3HC7A

Crystal structure of lysin b from mycobacteriophage d29
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
SKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMWPSVEKGVAELILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHILPPTGRLHRFLHRLKKVIFWGNPMRQKGFAHSDEWIHPVAAPDTLGILEDRLENLEQYGFEVRDYAHDGDMYASIKEDDLHEYEVAIGRIVMKASGFIGGRDSVVAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPHLYNRYPAVEFLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 12 protein
publication title Mycobacteriophage Lysin B is a novel mycolylarabinogalactan esterase
pubmed doi rcsb
source organism Mycobacterium phage d29
molecule tags Cell adhesion
total genus 90
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1120 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hc7A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hc7A01
2OQIA 3ANSA 3AFIA 2VEOA 1FFEA 5I7UA 1GQRA 4Y2PA 4X95A 4BBZA 1VZ2A 1EDDA 4Y2TA 1XRLA 3T4UA 3WMRA 3O9VA 3F96A 4IHAA 3JWEA 4B82A 3QPAA 3I28A 2WIGA 5EIAA 2O2HA 5KWIA 3WWDA 4X90A 2C7BA 4FTWA 3WIOA 1Q0ZA 2XUHA 4DNOA 5DNUA 5A7HA 5CT5A 4FNGA 2NW6A 3ESCA 3OTQA 2XLCA 1N5MA 5FKJA 3W05A 3WIBA 1E66A 3I2IA 1YAHA 3KSRA 1JU4A 2AXEA 2XMGA 3ILSA 4IQ4A 4A23A 3D4LA 3DOHA 4MEAA 1MX1A 4ZGBA 1O6FA 1F0NA 2GYVA 4AZ0A 4GDMA 3DDUA 5ALVA 5AM5A 4WFIA 4FLFA 1LLFA 2RONA 4C01A 2XUPA 4B83A 1XRRA 2VQ6A 5CXUA 4ETWA 1QO7A 2XMQA 1CUIA 4QZVA 1QIKA 2WUFA 1XQXA 4J03A 3V1MA 2OCIA 3I2JA 3LIPA 4WDRA 2YASA 1DQZA 4GLBA 4U2BA 4UBLA 5ALJA 5JIBA 1P0IA 5ALHA 4GW3A 4HTAA 2HA0A 5D3KA 2PUHA 5EIHA 3H19A 1XZIA 4UHEA 2VT6A 5ALZA 3CN7A 3N0TA 5HF9A 5T4EA 1UFOA 3BF8A 2E3JA 1BN7A 2HL6A 3UUFA 2XLBA 3BDVA 4U2EA 1EHYA 3WJ2A 4PNZA 3WZLA 5E4JA 4M0EA 5HZGA 2OCGA 1IUOA 2PKYX 3AINA 4Q05A 4OCZA 4J0CA 4BDTA 