 2ZYIA 4ARAA 1JU3A 1VE6A 4Y2UA 1FJ2A 1LPSA 3WL5A 4IO0A 3WIOA 1H2XA 3F96A 5FDFA 4BP8A 1GT6A 2AJ8A 2ZYHA 3I2FA 4B83A 4NVRA 1LGYA 5KWJA 4OU4A 1ODSA 3STYA 1TRHA 1DT3A 4Z49A 5JZBA 5ALEA 3G9TA 1EHYA 1P0IA 2OQVA 4UHCA 3JW8A 4NMWA 3C6YA 3IUQA 2XMCA 3E3AA 4ZXFA 1UK8A 3L1HA 3WWOA 4Y2YA 3GROA 2O2GA 3WL7A 5ALGA 3R3WA 1XQXA 3R3XA 3UMJA 5CBKA 1EA5A 1NX9A 2B61A 3WK7A 5AI4A 2VT6A 1U4NA 3F9CA 2B4KA 4MWTA 4L9AA 5CT4A 1K5PA 2WUDA 1ZI6A 3WK4A 3Q0TA 3GUUA 1U2EA 4RGYA 2V98A 1BN7A 4FNMA 1FSSA 1MJ5A 1QIGA 3STUA 4CIBA 2X5XA 4N5HX 5C8ZA 1Q0ZA 3HJUA 3LS2A 4CI9A 3FLAA 1XZCA 2ZJFA 4H7IA 2XE4A 1VE7A 3Q8WA 5ALJA 4Y2SA 2JGEA 2ORYA 1CUXA 4Y2XA 1H22A 1ZD2P 4BRSA 3PF9A 2WFZA 2YXPX 4W1QA 5AI0A 5HQ3A 4YPVA 2VT7A 1J2EA 4GHWA 1X2EA 4DMKA 2HA4A 6YASA 4OD0A 1GPKA 4QDOA 2JF0A 4PV7A 2WHPA 1CUSA 4FTWA 1YR2A 3X3HA 2O2IA 1G42A 3SX4A 3C5WP 4XWGA 3VJLA 1EB9A 1CUEA 3KWJA 1CUGA 1U8EA 4C88A 2WTMA 2C0QA 2OCIA 4Y2TA 5AKLA 5C7YA 3QMWA 3VISA 1G66A 3ZI7A 1KEZA 3OM8A 2XQJA 4DIUA 4DSAA 5JAOA 4HXGA 1XQWA 3DD5A 4WJLA 1T2NA 4AQDA 4G1FA 5LKRA 1EVEA 1YSCA 2RIPA 2QJRA 3V48A 3AFIA 1CQZA 3BDVA 1JJIA 1TQHA 1W76A 2DFPA 1CRLA 2H7YA 2Z8ZA 2QT9A 3HXKA 4B84A 2BGNA 5ALKA 2R8BA 3DEAA 3A2LA 4PSCA 4YASA 3QITA 5FPPA 5AM2A 5IKXA 2GBGA 1HKHA 5DTJA 1AMNA 1A8QA 1MU0A 1DWOA 1GXSA 3GELA 4F5ZA 5A7HA 4QE3A 4WDQA 3FCYA 3WZLA 2ONCA 3R3YA 4KE9A 1PFQA 2WM2A 1FFBA 4FOLA 4N8DA 1THTA 1UK9A 4KACA 4KE6A 4GXNA 3ESAA 3D3NA 2BUCA 1Q83A 1ETHA 5HFNA 3KD2A 5HKAA 1QO7A 5AK4A 3VJKA 4JNCA 3R40A 2IIVA 2XI4A 2Y2UA 4UBNA 3FVRA 1J1IA 2QUBA 3OG9A 3AZQA 1TAHA 3WWCA 5A2GA 2DQYA 2YH2A 4QEKA 2XUJA 2PSEA 2G5TA 3IUNA 2YYSA 4EY6A 1MTZA 3DOHA 4CG2A 5AK6A 1K8QA 4ROTA 2V9ZA 1J07A 4RNCA 4BAGA 4JH0A 3DKRA 2GYVA 5AK3A 3H2KA 3AIKA 1MT3A 1FFDA 4ITVA 1XRPA 2GBFA 2PSHA 4MJ3A 5KREA 2WJ6A 1G4HA 2R11A 5JD5A 1W52X 2JIDA 3PF8A 4KE7A 4G8BA 3FLBA 3K9BA 3LP5A 2J3DA 3H2IA 2HDWA 1THGA 2Z3WA 5T4BA 5LZ7A 3WKDA 4EA6A 1ZOIA 3WWDA 3WIBA 1UKCA 2HA0A 2E3JA 2XQIA 4ETWA 1HLGA 4UBIA 5SYMA 5KBYA 3RK4A 1CUVA 2WUFA 2XT0A 4MYSA 4J0IA 4J7AA 4H18A 1MNAA 1UK7A 1VXRA 2C4HA 4OYYA 3TEJA 4HRYA 3P2MA 3EQ7A 3V1NA 4UHDA 5AK5A 1LLFA 1LPAB 5EIAA 4Y7DA 5LYYA 2W6CX 5F4ZA 2OPHA 3K2IA 2GBCA 2ACEA 3O9MA 5AKEA 3WA6A 5JASA 4WFIA 5ALNA 4BTLA 2ES4A 4N8SA 4QNNA 3I28A 3D2BA 4G5XA 1X70A 2GZSA 1MX5A 4FWBA 4F0JA 4Y2PA 1CR6A 3AIOA 3ANSA 4GI1A 1GGVA 2DSNA 4BE9A 2NW6A 5LZ2A 5HK8A 4PW0A 5AI8A 5EGNA 2AJBA 4ZWNA 4IH4A 3CCCA 2OGSA 5I9IA 1XRLA 4U2CA 2WU3A 5YASA 1DQYA 1EDBA 1JU4A 3H04A 3AZOA 5CMLA 3T52A 3DS8A 1GQRA 1QFMA 4FBLA 5AKJA 1E3QA 3CN7A 3W9UA 4A23A 5AKGA 4EY5A 2C58A 1BROA 3KOOA 1CUAA 3ZLVA 1XZHA 3W06A 4DNOA 4J03A 4CFSA 4KEAA 5CT6A 5E2IA 4U2EA 2Z8XA 4I19A 4DTCA 1E8NA 4U2DA 4AMYA 2VQ6A 3NUZA 1R9MA 2PVSA 1XLUA 3I1YA 4E46A 2Z3ZA 4BP9A 4OB7A 2QUAA 1QIJA 3I6MA 1C7JA 5FOQA 1ZIXA 4H7FA 2W22A 2AJCA 2WIDA 2VJBA 3VVMA 1L7AA 4BE4A 2PUHA 3OURA 3QYJA 4WY5A 5LLSA 4HVTA 4K6KA 4OCZA 4Q3LA 1U65A 3LLCA 1QZ3A 3KWFA 4G4JA 5AH0A 1QLWA 1CIJA 5FKJA 3S2ZA 3F97A 2HADA 4IH9A 5AP9A 3LIIA 4WCVA 3EF3A 2QXTA 2VTVA 2CBGA 3WJ2A 1LZLA 4Q05A 2JGFA 5EI5A 4O08A 4L3WA 3QPCA 2WG0A 2G63A 4A5SA 1H2WA 2JGJA 1IUPA 1DU4A 4H7DA 5CH3A 4H7HA 3V1LA 2WU4A 3C6XA 1CUZA 1SOMA 1Y37A 2WJ3A 2WFLA 4M0EA 1BS9A 2OLEA 1ODCA 2HRRA 3T4UA 2HA3A 1CUIA 4KAJA 3G7NA 4YK7A 4LKOA 4TVKA 3W05A 4OSEA 4PNZA 4Q1VA 4X3CA 3WJ1A 2CMFA 3ED1A 5DJ5A 3GFFA 4X71A 4AX4A 3AUKA 3L1IA 3F8SA 5HF9A 1CUYA 4X85A 1IUNA 3A2MA 2GBIA 4GBGA 4Y2RA 4MWSA 4MQMA 5A71A 1YB6A 2XUHA 1AGYA 2PUJA 3FAKA 1MO2A 1F0PA 2DHEA 5C8XA 4FLMA 2EEPA 2HA7A 3PI6A 1FFEA 5ALIA 1E5TA 2WHRA 2QZPA 2OCKA 3A2NA 2ZJ6A 3AJAA 5K3BA 3WA7A 5A6VA 1MN6A 4XJVA 2Y2VA 5T4EA 2HHAA 5ALSA 1HL7A 5FUMA 2DCMA 1QIFA 1CUUA
chains in the Genus database with same CATH superfamily
