3HC7A

Crystal structure of lysin b from mycobacteriophage d29
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
b'SKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMWPSVEKGVAELILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHILPPTGRLHRFLHRLKKVIFWGNPMRQKGFAHSDEWIHPVAAPDTLGILEDRLENLEQYGFEVRDYAHDGDMYASIKEDDLHEYEVAIGRIVMKASGFIGGRDSVVAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPHLYNRYPAVEFLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 12 protein
publication title Mycobacteriophage Lysin B is a novel mycolylarabinogalactan esterase
pubmed doi rcsb
source organism Mycobacterium phage d29
molecule tags Cell adhesion
total genus 90
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1120 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hc7A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hc7A01
5LP1A 3T4UA 4B6GA 5AI6A 4UHDA 4UBNA 1SOMA 2ZVDA 4UHBA 3F97A 3N0TA 1R88A 1ZICA 5CH8A 4DLNA 4KE6A 5JAOA 2IITA 3R3ZA 5JATA 1QTIA 1BN7A 4DYHA 1SCKA 4RNCA 1E3QA 5JADA 1XZEA 5AM0A 1RYYA 1QJ4A 4S0XA 3AJAA 3FYUA 4X6YA 2FJ0A 4HVTA 1R50A 3FAKA 1FFAA 1VE6A 3M83A 4K5QA 5ALTA 2HA2A 3WK6A 4MJ3A 2HFKA 4IH9A 4N5IX 5BV7A 1PV1A 1LPSA 1GPKA 4EY7A 2AJCA 5JZ9A 1OCEA 4W9RA 3DEAA 5LLSA 1HL7A 1VLQA 3DDUA 4BYMA 3GELA 5BWBA 2GBIA 3CN9A 4KYVA 3A2LA 1OXMA 1DX4A 5LKRA 4G4GA 4OPMA 1DWOA 2ONCA 5A7FA 1XRRA 2WJ6A 2CBGA 1RWQA 2BKLA 3FBWA 4GI1A 4AMZA 5D7BA 4UHHA 3SWWA 5HF9A 4BRSA 4KEAA 4U2DA 3WL6A 1YAJA 1EDEA 2EDAA 1CV2A 2QT9A 3I6ZA 4W63A 4OU4A 1EX9A 5FLKA 5D3ZA 4U2FA 3E1GA 5JALA 1JFRA 2IIVA 2O7VA 4J0CA 1CFJA 1JT2A 1FSSA 1E8DA 3WYNA 3EQ7A 3R41A 4L72A 4BATA 2BUAA 4C01A 3I2FA 1XRPA 4H18A 1DINA 4U2GA 5E4JA 1VE7A 4XWGA 2ECFA 1FFEA 4H7IA 5KWIA 1MNAA 1VOTA 1CUYA 3JW8A 1EH5A 1GKKA 4WJLA 4P93A 1UK9A 2XMCA 1IZ8A 1MX5A 3OG9A 1T4MA 2XMZA 2XQGA 2JF0A 2WFMA 4QE3A 1UOOA 3SC2A 3ESCA 4GW3A 5AI0A 3STTA 4H7FA 1XZLA 2DCMA 2QKYA 1ZGBA 2HA4A 4BAGA 2JGJA 1W6RA 1MO2A 4G4JA 4U2BA 1KU6A 1ODSA 4C88A 4CI9A 3FWHA 3WKBA 5F4ZA 3IULA 1N5RA 1EXWA 2XQKA 3CN7A 3OOSA 3W05A 1QIFA 2OAEA 3F9CA 4Z49A 5CT9A 1CR6A 2QUAA 5AK5A 1QE3A 1NX9A 1QONA 1KU0A 4HS9A 3WK4A 1P0MA 2K2QB 4EBBA 1QLWA 3A6ZA 2C5GA 4UFPA 3ANTA 4O08A 5AKYA 1A8QA 1W75A 1K4YA 2PM8A 2V9ZA 4MQMA 3UUFA 3AZOA 4Y2VA 1YS2X 3C6YA 4Y9SA 5DTIA 2WSLA 4QDUA 2OG1A 2QVBA 3OURA 5HF8A 2X76A 3ZPXA 4ETWA 4EY4A 5FP0A 1QO9A 2QOEA 5AM2A 3G8YA 5FPPA 3EF3A 1J07A 4G8DA 3G0CA 1W4LA 4QLAA 5CT6A 5DYTA 3R0VA 1JJIA 2WHPA 2BGRA 1CUIA 1O6GA 3QYJA 2ACKA 2PU5A 4MWSA 3TRDA 4B9EA 2XUAA 3H2JA 1ZD2P 3BIXA 5EHQA 2I3DA 5AHXA 3W06A 3H2KA 4I4CA 2PX6A 1LPNA 4M0EA 2WLSA 1SC9A 3ZWQA 4QDOA 3DCNA 4W1SA 3SK0A 1HDEA 1XRNA 3O9VA 4J0GA 4DNFA 2HU5A 3I1YA 2B20A 2H7CA 4JYMA 4QEKA 3G9UA 3RARA 4Y7DA 1LLFA 4CG2A 1K63A 2X5XA 2G63A 3QPCA 2V97A 4P9NA 3STVA 3IA2A 1F6WA 2HA6A 4OB7A 4P08A 1AQLA 3W2TA 4NMWA 5EGNA 3ZV7A 2W6CX 2P8SA 3RKSA 2DQZA 2V96A 4UPDA 1ISPA 3LS2A 5HF5A 1VA5A 1MN6A 4AZ3A 4H77A 4AN1A 4FMPA 4FDMA 4LIPD 2J4CA 4PSUA 3PFBA 5EIHA 4ZXFA 2VQ6A 3R3YA 2ORYA 3HSSA 2Z8ZA 1YB6A 4CIBA 1MX1A 4EZIA 5LYYA 3KXPA 1WPRA 1JMKC 3DOIA 3F8SA 3WIBA 1F8UA 1XRQA 3WIOA 5ALLA 5I9IA 1E8NA 1ZD4A 3FYUC 1QIJA 1G42A 1ZGCA 3PFCA 1DWQA 4H7JA 2WHPB 4BTVA 5ALRA 3QVMA 4UFOA 3HJUA 5FV4A 3M82A 2RONA 1M33A 1CUFA 1IUOA 1CRLA 3E3AA 2HADA 3K6KA 5HCUA 4PSDA 4WY5A 4Y2UA 1MAAA 4C4XA 2PSEA 1GPNA 2VEOA 3AINA 4ZGBA 1FJ2A 4QWWA 1PJAA 1Q0ZA 3LCRA 4M0FA 5AM4A 1QIKA 3HEAA 5HK8A 3LLCA 1IUPA 2XMGA 5JZSA 4HZGA 3DKKA 4YPVA 2OPHA 2YH2A 1BCSA 2WILA 4Q34A 1ZIXA 1YR2A 3OTQA 3BF7A 2I3ZA 2ZYRA 4J7AA 1CLEA 1CQWA 4EY5A 1JJBA 2J3QA 3WK5A 2JGIA 1W76A 4X71A 4XX1A 1TKRA 4KACA 3BE8A 1QGED 5JD4A 5JASA 4A16A 1CUAA 3O4HA 5AIAA 5K5EA 4B9AA 1WOMA 4FLFA 4NS4A 1D07A 4Q82A 2JIDA 4KR0A 2BGNA 5ALOA 2R11A 5A7HA 3STWA 4GDMA 5LZ4A 1IZ7A 4FFWA 3EQ8A 1XZBA 4U2EA 1TK3A 2BCEA 1GZ7A 3IUJA 2ZSHA 2XI4A 4Y2TA 2C58A 2Z3WA 4IH1A 2ACEA 3WJ1A 3MGAA 4BDSA 1AURA 2DSNA 3DYVA 1XRLA 3FOBA 3O4JA 2QS9A 1H2XA 3BJRA 4OU5A 3ZLTA 3B5EA 1CUVA 1UWCA 5AKJA 1MNQA 2XMDA 1THGA 1Y7HA 3WYDA 4MWTA 1DTEA 4ZV9A 4GHWA 5CBKA 3QPAA 4AO6A 3QMVA 2B61A 5DNUA 1E66A 1QTRA 3C45A 3N2ZB 1FFCA 2YXPX 4RPCA 2WJ3A 5EIAA 4QDZA 2OCIA 1EI9A 4FHZA 3KDAA 4WY8A 4KJXA 4X97A 1JI3A 2WQZA 1UXOA 5A2GA 4BP8A 4BB0A 5DTJA 4AB1A 1XZDA 3UUEA 1EK1A 4X93A 3E0XA 3LIPA 2FUKA 2QR5A 2WUFA 1CUUA 4H0CA 4PW0A 4ZV7A 2W22A 5HKBA 1N8SA 4HRYA 3V9AA 4X00A 5ALWA 2QJRA 3ED1A 3ZLUA 2IX9A 2X8BA 5ALJA 2HRRA 3V1NA 3O95A 4DSAA 3O4GA 4BVLA 3W9UA 3ICVA 1DX6A 1QIHA 3ESAA 3IBTA 5JIBA 3I2KA 1TCAA 1XROA 1U8EA 1O6FA 3STYA 5ALYA 3GUUA 3QMMA 5D3KA 4UUQA 1EINA 5FPQA 1YCDA 2ZYIA 3I28A 4ZI5A 2O2HA 1CUJA 3DLTA 3IDAA 4FFVA 1LGYA 1IVYA 5J3JA 2XT0A 5AKHA 5LZ7A 5AO9A 3ESBA 1GPLA 2PUJA 4LHEA 1W1IA 1BCRA 1UOQA 1XLUA 3A2MA 3O4IA 4X92A 4H35A 3TGLA 4K6GA 4DMKA 2FX5A 5E4YA 3H2GA 4KRYA 4H7EA 1UZAA 3DNMA 4UBLA 2DHEA 3S2ZA 1NU6A 4AQDA 3AILA 3WL5A 2WIGA 4FNGA 1EK2A 4EUSA 2WIFA 2O7RA 5AM1A 3OPMA 3WK7A 2OCGA 3WWPA 3WWOA 2LIPA 4EHBA 4J0DA 3CCCA 2G5TA 1LBTA 3EBLA 5HZGA 2DR0A 3WK8A 2HDWA 1UKBA 4BZZA 4HAIA 4L0CA 5ALXA 4BTLA 2PBLA 5IVDA 1G66A 4UBMA 3C5VA 4MXDA 5EFZA 3PDCA 3BDIA 1S8OA 1UOPA 1WCYA 