4NZZA 2PSHA 4AQDA 1BRTA 1SCKA 3AJAA 4ROTA 5D7BA 1N8SA 3KWJA 4PSDA 3F9CA 1L7QA 5E2IA 1QONA 4EUSA 3G8YA 2ZJ7A 4ZRDA 2PU5A 3FLBA 1AMNA 2LIPA 3G0GA 2EDAA 4L72A 1CRLA 2XUJA 1R1DA 4LXHA 2HA4A 1Q83A 2G63A 3PI6A 1EVEA 5HQ3A 1WHTA 5DNVA 3CXUA 3IUQA 2W6CX 2GBGA 5ALEA 1JI3A 1HBJA 4E15A 3WL7A 3W9BA 2GBFA 3G02A 2XUOA 4IO0A 5C81A 4OSEA 1YAJA 5FUMA 1MO2A 3FLAA 5AOAA 5JZ9A 1QIJA 4QDTA 5LZ7A 3VKFA 4ZWNA 4FOLA 1F0PA 1AKNA 4DSZA 2HDWA 2RHWA 1YS1X 2WHPB 1CVLA 3R40A 3DCNA 5AJHA 4A5SA 4H7HA 2UZ0A 2BUCA 1K6EA 3AZPA 5ALIA 5IVDA 4MJ3A 2ZJFA 3H17A 2H9YA 3P2MA 5LZ2A 1CUSA 3A2MA 1EDEA 2WTNA 1QGED 4IH1A 4BCDA 5AKZA 2HADA 3NUZA 4G8DA 1QFSA 4QWWA 1N5RA 1MAHA 2ZYSA 3EIOA 3KXPA 1R9NA 1VXRA 2Z5GA 3QYJA 3RK4A 3IUNA 1LPBB 1EDBA 4BDSA 3AILA 4JYMA 1ZOIA 4J0GA 1BEZA 5H3HA 4GHWA 3IB3A 4MEBA 1LBSA 2HU5A 4RPCA 1AUOA 4KJXA 5J3JA 4Y2VA 1FSSA 3OM8A 4FWBA 3GBSA 3VDXA 1DX6A 3G9XA 1CUAA 5JAUA 3IULA 4WY5A 3AZQA 4Z49A 1W1IA 3I2GA 2D0DA 5BV7A 3V48A 4ZV7A 2I78A 3WWOA 3H1AA 4BE9A 2VA9A 3BXPA 1XLUA 3N2ZB 4Y2YA 2I03A 3WKEA 3VVLA 4BVKA 5CT8A 5SYMA 3BF7A 2CBGA 2CZQA 1HKHA 3FVTA 1H22A 1VXOA 2B61A 1UT6A 5CT6A 5I9IA 2ES4A 2XMSA 5A6VA 1CPYA 4KEAA 5DYTA 2H7CA 1AGYA 4A16A 2G5PA 3EBLA 2H1IA 4LXGA 5K3DA 2RI6A 2XQFA 4KAFA 1J07A 1E8DA 1NX9A 1E89A 1ZGCA 1UZAA 1EB8A 1AZWA 4TPKA 3W06A 3STTA 3HYSA 5HKBA 5AI8A 2YXPX 4UBOA 1JJFA 4EZIA 1XRMA 5T4BA 4BVLA 4EBBA 1GKLA 3HRHA 4B6GA 5JD6A 2VT7A 5FRDA 2PU7A 1ZGBA 2HM7A 5DWDA 4J0IA 2QVBA 2D5LA 3U1TA 1CEXA 1LPMA 1ZIXA 4I19A 1ORWA 1XZKA 5FPQA 4KRYA 4J0DA 1G4HA 4MYSA 1LGYA 2BJHA 5HCUA 5ALDA 5HF8A 4UFOA 5AIAA 3R0VA 1CUCA 5LIPA 1EB9A 1EK2A 2XUQA 2J3QA 4HAIA 4RE5A 4FHZA 5LLSA 3I2KA 4H7EA 2HU8A 2RHTA 3L1JA 1B41A 2OXEA 2B4KA 4LYEA 3PUHA 3KD2A 3R3YA 1MNAA 3PICA 4G9EA 5JATA 3LS2A 2OQVA 4UBJA 3ICVA 