4A0GA 4QC2A 3D31A 4B71A 1G38A 1FQKA 4UD2A 5KQRA 3TG8A 5AIQA 5C8DA 1NG1A 1OWPA 3DZHA 4BJ3A 4C3IJ 4KN7X 2H1IA 2F59A 4QWMA 3ZI4A 4V0RA 1R0SA 1SCBA 4V2IA 4ZQCB 3CJRB 4BXFA 4W1UA 2B30A 2FV8A 2QGNA 3CUSA 4A10A 1WKBA 4BH9A 1DBSA 1SCUB 1TYZA 2VAXA 2ZE7A 1I13A 3HPRA 5B6JA 2QVBA 4GWLA 3DBRB 3FDYA 1KGDA 4IF4A 1FNCA 1XTKA 3A1FA 2CLCX 2XRYA 3MUFA 4L0QA 1G3SA 2FLKA 4MV0A 2Z8YA 5BVGA 3THWA 4IJ5A 1RZUA 2FY8A 3TVYA 2WWHA 4HK4A 1JE8A 4L1KA 4OB8A 3AGQA 4L5EA 2P90A 3ZE2B 4DMFA 3W2AA 3PQEA 4FZ3A 2ZB2A 2MSEB 1EV7A 2B5OA 1HQKA 3HFGA 5JG7A 3WRYA 3OQVA 1KEKA 1EFRD 2PCJA 4XIDA 2BI4A 2IHJA 1ISRA 1P4WA 1ZIYA 4BLPA 3QVTA 3HUEA 1FU4A 5E8RA 3OYEA 3UCFA 3B2NA 2X40A 5JI6A 2UXCB 2WIBA 2PXCA 4IZIA 3L7LA 2VKEA 3DFGA 1JR4A 1SD1A 4G1CA 4JDUA 2CXRA 3PT5A 3VR6H 3CCMI 2POQX 2XIGA 1NSYA 3UFBA 3GRFA 3PJRA 2B35A 3BMQA 4NAHA 2ZI9A 2HCBA 4IGKA 4KVFA 1AZTA 1PNVA 5BPHA 1GVDA 1DEKA 4E09A 1SBZA 4D3ZA 3TWOA 4BIMA 4OLBA 4EFKA 1U0GA 3NONA 4WFJA 3U3ZA 4UNPA 2ZTHA 4I7HA 1CCWA 1ZQ9A 3QYAA 4YRRA 3R0VA 1FY2A 4AN0A 5KMGA 1QF6A 3LBAA 1V4NA 4G5FA 5CLLA 3NHMA 1HDGO 4L0DA 4QWWA 1N75A 1L8AA 1AB5A 2XVZA 4HZGA 2VH5R 3V8EA 5F7JA 1IEWA 3QXGA 4A3SA 1AA7A 2XMBA 4QUEA 1PZMA 3GFMA 2FDXA 2DTRA 3PQJA 1QO9A 2YHAA 1PHRA 3GJTA 3L8DA 4KK4A 4IV8A 4LJLA 4O5VA 1WXFA 1HT0A 2GTPA 3HUTA 5HS9A 1U7PA 5GGYA 2ODPA 2QYHA 2YJ6A 3IA2A 3MLBA 4XBFA 2IUTA 3FYCA 1PNTA 1QNFA 1TYAE 2GX6A 4MEJA 2I9PA 2YN2A 4CNBA 2Z5GA 2GRAA 4LIPD 3UG7A 2CDNA 1ACJA 1GVNB 2CVOA 4JGGA 4RESA 1CX9B 1TECE 5BP7A 5BN5B 3PXDA 1JR6A 1HV8A 1QZTA 3BR3A 2FFAA 3VNAA 2QQBA 4RS8A 3GJQA 3VZDA 4QYIB 3OHMA 3OQBA 4JWTA 1SVLA 4MO9A 1RC8A 1VKHA 1U3VA 2GZDA 5FRDA 3QVVA 1FUUA 3ZCQA 4PJMA 1A9SA 4O3MA 1U3DA 3AX6A 3OQPA 4F6LA 4QDUA 5FWNA 4A8PA 1K4SA 3CDLA 2XGJA 1Y89A 2JN6A 1L7NA 4G0PA 2CXOA 3HB1A 1GL7A 5G41A 2IGMA 1OREA 2AMLA 4D8TA 4E88A 1N5OX 1P4GA 1U02A 5DVZA 5ANRB 4EVRA 1NG7A 1JJFA 3N9IA 5CVCA 1CEYA 1SKQA 2WF6A 3OT1B 1DWQA 4HUJA 3KPUA 1XMSA 1RAHA 1OYYA 1KJJA 4A2UA 1FUIA 3ET5A 2PYDA 2H4XA 1LUAA 5AVTA 1BA2A 2BEVB 3DD1A 4O63O 3OX4A 3ZGYA 2O8CB 1TMOA 2Y6VA 3QUQA 4AIKA 2QF7A 5I3CA 1E1QA 2ZCJA 1E6CA 2OK7A 4ZCPA 2PNJA 1HW5A 3HV0A 2MR6A 4CKZA 1ETQA 2WZCA 3HUDA 2LCQA 4A9AA 3I32A 1LVKA 1TWHJ 4OIOF 2WM8A 1M1YE 2HX1A 1U2TA 4ZOBA 1DE0A 2QENA 1RIFA 5BOVA 3UB3A 2VQFB 1RAIA 2A58A 4LJ6A 4ZDPA 5CFRA 3MEXA 5EEAA 3GJRA 1YDFA 4BHTA 1IQRA 2PKQO 3HOWJ 1HBJA 2WSLA 2IZOA 4E51A 1BXGB 4A73A 4KN6A 1I6MA 5J2TA 4PUSA 3I2GA 5FL3A 5LPNA 2FMFA 2OBPA 2I2BA 3SDGA 1HQCA 4C87A 2GXGA 2IYPA 3QXJA 1IH8A 2DF8A 1PE0A 2E89A 3ORSA 4MUFA 4W63A 1TLFA 2CWEA 2CF5A 3NX4A 4R2KA 3TGLA 2Z6UA 2VL8A 4LGCA 1Y8QA 4WCFB 2DZDA 4LYJA 2FX2A 5IH3A 1YTLA 1BIFA 4TT3D 4BVKA 1EPUA 5ADVA 3I6QA 1V6AA 1VLMA 3B6CA 2GZ3A 2QN7A 3FVTA 4BQEA 1TO1E 1U8FO 4MPJA 3O73A 1U5BB 5FI5A 3THOA 3JWEA 1FSPA 2B2CA 3HOVJ 3ND5A 1KL7A 1P18A 5DUKA 1VJTA 1Z12A 4QEZA 1EX7A 5KVSA 1M6VA 3CLRC 1W0UA 4HAWA 4ZVNA 3ZBPA 2CMKA 1EQAA 1H69A 2BZTA 2WABA 2Q3FA 4YRGA 5AVUA 2R5ZB 1JIKA 1E58A 1VHJA 5B3JA 5JS8A 1HXHA 1T0FC 1N5DA 4YJ3B 1Z77A 1K7AA 2OBYA 1T0HB 3NJRA 3R5SA 3M3DA 2Q3CA 3VNUA 3NCTA 3ZHTA 4N5NA 1JUMA 4B43A 1AXEA 4BFWA 3GVCA 4C08A 2Q2VA 2Q28A 2WUVA 2V03A 2Y0MA 1CNFA 2AFHA 2JD2A 3OFSA 1WMSA 4IOAF 1C14A 3FZYA 4HEA1 3E84A 3K4KA 4S05A 1TW2A 5FKNA 4FHTA 3KP6A 2DUUA 4MHOA 3WYNA 2RGNC 3M4YA 4OI0A 4E22A 4D0NA 1NUUA 3OR1C 1T8TA 2P4UA 2FPRA 2LRHA 3AR2A 5B37A 2WV0A 4HN9A 1Y6GA 2FRDC 4HFMA 4MV8A 4XZ3A 5EQJB 3S2IA 1HYQA 3IXMA 2DX7A 4E7JA 2NUPA 1GSOA 3FJOA 2WSBA 3R24A 4Y67A 4E03A 3TYXA 2YVQA 1L5QA 2XY4A 3FTPA 5HF6A 4E2FA 2YWHA 4AO7A 2REOA 4W1PA 4RAOA 5DYWA 3NUGA 4TUYB 5FFZA 2Q50A 3A4YA 3KQOA 2AN5A 3DTIA 4IHQA 4LTNA 3TCXB 3H0GJ 2Y71A 1JI0A 4INZA 5B4UA 1IZ1A 1RZVA 3EZNA 5FBVB 1VJ1A 4KR9A 2WJWA 1OBOA 1C41A 2ELKA 1OKKD 4H7EA 3UB2A 3WGMA 4ALLA 1H5UA 4XX1A 4DIOA 5BSGA 5F3RA 4MSUA 3PNKA 1RWOA 2RGGA 4FFOA 1P1RA 1N6LA 1V3UA 3JREA 2R7VA 3GJ6A 2WJZB 4CM3A 1Z37A 3ETDA 4RKWA 1E92A 2P9HA 1CB7A 3CO7C 1SBCA 3COSA 2ZB4A 3KJNA 3N2NA 1C1YA 2HRDA 4O4HA 4RIEA 3OM0A 3DV9A 4WI1A 4ENUA 3ED5A 4RO0A 3ZU5A 3HYIA 4HBGA 2O07A 2DULA 1I2BA 1GPDG 1E60A 3UJ3X 1W4CA 2RFLA 3K1MA 2QTVB 2J6BA 2EW2A 3OKCA 4PAMA 5JISA 1Y80A 1IU9A 5K03A 2P9BA 3OZIA 4KIBA 3CUUA 4O5AA 5A3QA 3UV3A 2C9DA 2O19A 2G9ZA 1Q5PA 4AMVA 1GR1A 2XHKA 2OGUA 4ZYLA 1EJBA 2KYRA 2ORVA 1B0AA 3CUQA 3HYLA 3Q41A 5JAQA 5TF0A 1L5VA 3T0FA 4L7QA 4TMFA 4BBPA 2Q4BA 2PJRA 2EFHB 1PUFA 1Z9CA 3JQFC 4EY3A 1OXMA 4ALIA 3L0BA 4GMHA 4ZJPA 3U37A 4UHEA 4PTYA 3T5AA 3TZEA 1GXSB 1U2DC 4HUQA 4L4XA 1QHHA 4F85A 3CYFA 4NCJA 5B55A 5HR5A 4E11A 1M1EB 1Z2NX 2GN9A 4IRGA 4JD5A 4S3MA 1QCYA 3EQZA 3T8YA 1P9QC 4B75A 1NRXA 1RWBA 