1T2NA 1XLVA 2XLBA 4WFKA 5CTAA 5DNVA 5D6OA 3PE6A 1GT6A 1I6WA 4Y2RA 3HABA 4IHAA 4QWMA 4DIUA 4C87A 3C8HA 4FLEA 4GBGA 3X3HA 1WHSA 2CJPA 1XZMA 1DT3A 4BE9A 4XJVA 5ALIA 5SYMA 4QNNA 5DWDA 5DYWA 1Z68A 1JMYA 5KWJA 5K3CA 1A8SA 3BIWA 4G9GA 1HPLA 4BE4A 2VTVA 1WB6A 4Q3KA 5FUMA 4OSEA 4CCWA 4QZVA 3WL8A 4E46A 3UMJA 5AJHA 3FVTA 3R40A 3WKAA 4PSCA 1VXOA 4TVKA 4IH4A 3U1TA 2JGEA 2WFLB 1TCCA 2WIDA 1HLGA 3FCYA 5AM5A 1XZGA 1OILA 1VZ2A 5ESRA 4FTWA 4FLMA 4BC0A 3IB3A 3I2GA 2H1IA 2O2GA 2VT6A 1ZD5A 4E11A 4F21A 3NUZA 2OQVA 2OAGA 2QJWA 4XIIA 2WUEA 4UHFA 4BCBA 4H7DA 5FKJA 2CZQA 4JYPA 5AK4A 3DL4A 7YASA 4BCDA 4A23A 1P0PA 3VJMA 1UK7A 3DOHA 1J1IA 4AXBA 1VKHA 2WUGA 5AKEA 3V1KA 4NZZA 3H19A 3IIIA 4N5HX 3HXKA 5K3FB 1YASA 3STXA 1ACLA 4N8EA 2GYWA 5AIBA 3I6YA 4FBLA 2XMRA 4KAJA 2PSJA 3QZUA 2Z8XA 2JEYA 5C81A 2C4HA 1UK6A 3D7RA 1ZJ4A 2QXTA 1HKHA 3FCXA 3G0GA 4G8BA 1EB9A 1J06A 5AKXA 4C4ZA 4P92A 4N8DA 3WKEA 4OYYA 3FVRA 3QH4A 2OCKA 4OB6A 4PNZA 1ZI6A 1AC5A 3D5EA 2PPLA 3NWOA 3ZI7A 4Q1VA 5JD6A 3KOOA 5AKKA 3H17A 5ALNA 1UFOA 5DLPA 3VVLA 5ISMA 3WA7A 1WB4A 5IVIA 5DYYA 5CXXA 2HRQA 4YK7A 1HBJA 2AJBA 3H2IA 4E14A 3AZQA 2JGKA 2FJPA 5ALDA 1XKLA 3NOXA 2C5FA 4Y2YA 1ZJ5A 4G1FA 4Y2PA 4B80A 5AI5A 4INZA 5ALKA 1L7AA 3WA6A 1C7IA 2DHCA 3BJMA 1QIEA 4K2AA 2HA3A 1R3DA 2PKYX 2H7XA 1LZKA 4RE6A 3STUA 3CXUA 1G5FA 4N8SA 4BDTA 1BEZA 5AP9A 3FNBA 1JKMA 2HU8A 1BRTA 2JBWA 4LXHA 4ARAA 3FLBA 2XUOA 3AZPA 1XFDA 4JEIA 2XMBA 5FOQA 1CUXA 4GEGA 4H7KA 1DT5A 1UT6A 5BOVA 4RE5A 3L1IA 1VZ3A 2BFNA 1BN6A 5AOBA 4PO3X 5JAHA 5C8XA 4CCYB 3L1HA 2BAGA 4J3JA 3WI7A 1XZAA 1DWPA 1XKTA 2DQYA 5ALHA 4MYSA 1EB8A 3ANSA 1U65A 5E2IA 4BCCA 1RP1A 3L1JA 5JAUA 1E5TA 3WK9A 5JAPA 1XQWA 1GKLA 4KRXA 4X90A 5K3EA 5C7YA 2AXEA 5FDFA 2JGMA 2ZYSA 4YASA 3C6XA 1R9MA 3PICA 3P2MA 2CKMA 3DD5A 1F0PA 4B0PA 2WG0A 3AIKA 3QITA 2HL6A 1LZLA 2XUIA 1ODCA 3HLKA 4PF1A 2WIJA 1FFDA 3BF8A 5HFNA 3BL8A 4BVJA 3C6ZA 4HXEB 5HKAA 2PUHA 4B82A 4AMYA 3WJ2A 3DS8A 1A7UA 1DQYA 2VAXA 4G4IA 5CMLA 2VF2A 1MTZA 4DMFA 4MEAA 1TIBA 3HRHA 3KWFA 3H2HA 1UKAA 4MEBA 4A5SA 4B84A 4DNOA 5LZ5A 2VJCA 4DNQA 5JD5A 3M81A 5T4EA 4LKOA 4KE8A 3W04A 3TJMA 1EDDA 2H9YA 2V98A 5HQ3B 1AGYA 4BC1A 3WLAA 3C87A 1ORWA 5C8ZA 4B85A 4UBIA 3VJKA 4JNCA 2WU3A 2WKWA 2ZJ7A 2XUKA 5LKAA 4G5XA 4IQ4A 3VISA 3RK4A 4DNPA 4C89A 4OYLA 1F0NA 2CMFA 2WTNA 4Y2QA 4GECA 3PF9A 2RHWA 5JARA 4J0IA 1LNSA 3A70A 2E3JA 3T52A 1IUNA 2WJ4A 4QDXA 3R3VA 1VA4A 3KSRA 4L9AA 1QIMA 2XMSA 3B3QA 4ZWNA 2C7BA 2VSQA 3G9XA 1VXRA 4JH0A 4X91A 1MPXA 5LZ8A 1XQYA 5AOAA 1L7QA 2B4KA 3K9BA 4EY8A 3D59A 3QMWA 5ALZA 2PSFA 1LPPA 3RM3A 3WZMA 1SCIA 4LXGA 2H7YA 3C8DA 4X6UA 4Y2JA 2XQFA 5CH3A 4AZ0A 2OGZA 3ICWA 4GLBA 1JJFA 4F60A 4MYDA 4UBOA 5C8VA 2RHTA 4QA9A 5DNWA 3G9TA 2GBCA 1XQVA 4L3WA 2VJDA 5T4FA 4B7ZA 4U2CA 1LPBB 2QMQA 1QO7A 2Y6UA 2VJBA 5IH7A 1GQRA 2XUJA 1CQZA 3MVEA 1CUHA 3VJLA 1BU8A 4FNMA 3ESDA 5LIPA 2HIHA 3GZJA 5HFAA 5IVHA 4DSZA 5KREA 1AKNA 3PI6A 2XQJA 3I2IA 1WHTA 4C6HA 1ZD3A 1H2WA 2GBGA 5ALFA 1WB5A 2RAUA 3VKFA 3V48A 4BVKA 5ALSA 1BEEA 5AK6A 5CT4A 2Y6VA 4HTAA 1QOZA 4HXFB 3H04A 4KE7A 2GYVA 4X7BA 3WKDA 1DQZA 1C7JA 2WFLA 4B83A 3GBSA 5A6VA 3FLAA 2QRUA 2G4LA 1P0QA 4G9EA 3W9BA 3I6MA 1Q84A 4QLOA 1XZIA 2XLCA 1UKCA 1P0IA 3Q8WA 3YASA 3WZLA 2VATA 1N5MA 5ALEA 4X3CA 3F98A 1BE0A 5CW2A 2HA0A 4DGQA 1JU3A 5AM3A 1H22A 3TEJA 2ZSIA 5BWCA 1TQHA 4UBKA 4WFIA 2VAVA 1AUOA 5JYCA 2XUGA 2Z5GA 4TGLA 3EQ9A 3NGMA 1CEXA 1K6EA 4J0KA 1Y7IA 3KD2A 1NU8A 3WKCA 1G4HA 2GYUA 2YYSA 2WFZA 1AX9A 4K6HA 1XLWA 3EIOA 2Y2UA 3JYHA 2OCLA 4BRZA 3AIOA 1EHYA 2DHDA 4B81A 5FXMA 5CRIA 5K3FA 4BAUA 2HU7A 4TPKA 3F67A 1SCQA 3D2AA 4PV7A 1ACJA 1B6GA 4HXGA 4X85A 3C5WP 4ITVA 5A71A 3HZOA 4E15A 4CIAA 4CG3A 2EDCA 4ARBA 4V2IA 2UZ0A 2OXEA 3WQHA 1Y37A 3C70A 2CUTA 1CUSA 1K8QA 3BXPA 1FFBA 1H2YA 3OC0A 2XDWA 2WUDA 2D5LA 1H2ZA 3G7NA 3BWXA 4B0OA 1WPXA 4OD0A 1CUEA 4IO0A 5EIEA 3S8YA 5K3DA 1L7RA 3ZLVA 4FBMA 3F96A 2PSDA 3MUNA 5E4TA 1TAHA 2ROQA 4BZWA 1QFSA 1PFQA 4QDTA 4UFNA 1YB7A 5AKGA 1KEZA 3C6BA 1MU0A 5AKIA 5ALUA 5JANA 4WDQA 1XRMA 1ZOIA 6YASA 4X95A 1TRHA 2XB6A 3DYIA 1QFMA 2PU7A 2XUQA 5AKZA 4G8CA 5I8PA 3D2CA 3AFIA 5AI4A 1W52X 2QXUA 3FSGD 3FYTA 5ALQA 1CUCA 4FOLA 3GFFA 2RI6A 3FYUB 2EEPA 2C0QA 4KAAA 1LPOA 4AN0A 3D3NA 4UBJA 3O9MA 4Y2XA 2I03A 1H23A 5HF6A 1VJ5A 3GROA 2AJLI 3SX4A 2VA9A 1XZKA 2CEKA 3V1LA 1MAHA 4CCYA 2J4FA 1HQDA 1CPYA 4BAZA 1A8UA 3MUOA 4LXIA 3M3DA 1E89A 1XZCA 3H0CA 5A62A 4OUKX 2GZRA 5A7GA 4LYEA 3LIIA 2ZJFA 5LZ2A 4HRXA 2BJHA 4WDRA 3I1IA 1CUZA 3WMRA 3VVMA 2XMQA 1EVQA 2NW6A 5EHNA 4FWBA 4MQLA 5ALPA 1YA8A 3WL7A 4EB0A 3QM1A 1ZI9A 2DFPA 1QZ3A 1MX9A 1JU4A 4Y2SA 2JGFA 5AH0A 1CIJA 1R1DA 5T4BA 5AICA 5IKXA 2Q0XA 3IUMA 3HACA 3QBJA 4NVRA 3FLEA 3WWCA 4JUIA 3G0DA 1XZJA 2RIPA 2XUFA 2Y1KA 4BP9A 1ZI8A 1Q0RA 4K6KA 2BUCA 2XQIA 2BUBA 2WU4A 5HQ3A 2HM7A 1EDBA 3K2IA 5LZ9A 1Q83A 2GBFA 2ZJ6A 3VDXA 4GXNA 3G0BA 4J03A 5SYNA 1GGVA 4WCVA 1CVLA 4UHEA 1XZFA 4ZREA 1TCBA 3ILSA 4W1QA 4DTCA 4EA6A 1ORVA 1CUWA 3D4LA 2HA5A 3G9ZA 3R3WA 1GXSA 1X70A 3I2JA 1YAHA 3JWEA 4W1RA 3VXKA 5EHXA 2B9VA 4J0HA 3DJYA 4UHCA 4XVCA 4ROTA 1BS9A 4X6XA 2QTBA 2OGTA 5EHZA 3O0DA 1DU4A 5HK9A 4Q05A 2PSHA 4I19A 1LPMA 3HYSA 3WWDA 5CT8A 4PQEA 3V1MA 2C0PA 3D0KA 