4J0HA 4DGQA 1B6GA 1P0PA 4ZXFA 3V1LA 4RGYA 1DWQA 1WPRA 4CG1A 5JD5A 7YASA 5AOCA 1UK9A 4IH9A 5IVHA 3O4IA 3PFBA 2OGTA 4OYYA 4BP8A 5JAPA 1WB4A 5CURA 5BOVA 4AN0A 4CCYB 4K5QA 3WK5A 3A2LA 4KAAA 5AK3A 5ALUA 1LNSA 5DYYA 4KR0A 3HXKA 4B85A 1W6RA 4QWMA 1H2ZA 2ECFA 2ROQA 1QZ3A 3WQHA 3OOSA 3W9UA 2C0PA 2C4HA 3VJMA 3SC2A 1OILA 1AX9A 4H35A 1CFJA 4UPDA 4QLAA 1K4YA 3WWPA 4OD0A 5AH0A 2GZSA 3OPMA 3R41A 4BATA 4TVKA 4PV7A 1I6WA 4UBNA 1CUDA 3M83A 1TQHA 3H2GA 1J1IA 2Z8XA 3WK8A 4C6HA 3U0VA 1U2EA 5ALMA 3G0BA 4W1PA 5JZSA 1XZHA 4F0JA 3G0CA 4Y2QA 2WFLB 4K6KA 1TAHA 5DLPA 2ACEA 4L3WA 3E1GA 4FBMA 2ZSIA 2VF2A 4FDMA 4H18A 2C0QA 4EY4A 3BDIA 1AQLA 2Z3WA 2QUAA 2H7XA 1CIJA 5AK6A 4HVTA 2Y6UA 3LP5A 2VATA 2JGIA 1PV1A 2DHCA 1SC9A 1TCCA 2BGRA 4U2GA 4X91A 1HPLA 3PUIA 4BRSA 3R3UA 1BEEA 1NU6A 3C87A 1E8MA 2AJBA 3DD5A 3C43A 4UUQA 2WIKA 3AUKA 3M81A 5AO9A 1CUHA 4Y7DA 4L0CA 3V9AA 1PFQA 4MQMA 1A88A 4BC0A 3KDAA 3ICWA 4N8EA 1QTRA 4UBMA 3WJ1A 3WKAA 2PSEA 3WA7A 2WUGA 4MWSA 4X71A 2WHPA 1XZMA 2HA7A 4LXIA 2WSLA 3RLIA 2WG1A 5FOQA 2ZYHA 1DINA 1YR2A 2ONCA 5FXMA 5FDFA 3ANTA 4OB6A 4G4JA 1ISPA 4AO8A 3MGAA 1DWPA 2HRRA 1CUXA 2WFMA 5I8PA 4BTVA 3HZOA 3VJKA 2ZSHA 1OXMA 1Q0RA 4BYMA 5CTAA 3V1NA 1XQWA 4IH4A 2XMBA 3HEAA 2GBIA 3LLCA 4BE4A 3STYA 3I6ZA 1ZICA 5K5EA 4C4XA 2C5FA 3WKDA 5K3BA 3KWFA 1EK1A 1AC5A 2O7VA 1THTA 3GROA 3BJRA 4ZREA 3HSSA 1QFMA 5CMLA 5CT9A 1P0MA 1RP1A 4HZGA 3DEAA 4ARAA 1MT3A 1JMYA 2PL5A 1E5TA 4P93A 4X93A 1GPNA 1Y7HA 2K2QB 5DTIA 5AKEA 5AOBA 5AKIA 1IUPA 5HF6A 2ACKA 3EQ7A 4W63A 5JD4A 5ALTA 5JARA 3DLTA 4J0JA 1Q84A 1TCBA 4M0FA 2WU3A 4UFNA 3BE8A 3O9MA 3C45A 5CBKA 1H2YA 3GFFA 5LKAA 2PBLA 4UHBA 4DMKA 1IMJA 2RIPA 4C4YA 4UFPA 1EI9A 3UUEA 1EVQA 5K3FB 1R50A 1UK7A 3F67A 4H7KA 5AKYA 2O2IA 3K2IA 4P9NA 4FFWA 3KOOA 5AKXA 5JALA 1G66A 1R9MA 