3W2WA 3LPMA 1O4XA 3HUGB 2G72A 4MIYA 3ADBA 2HUNA 2VONA 2RONA 1MBJA 4KWHA 1GL9B 2H08A 1L3BA 2JI6A 5FL7A 1H4SA 4D9MA 4IX7A 5KYUB 4CIAA 2E35A 3BSYA 1S1CA 3D64A 3K9CA 3NOOA 2YPRA 3O7MA 1M0SA 3G0GA 5AVXA 4B8YA 4N3CA 1E4EA 3PWZA 1TK3A 5LZ8A 4EMTA 2IA5A 3ZWYA 1UAAA 3LWFA 1UBCA 2QSZA 1FQJA 3ABMH 2QRHA 2HIGA 2HCRA 2GEFA 2XMRA 1KOFA 3TIXB 2IXEA 4CM1A 2MYNA 3O26A 1GCIA 5AW4A 5K0BA 1WXQA 1KRHA 5CU7A 4BBJA 4AJKA 4AVPA 2AC2A 4QZVA 5HZGA 1S6LA 4P5OA 4LJRA 3M4JA 3ZHUA 3HKCA 4KQWA 5IUJC 1NUHA 1QE0A 4ND7A 4NK4A 2IP1A 4JI0B 4PN3A 1UJNA 4L3OA 4C6TA 4DQDA 2J0QA 2W70A 2WG2A 3SEZA 5FLXK 3P0IA 5CYPA 4EI7A 1ZNQO 3I8XA 2F00A 4UUSB 4NDZA 4RVHA 5CNIA 4WY8A 4EHKA 1UOQA 2OXCA 2VQDA 1I33A 1QTIA 1KI3A 1JEDA 1RJWA 2P69A 1LFUP 3EXAA 3OCXA 2H1KA 4M98A 1S7OA 3LL7A 3TBFA 2Z3VA 3IBSA 4YIHA 1JEYA 1YZFA 1JKMA 3KOYA 3OPMA 4PG8A 3RKXA 5ILSA 3SHWA 3DJYA 1EMDA 1TM2A 1U7XA 3IAUA 3M6MD 4Y33A 2ZYGA 3I2JA 4H1WA 2RAFA 4M1KA 2BWJA 2RGUA 4MWBA 3HU5A 1ZRCA 2A5DA 2HZTA 4MEYF 3P71T 3KE2A 5CA0F 3H83A 4LBZA 2E4WA 2V6JA 4GQIA 4PZ9A 1JNYA 1Z6AA 2FUCA 2MJLA 2YU3A 2VYVA 3SLGA 4BJ5A 4J0KA 1BZYA 4UBMA 4JLWA 2CLEB 4TTIA 1Q12A 5A3JA 4DLBA 4EL0A 1K7YA 1UPCA 2ZI6A 3WR5A 4TWAA 5F1PA 3RB8A 1UJ8A 1XTRA 3VQTA 2NP7A 3BD8A 2V6CA 2HVSA 4Y2HA 2PRZA 1C80A 2CYAA 3CLUD 5HQ3B 3IVRA 1OCEA 2IOFK 4GXRA 4HYTA 1VG9B 1GKKA 3MRXA 4NZPA 2D54A 4DZZA 3A6DA 1LI4A 4J8PA 1PAUA 4DNPA 3ISVA 4F71A 1UDWA 3RWMB 2QYSA 4Q03A 5H3LA 2WC1A 4AWXB 3KCCA 1FPMA 3B1WA 2DPYA 4LHWA 3HBAA 1VQ7I 1JBEA 3PUJA 3SK0A 3EVEA 1OZAA 4UM8B 5GZ1A 1NA5A 5JSZA 2QGZA 1NHAA 4KXWA 3K1NA 3IAM1 1V5IA 4I4TB 4XARA 2CMHA 2FGKA 4I55B 2VQSA 8ABPA 2NXNA 4A3CJ 3M82A 1ZISA 2Z9BA 4PSXA 1D8JA 4AT1A 2J6IA 5BW5A 2RDMA 1EE9A 1UT6A 4KHZA 1C7RA 2NMVA 2PKRA 2E7ZA 1ZR2A 2JA8J 5BNFA 4YB8A 2XOKD 1XZEA 2NU9A 4CLXA 5AOBA 4PLWA 4XQEA 1EX9A 3BTLA 4TL7A 1KJ8A 5H68A 3CR7A 1KXZA 3D3WA 3FXKA 2PK3A 4XEHA 1JAIA 2BY3A 1XZBA 5ALFA 4D3XA 1K6OA 5ICFA 1DG3A 1OX5A 1RI2A 2BKLA 2HLHA 5C1IA 1DPGA 4CMCA 1ZMTA 2NNYA 4MV6A 4Z8YA 2G77B 1UKZA 2OXFA 1KSJA 3FBTA 3FNIA 2Q1TA 1CHNA 1UJ4A 1YKFA 3HR7A 2FWNA 4I9FA 4JZKA 4WJZA 5L7YA 5D86A 4UMEA 2JK3A 2ISZA 1BJAA 3ULQB 4EENA 4CTJA 1JT6A 1JHDA 1L4YA 1GA6A 3LAPA 1STOA 1DRKA 1NN5A 1HE8B 5EQDA 4BRUA 1A82A 5AI9A 2QZ8A 2IXBA 4IEEA 5EZYF 4EA7A 3M07A 3LCVB 5JH7B 3DYBA 1W0TA 2BBWA 2ZUWA 1REQB 3E9ZA 1YVRA 4MUMA 1UB9A 4PONA 5KHOC 2XDQB 3RBXA 1XX5A 4A36A 5T67A 2Z0MA 3PUYA 2YIMA 2Y05A 1HSOA 1ODJA 2GGSA 4BLUA 1YW9A 2V6BA 3EZXA 1NBEA 1KJNA 1VFCA 1YDEA 4L08A 1UAGA 1XLTA 4EW6A 1KRXA 4KFCA 3KQTA 3O4JA 1QUEA 3NM6B 5BN4B 4FB4A 4FZVA 4WKGA 4UUPA 3E82A 5KWVA 2AMVA 1QJ4A 4A26A 4BO3A 4DT1B 3JQEA 1Q0RA 2A33A 1NUQA 2D7CA 3NWEA 4MVJG 3UJHA 3V3TA 1Y1LA 2B8EA 5ALWA 2PKEA 3OMYA 1AOYA 1W47A 4ABZA 1R5OA 3C43A 2IA1A 4WINA 5FTWA 2KMUA 2OCAA 1GFIA 1GXQA 4V24A 3TQQA 2YXEA 3N97A 2YY5A 1BN5A 3KPWA 1FMLA 2ZIXB 3JQ8A 3FJ1A 2DA2A 3FMOB 1Y9EA 3AF5A 1ISIA 3AEQA 3FOCA 3P94A 2PSFA 1TP4A 4MRRA 4OK5A 4RNDB 2O0HA 5FO1A 3Q9SA 5FQOA 3TR5A 1VLQA 1DIHA 4DDUA 1XTTA 2CVPA 3MKLA 2CJWB 3U44A 4KV7A 3KSRA 4YV0A 1BCSB 5DHTA 4JLOA 1AF4A 5LRRA 2AEEA 2P11A 3HFRA 3IMFA 3AILA 3IEIA 2H16A 3EY4A 5DV9A 2AHOA 1V96A 1E3IA 1I32A 5TX7A 4ESBA 3RS7A 2QY6A 5HIKA 5HDBB 5CTJA 3W5DA 3DOFA 4RA2A 3SXYA 3G2MA 3HL0A 4TSFD 2VHEA 3U4MA 4JKOA 3N7TA 3NTUA 5EZ6B 5HMLA 2ZIZA 3MHPA 4KPUB 3BGOS 5H82A 3U17A 2BFFB 3BWEA 1NJSA 3RSLA 4H31A 4GKAA 3W6KB 4NHJA 2A9RA 3A05A 1FBSA 3KFXA 3N2KB 4Q9NA 5T6MA 1L7DA 1UWVA 2X86A 4POAA 5G4KB 3F3SA 3DZIA 1WA5A 5DSTA 3FPEA 1RZ4A 2MSNA 5EHQA 4JQCA 4BX8A 4J1SA 4QLCU 4GEGA 1NVBA 4I50F 3ZQ6A 3FOEC 5LGTA 4JK3A 5F73A 3C8UA 4P4NA 3BAFA 4QAQA 3V4SA 1JG3A 2JGIA 3VR3D 3LXRA 4EB6B 2EYUA 4Q34A 4YUYA 5T8KA 2CJYA 1B74A 2I87A 1FFHA 5DBFA 1XAJA 5TVGA 2MG4A 2W84A 3CVOA 4R98A 4UHFA 2J4FA 1JHMA 3TSAA 3TTWA 5CBPA 1YQDA 2GRUA 4MI3A 2WY7Q 3VKFA 5J2UB 1ZHOA 2I22A 5D87A 5LDGA 4PYNA 2RCYA 3PDCA 2BY4A 3MGBA 3TR6A 4QLOA 4AXBA 1AUVA 1FVXA 5KZMB 4HDSB 3NMUF 2ICAA 1Z6YA 1H6DA 3PVCA 3GX1A 4URYR 3HLYA 3G9QA 1RPJA 4G65A 1SQ0A 4DM3A 3CLOA 1TCVA 1IXYA 5M5XJ 3GD7A 3T7TA 2WJYA 4MR8B 1MBFA 3ZI0A 4BQRA 3OS1A 1PZHA 3IEUA 4KSCA 3WXMA 4DOZA 4JP3A 4R1OA 3OECA 2LP0A 1GQSA 2K5UA 3OO1A 2Z56A 