1A88A 1E8MA 2ES4A 2VT7A 3DKRA 5AK3A 3IUNA 5IVKA 2CB9A 1R9NA 3C43A 2Y2VA 5K3BA 4KE9A 1ODTC 5CURA 1EA5A 4KAFA 1IMJA 4C4YA 2QM0A 4RGYA 3KWJA 3IURA 4Q3OA 3G02A 4F0JA 4W1PA 5EI5A 5AI8A 3IVMA 2WM2A 1UK8A 1YSCA 2JEZA 4AO8A 5AI9A 5JZBA 4AO7A 2AJ8A 1THTA 3CCBA 4LYDA 5T4HA 1XZHA 4DMHA 3E4DA 3RLIA 2RGUA 2WIKA 3DQZA 1ETHA 1YA4A 2G5PA 1LPAB 1EVEA 3LP5A 1B41A 3IUQA 3U0VA 1AMNA 1N1MA 1ZIYA 5K3AA 5CXUA 2HFJA 2PL5A 3I2HA 5YASA 3B12A 3FSGA 2QZPA 2R8BA 2WG2A 3AIMA 3Q0TA 3A2NA 3G0IA 2PVSA 3R3XA 1SFRA 1QIGA 3D2BA 5I7UA 2O2IA 3BDVA 4GWLA 5CH5A 1QIDA 2HHAA 2XE4A 1LBSA 5CT5A 2WHRA 1U2EA 2OGSA 1CUGA 2WG1A 5AKLA 2WTMA 1BROA 3AUKA 1XQXA 2OQIA 4ZRDA 3H18A 2XUDA 1GQSA 1YS1X 5ALGA 5ALMA 2OLEA 4OCZA 4OB8A 4I3FA 4F5ZA 3R3UA 2QUBA 4Q3LA 2HA7A 2J3DA 4BBZA 4H7HA 3WWEA 3DL7A 1J2EA 4CG1A 3H1BA 1X2BA 4X94A 4FKBA 4CFSA 2Z3ZA 2JGLA 5ALVA 3PUHA 1QIIA 3PF8A 1MT3A 5FRDA 5AOCA 3HC7A 2AJDA 1C4XA 2VJAA 4DMCA 1WM1A 2WHQA 2XUHA 4AX4A 3H1AA 2D0DA 4WFJA 4YX9A 3GA7A 5DJ5A 4DM7A 3OM8A 4EY6A 2YASA 5KBYA 1U4NA 3HI4A 1AZWA 1MJ5A 1X2EA 4D9JA 1CUDA 2ZYHA 2XUPA 5H3HA 2GZSA 1K5PA 3PUIA 3QPDA 4J0JA 1R4ZA 2I78A 4M0MA 1USWA 1CUBA
chains in the Genus database with same CATH superfamily
5F5XA 3UJ8A 1RBZA 3F71A 3EDRA 1CB7A 3ZWAA 5A6SA 1CTQA 1DUIA 2XEXA 1T0FA 3PGLA 3OMXA 2Z9BA 2EF0A 3B20A 1VI0A 5IARA 4DVJA 1PVOA 4ZYDA 5KKNB 2CLCX 3ZQJA 1SVUA 2GSDA 3RTCA 4RCZA 4ARCA 1WSUA 3D0OA 5BPDA 3OFVA 4S05A 3ZQFA 1P5JA 1R0KA 3ELUA 5BWBA 4DIMA 1YQDA 2V7FA 3VR5A 4LISA 2AK2A 4EEFG 1BZYA 1BR4A 3VOAA 1G6Q1 4Y6GB 2G9RA 3ND7A 3PYXA 4HB0A 3RKRA 1GGFA 1MOSA 5D7BA 3FMQA 3EX7C 4CMGA 2AN9A 2ZNZA 2W58A 2XIJA 2G70A 3BMCB 5HF9A 1ECBA 3DO6A 1FJGB 2IZ1A 2I7DA 2EDAA 4Z4HA 2B8WA 2INGX 2IA2A 1HT3A 1NJ5A 2J3MA 2FY8A 1PRYA 4ZQFA 2DH6A 1YOVB 3I0MA 4J0CA 4XFKA 4MNUA 1F6BA 1EBUA 1H4QA 3E9NA 2D2VA 3BMXA 1YGPA 1J42A 2AK3A 3GRCA 4GLOA 2OBXA 4M9QA 4AKSA 1RE1A 4IDGA 5F9HA 3L8CA 5E8JA 4EBFA 1L6RA 1JG1A 4YJFB 3SF8A 2ZZMA 4KNYA 1SUFA 2ZU0C 2FA9A 5L9AA 3L7WA 4GRIA 2OGWA 5EHIA 3CEPB 4LZWA 4J1QA 3PL8A 3PHLA 2BTOA 2ADUA 4C88A 3PFWO 3IULA 3C98A 3DBIA 3IQGX 4KNWA 3I5AA 1CJBA 3CH7A 4NCIA 3UT6A 1ZSVA 5JJLA 4YA6A 2OE2A 3RC3A 3H9BA 1W88B 2J6CA 3B2EA 1L7EA 2DVMA 3WTSC 2V9ZA 3ZWNA 4Z8XA 1BSVA 1QPMA 3CRNA 1MQ9A 2JVKA 4ZJUA 2VNSA 2VQGA 4FT4A 3AR9A 1UZLA 2OV4A 2ZG6A 3P2JA 1FDIA 3GT7A 1JX6A 5FPPA 2HU9A 2O3FA 1FBNA 1G21E 4PQFA 5H02A 2C0CA 2YZMA 4FC6A 5EVJA 1CUIA 3QYJA 3EGWA 1EGQA 1WSDA 2PU5A 4JI4B 2VF5X 4YWHA 1ENHA 2YYZA 3H2JA 1AIPA 3CX3A 5B4VA 1MJGA 2QNBA 2ON6A 4A5OA 1FDVA 4QDOA 3F21A 3VPHA 3DOCA 4RDUA 4E7JA 3HA5A 3I92A 3NPAA 5C8YB 2JK1A 1U1EA 1RJWA 3E5QA 3SC2B 4MLCA 3HCOA 4QEKA 2VPYA 4CG2A 3FCEA 3TNJA 1T6NA 1I3KA 3BXZA 1FBTA 3ASYA 4P08A 5DGTA 3W2TA 5C0OE 4GPTA 3OZSA 1PFGA 4CV2A 3OU7A 5BYBA 4L1KA 1OI4A 2VL7A 3LQYA 1O96B 5ICEA 2FWJA 2V9CA 2RD2A 1UBCA 2DFLA 2NYRA 2ATEA 2PWBA 3PFBA 1F9AA 3KKQA 2VQ6A 2Z83A 4M89A 4JUFA 1E3TA 1H2BA 4L5JA 5FFXA 4H1WA 5CVDA 4MS3A 4E07A 2PD3A 1HLFA 3VO8A 1E8NA 3DQPA 2I8AA 3JZAA 5LWHA 1E1CA 1QIJA 3NWTA 3AHDA 1WD5A 4L2IB 3GLVA 2FLVA 2B2XA 3E22B 3HJAA 3HDQA 4P7GA 1QQBA 5TB5A 5J1UA 2EZ9A 4PBSA 3TTVA 1IUOA 3E3AA 2ZIFA 2B36A 4PSDA 3OZGA 3T61A 3O7WA 2PSEA 4YCNA 4I4TA 4TLEA 4RZSA 4QWWA 3ASVA 4S04A 2JHPA 4IQJA 3Q8XB 3T4XA 4RGXA 1BFUA 1EFKA 2FG6C 5JLXA 2HK8A 4XPIA 5BUZA 4XUDA 3AP1A 4HZGA 2V4MA 2PWYA 1XNGA 2A5LA 4MEXF 3OM0A 1UCFA 1K66A 4FTHA 4RULA 2I3ZA 3IP7A 1CQWA 4LWQA 2IL1A 4EX7A 4X71A 2JAQA 3BIJA 4I6GA 1TL8A 1ZMTA 3HPQA 2HO4A 3L0DA 4CCSA 1AQUA 4F8JA 4C04A 3LECA 3ABRB 2PA3A 3L40A 1E5DA 3BC8A 1Y8CA 5EJ8A 4I1YA 5LMUB 2YR0A 2XC7A 3N76A 4JS0A 3L5OA 2C7OA 2Z3WA 3K1PA 6REQB 2YUIA 2C9MA 3WTUC 3LUJA 1XRLA 2A3NA 1JGTA 3A1YA 1OAOA 2EC5A 2N46A 4KKVA 4BKUA 4NFSA 4TRJA 1Y7HA 4ZO8A 1SFOJ 2OXCA 4XTCS 1IK6A 2L2OA 1HFKA 4LJYA 3FBGA 1L8LA 3NMUF 4ENSA 2WHYA 2FW6A 2CJWA 5E3JA 3KQLA 4P9UA 2FZLA 3RC9A 2O59A 2COKA 2WQZA 1PNOA 4ZOLA 1D3YA 1GNQA 4Q4AA 2GJ9A 3KYCA 3LA3A 3V00A 1YR6A 1MJGM 2QR5A 3CSUA 4H0CA 4A6PA 1OFVA 1RYDA 2WAAA 1SMYF 2HSZA 3NETA 1HC8A 3ONDA 1JXSA 1A2OA 3ROXA 3K2QA 4MLZA 3FB4A 3HZJA 4KMMA 3CEAA 4K3VA 1DIRA 2OD5A 1DG3A 1OUMA 1MB3A 2JFVA 4BNKA 4I2OA 2DLNA 2EQAA 3L9XA 4IEFB 4NBVA 1QYDA 5CVCA 1VJGA 4O4JA 1HSTA 4S12A 2FR0A 1KDYA 3I28A 4OO3A 1SPBS 4FK8A 1CUJA 3DLTA 3MWFA 3HVRA 3IQFA 3TP0A 1JJAA 4X92A 4CU2A 1RR7A 3HCRA 1LS1A 2RKOA 2F9MA 4I5GA 5KQLA 2ZIXB 2GEJA 4UBLA 4DBLC 3JWHA 4IFBA 4BASA 4GX5A 2XDAA 3P4XA 4RV4A 2P6MA 1JLLA 3JYLA 1ZGGA 3QOXA 4EUSA 3SSMA 3PYLA 1CZRA 5J63A 7REQA 1E0KA 3F49S 5DNYB 1L5KA 3TTUA 2XOKA 3VYSB 3NRVA 3EBLA 3WK8A 4PLHA 1ZM7A 4LRXA 5IVDA 4O4IB 1OXBB 4P35A 1H88C 3L0OA 3NTVA 4LQDA 2XDYA 4DQXA 1W7PB 1U9IC 1MO4A 2ZUDA 2QJFA 5DYIA 2HXGA 2JG3A 1ZO8A 4JQFA 4NBKA 4F86A 1DG1G 2BY0A 2Z5UA 2XGCA 1GLGA 1PT7A 4XQ9A 3ICPA 1WHSA 2HK6A 5CYVA 2ZJYA 4UPEA 3MTJA 4HQKA 4RJLA 3OT4A 4B3BA 3JASA 4G9GA 1MA0A 4BE4A 1GNVA 1NNUA 3ZD9A 3BTSA 1CVRA 3RAGA 5DASA 1PUJA 2B6HA 2BEVA 1WSAA 2WMYA 2Q9AA 5DGDA 1K0UA 1COZA 2KT0A 4XIGS 1XPUA 3LUKA 1AUXA 2Y8EA 5D7NA 3T9FA 3VZCA 3OPYA 3S3NA 5FLXZ 1BJTA 5IAAA 2XXBA 3HU1A 2W2NA 1XS9A 3ZCXA 5LQUA 4YHBA 2CNWA 5BW6B 1U5BA 2NSDA 4QATA 2J5BA 3DOHA 2Z2XA 4KUMA 3SDSA 