5AM4A 1GPLA 1MJ5A 2JF0A 2J3DA 2WG2A 4AMZA 4XX1A 4UHDA 4L9AA 2J4CA 4PF1A 1DT3A 4TGLA 1HDEA 3FVRA 5HF5A 2VAXA 3R3XA 5CXXA 1EA5A 4G4IA 5LZ4A 4PSUA 5C7YA 5C8VA 5AKJA 1T4MA 3D7RA 1JJIA 1YSCA 4E11A 3I1YA 3IIIA 1AURA 3PF9A 1EXWA 2PSFA 1WPXA 1LPNA 5LYYA 3D2BA 3Q8WA 4QA9A 1Z68A 2VJAA 3ESDA 4GECA 1UWCA 5IVIA 3O4GA 3S8YA 4KACA 2V96A 1YB7A 2BCEA 3NOXA 3IA2A 2BUAA 3I1IA 4C4ZA 1RYYA 2HIHA 5K3CA 1JKMA 4X6YA 5EHXA 3WWCA 3K6KA 1ACJA 5CH3A 1C4XA 3FSGD 3I2HA 3IUJA 4JH0A 3BJMA 3EQ9A 4I4CA 4YK7A 3QMWA 3HLKA 1JT2A 4G9GA 4AN1A 3D2AA 5EHZA 4UHCA 2WHRA 2X5XA 1E8NA 2WKWA 3BIWA 3ED1A 1LZLA 5BWBA 5IKXA 4H7FA 1XZDA 1GPKA 3C6XA 4CCYA 5EGNA 5JAOA 3RM3A 1XLWA 1ACLA 2ZYRA 1W76A 1MX9A 2X76A 5FP0A 3DNMA 2JEYA 4DMHA 3FYTA 4I3FA 4Q3OA 2EEPA 1QIGA 1U65A 2PM8A 3HJUA 4G8CA 4OU5A 4B80A 3A70A 2ZJ6A 1CLEA 3FYUA 4O08A 1DX4A 3IURA 2HA3A 1LBTA 5DTJA 4XVCA 1ZI9A 3D3NA 5T4FA 4K6HA 1ZJ4A 1QOZA 3WYDA 1XZEA 4FKBA 4GBGA 2WM2A 2OAEA 3DL7A 4P08A 3VJLA 2AJCA 5ALFA 1X70A 3FCXA 3AIMA 4BB0A 4HXGA 3E0XA 2QS9A 2BGNA 1FJ2A 3AIKA 5CH5A 3ESAA 4F5ZA 4OB8A 5C8ZA 4DNQA 2OCLA 2WIJA 2CKMA 5A62A 5E4YA 3VVMA 3F8SA 1QE3A 1WB6A 2XUIA 1NU8A 4S0XA 5CRIA 5EHNA 1IVYA 4QDUA 4EY6A 2DHDA 1X2EA 1XFDA 4NS4A 5DYWA 3RARA 3D59A 4F21A 1CUJA 2JGJA 1DU4A 1CUVA 3IBTA 1O6GA 4AMYA 3O4HA 4W1SA 4K2AA 1XRPA 3DL4A 4UHHA 1GQSA 3PF8A 2XQIA 4X94A 1Y37A 3FOBA 6YASA 3IDAA 1G42A 1WCYA 3CCBA 4PQEA 4DYHA 2QOEA 4N8DA 2XUKA 4PSCA 1JFRA 1EX9A 4X6XA 1W75A 2WIDA 1XKTA 4U2CA 1LPAB 3C8HA 5EIEA 3A6ZA 2RGUA 1CV2A 3FLEA 1CR6A 1K8QA 1MU0A 3WLAA 4BRZA 4JEIA 1JU3A 3PE6A 3PDCA 1XQYA 2WUDA 3UMJA 2YH2A 3M82A 2B9VA 1U4NA 2JGFA 1YS2X 4AO7A 3ZPXA 3WL5A 5HFAA 4Q82A 2C58A 5AI0A 1WB5A 5ALSA 1W4LA 5HQ3B 2DSNA 1UOPA 1H2WA 2QJWA 1R3DA 3W2TA 2PSDA 5ALYA 3QPCA 2HA2A 3QITA 1KU0A 3A2NA 