3CH4B 5DTEA 5FPTA 3RDPA 3KQHA 2DQKA 2CHQA 2Z57A 3BA6A 5JQGB 1PR9A 3UJ7A 4II3A 2QD2A 2O8EB 2FDRA 4ZDLA 3BOQA 2ARKA 2VATA 1J0EA 4P0PB 3PDWA 4JR2A 1BW6A 3OIGA 3BWCA 1LFDB 1X42A 4IGAA 2V3WA 2QN1A 3NIBA 2HU8A 3BORA 7YASA 1QK5A 2QZSA 5DNCA 2BIFA 1A1SA 4RK0A 5K7FA 5DHPA 4DSZA 3CZ9A 3UOAB 5HOQA 3I0MA 4E2WA 2GN8A 3DF7A 3LDFA 2DWPA 1RRVA 1PWEA 1NE2A 1T35A 1W48A 1YR8A 3IVXA 4OHYA 4D6YA 1W0CA 4E6EA 2ZBRA 3NPMA 1W2HA 3F6CA 4B74A 3O2JA 5LYJB 4D0PA 4ZHSA 1NG9A 3GH3A 3VAAA 2QW0X 1ECCA 5JYEA 3ZE9A 2AXEA 3IT0A 2P5KA 4QECA 3S14J 3QNWA 4O4LF 1B14A 5HK9A 1ZJJA 1DKUA 2JTVA 2VQHA 4JXZA 4J0GA 3VU1A 3AFMA 3FBWA 5BUZA 2WKWA 2XZTA 4KR7A 4GPEA 4REQB 4KN8A 4Y15A 4OOFA 4Q24A 2FQ1A 3G5TA 3ROMA 2VDKB 3BWYA 2YMQA 3L7MA 1Q3HA 3DP7A 4MVJP 5LFAA 5SZKB 3TBKA 1K1EA 2ETXA 3CCBA 3QPLA 2CW0F 4NPHA 3TRIA 3MEQA 2PT7A 1CDZA 3FM9A 4X7PA 1UBHS 2X4HA 1F8UA 2F43A 4MYRA 4ND8B 4QDXA 5AJZA 1GADO 5IW8A 3LRXA 1E5DA 1V5FA 3ABUA 3P2JA 4B3XA 3IWZA 3R5HA 5EPOA 1H05A 2W24A 1YS2X 3WYGA 1BD4A 2C99A 3K73O 2O4CA 3R3VA 3P9SA 4GC5A 5CNMA 3R76A 2IXAA 4BFCA 5ALVA 4OHWA 3C85A 4AECA 4FYVA 1N0IA 3SVZA 2Q1XA 4FDUA 1WXWA 2YBDA 2C1XA 1F9EA 4RDCA 1EP1B 5JD3A 4D98A 3DTVB 4R9VA 4F3RA 1MW9X 1QPBA 3OO0A 4HDOB 4NFHA 3DYVA 4XPZA 5REQA 3ZLBA 1JHFA 3DTVD 1JHXA 4XUCA 2I6XA 3JVIA 1EFKA 4HQRA 3FXAA 5FPSA 1WE2A 2GZHA 1U7DA 2HRZA 4MZDA 5KTKA 2JC3A 3P9RA 1XMOB 3CWQA 3SDSA 5KSZA 5IH7A 2RIRA 5JVTA 2TSYB 4OHRA 3JZAA 1FLIA 3E5HA 3SDZA 5G3ZA 1KK3A 1WMFA 2NAZA 1NBWB 2G9QA 4D8WA 1AMUA 5DISB 4B3CA 4M0UA 4BB9A 2IFTA 3B6IA 2ZNYA 4YEJA 1IIRA 2PX6A 1AOXA 3OD5A 2M45A 3CMMA 1MOSA 3HRSA 1VBFA 2R9VA 4QULA 3HEAA 4QASA 1NJ6A 5AKXA 4MGZR 5A2QA 3VC2A 3Q5EA 2IY7A 2R4UA 1E6EA 1KU2A 1DZ3A 1G1MA 2SECE 3C1OA 4WJKB 2FSVA 5EJAA 1RTTA 4DIEA 5KSYA 2Q3EA 5GPCA 4NATA 4WLEA 1GR0A 3DAPA 3RSZA 4WNAA 3CH6A 4F84A 3AONB 2FHSA 5HBGA 2HWWA 4D97A 5IS2A 3MZ8A 1TM7E 3LHSA 3A9VA 5FH9A 3LA2A 5ECGC 1E9VA 5LIRA 3PA6A 2W6PA 1YAJA 1EINA 4Y30A 4NONA 2JCBA 1B76A 2WJJA 4QBHA 3FIWA 3JQBA 2JG3A 1Z91A 5IYCJ 2QPAA 4NCKA 3SJAA 3VNRA 3GNTA 4BKPA 3EVFA 1S5PA 3EEBA 3CIFA 5LVAA 4BLRA 5DK6A 1L5WA 1VIMA 2XH8A 3CZPA 4HW0A 1DJLA 3D3JA 3LW7A 2PL5A 3K8OE 4ESVA 4GP9A 2OAGA 2DG2A 1G6Q1 2DU9A 4BV3A 2HT1A 3OCVA 5AVOA 2EWMA 1IOZA 1QVRA 1I01A 1NHWA 1YZQA 2CHFA 5BNWA 2O5CA 1XMAA 3BQ9A 3OTQA 1R4ZA 4PNHA 2PCLA 4KLAA 3ZWQA 4ACBA 2FFJA 3CRQA 2WTAA 2QLZA 1F6BA 3O74A 3A3KA 2QBYA 5BOSA 3URMA 2I4RA 3GT4A 4NZNA 5IJZA 4XB2A 2F4VB 1G3YA 5HKKA 2DYSH 1LK5A 1N57A 1GV1A 1CB0A 5DBHX 3E27A 1XCPA 3DE5X 3TL6A 1X7YB 3ZZ0A 3HN7A 1PO7A 1T9ZA 3G8DA 3CNHA 1B3RA 1ICIA 3NFYA 4LDZA 4Q4JA 4RSHA 1S0UA 4YFVA 2GVZC 2VHTA 5IM5A 4AN4A 4RD0A 3ZDZB 5JAUA 2HYFA 1YB1A 2FLVA 1PGNA 5HZKA 3GLLA 1T43A 1Y7HA 2FCAA 1E2UA 2M32A 2OGZA 2W6IA 5IDWA 1FLDA 1TAQA 2O7NA 2R4QA 5EJ9A 2JLZA 1FFXA 2O03A 2VYQA 3RABA 3I05A 4L9RA 1S4MA 3BR2A 1SBQA 3IFSA 2BL4A 1E8DA 2FA5A 3B78A 1DKPA 3OF2A 2XT6A 5D8LB 1DJNA 1VPEA 1VF9A 3H35A 3MD2A 3QOPA 1LSSA 1W4AA 3FOWA 3LDGA 4JJKA 4PAGA 1KKMA 1JYFA 3SSAA 1AK9A 3G73A 3QY0A 5AJHA 3VODA 4KQ2A 2ECPA 4QNRA 3GTOJ 4BC1A 4P7KA 2SKEA 5EIHA 2VHQA 4YJFA 1HOTA 1VG8A 3HZJA 1XZKA 2Z9CA 3O7WA 1SEVA 3KELA 4LOCA 4G12A 2NUAB 1QZEA 2HJWA 3DBHA 4TLCA 2IU0A 1FYKA 4Q7QA 2D1YA 4JUAA 4MR7B 4JI4B 3WHPA 1F3OA 3MTGA 2CUFA 2BRUC 3H2GA 2G5GX 4MUXA 1YOBA 4BGUA 1OX4A 1RLTA 3FSGD 1O7LA 4L0CA 1KIFA 1PGOA 5LP6B 2FUEA 4CHGA 2GQQA 1Y3AA 2DLCX 4PSVA 3BL6A 4PBRA 1F36A 1UXOA 5AK0A 2XAFA 4RSGA 5CQEA 1TGVA 3RNLA 5LWHA 2AZDA 3AXTA 3D4PA 4LMYA 3B48A 1J70A 3KEMA 4BJHB 1MZBA 4LGMA 3RHFA 4FB5A 1DKMA 3CMCO 3B82A 3CM0A 3E7XA 1BJTA 3IXQA 2BGRA 3VKUA 3ZVLA 4DREA 4BL5A 3NXSA 2BN4A 3HB4X 2X13A 1XZQA 2WNIA 2HEGA 2HW8A 1K4YA 1E64A 2IDKA 3TZBA 2Q8KA 2GD6A 2FMLA 5CH8A 5BNTA 4A3MJ 1UPXA 4RV4A 5M5BA 2QM3A 1QVTA 4BAYA 1XNRB 4WZAE 1TQ8A 2P40A 4M6YA 3ZGXA 1MOPA 2QX8A 3NAZA 4ZCIA 3CR3C 1IHYA 3ER9A 3KKOA 2F8SA 2YHIB 4FUQA 3TEDA 3RSSA 3T9BA 2EJRA 1RE1A 3I8OA 2P9FA 2ZRKA 1US8A 5DNVA 4C2BA 1NU8A 4C7MA 4L6CA 5L3FA 5FXMA 2VJYA 2WWXA 3N5CA 2OP0A 4C21A 1PJCA 1D7AA 4A12A 4FT2A 4MV5A 4KXYA 3ZQJA 1KO1A 4YFNF 2OILA 4H17A 4W5JA 5JNVA 1TMGE 3LWDA 4FILA 2NNLD 4KC0A 3NAUA 1LPOA 3KE9A 2W4QA 5DFAA 4F3KA 5J2UF 4O5OA 3Q3GE 3VNVA 