3JWGA 2IVZA 4M1KA 4PE5B 3WNVA 1XN4A 5JZOA 1EWYA 2AFIB 1MQAA 4TMKA 4HTFB 4NC7A 4ZOBA 4DRXA 3QP9A 1FRZA 2E48A 2BY3A 3A58B 3PNOA 4L7QA 3F3MA 1LFAA 1Y1RA 2BFOA 5B2FA 4A6XA 4BNZA 4TYWA 3F3SA 1PUEE 3BRCA 1FDWA 3IQWA 2NZ2A 5FHQA 3WS7A 1U9JA 4PNZA 2PY6A 2Q6OA 3KOOA 1GV0A 4RVGA 1EVKA 4YRGA 1W4RA 4GXOA 1YXMA 4D0PA 4RORA 1IOZA 3FIWA 2C5FA 4Y2YA 3GAFA 5AQ1A 3E0JB 2B78A 4YRMA 2Q0SA 1YJCA 3WHBA 2P5SA 1S7CA 2REBA 1WXFA 4UZEA 3GQBA 1JB9A 2HA3A 1LZKA 3BPXA 1L7DA 4BWYA 4TV9B 1IB0A 4Y1GA 4HDSA 2R5FA 1UANA 3KM0A 4FX0A 2QDKA 5M5XJ 1TKAA 5K7ZA 3F4BA 4G5QA 1BE8A 4G0QA 5AUPB 2C5AA 5LJIA 1OCPA 4KDEA 2QRGA 1IM5A 4EFKA 4M1WA 4M1EA 3LBHA 1Z4KA 1E5TA 3IDSA 3QKSA 1EWVA 3GJ6A 3KJGA 1XGKA 4NCAA 2PRSA 2GEFA 3ADCA 4DB2A 3QU9A 5D84A 2I87A 4GRAA 4LMAA 1F0PA 3OSUA 1S4QA 4TXMA 3AIKA 3RUAA 2XITA 2HL6A 4ZH4F 4FETA 3PWZA 1R4NA 2J5QA 4JU8A 3CV3A 1EFPA 3SYLA 2KL4A 3MBKA 3MSCA 4Q19A 3KO8A 2Y99A 4NENB 3QVOA 3GXOA 1AF7A 1QU3A 3KPVA 4G4IA 3RVRA 4ARVA 3HQ4O 5B5SA 2YNMD 4AICA 1TO2E 3VVBA 3U19A 2GIVA 4EL5A 4YAIA 3TJMA 3SSAA 1OLSB 1Q50A 2F1IA 3O92A 4L5BA 5LU9A 2I4MA 3WLAA 3KOZA 1K7AA 2D3TA 2WICA 1RESA 3TQHA 4OLFA 1N6NA 2WU3A 2I9KA 5LKAA 4OINF 2W2LA 2JKYA 3SFZA 4KGDA 1Z0DA 5AIQA 1M2OA 1SO8A 4M6VA 4MKGA 5EUCA 4YJHA 4PYOA 1B4AA 1V4VA 4KR9A 4JHXA 4AM3A 3QOWA 4RJKA 5JHUA 3ASNH 5EMHA 3UICA 5JJIA 1V55H 2PH3A 3LOCA 1L7QA 3GVCA 4C22A 2VDRB 5F3DA 4EKNB 2P7HA 3J81K 3DBRA 3HZRA 2IXDA 1I24A 1NLFA 1KY2A 5CH3A 3FPCA 2X2OA 4WXYB 2P1ZA 5DNWA 3K9TA 5MFPA 3P5JA 3ONFA 1MMFB 3VR3D 2HHJA 3GLQA 4WLEA 2K7ZA 1OCCH 1B6AA 1T4DA 5JBQA 1ZNXA 2ONYA 3TINA 2DBQA 3NCTA 2PRKA 1H05A 4KBYA 4LCJA 3IO5A 3PC8C 5GADl 3A37A 1XL0A 1Q14A 5LBIA 2QQEA 3ZY4A 1HE5A 4KN4X 4QT4A 2Z9OA 4RAQA 4HXFB 1SKQA 1ZH2A 3ULQB 5K8VA 3AQIA 5IYZF 4DDVA 3TB4A 3R7FA 3HVJA 4AZWA 1L0OC 3FISA 1T24A 3CW2A 2JIRA 4DV6B 3G2NA 3A6PC 4F04A 2W2KB 4CMEA 4R1SA 2O8XA 4MWZA 4DGQA 3OY9A 1YZFA 1KOJA 1YDEA 3WE7A 2PZKA 2Q3DA 3DT8A 3QBVA 2WY7Q 1K6EA 4YQEA 2PFBA 2ZT8A 4QBHA 5HOOA 4I0WB 2GYUA 5KTNA 4TKZA 3FSJX 4MHGA 2IOFA 3NLLA 1G8PA 3GCDA 3WXMA 1EHYA 2Q3BA 4WECA 4D57A 4BAUA 2LVSA 1QP0A 2NVYJ 4A8PA 2Z58A 4EI2A 4A3KJ 4X64B 5TS2A 4O2BA 1FVOA 2HMWA 3S27A 4AYWA 2BZ1A 4CG3A 3OLZA 5LN1A 2R6JA 3H1FA 2UZ0A 2OXEA 3DZKA 4YJ3B 1II9A 3WAKA 1RTTA 2A5FA 4F1JA 1FFBA 2NP6A 3JVVA 2O6GE 1T36B 3BWXA 1CQJA 1RBYA 1F4KA 4O33A 5DGCA 5M34A 3QI2A 3RPUD 4LRWA 3ZUPA 4Z3OA 2JA6J 3O8LA 3W6KB 3TBHA 1HE4A 4BVGA 3PEEA 3ZD7A 2WEKA 1T98A 4AS1A 4GX2A 4P3PA 4UTXA 1MJ9A 3MC1A 4AUXA 3RRJA 1LJUA 3LSGA 5DBOA 2MSKA 2FUNB 1M0SA 2XB6A 2PU7A 1P9WA 3AWIA 3ZU5A 4O5OA 2VAWA 3IUEA 4NS1A 1MDBA 4BNMA 3U1KA 4W7HA 2OB1A 3MWYW 3CLHA 2VKTA 3R9IA 3PXXA 2VTKA 1VJ5A 1W4BA 5HS4A 4ZI2A 3ER8A 2H6CA 3DLIA 3IMGA 2A9QA 1XZKA 4K9RA 4CCYA 2I33A 1ZH4A 1G8GA 3IR7A 1VTKA 3G1UA 2OD2A 3THOA 4RKYA 1DPRA 3W0LB 3PXAA 1Q1BA 3GG2A 1NV9A 3ZHUA 3CC8A 3UJ3X 4CTMA 2C7RA 2YFKA 3DE6X 4L15A 2C82A 1ZAKA 3DDOA 4FQ5A 3ZDDA 1I1OA 1P5HA 4LN1A 4IINA 3I71A 4YV2A 4PLCA 3ZQLA 2M9MA 2LDXA 3JAMZ 3IXQA 4LYYA 1QZ3A 1SVNA 3QJ5A 5BORA 1HZZA 2GEDA 4IF4A 1WF6A 1TM3E 2BT4A 1FW6A 3O73A 5IKXA 3RIMA 2XKJE 1LA2A 4AYBN 4BV2A 5L51A 1QCCA 4W97A 5HM6A 2YMMA 2VONA 1E3EA 4ISCA 5KTSA 1ONNA 3GPBA 5WRFA 3TXXA 5H5JA 1NQOA 4PUSA 5HQ3A 1QK3A 4GGOA 5LZ9A 2GKSA 4EGQA 4KSBA 3RPQA 4DB4A 4GOLD 1EEXB 4R0NA 1XU7A 2MOKA 2O8VA 3KSBC 1NDQA 2A5YB 4U0KA 5CTJA 3V8RA 1CQIB 1NVGA 1OWLA 4HH1A 1FRFS 4F91B 2FN9A 5LHIA 1GXSA 3BGOS 3FN4A 3CMAI 3L04A 2RGWA 2B9VA 4UHCA 1GG2A 5KJ1A 2BM9A 5E2BA 1WUYA 1G38A 1RAGA 3RUPA 3QUBA 4ZVTA 2ZYAA 3JRHA 4URWR 2JFWA 1PI3A 3JPWA 2PQ6A 3DMDA 3IUNA 3G1LA 3GTJJ 1TGYA 4OJYA 2QIPA 3LA7A 1HOXA 1GSIA 3GEIA 4ASUA 1YBAA 2PO7A 4PHHA 5DNDA 4TVOA 2AF4C 2R8YA 1LSJA 1UMBB 1A5BB 4NARA 3I09A 5KCMA 1QC5A 5B1BH 5EI5A 3DLHA 3PNBA 3TRHA 4IHKA 1EFCA 3EODA 5AW1A 2JEZA 5LVAA 1WZUA 3PEYA 1R6TA 3OJEA 4ANJA 2HQ1A 3CCBA 1ZSYA 1Y63A 2A57A 4HB2A 1XU4A 4QOEA 4EPRA 1BX3A 4UVGA 3VKWA 5KTPA 3DQZA 1IMOA 1V5IA 1LY1A 1TU4A 2WWWA 3DKVA 1CY4A 2H11A 1Y81A 4CQLA 1VI6A 5JNWA 1IAQA 3DMRA 5K3AA 3A04A 2SCUA 1C3EA 1PEDA 4XA8A 1BHO1 1TGVA 1SFRA 4ZAXA 4LJLA 1VLZA 1QIGA 1Z38A 2YU3A 821PA 1P9NA 4D1YA 2IYRA 2AMFA 2J5XA 1KR5A 4HAVA 3ZHOA 1T6ZA 2VHZA 4YEDA 1JHPA 3HNPA 2J41A 5A2QA 1LLDA 4MV1A 2OQIA 4ZRDA 1SC6A 1TPZA 1X1TA 1GQSA 4XVHA 4DBZA 1KKLA 2ODBA 1DQRA 2FFHA 3F0TA 4IHJB 3LRPA 5LA6F 1CZLA 3JQ7B 2JI7A 3TW8A 1UC9A 1J2XA 4MGKR 2E0IA 3PQEA 4LJ9A 2WE8A 2E4UA 2G6TA 3M6WA 2AR0A 5LQRA 2FUG6 5AOCA 1GPBA 4Z2AA 2DA7A 2BDEA 3ES9A 4JI8B 4CRWB 1PNRA 4JOBA 3F8FA 2DCUA 2AX4A 1CR0A 1H1LA 3GGOA 4C2TA 1C9DB 1RUOA 3HI4A 4WLOA 1R9TJ 3B7PA 2YC4C 4TMXA 3KOWA 5BYAA 3UWDA 1F8FA 1O08A 1R4ZA 2I78A 3NIFB 4M0MA 2ZJAA 5EZYB 1Q2XA 3ZMDA 1YJXA 3KQQA 2H18A 4RESA 4UHBA 5KWVA 1NVAA 1A77A 1FCJA 1IJEA 1I9CA 1TMOA 4D6PA 1DU0A 1BN7A 1A72A 4D4GA 3TGPA 1NMZA 5CFRA 3OPYI 3OOWA 2EARA 3QLVC 1QJ4A 2EKZA 3KBBA 3ND6A 1Q1NA 5HCNA 2YN4A 2GK6A 5HFJA 3O26A 4FSHA 4KRFA 4IH9A 4G0VA 3OHMA 2FNPA 1LS6A 4OXXA 1HL7A 3GEEA 3HR8A 5HE9A 3U62A 3TQQA 1YZLA 1SFKA 1XRRA 3ELYA 3KPYA 1K2WA 2EZIA 4M88A 1W2GA 4QLCU 2NVWA 5LPNA 3WLOA 3KTOA 5EXSA 4ADSG 1JKXA 5EMMA 2M45A 1AWCA 2GTIA 2PT6A 3LA2A 4QUHA 2PE5A 4RVOA 3GP3A 