1VZ3A 3SWWA 1TIBA 2BUBA 3STUA 3DOIA 4BZZA 1GGVA 2PVSA 4GXNA 3BIXA 5KWJA 1DQYA 1CQWA 1UKCA 2FJPA 4KAJA 5F4ZA 4AB1A 1XZJA 4QDOA 1XKLA 2CUTA 4RE6A 2PX6A 3C6BA 2WILA 2QTBA 2WU4A 3TEJA 2G5TA 3HABA 3IUMA 3O4JA 3C70A 3FYUC 1F8UA 4B9AA 2GBCA 4KE6A 5ESRA 1K63A 3EQ8A 3WK4A 4X97A 4B0OA 1A7UA 1JMKC 3ZV7A 1FFAA 2XI4A 1QIFA 1ZI8A 4KRXA 3T52A 3WK9A 3HACA 4FBLA 1XZBA 4QLOA 1JJBA 3STVA 5ALXA 1UK8A 4AX4A 1QIHA 4INZA 5LKRA 2HFKA 4N5HX 4B0PA 1XROA 2WG0A 1ZI6A 4X3CA 1VE7A 4GI1A 3HI4A 4J0KA 2Y1KA 4WFJA 4XIIA 5LZ9A 5D3ZA 1G5FA 3CN9A 2XMZA 3I6YA 3OURA 3W04A 2PSJA 2YYSA 2OPHA 4E14A 1SOMA 1YASA 1VA4A 3QPDA 1BN6A 3WI7A 1MN6A 4EHBA 1H23A 3GUUA 1BCSA 1CQZA 4BZWA 4DIUA 1ZJ5A 3BL8A 4DMFA 3M3DA 5C8XA 3GZJA 5DNWA 5JZBA 1USWA 4LIPD 1XZGA 3STWA 4YX9A 5ISMA 1U8EA 1WOMA 4OB7A 2XMDA 3HC7A 3WL6A 3QMVA 2XMRA 2BKLA 1FFBA 4X7BA 3H2KA 1ZD4A 5JANA 1RWQA 1C7IA 4CIBA 2WIFA 5KREA 4HRYA 2XT0A 2X8BA 4W9RA 3NWOA 2HHAA 5AI4A 3Q0TA 1ODSA 2XUFA 1ODCA 4EY7A 1BS9A 3YASA 1VJ5A 5FLKA 4DM7A 4Y9SA 3GELA 4HRXA 3B5EA 4KE7A 4Q3LA 3JW8A 1BU8A 5AM3A 4BAUA 4EY5A 4OU4A 5A2GA 2WFZA 3H1BA 3H04A 3DS8A 2V97A 2QUBA 3MUNA 3NGMA 3WK7A 1XQVA 5HK9A 1ORVA 4H7DA 2Y6VA 1QIEA 2Q0XA 2JGLA 5DJ5A 2QJRA 1D07A 2ZYIA 2WLSA 3LCRA 5IVKA 2QRUA 4BCBA 1IZ8A 2P8SA 5FV4A 3F97A 5ALLA 4BAZA 4ZI5A 1TK3A 4WCVA 4DNFA 4C87A 1ODTC 5AI6A 4OPMA 3O0DA 1H2XA 1THGA 2B20A 1UXOA 2VTVA 3JYHA 5ALWA 1DT5A 4X00A 1N1MA 4X6UA 1TKRA 4BVJA 1WM1A 3LIIA 4PO3X 1CUFA 5CW2A 5AKKA 4CI9A 1QJ4A 4QDXA 1FFDA 1YA4A 5HFNA 2IX9A 1EH5A 3IVMA 1T2NA 4X85A 4N8SA 2VJDA 2DR0A 5AM2A 1A8QA 2VJCA 3F98A 3H2HA 5SYNA 1A8UA 2WQZA 4WY8A 4UBKA 3K9BA 2DHEA 4EY8A 3GA7A 3AIOA 4LHEA 2QZPA 1HLGA 3I2FA 4ARBA 4Q1VA 1VLQA 4OYLA 3SX4A 4MXDA 1XZFA 5K3AA 2ZVDA 3TGLA 4Q34A 4Y2SA 1J06A 4CG3A 4EA6A 2QKYA 2Y2VA 3C6YA 