5IYDJ 4KXVA 4G9EA 2QQAA 1RR8C 1BOOA 2BFCB 3IAEA 4TQAA 3UXEA 2F5VA 4KIUA 5TGZA 3H1TA 2HI0A 1G20E 2PIAA 2XNCA 2EYQA 3M9LA 1WH7A 4E1BA 3TN7A 5B6IA 1T1IA 1R10A 3CBGA 2J3QA 3ASZA 4L8GA 4RB0A 4C04A 7MHTA 1V11A 2JEZA 2W2KB 1LPPA 3GTKJ 3J7AC 5IVIA 2NTJA 5JXHA 1QTQA 1LV7A 1Q44A 2DDBA 1XT6A 1YJ5A 1BIBA 3DZGA 3I04M 4B87A 1QAQA 3HOZJ 3I6IA 5UKDA 1VYHA 2XEDA 5J4KA 4QBTA 3ZJVA 2CNOA 2ZI3A 4MDEA 1W5BA 4PZ0A 5JCPA 4G0ZA 1YJAA 3CIOA 5EZ5A 3L02A 1FYEA 1LBSA 2I67A 3A4VA 2IWRA 2EIXA 4WQMA 4RYDA 1CQWA 3HI6A 1Y56A 1JQDA 1OI7A 3UNXA 1UP7A 1TXGA 1U8BA 5FA6A 2XOXA 3UH1A 4NHEA 2DMTA 4NB5A 4F3CA 1G3RA 1A31A 5ALDA 2NYVA 3QJYA 1IMJA 4A0RA 3DDHA 4HOYA 4D99A 2FBKA 1QQBA 2PFKA 1U0JA 2X23A 1Z08A 3GLQA 3WV4A 1DXHA 1ZM2A 1RYDA 4REOA 4LE2A 3TSWA 3UR3C 3KWMA 3BWMA 3VOTA 4DA9A 2H7CA 5ALUA 4H1TA 3U3KA 4BPBA 2FSFA 4J43A 5AJTA 4AQ7A 2X6WA 4L9VA 2R44A 4DA4A 2NP6A 4KQ9A 3VZQA 1AKTA 4GYJA 4RX1A 2FKAA 2CVZA 4GYIA 1BE8A 3N8GA 4R31A 3B2EA 3DEUA 1PSZA 2CWWA 3HMQA 4P98A 3LHKA 5GAGJ 4WECA 3LY7A 4DDKA 1TQIA 5TGDA 2O8DA 1QO0D 1DADA 3USCS 2F55A 3WFJA 4MI1A 3G0IA 4B32A 2DLLA 1J59A 2A3RA 1ADCA 4UW9A 2JLXA 5DYNA 1RWNA 3SQWA 2QY9A 4R2LA 4XUEA 2ZBQA 1EUDB 3K1ZA 1B59A 5IAOA 4RLHA 3H5VA 2FUNB 3AL0C 1NX6A 1K4MA 2FLWA 3ZZ1A 3ADCA 4OGGA 4ESHA 2XMZA 4Q16A 3DTEA 3H1BA 3L41A 1IZ9A 5CXSA 1A4RA 1DRUA 3RV3A 2ZVJA 1ISHA 1VSQA 2PH1A 1BXRA 3KS9A 3VTAA 4ICIA 2E1NA 2X6RA 2R25B 2AYXA 1PS8A 4NQRA 4IILA 5GAJA 5KTTA 3IPYA 4IIVA 3WGKA 1M3SA 5LL6P 4AP5A 4E2XA 4OHZA 3DLAA 2NO7A 4N6OA 1BXKA 1T3SA 3I1JA 3KVVA 4B40A 1YFHA 5HNKA 1XZLA 1NFQA 4CHUA 1J09A 2BW3B 2WIKA 2C54A 3LYLA 4MAMA 2JT1A 4F92B 1WL8A 4PC2A 4EM2A 4PIMA 4RANA 3T1TA 2IYVA 4HWPA 3HJEA 2WHPB 1HLPA 2OB1A 4HYYA 4RZUA 4P7FA 4WY2A 5CJJA 5EC8A 5ILQA 1QCDA 4CCWA 2QN2A 4JXKA 3SVTA 4RGRA 1KEPA 2ZRNA 3PZBA 4RZ3A 2HPMA 2A5LA 2IIBA 2XW6A 4QRHA 5CD1A 4FM9A 3CDIA 2VF2A 3REFA 3FZGA 3GGGA 3BSWA 5FWYA 2JFVA 3UICA 2RQPA 3E6CC 2WADA 4IS3A 2MINB 5F5XA 2JH9A 4XE5A 4G0YA 5KVRA 4UTZA 3ROGA 3GJ0A 5EWLB 4MFDA 3G4SI 3PSAA 1CUDA 1ODKA 3HACA 3O1IC 2BP7B 5H6RA 4MQBA 4IUYA 2ZVPX 3MA0A 1WCYA 3LNQA 5DCUA 1T1RA 1VIVA 3ZW7A 1JDPA 2X3UA 4HSGA 5G1OA 5H3HA 3DAFA 1KKUA 4XEUA 1TKBA 4OQ4A 1GZSA 5DCFA 3CQ9A 2PU5A 3GJSA 5B7QA 4GECA 2AMFA 2KFDA 4NMMA 1GTSA 1WSUA 1QP0A 3CJNA 4EBBA 3G2BA 1PDNC 3RYIA 2WB1N 4DJJA 1NQTA 1ZD5A 3LRTA 2ZJRF 1WCXA 1WSAA 4BO9A 2J5KA 2RARA 3JQ9C 1TW3A 3JRCA 4DYDA 4YRJA 4UE3S 2PT9A 3AW9A 5AOCA 4IHWA 5HKKD 4LNAA 1UPAA 4X61A 3D4BA 4LK1F 4GFDA 4J16A 3UYKA 4YR9A 4J4HA 4PSDA 4ND8A 4UUNA 5C80A 1Y4AE 5KPJA 4DBLC 2Z6AA 4TYNA 3QP6A 2B1QA 3DG9A 1ZVKA 4NE7A 4OP3A 4PLZA 1GPNA 2UUPA 5AW8A 1A88A 5CTAA 5T3UA 4R0VA 1OLSB 3U7QB 4NQWB 3ZCUA 2QMZA 3E2IA 4C9YA 4HLNA 3FCAA 2WSIA 4RIHA 5G0WA 1HURA 2DMUA 3P20A 1ETVA 4I09A 2OMKA 1AA9A 3SMQA 1BMFA 5CGZA 1J0XO 5CB8A 2FJPA 4KITB 1U7HA 2BFDA 1YOVB 2H4HA 2V5UA 4LPSA 5IYZF 4A0QA 4X6XA 3PQKA 1LC3A 2PMUA 2ID8A 1YVEI 1J2YA 3CS3A 3JWJA 1XUOA 3MS4A 1NXOA 2FPXA 4JJ8A 4DMGA 4E7KA 1FTQA 1JALA 1GZ6A 1HDRA 2FPOA 4C7VA 5H8WA 5JOQA 2HN9A 3CZRA 3SDBA 4I4TA 3B12A 2HQRA 3ZHOA 4HLUA 4ENPA 3M8FA 5EKDA 5JDIA 1WU8A 3MAGA 2BGGA 2NU7B 2HVRA 2Y1CA 2GPNA 3BPSA 1YZHA 3RLIA 1YFKA 3NIDB 2JEYA 3B3QA 3NHBA 4EWLA 3I54A 1JE0A 1N7JA 3KJHA 1OYWA 3BIWA 3VDRA 3WQHA 4EBFA 2FZCA 4LFUA 3CU5A 1J9GA 2H31A 2AFIE 4R81A 3RJMA 1NU6A 4C7OA 5DHRA 4JOMA 2NAPA 2A05A 1MC5A 3QKUA 2ORIA 4CKBB 1II0A 2QJOA 4NV0A 1FC3A 1LPNA 3OEED 4GM1A 3S2YA 3K2AA 2J1LA 2W0SA 4LGWA 2R7WA 1W1UA 4RU1A 2WHQA 3QKRA 5EFZA 4S0HB 3H9CA 2H2IA 2X9GA 1DUIA 2RH9B 1T98A 4I2VA 4LWQA 1IAVA 3TDZC 4EIWA 4R8KA 4W1SA 2O14A 1CY4A 3FNHA 1VQLI 1GPLA 2HBRA 2IXSA 1QB8A 1WDWB 2C82A 2QD3A 2OQRA 2RHJA 5F21A 1QP7A 4GX2A 5DGXA 3WZMA 5EJMA 2FXIA 4O4JB 2Q5IA 1GGEA 5CHYA 3B3GA 4CF6A 4V1CB 2XVYA 4NBTA 4MPTA 1FFCA 1ESDA 3KQLA 5HSGA 2VDWA 3OCYA 2DGDA 3LDHA 4BCCA 3A3NA 4EFNA 5A4AA 2MYPA 2RI6A 3DEKA 1PG0A 4MKZA 4N0EA 1DPFA 3K53A 2CXXA 3X2QH 4RJLA 5HLHA 3LBFA 1QWSA 3X1YA 3M1CA 1NVTA 2CFSA 3NJ4A 1EP3B 3H11B 3AINA 3CG0A 3K20A 3MBKA 2DFIA 2ISYA 2WWYA 1KERA 3R5XA 3WK9A 4DPLA 4MI9A 3NG1A 2BISA 3MGKA 4K6GA 4L72A 3B6KA 2VLIA 4LMPA 2G5PA 4XYBA 5DEOA 3BPVA 4Q1EA 3IP5A 4PYJA 5AW3A 4AJNA 2H2AA 4IQJA 4EEXA 