4JL6A 4OU4A 4FE4A 3VFZA 5D3ZA 4NQWB 3HYIA 1FFWA 4BGIA 2DF8A 1E8DA 1ZD8A 3L7YA 4W5NA 3PIDA 2NIPA 3EF0A 1BYUA 5INTA 2Y05A 5A3VA 3BG7A 4IQGA 3AH8A 4HZIA 1JEQA 3FMRA 4FIDA 4L51A 4B74A 4HLCA 4NK4A 3WGTA 2P9HA 3E9ZA 5T3UA 3NBYC 3FPEA 4RMNA 4CYMA 1W29A 2QTHA 3CE9A 3E05A 1OREA 1DUXC 4YRJA 1SZJG 1GU0A 2A0FA 1ZGBA 2ZIEA 3KUKA 2HA4A 2WBLC 4BX8A 1LNQA 3ITKA 1HDRA 5F4ZA 3AOEC 5BQXA 1ZCAA 2H00A 1QNLA 2JTVA 5EG0B 1AB5A 4OP3A 2P4WA 1W9MA 4XI9A 2X9DA 4MMXB 4V2GA 3RRMA 4JD5A 2XTJA 4G37A 3OKCA 1KC1A 4MQMA 1DIBA 5D86A 1FDRA 1OCTC 1QQ7A 1XZQA 4HVCA 1ZUWA 4QDUA 2UUZA 1JN0A 2B35A 3ZPXA 2GERA 3OQ6A 1Q12A 3Q9NA 2A1IA 1PD1A 1MCZA 1M2VB 1FYVA 4E2WA 1K06A 3OMWA 2WF6A 2ODNA 4CN8A 4HZUA 4AJHA 4CDMA 2XBLA 3FTFA 5CX1B 5LHHA 3F5QA 3EZ2A 5C80A 3E8MA 1DAFA 2WUWE 3U7HB 1X7ZB 2X9VA 1T9CA 2QGUA 2PAFA 2IRFG 3NM4A 4DQ2A 5LQNA 3GEGA 4PGAA 5EJAA 2D4AA 4ENVA 1SUBA 3WFJA 4J0GA 3HSRA 2X42A 4KYWA 4HGNA 2R5WA 3ZZTA 4RTQA 1FLVA 2ID3A 1VQPI 3FCSB 1V4NA 2G63A 3K70D 4IZZA 3PFIA 1KA9H 1N7HA 5TIIA 4O8ZA 1UMKA 2J8ZA 1AQLA 2X0IA 5KZMB 4OI4A 4MVCA 2V96A 2Q3HA 5AW6A 5E6RA 4IRMA 2OUIA 4KN5A 2YJ3A 3H2SA 2BF7A 4AQ7A 1Z7WA 2RI0A 1KPIA 2D59A 3FHTA 4QUBA 4LWOA 1SUSA 2I8CA 3PFGA 2PUWA 1BEUB 2A78A 4CIBA 5I9LA 1MX1A 2FSSA 4XGIA 1WPRA 3HUUA 5I9IA 4HH0A 2VDOB 3KSDO 3ZHCA 1TA4A 3WGLA 3U2QA 1DWQA 5ALRA 3B3GA 4AL4A 1MW7A 4EMTA 4MWOA 3PGJA 5DD4A 2OZVA 1B8IA 1NHWA 3LTNC 3HCCA 4EHDA 5G4KB 3H0KA 2IXFA 3RHSA 3M5WA 4RHEA 4GLLA 3A4TA 4WK2B 4WD3A 3GI1A 3K6GA 2OPHA 5UKDA 3ESZA 1V7PC 2C8LA 2VSYA 2NPFA 2ZYRA 1R0LA 4J7AA 4IFEA 3R6SA 3IX7A 1M34B 3LUGA 2YR2A 3H8SA 1TKRA 2C5HA 1DEXA 4FYMA 4M36A 4C0WA 3UOGA 3NHUA 4B6PA 3NKLA 2FEKA 3K32A 1YX5A 3VU9A 4ZA2A 1GRCA 1D07A 4NU6A 1Q1VA 1IG3A 5A1JA 4MV7A 2EJBA 4UQLA 4HN9A 2BCEA 5F33A 1GV1A 3VPSA 4OHPA 1A9ZA 2PGJA 2PUTA 2DODA 2R68A 4HNAA 1IK4A 16PKA 1XCVA 3DTIA 4M1TA 5A5EA 2RNGA 3JQ9C 3FOFC 3I8XA 3UA4A 3B36A 5DSTA 1KJNA 4OVKA 5CJ9A 1AF4A 4YLYA 4OKIA 3UHAA 4F71A 1IQUA 1JG2A 2Q0HA 2MMGA 3D3QA 1JDTA 4XE5A 5L6LB 5E3OA 3BMCA 4IFIA 1MV8A 1JWAB 3DDHA 4AB1A 1PUFB 1RYHA 5FX2A 1R8YA 1YOVA 2ZBGA 3GRYA 2K86A 2FRVA 4X00A 4E12A 5ALWA 3IOBA 3VSEA 1T1EA 3BJIC 4XRGA 3ZKWB 4KW7A 1IDYA 4KFUA 3DZGA 1TAGA 2CBXA 1JHYA 4BO4A 3QVKA 4M4SA 1P4AA 4MQ6A 2H1LA 4YJFA 3IS3A 4LK1F 2A7QA 4YAWA 2JC3A 2R48A 2IWHA 4BV9A 2RJ3A 4D74A 1TL7C 1YCDA 1VCMA 4LOHA 3I5YA 3PE3A 4IIGA 3O3CA 4AJ2A 1LGYA 2IHZA 3S7TA 3UOAB 3N97A 1AA6A 4UATA 4EUFA 4JASB 4P4SB 4DF3A 4C3OB 3GX1A 1TT5B 4BKRA 3L4JA 2FEWB 1W88A 3UY4A 3OOHA 4HX2A 5D6NA 3FF5A 2F1RA 5AM1A 2LIVA 4K9SA 4CL0A 4CV0A 3F8BA 1TZCA 3ISVA 2AI2A 4J0DA 3CCCA 4BPBA 1ZW1A 5KU1A 1N34B 3HP7A 1DKLA 5GIPE 1NJSA 2HDWA 1UKBA 4XIJA 4BJ3A 3JAWB 3W90A 1K75A 3EHDA 5EFZA 4RKQA 5LLTA 2JK0A 1VFNA 3PE4A 1WCYA 1L4EA 1FUUA 1NP7A 3TW7A 1WWXA 4IPAA 3HEFA 5DXAA 1UOEA 3RU9A 4GBGA 3X3HA 3KVNA 3A01B 1V5EA 4XJVA 1DC7A 2F67A 3KOMA 4UDXX 5DWDA 2EHJA 2DI3A 3AAFA 1A8SA 5IWCA 4B4UA 1WHTB 4HXYA 4I99A 1DQPA 5C8YA 3MJRA 5HBGA 4AY5A 4CCWA 1XCJA 4F12A 4QXPA 3PKIA 3D6JA 1VXOA 4GM1A 3DEKA 1HDIA 1XDZA 1P0FA 3AYXB 2YJZA 4ERXA 1AUQA 3GT0A 4FMCF 5FF9A 4L0QA 4UXJA 2DLDA 1O96A 4R9NA 2EGHA 2DUJA 3G6EI 2QJWA 2GD1O 3F8NA 4UHFA 4IL6C 3RQIA 2TCTA 1I7QB 4LRYA 4I6ZA 1A95A 4KLCA 1Y1TA 3FSRA 3T1HB 1PDWA 3P27A 3N9IA 4IJUA 3DGFC 2AXTC 3HXKA 5H4HA 2EFJA 2W2PA 1I01A 5J1TB 2J3KA 4L2IA 4LX0A 2IFTA 2QGNA 3RG2A 2BFPA 3CDHA 3E22A 3N8HA 4D4IA 2Z8XA 4L27A 3UVEA 2CKDA 3UYKA 2HQNA 1H66A 4HMQA 3TSWA 4G8BA 3P4YA 3V42A 4N8DA 4CZCA 1SAYA 4CM9D 2F64A 1FMJA 1J8MF 3ZI7A 5JD6A 3OJFA 2H6EA 1I1QB 2Q2NA 3FFTA 4WCFB 1UFOA 4U7BA 1R7RA 3WA7A 3T3OA 2B9SA 3BGSA 4LQLA 3A0HC 3WBBA 3V4SA 5EQJB 1XMAA 2JGKA 1MENA 2AFIE 4CHTA 4JC4A 2GUGA 1YJNI 3AEKA 4OK5A 1LK5A 3BR1A 4RQTA 1GTVA 3ZGXA 1QO0D 3BTOA 1PLKA 2PKYX 1G0OA 2J3HA 1I5EA 2IS4A 3NHBA 3IH5A 1B6SA 1V3UA 2H5JA 4A3MJ 1GAJA 5B57C 2XMBA 5FOQA 3RSSA 5D51S 4H7KA 3VSLA 3AP2A 2VUMJ 4PFKA 2E4YA 3ZGYA 1W44A 3L6BA 1IATA 3PD7A 1D4AA 4ZQIA 1GGEA 5JISA 4OMDA 2BY1A 3C8MA 5ALHA 4XR6A 1TEXA 4YGYA 1RP1A 1I2AA 3PUKA 4E6EA 3OYGA 1F6DA 4X90A 3BJOA 5K3EA 1LQUA 1IL0A 3KAJA 2HBZA 2IWRA 2UV1A 1RD4A 5TF0A 2WJYA 3GTKJ 4DIEA 3GA0A 4G12A 1X39A 3BA6A 3HLKA 1F06A 4PF1A 2D74A 3S5JA 3WNBA 2HF9A 2L17A 4DVGA 2O8DB 2XGXA 2BGMA 4DDWA 1XA0A 1L9KA 3MTBA 2AZXA 5GQSA 3BT9A 3A1NA 4KQGA 1TIBA 2FPKA 4HO1X 1R0XA 2DH5A 3IPRA 2GLUA 3TAXA 1RHUA 2VXZA 4RD1A 3T1YB 5K0LA 1E0AA 4IDEA 4G7ZF 4DXHA 5KO2A 3DE7X 4JI2B 4ER0A 2O57A 2VBXA 4AKTA 3WTZA 5FA5A 1NQTA 1Z74A 1JSLA 4YRTA 3WV5A 3VJKA 2OZKA 3KWMA 3QK7A 3HVUA 1TJPB 5C4GB 2IF0A 1KK2A 3L4BC 3TGNA 2ZIXA 2ZIAA 3F6CA 3PF9A 2TMYA 2DA5A 4Q7EA 2E3JA 2K9NA 4J8PA 4MH0R 3M4JA 4Y9RA 1VA4A 3KSRA 3U17A 1QIMA 4IYJA 2IGBA 1ZW6A 3MWDA 5HS7A 3HJGA 4MVYA 3OOJA 4FWIB 1RAHA 2E1PA 1MJNA 4JH0A 3FNHA 1KZ4A 5AOAA 3DXFA 3L00A 2RFLA 4KXFB 4QIWN 1I51A 5J3LA 1Z7LA 4EMSA 2NNYA 2ZJ8A 2ARKA 4AKEA 1C0IA 2B8JA 1S2GA 2X2FA 1Z73A 4B17A 4I2NA 1BVHA 2G9ZA 1QCYA 1W7PA 3KEOA 3ONQA 1T13A 4L4RA 2LTPA 2BVNA 4XFDA 2X9NA 2CNKA 4L3WA 2BW3B 2F8MA 2G4VA 1WBDA 3RS2A 4MCIA 2D1RA 2VL8A 1SPXA 4Q9HA 4D56A 1C80A 1CUHA 3SXUB 4N82A 3UR3C 2OV8A 3OP4A 1E94E 1RHMA 4FMBB 2G8LA 2I80A 1U04A 1BGWA 1U3WA 2E1MB 