1E3QA 2WJ4A 3MVEA 5JASA 1KEZA 2EDCA 2VSQA 4P92A 1WHSA 5AK5A 4J3JA 4ITVA 1GZ7A 5ALOA 2XUAA 5JYCA 2I3DA 1CUGA 2OG1A 3OC0A 3WA6A 4Y2UA 3I6MA 4G1FA 2XUDA 1L7AA 1EINA 4QNNA 5CT4A 4PW0A 5HK8A 3L1IA 5CH8A 1GKKA 1QLWA 3G9UA 5IH7A 1UKBA 5ALPA 2DCMA 2QT9A 2DFPA 3B3QA 5ALKA 1MPXA 3QH4A 1J2EA 2J4FA 3O95A 1M33A 5AHXA 3WL8A 3B12A 3FCYA 1LZKA 5ALQA 5A7GA 3ZWQA 2QMQA 1YA8A 1CUZA 5AK4A 3DKRA 1XZAA 1LPOA 2C5GA 2Z3ZA 3R3ZA 1VA5A 2XQJA 4EB0A 3VISA 4FLMA 3DQZA 3R3WA 4JNCA 2RAUA 4XWGA 3X3HA 4RNCA 4N5IX 2WFLA 3DYVA 3S2ZA 1TCAA 1XLVA 4D9JA 1XRQA 1VKHA 5KBYA 4DTCA 1XZLA 3G9ZA 2CB9A 3QZUA 1BROA 1P0QA 4KE8A 1CUUA 5HKAA 4M0MA 2AJLI 2PUJA 2V9ZA 4JYPA 1YB6A 1ZIYA 4CIAA 1QIDA 2Z8ZA 5K3EA 1UOQA 5AM0A 3TJMA 5JAHA 1W52X 2OGZA 5JADA 3ESBA 1MTZA 3MUOA 2R11A 1Y7IA 2AJDA 2JGEA 4MQLA 1OCEA 3FBWA 2GYUA 2DQZA 4Y2JA 5FPPA 5EI5A 1DWOA 2W22A 4FLEA 1YCDA 3WKBA 3AZOA 1F6WA 4YPVA 4ZV9A 3WWEA 3STXA 4QE3A 2V98A 4U2FA 2JEZA 1SCQA 1SFRA 3CCCA 3QM1A 1DTEA 3C6ZA 4C88A 2H7YA 4BP9A 3ZLTA 4E46A 3G9TA 3RKSA 3D5EA 5AM1A 3G7NA 4JUIA 3TRDA 5BWCA 3R3VA 5EFZA 1L7RA 1BE0A 1GXSA 1KU6A 2QXTA 4U2DA 3FAKA 4Y2RA 3SK0A 2HA6A 3D0KA 1ETHA 4B84A 3E3AA 4X92A 2OLEA 3H2JA 5ALRA 2XB6A 4AO6A 1CUWA 3WYNA 3ZLUA 4DLNA 5ALGA 2HU7A 5A71A 2VJBA 2WHQA 4Q3KA 4LYDA 2DQYA 5AKLA 2QXUA 3OG9A 4W1QA 5A7FA 2GZRA 1MAAA 3V1KA 2BAGA 4DNPA 3FSGA 1R88A 4BC1A 5AKHA 1UK6A 3G0DA 1MX5A 4FNMA 4DSAA 4CFSA 2ORYA 2HFJA 3DKKA 1ZD5A 2G4LA 4H7JA 5LP1A 4C89A 4QDZA 3QBJA 4J7AA 1MNQA 2VAVA 2XUGA 3PFCA 3QVMA 5LZ8A 2QM0A 1BCRA 2FUKA 2QR5A 2I3ZA 3WK6A 2IIVA 5AP9A 4HXFB 4AZ3A 2JGMA 5E4TA 5K3FA 1QIIA 1S8OA 1CUBA 4F60A 2FJ0A 1QTIA 2OGSA 4AXBA 3QMMA 4G8BA 3DJYA 2O2GA 4H77A 1LPSA 4MWTA 4NMWA 4UHFA 2WUEA 1UKAA 1X2BA 4FMPA 3D2CA 5EHQA 4OUKX 1HQDA 2R8BA 2OCKA 4QEKA 4WDQA 5T4HA 