3GBGA 5CFNA 1OQYA 3S3MA 2REXB 4FXOA 3W3ZB 4KWTA 2NO9A 1WSWA 3FG9A 3D5EA 5ICCA 3Q1LA 1SBTA 4AYBA 2FZWA 4CF3A 1B41A 4CYMA 3VA7A 1AVTA 1E0DA 1ENOA 1V2HE 1YCDA 2WB4A 3H9GA 3KD3A 2JSPA 2EBHX 4AL4A 5HS6A 4TLBA 2A1IA 3I2KA 4L9NA 3ESWB 4JJZA 4TKVA 4DZRA 1PFVA 5A4DA 1K88A 2HPAA 2ODBA 1LTQA 3AP1A 2FR8C 3RREA 1I7QB 1LRJA 3T1OA 4H0EA 1RBZA 3V1UA 5C31A 4IQ4A 1GN8A 2B6HA 1E1LA 2ISQA 3L1JA 4K3UA 1EK2A 4L5BA 4DLYA 1JEQB 4MKXA 1K78B 2GH1A 4H27A 4I3FA 4B6SA 1FYLA 1AGPA 1XAGA 3EUFA 1XCVA 1EP9A 1Z06A 4HH1A 3D6UA 1DV1A 2VLBA 3K6KA 5HE9A 1T2VA 4GM4A 2IKSA 5DWDA 1J9IA 4B80A 1DRWA 4AF8A 3RK1A 3WL3A 2VNHA 2XOKA 1X1QA 1JA0A 4LZLA 5LQSA 5LD2C 2QG6A 4UTXA 4B8ZA 4CLRB 1QOQB 3MWFA 2XV1A 3BQMB 3ZE7A 1VFPA 1LLDA 5DGTA 1XJCA 3DDZX 4NNJA 3DE6X 2D00A 3BL8A 1BE0A 2WHXA 2GJ8A 3ECCA 3NGLA 4FGJA 4G8DA 4HFRA 4ND4A 5E7IA 1GN9A 4K8RB 4EJOA 1C3EA 2R6GA 4EABA 1KKLA 1TM4E 1IK4A 3CRVA 2MABA 2IQ5A 4TS1A 2PM8A 4BX2A 1THMA 3C1AA 3NKVA 3DMFA 3P97A 3BFPA 4OGFA 5C35A 3AR4A 1CBUA 3RS2A 1A9TA 5IPAA 4F45A 2LDUA 2G6BA 5C5EA 3VDXA 1MPXA 4F11A 4NH0A 5FPKA 1O7FA 1ZGCA 2C96A 2E1MB 3SZGA 2M2IA 2ODQA 3H5LA 4PQRA 3ZE0B 4LXIA 4D8UA 4DDMA 1DHRA 2EZ9A 4FPXA 5GVRA 4EY8A 1FL9A 2W2TA 1Z18A 2C77A 4EITA 4BDTA 4DLXA 2PUBA 1IY2A 3M1IA 1N0UA 3RSCA 1AXGA 2OLKA 5CGQB 3THXB 1LJLA 1KORA 2IEKA 4ZTFA 4Y2QA 4CMJA 4JYMA 1TL7C 4FMCB 2F2TA 4ALJA 2J0SA 3SJZA 4FDAA 4IJKA 1X7DA 4G2NA 4XDYA 2P2SA 1U5BA 2Z2JA 4XOPA 3ESCA 1HMYA 3DLLF 4Q39A 4QXRA 5KNCD 1ND5A 3UAWA 4G9GA 1KFJB 2QR5A 3TBHA 2C7BA 4BGVA 4DJAA 3PIOF 3LUKA 1T8PA 2G70A 1XZNA 2NVTJ 4IDQA 4N5IX 4TT3A 2VC0A 1VL6A 2D8MA 1E89A 3BF8A 1CVLA 2O48X 2IY9A 1MVOA 4IWNA 3A27A 4Q9JA 4MWEA 2DODA 1MF7A 2WZBA 2XQGA 3HC7A 1BO6A 3P8ZA 3UM9A 3VHRA 5JECA 2RG7A 5F0FA 4Q1DA 1QVAA 3PCTA 2MLKA 2Y0BA 3IKTA 2J5QA 3LBYA 5LBIA 3TD6A 1GEGA 1QUFA 2Z5UA 1UQUA 3RGWS 2CBZA 2K9MA 2J5OA 2FG5A 3B36A 5LHHA 4NOMA 3A1TA 8GPBA 2C83A 2CRGA 4N4OB 2GXQA 3HDDA 1R23A 1D9XA 2AOVA 1TZLA 1RFGE 2C2OA 1T0FA 5HLIA 1HLFA 1ULZA 2VPQA 2O59A 4OQPA 2DPXA 2W2QA 1WG8A 2OBMA 3L8MA 2TDXA 2FYTA 3R3SA 3MYYA 4Z6KA 2Q6KA 1T26A 2H27A 4GI5A 3A10A 2BZGA 3F6SA 1D04A 5LEJA 1DQNA 1SJ9A 2IZ0A 1RHUA 4WL0A 3R9KA 1M66A 1RMQA 3W8NA 4G0NA 1VMAA 1K8ZB 4EG0A 3O3OB 1GRCA 4Z9FA 1QMPA 4GS5A 2X8JB 3KT6A 3BQYA 1E2JA 1BQEA 1KJQA 3V42A 2IX3A 1TTYA 2IYAA 1US8B 1I4WA 2ZI4A 4BNYA 5IAAA 1Q0HA 1PEYA 3GAMA 3PPIA 4HX2A 2HQ5A 1FIAA 2X6QA 1PQ4A 2RC6A 1TZJA 1HYGA 1UBRS 3AKYA 4K2AA 4N5LA 3W9YA 3O8RA 2VDVE 2E71A 4ESFA 4KW7A 5EMMA 4CN9A 3QI2A 4L07A 3RZDJ 1YLFA 3WLTA 2ZZKA 4LXHA 3EF1A 1K2WA 5ALMA 1KWKA 1DFGA 2BLLA 3OU6A 4TMZA 3CZ5A 2R7MA 1AKNA 4KJXA 2ADOA 3HHEA 4I4TF 4LSWA 4M9RA 5K3FA 5BUQA 3WDMA 1O03A 2YICA 2IJLA 2B4YA 3I6YA 3MUEA 3MTDA 1KOLA 1TIKA 3MT7A 1L4NA 2JLWA 3SIRA 3I56I 1YONA 1FTGA 4WE3A 2QQGA 2GZWA 2OO7A 1XEXB 4I50A 2NYAA 2F8LA 2XODA 5EFOA 4BCDA 3ZBUA 3TIGA 1L4LA 4CETA 1LE8B 4C9BA 3TO6A 1MOQA 2AB0A 2ZIUB 2HNKA 2ZQYA 3PNBA 4O59O 2Y1GA 1KU0A 1XP8A 5JNTA 2CLKB 4A0HA 3KE8A 3MERA 4HGRA 1KMMA 2Q41A 3VPHA 1Q91A 1E3SA 4DLLA 3HRMA 3SOPA 4IGIA 3TPFA 1IB0A 4AKTA 1LDYA 2VXOA 2K9NA 3LP6A 3PFCA 4R9SA 1FFAA 3RW9A 2O52A 3EGCA 2LR0A 3GDGA 1IDN1 4FU0A 1RRPA 2VHYA 1P4AA 1LH0A 1UDCA 4FSHA 4E12A 1ADFA 1LI5A 3T1NA 4LXTA 2HZ7A 4AY6A 1B8IB 4ER0A 2PMZN 3DOOA 3ER6A 3I9LA 2W9XA 4MAFA 4BV9A 1VMEA 4CVNA 3NHUA 5AKYA 1W0KA 3CA8A 2XDAA 3ITDA 3MWMA 1A9YA 4QBIA 1YR7A 1ZA2A 4WX2B 4L6IA 4WESB 1A2OA 4D0GA 1D2EA 1RXWA 3IC7A 1DX6A 4G4IA 1D5VA 3IAXA 3SE0A 5U4XA 2VXDA 2R68A 3DMYA 4YY3B 2FJ0A 3PWKA 3H6KA 3JWGA 2LFBA 4XOTA 1LD3A 4RK7A 4X41A 1MCZA 3L6BA 5K6TA 1YBAA 2YV5A 1GL3A 1OR8A 5JARA 1QS0B 4CLHA 2CH0A 2WZQA 4H16A 1K08A 5TRTA 3STVA 1L8QA 1UJCA 1N33B 4DEYA 2B2XA 3QQAA 3ZQGA 1DO0A 3ZXUB 1KQGA 4IRHA 5IOZA 1O6CA 5CURA 1FZQA 2Y0SN 2V7XA 3FY4A 3K9HA 4O02B 2P5TB 1J06A 2V96A 3D8HA 4TQGA 3IV6A 1JB9A 4O1MA 2R96A 4AMGA 2PLWA 1CR4A 1PVOA 2VRBA 1DQPA 3PRKE 1U9OA 2M8EA 1JGSA 1HE2A 2Q0SA 2IW5A 1ZWKA 1FX1A 1QLJA 2OAQ1 3CY6A 1SIWA 3PDHA 5H02A 2I6QA 3OFVA 5CLIA 1YRQA 1XJQA 3ORFA 4H35A 5NLLA 3U3MA 1ELOA 3UENA 3EDCA 4MB6A 1QYXA 4BBRJ 3I2HA 4LDJA 1PR6A 3EPRA 4XUGB 3S3TA 3WKAA 5BV7A 1WB6A 3CX7A 2CEAA 5J2UA 1FEZA 1FLNA 3CX6A 4GZ6A 5CDGA 3UQYS 