4TQGA 2BLLA 3PHHA 1G8FA 3GZTB 3V48A 2ZB9A 5E6SB 4JR1A 5CT4A 5BQ3A 4KE7A 2WD7B 2F8TA 4AVZA 3OX1A 5DEQA 1ZIOA 1R6AA 2YW9A 3RSZA 3WZLA 1EX7A 1GZ4A 4D4HA 3HNOA 1GL7A 1H22A 1Y3DE 3TEJA 1MFPA 5B36A 1MH3A 3X1ZA 4QO8A 2J45A 1R5ID 5JYCA 1NG1A 4I9GA 3CEHA 3HUTA 3QXSA 1YJBA 2O0LA 2DAPA 4N9WA 1N2JA 1NU8A 4LSGA 2XNKA 5DF1A 4B3XA 2OUKA 2NGRA 1E92A 2EH3A 4B1FA 2CXRA 3CZAA 1RXSA 1RYBA 5FXMA 5E17F 2V6MA 4TPKA 3K7EA 4S3MA 2AFIA 3CS3A 4HTFA 2JANA 3T3MB 2NO6A 2LNBA 2PRZA 5LP6C 2MC4A 4HXGA 3T7AA 4X3PA 3IT1A 4JLVA 1N5OX 1ZYRF 3H3FA 4WNYA 3SYKA 1KGSA 2QTNA 1NPTO 2OZEA 1U2SA 1BR2A 1P60A 3DHYA 4KZPA 3W3ZB 4C20A 3QVLA 3QHPA 2GTHA 2ZAIA 4JLDA 5M5BA 3S17J 4MVJF 1WXEA 2RHHA 1TU0A 1VE9A 4AF7A 3W6ZA 4EECA 5K2OA 3RI4A 4RPIA 1SVLA 4AYXA 1DQUA 4O59O 4HDQB 2Z6UA 3HL4A 1K1EA 4A92A 4PYLA 3KOYA 2FOWA 2IY8A 3FPSA 2JAWA 3WTXC 1K61A 2I6FA 1XRMA 1S2LA 3E18A 4X95A 2FVYA 2W4IA 4TV9A 3HYRA 3RDIA 3KZNA 3CJNA 3AF1A 1H2AS 3MTGA 4IXAA 2QW1A 5C5EA 3RS8A 4EV0A 3D3NA 5IM5A 1FYMA 2QMYA 1E60A 3D5SC 5KI6A 1K3UB 2XVZA 4D0NA 2K2WA 3OETA 4C0BA 3THYB 1Y1SA 4P8RA 5BMVF 1UT8A 3AV0B 2L69A 1XSDA 2YOFA 1NWCA 4V1CI 1AH2A 3TE6A 4HRXA 1C2YA 5AJYA 421PA 5CLJA 3OOEA 1CUZA 3C2GA 2P2GA 2FFJA 2QX8A 3G2MA 4Q3NA 1KEWA 3L2OB 1TDJA 2EZ4A 2O5RA 3M70A 3VVCA 4Y2SA 4B6QA 1G41A 4NENA 3COAC 1ZIDA 3TTXA 2W4SA 3RFCA 2IEYA 3HACA 4U02A 3KZVA 1K8YB 1XMXA 4ZARA 1J97A 3LGAA 4E5SA 3WWCA 1ICIA 3BR3A 2Z95A 2ZI6A 2JPBA 4DR4B 2WV1A 2HCFA 5ESDA 5CG2A 2ZQ5A 1QJCA 2ZPTX 4XDGA 3WODF 3OY7A 1CLUA 3DR3A 4BIMA 1GT91 3UFXA 3K2IA 3L0BA 3R9XB 5BWOA 3P96A 4N0BA 3ENVA 3ROZA 2H07A 3SGLA 2DCEA 1ULHA 3R3WA 3M8KA 2FR8C 2NTJA 4BNLA 4BO1A 2CMDA 3EVBA 2FZWA 5A06A 1A5JA 5D5UB 2AFRA 3N3AC 3HEMA 3O91A 1XWWA 1NUTA 3P2OA 3BIOA 4MCHA 3PQJA 4PZCA 5G40A 2OBFA 1DU4A 3GWZA 5M3FJ 1I1NA 1EE9A 1GVDA 2PIDA 4KV7A 1V3FA 6AT1A 1A88A 2VT7A 2E2WA 3E9EA 1NC1A 4GOOD 1USSA 2BI8A 4IDPA 1HK7A 2H16A 3VAZA 2G17A 1Q15A 4C4YA 4R7TA 1D2CA 2K9LA 5H7XA 1XAIA 1MORA 4HC4A 3OS2A 2WM2A 3IWFA 4R9RA 1ISMA 2V79A 1KMNA 5KJCA 4FYHA 3MB8A 2ZRPA 3FYDA 4MUJA 3LL4A 3H5VA 1DMRA 4Y6SA 3A8TA 2UZ1B 1ETHA 2Q5FA 4HI0E 2OFWA 2JCXA 2LY2A 2CFRA 5DHFA 4F46A 3U0VA 1N1MA 3OHSX 2BGIA 1Z28A 2O05A 4ALIA 3G0IA 2A4KA 1WUHS 1RWMA 1Y0BA 4JX5A 4YR7A 3SXYA 2XASA 2W2KA 4ZO9A 3IKJA 2WP8J 4YRZA 2I66A 1C7RA 2VSOA 1E6CA 3ZK9A 3L9FA 5KNDA 3BZKA 4QPNA 1BROA 1RWKA 2ZPUA 2P62A 3OFSA 3BTLA 3CG4A 4TTJA 1FLNA 1YS1X 1NJGA 4OCZA 3UG7A 4J6FA 2O3TA 4F5ZA 2B25A 3BTIA 2YIJA 5FPKA 2QUBA 3IP6A 3I42A 2CQXA 1Z88A 2ZE8A 5E1XA 2D8MA 4FKBA 4P6VF 3QNMA 2VLIA 4HDOB 1NUAA 3M4OJ 1NFQA 2V7WA 3MCVA 3HC7A 2YMLA 4RLQA 4B31A 1X0VA 2WHQA 1XHLA 2QTMA 3UMRA 4I3GA 2W98A 1O94D 5ANRB 5IX8A 3ENZA 1T36A 1TLLA 4QPZA 1V96A 1K6OA 5DIFA 3V4FA 2FVXA 4NATA 3J7YJ 4FSDA 1T6XA 3GFVA 5CB4F 3R7NA 1Y6FA 4QICA 3DM5A 2YFQA 4OREX 3H84A 4XRSA 4NSNA 4D0GA 2EV5A 3ABSB 2FXAA 3CA8A 3N1UA 1VLHA 2M6KA 4QTTB 2D2IA 1K6YA 4RJJA 3NJRA 3L4EA 3O6BB 1E3QA 2PVPA 3FWPA 5JCOC 1ZL0A 4BXXJ 3K9CA 1G21A 2BH9A 3R7AA 2P6PA 4K5QA 1H4TA 5ALTA 3E8XA 1QFYA 4DYVA 4MJ3A 1S2OA 3GGDA 1JKFA 1Y98A 3KZMA 2Y92A 4EFNA 2M98A 1X86B 3JZDA 3DTNA 1AMUA 3LSMA 3PR1A 2IPNA 1JQ3A 2F3UA 2IHTA 1S5LC 4FHFA 1A04A 2OENG 4KDPA 4C14A 1AGNA 5LYJB 4D6YA 4WZAB 4AIJA 4TYQA 4MUAA 1EFUA 2FH5B 3BRQA 1G3YA 4N3BA 4HX9A 3SE7A 3GMIA 3WOVA 1SUEA 4TYNA 2CFSA 3AGPA 2Q4RA 5TLSA 2E5FA 4ISBA 4E3WA 1EP2B 1O3RA 4KLAA 5DWQA 3COPA 4A0HA 4RJTA 2QV7A 4E5VA 3TLZA 3ZG6A 1NOKA 3PD1A 3WADA 3D6HA 1U28A 3T9EA 3PQ8A 1EF4A 2AC2A 2ECFA 3SM3A 1EH5A 5HMMA 3B1VA 5E1BA 2RBGA 3EEIA 1P33A 2X0RA 3ZJUA 3T38A 4IDCA 3R5HA 4ZC8A 4UUSB 1X1AA 3CLUC 3U7RA 3KTFA 1RWBA 3CCFA 1J5EB 2JGJA 1CZKA 2VDNB 3RKXA 4OGKA 5EE3A 2J1LA 1F4LA 4LCBA 1GUUA 4MB0A 1L7OA 4RC9A 2UYGA 4DJDC 2OZ6A 2YJNA 5GVRA 2J09A 1CQIA 3CNHA 2OXIA 1NX9A 1QONA 2TS1A 2G82A 4UFPA 4RLSA 1N6LA 3SX0A 3OPVA 1W36C 1LK0A 3O8NA 3IAM1 1UMCB 4C2AA 1J9ZA 1UXKA 2WSLA 1DRUA 4ODIA 2CUKA 1IHUA 4PJ0C 3QFRA 5HF8A 2G6BA 4TX1A 1QA6A 1XNRB 1V4BA 5AM2A 1KMMA 2RNJA 1Q74A 3AXSA 2HV8A 4A3EJ 1BWSA 3DTVB 1JHVA 3A1SA 1VFPA 1PFWA 4ZTUB 1P4XA 5DU2A 4D7MA 4BLSA 3TRDA 3ABQB 2BFDB 2RGBA 1UMBA 4N54A 1XQ6A 2HUPA 5COBA 1VBKA 5EHQA 5HBRA 1SVMA 1BI1A 1T56A 3DAOA 1NW3A 2O3SA 2IV7A 3A1CA 5EYPB 2G36A 5LQMA 2G1KA 3NCHA 2DA1A 2UXBB 3DE2X 4LAFA 4JYMA 3HXLA 5IMBA 1LRLA 1MH4A 1K63A 1HG1A 4Z2YA 4WA8A 4IV8A 2B69A 1V8OA 5EGNA 1SEVA 4IWYA 2DUMA 5E1WA 4CN9A 5DHQA 1P1FA 4KBFA 3AKEA 2HCRA 4CM8B 4PYIA 5A3QA 4EJWA 4QOHA 1D6JA 3ITEA 5HNFA 3LFKA 4FMPA 2RHDA 4I76A 3D6MA 4OTZA 4PSUA 1O95D 5KHLB 4RGUA 1HT2E 1G9XA 1LV8A 4ZYYA 4CFYA 4G5FA 1TWFJ 2BFMA 5A5FA 4R16A 3I8SA 3KXPA 1FFGA 1NNLA 2H2AA 1SU8A 4J75A 1A2KC 3R0AA 5I9NA 1DO8A 1VBFA 3LTEA 4HLUA 3AU9A 1LCIA 4EKIA 1LI5A 3F6YA 2PFKA 3JQ7A 2Q3MA 4M1MA 4ZOAA 1JAYA 2JFZA 3ZVLA 2GNOA 3DUWA 4AY6A 4ONEA 2KFDA 4ON0A 3CH6A 3EIFA 3VTKA 2NPOA 4EATA 2P2CA 2WZBA 2MINA 4UAVA 2ZB2A 1RWXA 3KJZA 5CA0F 2JVGA 4ZGBA 1ZC3A 1FJ2A 3NTQA 1KOFA 2NUTB 1D1AA 5DH9A 2YZ7A 2DOAA 3JD4A 3WLLA 4E22A 4MUGA 2CLFB 4YPVA 5ER9A 3V7FA 2WILA 3HCBA 4Q34A 2X8LA 3ZWCA 4FGJA 4KMUX 2XY4A 5EZYA 1MVNA 1DFIA 3FGZA 4J4BA 1CLEA 3BWVA 1PR4A 4LF5B 4RF5A 5D5HA 2JFBA 3LK6A 4CEIB 4IRGA 5CB6A 1QGED 