5AI9A 4B7ZA 3E4DA 2XQGA 2XDWA 1XZCA 2HA5A 2XE4A 4YASA 4W1RA 2WJ3A 3DYIA 4DMCA 3C5WP 3FYUB 3BWXA 4V2IA 2Y2UA 5AKGA 4B9EA 1K5PA 4BCCA 4CG2A 4BAGA 5YASA 3ZLVA 4HS9A 2JGKA 2HRQA 1GT6A 4K6GA 3WKCA 1ZD2P 1SCIA 2WTMA 2XQKA 5AI5A 1CUYA 1R4ZA 3FWHA 1QO9A 5ALNA 2O7RA 5D6OA 2AJ8A 3L1HA 1VOTA 3EF3A 1ZD3A 2CMFA 4UBIA 1UOOA 3C8DA 2IITA 3FNBA 2XMCA 4Y2XA 1HL7A 1VE6A 2PPLA 4WFKA 4LKOA 4GWLA 2JIDA 1XRNA 1IZ7A 5AIBA 2BFNA 4KE9A 3H2IA 4H0CA 4G5XA 3WZMA 2FX5A 4WJLA 4G4GA 4KYVA 4MYDA 1FFCA 1LPPA 1QIMA 3H0CA 1A8SA 5LZ5A 3ZI7A 3C5VA 4B81A 2WJ6A 2CEKA 4HXEB 4CCWA 4XJVA 1PJAA 3G0IA 4BTLA 2CJPA 4H7IA 5AICA 3VXKA 2OAGA 3H18A 1C7JA 2GYWA 4FFVA 4NVRA 1TRHA 1IUNA 1CUEA 2JBWA 4GEGA
chains in the Genus database with same CATH superfamily
3QPBA 4X1YB 1KFCB 2L01A 3FB4A 3H0DA 2C5AA 2JCSA 2C7OA 2B30A 4CM5A 2XD4A 3K0SA 2EIHA 1ZS9A 3CLSD 2P9TA 5FEMA 4JUFA 2DCEA 2ATIA 3SHTA 2VUUA 5REQB 3F4BA 2VPTA 4NABA 4IKEA 1U3EM 5KVSA 2PZKA 4TRRA 1CQJA 4KZKA 2XGOA 3DZDA 2QUZA 2AZ4A 3NWSA 3M9XA 1DWUA 1MB4A 5JISA 1FFYA 1DSSG 2QUFA 3K72B 4OV6B 3P0IA 3T6KA 1A1SA 2WOOA 2AMYA 2AFIB 3INTA 3EYAA 2JAHA 4I4TA 3DZHA 2YC2C 1VRVA 3LSYA 3E22B 1RYDA 2DWCA 4GDMA 2C78A 5FJIA 3IHKA 4WFIA 1LLFA 3HBMA 2YV3A 5F76A 4ZZDA 1ECGA 4OIFA 1YZTA 3KV1A 3A4IA 1MXHA 2DA3A 2WUFA 1V54H 1F4PA 1YL7A 3ENVA 2QTTA 2CL6X 4ZVOA 2TSYB 4XM2A 1N2GA 1XCMA 1RWOA 3GBVA 4DIOA 3LX8A 2HVRA 4KJZA 1P2GA 2XVXA 5FT9A 2I2AA 2ZRBA 2EZLA 3LCUA 3BF8A 1QYDA 1TD1A 4U2EA 1IJFA 2MWMA 1A3CA 5LQRA 5B2EA 3OYAA 1ECJA 1N2HA 4CV3A 4HVCA 2FPUA 3TLZA 4BJTA 4LQLA 4F3TA 4BDTA 4KI7A 5KHDA 4LJSA 1PJSA 4ROTA 1CDEA 3DBOB 3VOBA 5L51A 2ZRKA 5CYGA 2M2EA 1W4MA 3TO7A 3K4QA 4ZRNA 2FBHA 1LNWA 2XGDA 1PJLA 3AUTA 1EQAA 5KTKA 4N12A 2HA4A 4ID9A 1Q83A 1GPDG 7REQA 3WAJA 5HQ3A 5DNVA 4RD6A 2D2XA 2HVQA 3CXUA 