5SYNA 1P7VA 4IWXA 2R2GA 3OX2A 1JI3A 3NHPA 1MMDA 5JUWA 3G5UA 3T34A 5EYPA 2RKWA 1TX4B 2LK2A 4GXQA 3DXXA 4NJMB 4LDNA 5SZJA 4LAFA 1U98A 4NOKA 2AMJA 4BU1A 3A58B 1N0VC 3OE5A 3NAGA 1PSDA 4UCWA 2VPXA 3RPQA 2XTZA 4IVQA 4Q3OA 3OUZA 4WGGA 1DO8A 3IOBA 2C3MA 4X60A 3GLIE 3PKZA 3RHTA 1NLFA 1Z33A 3JQ6A 1Z39A 1JJAA 1OV6A 2EP5A 5COBA 4Z53A 3CRRA 2IYZA 2XD4A 1QIEA 2XF8A 3GPLA 3LSYA 3V55A 4JLVA 1LX7A 1NVKA 1QVVA 3BTUA 3CF6R 3IAAA 4RD2A 4RD4A 1D1PA 1AN9A 4B3GA 1QZXA 2V58A 2Q3MA 5TMBA 2FRVA 3LPDA 4F21A 2VWQA 3GQVA 5DZSA 5A7FA 3ROUA 1SNYA 2IIQA 1DJOA 1FVHA 2ZYRA 5MGNA 3HSFA 2Z2KA 5LC1A 1R74A 3LVBA 4RB3C 1PK7A 3O4GA 3Q7PA 3TQTA 1TA4A 1IXRC 4G24A 4B6JA 1WBDA 2AFHE 3VH4A 4W9RA 3OLVA 4G4GA 1A50B 4CEIA 3JVDA 4YLEA 3R7DA 4P7JA 5GJVC 3V1KA 1I3KA 2GS9A 1NTOA 3QGMA 3S8YA 5U4QA 2HDDA 3TZ6A 1P5FA 1W5TA 1SXGA 1V0JA 2VQ3A 4AZSA 4MIEA 1L1QA 2B8JA 2TMYA 1CF9A 5DI9A 5IKEA 3L4SO 3R5KA 3OAAD 3FSGA 4UC0A 4EHNA 2FOWA 1UCFA 3F5MA 1MIOB 4F9GA 1X9GA 4ASNA 2WJIA 1H8EA 3ML1A 4OHOA 5CEFA 5JHGB 2NZWA 4ZQIA 3KYJB 3PQ2A 2ZYIA 4KMOA 3RFUA 4B3BA 4MYUA 1L5KA 1U5TA 3FFXA 1FOXA 3G59A 4XA8A 3WC4A 3L4BC 3OTGA 3KR1A 1U5TB 4P80A 4PU0A 4YXFA 5L6LB 4KA4A 1ABEA 2M1XA 2AFVA 1ZD8A 1T36B 3EGEA 3GLRA 3DDSA 1YTUA 3F3KA 1XGMA 1MENA 3WL5A 1QCCA 1JKRC 2FW6A 3NGXA 4IO0A 3M4OJ 1L7PA 1JQLB 3WIOA 4YBZA 3DOEA 2IW3A 4TL6A 4KX5A 1TMKA 5FDFA 1Q19A 2C92A 2CUKA 1EE1A 3M0EA 2I1LA 1F14A 1V5WA 1RVV1 1LGYA 3LKBA 5EDNA 2BF7A 2HDHA 3I09A 4OJNA 5D5QA 4C6SA 5I7EA 2B3TA 1GQQA 1R12A 2IU4A 1ODSA 3ENNA 4R69A 3STYA 1SFOJ 1P5HA 2QG4A 4Y6GB 2CE2X 2JGAA 4UU0A 1WIWA 3D0QA 4K28A 4NCBA 1FSFA 2E7XA 5F1JA 3F7OA 4ND5A 3QRFF 2X6XA 4FC7A 4AC0A 1C7EA 1BHJA 2GUWA 2I6SA 1U6IA 2PWYA 2QSGX 2VSNA 4Q66C 1P0IA 2OQVA 1SOVA 2VWPA 1MO4A 3H3JA 3G17A 1O0SA 1UXHA 1LDJA 3VYUB 3AFGA 3C6YA 4J2TA 5JJCA 5KC8A 4J7UA 5F3WB 1GOTA 3ZVNA 4J9UE 1JDUA 3AI2A 4ASUD 4YAKA 2YR0A 1PFKA 4N3GA 2DBRA 3IPAA 1U28A 3LCJA 2O61A 3LSPA 3OJ0A 4IF6A 4BO2A 4PGFA 3QU6A 1AT1A 3F8FA 2PQMA 4NZOA 3ASOH 1M8JA 2LWIA 1GNSA 3IRUA 4RKYA 1PLKA 4M0KA 1ORIA 4L5IA 3JAMZ 4M3DA 1C2TA 2CNLA 1M76A 4XLNF 1D0ZA 3A9CA 2GOMA 2IDMA 1Y8CA 1G7RA 3G6KA 3O93A 3PUKA 1GO2A 5HA5A 1I1QB 1GRQA 1JV2B 3K0EA 4UUTA 1QSGA 5L4LA 4UNSA 3DKXA 1O2DA 2JFBA 4RXTA 3QK7A 5HIAA 4N9WA 4PQFA 3F9CA 4WA7A 2AXPA 3L5OA 3N76A 4KDEA 2FX0A 1TK2A 2JJ2D 3QIVA 1VHDA 4GX5A 4GAEA 2AYZA 1JTEA 3P19A 2BVMA 1WZEA 4CCOA 1NIJA 1ZHHA 1M2FA 1PIWA 2XDYA 3GCGA 1ZSYA 3PGVA 2Q7OE 3W7BA 4IDBA 2OLJA 4AULA 1HE4A 3WU1B 3M5DA 4DG5A 4B3MB 3PR3A 2UZAA 2WUDA 5K8IA 1LA2A 2H4FA 4OJKA 1KVQA 2CZGA 2EC5A 1RYFA 3OWTA 1KU3A 1WW2A 2HNBA 1WTCA 3BOSA 2H4ZA 3EZGA 2HWXA 2P2LA 1ZX1A 2PRSA 3ZHZA 4C2TA 3CE9A 3EETA 2HHJA 2Q9CA 5FLYA 4I1PA 1YITI 1XA4A 1QIGA 1FTNA 4ZI5A 5E17F 4K7JA 7GPBA 2VP9A 3GFRA 5FNVA 2L9SA 5IFKA 4IOCF 1ESNA 4YI5A 2GLTA 1PD0A 3IODA 4OBEA 1R6DA 3MRSA 5C8ZA 2OV2A 2GASA 3DZFA 4FKZA 5FUVA 5A9SB 1REPC 2ZRPA 4ZDOA 4JY7A 1XZCA 2H6BA 3AVYA 5TQ0B 1RS0A 5I47A 3ZMTA 4JLKA 1VE7A 2CQXA 4GOOD 5FCDA 1HKQA 4U0VA 3PNQA 3EASA 2JFWA 3TGPA 4WNYA 5FQNA 2XYHA 1R0ZA 3GOQA 1XF9A 3JALA 3UK6A 4PC6A 2LDBA 4WAUA 1SXPA 1H22A 1VHQA 3C24A 3FNRA 1Q17A 3NO4A 4BRSA 4PBTA 1ZA1A 3TM4A 2G8NA 2REQA 4WXCA 2ZRCA 4E4YA 3HVRA 2W58A 3DO5A 1E94E 2WFAA 4DCMA 4QJ3A 1ZNYA 5ER6A 1KFBB 1WKCA 3HSRA 1O89A 2EIJH 3CCLI 2N75A 5LQMA 3AG1H 3S44A 4AYTA 2EGGA 1NFFA 1U1FA 1J8QA 1NGSA 1OWOA 3UXHA 4OFBA 1TQDA 3VHXB 2DK5A 1QH8A 1R8SA 3FXUA 2V74B 5FR2A 4HPXB 9ANTA 3V33A 2PGIA 1UBJS 3IAFA 3RYHB 1NVVQ 2VP3A 1EWQA 3P0FA 1B26A 1X2EA 4G56A 4HAZA 4QU8A 4EMUA 3FOFC 3ANMA 1G9SA 2Z4TA 4D2IA 2ZDGA 3TNYA 1V37A 2BY2A 4W5TA 5JHUA 3KP2A 1EDZA 1VCOA 2VDUE 3KEFA 1GPKA 3DFIA 3EA0A 3VPAA 3V8BA 2PX2A 5BY2A 2A0UA 1JUDA 1CUSA 2VUHB 1Z7LA 2LG4A 4FTWA 3E8SA 4RY0A 5K8CA 2HXIA 3JTHA 4BNXA 1WB9A 1X1EA 2BR4A 4IIXA 2VHJA 4RTPA 1PUEE 2Y69H 1XHLA 3LY5A 3NYRA 1XXHA 1T13A 3C3YA 3KWJA 4XWOA 2KE5A 1AXRA 4RMIA 2YYZA 1HGXA 2A0YA 2E4YA 1V26A 5D4SA 2OCIA 1V5GA 5JDCA 2HBQA 1PP4A 2H6CA 4DWOA 3KALA 2Y1WA 3PD0A 4RF2A 1MQAA 1I7DA 2QAIA 3DEJA 4NMHA 2VWHA 4UXIA 3R0ZA 5FHQA 2VHXA 3SNHA 2XQJA 1RR7A 3X0DA 5K20A 1QV9A 2JHFA 2IY8A 4I55F 4YNBA 2PWBA 4OAQA 5LUBA 3EEFA 3HCBA 4ENRA 3I01A 4D0SA 5JAOA 1U9IC 