4LZZA 3T3GA 5LMZA 3SR4A 1P4GA 3WR5A 3CCRI 1STOA 3HBLA 5CBPB 4K3UA 3CO7C 4A15A 2P77A 3Q3SA 1IZ7A 3G4SI 1OXXK 3DFZA 2H0AA 2P4QA 1GZ7A 2CHVA 1JXMA 3QV2A 2OYCA 4BL5A 1Q7TA 3H5LA 4IJWA 2KIFA 2VH1A 3ND9A 1P1CA 4DLYA 2PRJA 2QD2A 1L9XA 2ST1A 2ZB7A 1ETKA 1DAOA 5L3SB 3WYDA 1M34E 4M7RA 1NMXA 1REPC 2B61A 3U3MA 5BNFA 3PQ3A 4GZ6A 3JQCA 5E9WA 3PEUA 2ZIZA 3B53X 2QQ0A 3BRWA 4MW6A 2A0UA 1ETQA 4Q16A 3MQFA 4HDVA 1E1MA 1AXEA 4IZOA 1OW3B 1EFRD 2JUCA 4Y13A 1UXOA 1MKMA 1Y5RA 4NQWA 3UUEA 1GCIA 4BWGA 1GQYA 3JWPA 2WUFA 3HKEB 1QGPA 3CVOA 4HX7A 3ZLJA 1JAIA 2ZM6B 4UNNA 3ZLUA 2J87A 1WI9A 1LDBA 4DMRA 2HRRA 3TZBA 2Y9MB 4ZODA 5K3SA 3LDFA 3DHVA 3IJ5A 4NPAA 3AV3A 3ESAA 3IBTA 1J0DA 1V9SA 4KO3S 4PGGA 1EJ0A 1U8EA 1J8QA 3T5BA 2EJCA 1YFLA 1E2NA 1EUZA 2IZ6A 3GUUA 4XR4A 3CRW1 3WGVA 3SFVA 1I2MA 2CQKA 5B1DA 2FE3A 3QFCA 1RR8C 5LRSA 4B6FA 2IYFA 2VQHA 3ESBA 3MWGA 4GZMA 3HJHA 3UWSA 1X7XB 2D7JA 4UDYX 1TTQB 4L07A 1B23P 5EG0A 2F4VB 1YZNA 3K05A 1FQJA 3ETEA 1UCRA 1QHFA 3VR6A 3WL5A 3BL6A 3PT5A 5AW2A 1YQUA 4FFDA 1XTVA 3IELA 1WB9A 4JUBA 2AC4A 1SMTA 2IYYA 2OOSA 2D62A 4LC0A 4ZPXA 2ZXEA 3AHCA 3OZEA 3ZE2B 1W6UA 1M2VA 1P19A 2XNDA 3EC7A 2P5VA 5ALXA 2OT3B 2RAVA 9MHTA 1IYZA 2IYLD 3OIWA 4UBMA 2PMEA 2XODA 1XVTA 5IVPA 4EYGA 4H6WA 2NV0A 3M9XA 2IK8A 3W8DA 5CX1A 4DL9A 1BN5A 4QWMA 1O58A 2VPLA 1TYBE 5DSXA 1X7ZA 2AZ4A 5BRNA 3MD0A 2C20A 3LVBA 2RHCA 2I2BA 3P9SA 1XRJA 1HBXG 5K3CA 2GHRA 2BIFA 2G3YA 3U9TA 4F9FA 1OXUA 5AJHA 3FVTA 4Z51A 2IXEA 3I64A 3DFGA 2XF6A 5DCLA 2PX4A 4BNNA 4YT2A 5J40A 3CPEA 1JU9A 5AM5A 1N2ZA 4PZ0A 2UUAB 4BIIA 1EUCB 3ADKA 4E7IA 4JX8A 4ME6A 2V58A 3LG2A 1E2FA 3IB3A 1Z2PX 5IFLA 3HZZA 1ZYUA 1KQOA 1JRLA 3RSLA 2O2GA 3L6DA 5GP1A 4ND8B 3QI7A 4DEYA 1JPNA 4MR7B 4JMPA 4KXVA 4NBNA 4BCBA 4H7DA 2VK1A 1CRZA 4RZUA 2DA6A 1BIFA 1SUWA 3EPJA 4HY3A 2CWWA 3UUGA 1GVNB 2H4YA 5KYWB 2Q2OA 4WJKB 2PKXA 2XQVA 4FFMA 3ZEAA 4E7LA 1I6LA 2RJOA 2CS3A 3PUWA 2R92J 1P2DA 5AIPA 3DAYA 1ULTA 2VHXA 1HKUA 5LEJA 5I5EA 2HD4A 2Q27A 3GJ0A 5IAOA 3I72A 1KYVA 4URVR 3HSFA 4UE3S 3KYIB 3BKWA 1EJ6A 5G4KA 3P4UA 2E2IJ 2MSWA 1S2DA 3BK2A 3H7AA 5JDIA 5DMXA 4IEEA 3ZD6A 2HIGA 3M6AA 3H99A 4NV3A 3HB4X 3TL4X 2GO1A 3RYCB 1YMQA 2GD6A 2J5PA 2H4JA 1JDZA 2Q1TA 3R7LA 3L3BA 3N28A 3W2FA 1M34A 4CZ2A 1C7QA 3CXUA 2FDCA 4RKEA 1EUQA 1JKMA 3LRXA 1XG5A 1EEHA 4QHTA 4ARAA 4QKQA 5G0UA 4R40A 2JRTA 4E51A 1J39A 5DHSA 4OFWA 1RI4A 4RXTA 1DT5A 3G2BA 3VC3A 1YONA 5KAPA 1FSFA 3TZHA 2JA7J 4CUZA 2CDNA 3UXYA 1LLQA 1JR2A 1IRFA 2C99A 2JHGA 5JAPA 3WK9A 3GUYA 4HQFA 1Q6YA 2Y1XA 2GHTA 1L5LA 1JLHA 3P7NA 2R6CA 4RVFA 3CLRC 1CETA 3EZYA 2Y69H 3ZDBA 4B0PA 5CIYA 3NTUA 4Y4RA 5HHTA 4UVBA 1PQ4A 1JEOA 1GWNA 3D0RA 5BVGB 3EIQA 1N9GB 5IKEA 1JHUA 4TYMA 1WZIA 5HKAA 3D43A 4MEYF 1I50J 1ND5A 1C0LA 1T25A 1S1MA 3K1MA 3G5MA 4HEA1 2Q3JA 4RDCA 5IJ9B 3V3KA 5LXTF 1KK0A 4LHSA 4RKFA 3ZKWA 1GSHA 1HGXA 4RWZA 1KSJA 1FJXA 3BIFA 1S3JA 2R1VA 3O4RA 4KE8A 4EMBA 3QGMA 2CLKB 3NWSA 4HAXA 4OJQA 2EZLA 3Q5FA 1U2GC 1OA1A 1WW8A 2HDNB 1BE6A 1G16A 3QVSA 4FINA 1NF9A 4K2EA 4JOSA 1RYZA 3N6VA 2XUKA 3R6TA 1HDPA 3LAWA 1N7GA 3KLNA 4AIRA 2I7XA 2DEUA 3CCEI 3CJTB 4P4SA 3H2BA 1PYVA 2RHWA 4J0IA 3LT2A 3O94A 5IOYA 3I1JA 3Q85A 1TT5A 1GUDA 1Z83A 4WASA 1Q0PA 4DJEC 2LRDA 5EKXA 4L9AA 3SDBA 2OL4A 2XMSA 3LYUA 4F38A 1KNQA 3ENWA 4ZZ1A 2IIBA 3A10A 2HLDA 3UK6A 3T5TA 3D59A 5ALZA 1NRJB 3GTGJ 4UCQA 3JAWA 3JTHA 3OLVA 3BQMB 4ZO6A 3IH3A 1FXWA 2G88A 4IOCF 5K8LA 2ANBA 4KJZA 1XSVA 2FSVA 4BQFA 2FOLA 2VJDA 1PNQA 4U2CA 4DHEA 1A82A 4C0JA 2Y6UA 3OYHA 3G1OA 2OPBA 1WZNA 3A01A 3S3OA 1BU8A 2JAXA 1R71A 1P17A 3UKDA 4RJIA 1WHTA 2VE9A 2HKIA 1OYYA 3AR8A 4FOPA 1M2KA 5ALSA 4EG6A 1NQAO 4IQ0A 2PKQO 2QRUA 1BH6A 3ROMA 1P0QA 1M83A 2FPPB 1V41E 4P3KA 3NYRA 2VATA 4ESJA 1N5MA 4X3CA 4UD6A 1B93A 3I6QA 4UUOA 1L1EA 1QK5A 3GY0A 2ZB4A 5GTIC 2ISYA 5BWCA 2L7FP 2ZAGA 3ML1A 4N18A 5BYJA 1OI3A 4NFLA 4RAZA 4DQLA 1IW7F 5IXJA 2QSYA 2EFEB 1TNSA 1KI4A 4G0NA 2WFZA 2M0CA 1ONSA 1PT5A 2G67A 4PXYA 1CYEA 4CH7A 3F67A 3R3HA 4RU1A 3I8OA 1RYNA 2ZJ4A 2HYJA 2QTVB 2Q50A 1L4GA 5CVIA 1PGNA 2DK5A 2WV7A 1GR1A 4ITVA 2GWHA 2PT7A 1DGRM 4V2IA 2OHHA 4EJVA 4NRDA 5K0NA 4JSRA 4A3JJ 2OEPA 4A73A 3V2IA 1BMDA 2BVLA 4ZO4A 4C5AA 3OLYA 5FO0A 3OF5A 2DMTA 4FILA 3RS9A 2EB7A 1QGOA 3KR0A 1KF0A 1K7YA 4X41A 4D8UA 2HQ5A 3BD7A 1PJCA 2Q2EA 3UJ7A 1UJ6A 2P5KA 3WNCA 2HWKA 2C92A 3BY6A 3H36A 1J00A 4OMCA 3IQEA 1JR3D 2VXYA 1FFYA 4RF2A 3CF6R 3K69A 3MW8A 2J5OA 3AFIA 3MWEB 7AT1A 3FSGD 1JWLA 3TTYA 1UQTA 2RI6A 1V16B 1L4HA 2EFCB 1E1RA 2I03A 4NBTA 3CTMA 4G0OA 1KAOA 4EA8A 1U4OA 3R8CA 1JG4A 1MGPA 1F0KA 3UWPA 5G41A 4RTRA 4TWJA 4HCJA 4TTVA 2QYHA 1XEAA 1D0VA 5FNVB 2XGDA 3GFQA 2P0YA 4HFRA 2WWIA 1QM5A 1ZK4A 1NF8A 1Z1DA 4AQYB 2VRWA 4RTPA 3EW9A 1AGPA 3OC6A 3KBOA 5JW6A 3AETB 4UOEA 2FMXA 3UAZA 5FAXA 1GGNA 2XRFA 1BGVA 1L5WA 5EHNA 3VKVA 1FVHA 4MQLA 4KK4A 4A0GA 5DM6F 3BTVA 2ZRBA 4BJ6C 4D3FA 4CG0A 2GS9A 1F2VA 5B53A 3QWBA 2O8DA 2PBFA 4CYDA 4C9BA 1O9HA 3SJZA 1T2CA 4DRZA 4JJ4A 1II8A 1A2BA 2X0FA 4CQMB 1QGAA 2CMPA 3UCEA 1M54A 1P4JA 1MMAA 1RJFA 3BWGA 2YZNA 1FT9A 3QY9A 3L6OO 6ADHA 2EIKH 3GD5A 2JLXA 4IIHA 4L8GA 2YVQA 5FL7A 5BSGA 5KJ6A 1E3LA 1Q0QA 1Z15A 2P79A 3FYCA 3RRBA 3JU3A 4P4LA 3N2KB 1MAUA 3IEMA 3TMYA 1WXGA 3PDWA 4O4LB 1X8KA 1EG2A 2GQ0A 1FA9A 2Z2KA 1CUWA 3HWRA 3FM9A 4JROA 3INYA 2XTNA 3LYAA 4Z6YA 3NM6B 1OGIA 2OGTA 2PMHA 3FG9A 3QOYA 5EJ4A 5A9SB 5BYKA 1K7FB 4RY2A 4FYVA 3KXDA 2QRMA 5FUYA 3U3KA 5CT8A 1JLMA 3V1MA 2ZJBA 4IWNA 5HIIA 3UAGA 4O8CA 4TXHA 4TKLA 2GPNA 2VDJA 2MSLA 3EOAI 3TGWA 2CVHA 3H83A 3C43A 4LYJA 4V1CA 3AW8A 5AXBA 2HJGA 4DLTA 2VXDA 4D81A 4KQWA 2BW3A 1KI7A 4LQCA 4J16A 5F6FA 4LWZA 3ZMUA 1P3JA 1COWD 2C78A 1NIJA 3WJAA 1A8PA 1UK8A 5JZBA 4XSGA 1FIAA 4DV4B 5T4HA 2RC4A 1GFSA 4NCNA 4DJFC 1S0UA 1QVAA 3O7MA 2RGUA 4KISA 2BBWA 4TSFD 3EEBA 5E6SA 2D13A 1ZEJA 1ZIYA 2B2CA 3VI3B 1S5PA 2WD7A 4V02A 2ZUTA 5FBVB 4MWCA 4FASD 5TY0A 2GAUA 2DOEA 1G2OA 3DV2A 2FOKA 3CZRA 3BDVA 1HW2A 3HYLA 4F3TA 4GC5A 3K4CA 4J0EA 1XEXB 5JRZA 1QIDA 2JI9A 1CY7A 1ZPDA 1WQ4A 4GR4A 1Z4PX 1SXJD 3CKLA 5IFKA 1N3YA 3URKA 3QHAA 4YDSA 4E21A 4ICIA 2D54A 1YHZA 3I9V1 3WLMA 1P45A 4D5GA 3ZH9B 4KPYA 1QCDA 4TS9A 4Q9KA 4PVDA 1RC8A 1NQWA 1Y5NA 2ETVA 4EH1A 4MP8A 5LOVB 2VG8A 5IPFA 1N1GA 3MLBA 4IWXA 4NXMB 3PUHA 3BFPA 3MMNA 5C3UA 1H0KA 1ODJA 2IU4A 4R2IA 3ZK7A 5IAJA 2WJPA 2EF1A 3MOIA 3VUEA 3FIJA 2W71A 1BOFA 2XRNA 5DJ5A 1GGJA 3HU2A 3RKYA 4WBXC 1O5IA 3RO7A 1QHHD 3Q0UA 1Z6TA 1K5PA 4IRHA 2W4QA 5FLEX 4PLYA 3V33A 3WAGA 3HHHA 2V3VA 1C7ZA 1F0YA 1FJLA 4B3SB 1BQEA 3LHKA 4JLSA 1M66A 5H80A 4RK6A 3Q3JB 1ZICA 1STZA 2E5LB 3W5HA 4KE6A 1BFDA 2C4TA 4LMPA 2IT1A 1SCKA 2PMBA 4MULA 1KY4A 3D3EA 1G7CA 1JA9A 2C4MA 1Q0SA 1ZREA 1JHHA 1ISHA 4HL6A 1ZHFA 2GPWA 2LBPA 4O6VA 1EHIA 4HOBA 1JQJC 2Y75A 4KO1S 5T6MA 5T67A 1OCEA 3VSDA 3THYA 1EQUA 4RSGA 5LKRA 4JLMA 3DTYA 1E64A 3PSIA 3KALA 1X8LA 5IASA 1M67A 4MYRA 3Q87B 2E1NA 3SMVA 1Z3CA 2AZDA 4ZYTA 2NACA 4ZEMA 2IIVA 4LGMA 2QAIA 4KUEA 1DJMA 3OCXA 2XJ9A 4L5EA 4H18A 1Z6RA 3GGJA 2FFQA 1Y7LA 4OX9Y 2WABA 3TCNA 3UHPA 3HB9A 1J23A 3UB3A 1P44A 2NLOA 3KPJA 2HV9A 4WZAE 4IKEA 4TVSA 5KS2A 2G9WA 2JF0A 2WFMA 3SC2A 1UOOA 3AC0A 4KNVA 2ZYUX 1RAFA 3GLIB 5L3QB 2YIVX 3R9XA 3TEDA 5IYCJ 3ZY5A 3VA7A 4WLFA 5C44J 1VECA 1Z7EA 2Y1GA 5K99A 4YFVA 5DDIP 5IU6A 2DR3A 1YE5A 1RQGA 1Z6ZA 5F21A 2K7FA 4NDNE 4O08A 4RQUA 1V43A 1K4YA 6PAXA 3HK2A 1O4XA 2BI4A 1JUMA 1TJ5A 1Y89A 2YWHA 4YLGA 2FUCA 1LDKB 2X76A 2OFPA 5K4HA 2VASA 2OHFA 5E79C 3F6BX 3Q3GE 1MJBA 4D9HA 1QH1B 4N9QA 1V11B 3GU3A 1PWEA 4ZV4A 5L45A 4QG7A 1W7AA 2QI9C 1T3ZA 4LZPA 4MWSA 1VDZA 3BZWA 1XXLA 2DZDA 4M0CA 5JC8A 1TVCA 2FU4A 3A3NA 4WXHA 3LVRE 1P1HA 4B4KA 3B6MA 3S3TA 3H2KA 4AWBA 2Z6QA 3PPWA 1RJEA 3KPWA 3KFLA 3RTRA 1F3LA 5AESA 1XRNA 2HU5A 4G9YA 3I1YA 2H7CA 2UZ1A 5EG5A 3LHDA 2OBBA 2J9ZB 4BEHB 3LX8A 4QRDA 4FFLA 3PZRA 3ZZ1A 3LX6A 2UAGA 2HA6A 2VZLA 2YV2A 1G3TA 1GQ2A 2X6RA 1BA2A 1MQ8B 5BV2P 4Y30A 2FMLA 2A9RA 1AE1A 5IBQA 2FUG2 4XSHA 4H77A 4NFHA 4FDMA 4K03A 4LIPD 1NUSA 3GRFA 2QMEA 3O83A 3Q2KA 2ORYA 1VMIA 4Z4EA 4QGHA 6REQA 4DBVO 1WS6A 2IDZA 4P86A 4ZQGA 2OSBA 3CWQA 4BV8A 3K0CC 4NOMA 4WPGA 3FDZB 4GWKA 1VQNI 3KAQA 1SCBA 5IT3A 2WHPB 4IDHA 5BSEA 5ER6A 3RWBA 4B1RA 2WQ6A 2OQRA 3PNVA 1P6RA 4CCAA 5DT2A 1Q7RA 5A0VA 2EX0A 2AG8A 4BGVA 1N5DA 5FWAA 1QWSA 1CR2A 4C4XA 5DCWA 3NHJA 1E99A 3V1TC 1JBQA 4NPHA 3DFMA 1Q5PA 3KPUA 4XWYA 2MH9A 1PJAA 4DCOA 3VNQA 4P83A 1XD9A 3ZIAA 5IM4A 4II3A 5HK8A 3KUXA 1R22A 1RWPA 3TZ6A 2PN1A 4X1EA 1E6KA 2J32A 4P2GA 3DKKA 3QMPA 1D2MA 2PMZA 4JYBA 1BXRB 4EX6A 1H65A 1UBUS 3WGQA 3B48A 4MPRA 2OAP1 4PJLA 4G6ZA 4FYJA 3LQKA 2YMPA 5CVRA 4XN3A 4UHKA 2WMDA 2HVQA 1L1QA 1CUAA 2R1UA 4L4UA 4J19A 3FDXA 4ZCSA 2HQRA 1WXDA 2QRQA 3SLKA 1Z5ZA 4QBGB 2CE2X 2GZDA 4HEQA 1CJVC 3X2EA 4JA2A 5JMPA 2BFWA 4NEGA 3KYJB 1GN9A 3HM5A 4BEBA 5TF4A 2QS9A 5IP7J 2R84A 4LOAA 2X4HA 1L3CA 1W0JA 3CUWA 3HY3A 2W11A 5AKJA 1J49A 2XCRB 2ZRQA 4DLUA 4TN5A 2P35A 3BCSA 1TMKA 5LYJA 5EIAA 1IN5A 1EDOA 3MQ4A 4WZAA 1T6SA 5JR3A 4ATNA 3GGCA 1YBFA 1WCWA 2QRKA 1NNEA 5IT0A 1FUYB 4IZHA 5H83A 6LDHA 3PSFA 4O4IA 2YV4A 1TEZA 4YLEA 5DTJA 3HEBA 3BOQA 4LBVA 3NGLA 2YW2A 1RACA 3ZWMA 3DONA 2W22A 2XJ4A 2JCVA 3KQUA 4ZVKA 1JGSA 1UBJS 1NLMA 1YI8A 5MHTA 3T54A 4DSAA 4RHFA 1QRYA 4GMKA 2NX2A 1DX6A 2UYHA 2ISCA 3G1TA 4TLDA 5ICSA 4R7ZA 1KDOA 5L3BA 2ZK7A 2STTA 4MR9B 5E3MA 4UUSA 1WHUA 4L9NA 3G2LA 1WXWA 4D7AA 1M8JA 3ZR8X 3F9KA 1XLUA 3GFRA 3O8OB 5DTRA 3UB2A 1GCAA 1KZYC 4WV3A 1ZRCA 4KRYA 4AIDA 1U8FO 3FNRA 3UYLA 4AQDA 4PCUA 2C3PA 4MKXA 3S1MJ 1UMCA 4Q3AA 1AKVA 1PJLA 4ZAGA 1Y1VJ 2PX9A 4KR7A 3WWPA 3WWOA 4UAJA 2TMKA 4Q0MA 4GPAA 1AXGA 3B1KA 3IVAA 1QPBA 1M2WA 1U1IA 4PWZA 2G5TA 4ID9A 4D98A 5EJ6A 4HAIA 1C9YA 1XJQA 2JIBA 3MWJA 2YDYA 2YVLA 4Y6LA 3DTVA 4B6RA 4QYWA 3FPAA 2HI3A 2OHXA 2CDAA 1B6TA 2XRMA 1U9NA 3DWLE 4R8MA 1KETA 4Q7JB 4GVLA 1SD4A 2D1TA 3WQSB 1Z36A 1V8PA 5CFPA 1V9CA 5ALIA 1X3SA 1U98A 1VIDA 4GGPA 3X43A 5EYPA 2FBIA 2AUMA 2WK1A 1PJRA 3WBJA 1JSRA 1X77A 3ZCTA 2CVZA 2LKXA 3IUBA 1MBHA 2XSZD 3BEOA 4IH4A 3U1TA 2WFLB 4EW2A 4Y1FA 1TJ3A 2Y67A 2UZ4A 2CFOA 3LM8A 4NC9A 4W9NC 2EIJH 1QRSA 1Y5MA 4BC0A 1JHXA 5I8WA 1F8YA 2ZXWH 5B3SH 1ZD5A 4TRMA 1FVXA 1AS0A 3BA1A 4ENRA 3BQZA 1VFCA 2CK3D 3P94A 1LDYA 1NRWA 2XYVA 4I1RA 4IDDA 5FKJA 3GLGB 4CF4A 1Y9JA 1VF9A 2BKXA 3B52X 3M2TA 1V3QE 2VKQA 2E60A 4LRUA 1RLIA 2DMPA 2QVOA 1FLIA 4Y1EA 3BAZA 1QAOA 1ZCJA 4EABA 4FBLA 2YS9A 2JFYA 2FUEA 3WQBA 2MYUA 4UUNA 4BP1A 3SQDA 1J5XA 3EYYA 4E5NA 4LV8B 3GOQA 1EZZ