3CCUI 1N4DA 3BMXA 3EISA 3JY6A 3OOWA 3DMTC 4X5OA 4C5CA 5DCMB 3UN1A 4BNIA 4CCAA 1FSHA 3MILA 1Z0JA 2Q29A 3NEJA 5JZOA 1CULC 3THYB 1DCTA 5IT9Z 4XOUA 1M6EX 3K15A 1LBHA 4HDQB 1NVDA 3FJYA 4PSAA 1EVEA 1WQ4A 1YSCA 2FE3A 1MH4A 1VPLA 2RIPA 2E1OA 3CJQA 4FC6A 2A0FA 4NWIA 1E0AA 3AFIA 3L4EA 1QQ5A 1YUNA 3I59A 4MV9A 4Q19A 1RZRA 1W7PB 5EJ8A 3CCVI 2G28A 3B9QA 2B8WA 1SHUX 2K02A 3JATB 4GPIB 4ILKA 1SUSA 1TFRA 4QSHA 5E2BA 5GV8A 4W5RA 3LNCA 4OGLA 4BMPB 1UC8A 4P82A 1TK9A 3URKA 3LLUA 4B84A 1NQUA 3VR3A 4RKRA 1XE3A 5C7LO 3I9V6 1ZCZA 4YASA 2H1LA 2YW9A 3IUEA 1GAQA 4PSCA 4RBNA 5BR1A 3NDIA 5CDSA 1M0EA 4ER6A 3JRDA 3WQRA 1BOBA 2C1ZA 2FA9A 3PUZA 3OYMA 1H6BA 1MU0A 4EGJA 2CG4A 3QWLA 2RC5A 1YRWA 3LF1A 4G8JA 3G89A 4R8SA 2O7SA 2Z6VA 2C59A 4Q47A 4IEJA 1PR4A 1POWA 5IJXA 3HGYA 1NXXA 1VL5A 2ZQ5A 3GJ4A 4WF2A 2DMPA 4W6QA 2HF7A 3MQ4A 1G64A 1L8LA 3I9NA 3NRBA 4U63A 1AA6A 1VKRA 4N82A 3O38A 4AKHA 3CLVA 1U8CB 2QZZA 3PQFA 2JHCA 1JJ8C 1SFUA 2FZGA 3QVUA 4N18A 4QGBA 1F3LA 1RCFA 1CR1A 4GSKA 5F76A 1W19A 3WZLA 2ZBDA 2ONCA 3I9V2 3QENA 4MRMA 1QGPA 1S2IA 2O2ZA 2EAUA 5E1XA 1V8FA 2JUGA 1WY5A 2X3FA 3GLTA 5AW6A 3EYYA 1HDPA 1OUMA 1Y5LA 3RUCA 2WM2A 5D1HA 3OE1A 1UJ5A 3C6KA 2C2BA 2IZ1A 1THTA 1UK9A 1KBQA 3LQYA 3OR2C 3N3AC 5GTIC 4KRFA 2JSCA 2J3IA 1U3TA 3SM9A 3ZTTA 4YCNA 3EDPA 3K0FA 1TA9A 3VNQA 3BC8A 3ESAA 1XHFA 1B23P 4LZJA 3JZFA 4Z1MA 4IZZA 2JFNA 5CUQA 2P8TA 4WX9A 1XTAA 1QGZA 1SHLA 4X1OA 2A67A 4EO7A 4PYKA 1JDBC 2QE7A 3CV3A 4JLUA 4ZK6A 2RDPA 3I04A 1QO7A 3QE0A 1KK2A 5AK4A 3O6BB 3KPHA 1ZIDA 3NDRA 1POXA 1PN3A 2VFAA 1Q1VA 5EIBC 5TC4A 4F4IA 2JFFA 2OBNA 1SY7A 3FBGA 2XI4A 1PTKA 3MINA 4TL8A 5FTJA 3TQFA 3DVAA 3LCCA 4NSNA 2CXNA 1WCMJ 2Q62A 1P0FA 3FIUA 1A7JA 1OHHD 1OT5A 2PX0A 4MA5A 1PQWA 4S2EA 4F8JA 5E7MA 1PZXA 5DM6F 1TQ6A 4CZCA 2LCIA 2I10A 5JE8A 3AZQA 2PJUA 2SBTA 3GEBA 2DQLA 3KKNA 3P5SA 1GV5A 3I8SA 1VHTA 4OK3A 4DCSA 4M3BA 3Q9NA 3HPHA 2RGXA 4FQ8A 5IHXA 4DCUA 5C52B 3FXMA 1JKXA 2GXUA 5E9WA 1E2MA 3IUNA 4LV8B 1V11B 2QTTA 3CJTA 4NX2A 5EQFA 3ROTA 3TH5A 3HUGA 1RMYA 1OWNA 2QQ0A 5FAXA 4ZDWA 4IDPA 2ZWOA 1ESZA 3F8NA 3H9BA 1K8QA 1N6IA 4I1RA 4ROTA 5AK6A 3ZJ4A 4HVCA 2XRLA 5HXAA 1Z2CA 2WV7A 3FVVA 1ZUIA 3GLKA 4V3CA 1KQFA 4JH0A 1VMKA 1ZITA 4HX4A 1YO5C 1RVDA 5EJ2A 3G1UA 1TTQB 3AIKA 5TR9A 3T7SA 1M6NA 1TQMA 1ZBQA 2H2HA 4LSGA 3EK2A 2B4QA 4BWVA 2A5WA 3GW8A 1WXIA 3S99A 1OASA 1QV7A 4EG8A 4IFBA 2M1BA 2DE0X 2PZAA 1TWCJ 3IS3A 5DYGA 5HE8A 3IH2A 2A9PA 2VPWA 2AH5A 2YSRA 1W2GA 2GESA 3GDHA 2JLVA 2FZKA 3TL2A 3TDKA 2NSHA 4C1BA 4ENNA 1XS9A 2CDCA 1Q3TA 2IBSA 4IHVA 2EKDA 1GY8A 4O4HB 5AR1A 5EIFA 1WKMA 4G1EB 3AEUA 2CXTA 2WLTA 4JGIA 1FJLA 1JXSA 2PZJA 4KMUX 1GCAA 2Q5LA 1CY1A 1OX6A 3WMFA 4B4VA 4FP9A 4FCWA 3WFIA 4W5HA 5ECYA 1FF9A 2CW7A 1R6XA 4FYWA 2WAOA 4QPPA 2J9YB 4R05A 4CT4B 4DSNA 5ABPA 2I91A 3CG4A 2FWAA 3FUWA 3HP1A 2G88A 3WO0A 2ZRMA 3QWIA 1YKSA 4RV5A 4GL2A 4L18B 2WTXA 4M36A 3HTSB 3JQCA 1Z2DA 4KQEA 1MB0A 2VA8A 2H2WA 4G1UC 3HVKA 2CLDX 5AWFC 2Z3WA 3WP1B 4E3WA 1B1BA 3RUHA 1QPIA 2O0MA 3LLMA 3PGXA 3C8ZA 4EKIA 3UYLA 4FFBA 2HTFA 3HKBB 2PG4A 3LCUA 2ZUUA 2V9VA 3FX2A 3FR7A 1AO0A 5FULA 3UOGA 1J75A 4EARA 5I7RA 2B5WA 5SYAA 4QG3A 4IDCA 4QATA 3VPDA 5F33A 3WWDA 4U88A 3OZWA 4HFNA 5SICE 2JH3A 3RQSA 4CKEB 1GPBA 3X1WA 4D9KA 4LCBA 1NL3A 4HV6A 3DBLA 6ADHA 3O8OA 3SR3A 1UKCA 3GEPA 3RROA 2DT8A 2QGUA 3TBIA 2B8TA 2K9SA 3U44B 3QQ5A 4M1YA 3TQHA 2B21A 3B60A 2XQIA 2QNBA 4NCIA 3SXPA 4DA7A 4PAQA 5FTNA 1WTAA 1B72A 3V80A 1T2KA 5GPBA 3UW1A 2VP2A 3RAEC 4UBIA 3BY6A 2STTA 3GWGA 4A0FA 4WXYB 5KBYA 1CUVA 1JJVA 3D1VA 3ROXA 3TZCA 2PRIA 1S4QA 2A07F 3KR0A 2E5ZA 4ZOLB 2IS6A 1PT7A 3NTXA 3RS0A 3L93A 2FFBA 2ZBFA 4J0IA 4K40A 1IN7A 3FKJA 1XEWX 4J7XA 1P3JA 1UK7A 3DSRA 2C4HA 2J6CA 2QQ8A 3UAYA 3EH1A 4JBNA 4TKUA 4KO1S 1P0CA 3P2MA 4L8FA 3RS3A 3EQ7A 3W5BA 4QM7A 1N6NA 4RGVA 4OAOA 1LPAB 1NVFA 4DNXA 5AVVA 1CJKC 3W5AA 3IX7A 2KP6A 1LSUA 1C3XA 2OPHA 4YAUA 4JITA 4RZQA 3OPYA 5CCDA 2GBCA 3DEZA 2ACEA 2VBGA 5DH9A 4M1SA 3W8DA 2JAXA 4NMLA 4MYHA 5I51A 4DUZB 3DFUA 3N8HA 4WFIA 2DMQA 5ALNA 4X65B 2A9FA 4ZZ2A 4FWTA 5CB4A 1E77A 1Q0TA 5L3QA 5K9ZA 1RP7A 5LCXA 3KEYA 4R71A 1QCZA 2FF7A 4RHFA 3VSDA 2X8LA 3CSDA 1RRGA 4LCEA 1VSBA 2JIQA 1E0JA 3AYXB 4E7ZA 2PGNA 2VPRA 4KXLA 3TD9A