3PPVA 2YS7A 4FUQA 4AP9A 5I01A 1IN7A 2IHNA 1V3VA 2F62A 1AXGA 3VFDA 3ZWBA 3W9BA 3AVXA 4E09A 1DLJA 2JVGA 4YRBA 1JHMA 1MJGM 5FUMA 3CTAA 1QVWA 3EISA 2XF6A 3GI1A 3DBIA 3ZQ7A 1R5BA 4BLOA 1BW5A 1N2ZA 2WLTA 1SQ5A 2M6SA 3G0OA 2J9XB 3O5AA 1JXMA 3GFBA 2FF5A 5CLFA 2BFDA 2BMEA 4W7HA 3HM5A 5ALIA 1FUUA 3V1UA 1CUSA 3EF0A 5K0ZA 4OLHA 2MG4A 2NMVA 4TUYA 4DMUB 1PUFB 4BCDA 4GMGA 4OGLA 2ZTVA 4GOMD 1DFHA 3NHRA 4F52A 4Y7CA 2OHVA 1P5RA 3IMKA 5CLJA 4BDSA 4LLLA 2SCUA 1OQAA 3A8TA 2X41A 4TSKA 1JBQA 4XGRA 4OK3A 1Y5RA 1TLHB 5GONB 1BJRE 4XKWA 1PJZA 4P98A 4Y0VA 3NATA 2ELKA 2F4NA 4L95C 1JZQA 2PR7A 1E3OC 1EGAA 2DLLA 4MWOA 4CO8A 4KO4S 3EZFA 3QU6A 2CCJA 3P4UA 4GM1A 2FPWA 4KDFA 4ZYTA 3VVLA 4BVKA 1YE3A 5IT4A 2CBGA 1I2AA 1EX7A 3IQZA 5B3KA 4C0XA 1FBNA 3OQVA 4MAAA 3WB2A 5DN6A 1PBNA 1D1AA 4OUDA 5K0BA 2CVQA 3OOJA 4B7AA 1H8HA 4FFLA 3ZE9A 2C9YA 3EHEA 4QQ8A 3C1AA 1Z05A 4C07A 1CZLA 4Y2GA 4E3WA 1RABA 1J7JA 2KI5A 5AI8A 4HNRA 4URYR 4I50F 1PNTA 4UBOA 1JJFA 1UT8A 5IXJA 1YR9A 1QBGA 3AGQA 3QKIA 2DWQA 1OAOC 2O0HA 1BR1A 4OXYA 5AVOA 2D5LA 3FMVA 2X58A 2J31A 2M9MA 1UKYA 3W2GA 2J85A 2GN4A 2KZVA 3GIWA 3GT4A 3WS7A 2O61A 3QOYA 1AQUA 1KEPA 1F3OA 1FYMA 3RSFA 1WV1A 3MM4A 3BKWA 3D4PA 4D44A 2DY0A 3A6FA 1Z62A 3E9QA 4LC9A 3TLEA 4PEVA 4WZAE 4RLFA 3I2KA 4NULA 1B41A 4LYEA 3MT8A 5AUPB 4YAEA 2QSYA 2B5VA 4ALJA 4M9UA 4XYMA 2VBIA 5JHHB 1QB7A 4MP3A 5JD5A 3O84A 3PFBA 3LQRA 4I1SA 1GUFA 1ZMBA 2CWWA 3UF0A 3C3AA 4FFDA 4MO9A 1OR7C 3LHSA 3HXKA 4XICA 1YZYA 2NXNA 1QZ3A 1LE8B 4MP8A 1OX4A 3HUTA 4ZZ1A 4UPDA 1D6NA 2FSFA 4A03A 3EJ6A 1X94A 5CYVA 3UG6A 2KYRA 3CRRA 2XOKD 3BJIC 4DCNA 3H2GA 1XPOA 2BOVA 5K01A 3E58A 4Y98A 3G0CA 3LUFA 5JT1A 1S2NA 4K6KA 4ARSA 4EPVA 2O8VA 2VPQA 3KO8A 3HTXA 2CXNA 1DUSA 2WD7B 5LLDA 4WXPA 4DBVO 4GPIB 2R6HA 5LHIA 2CSXA 5IBPA 5C8YB 1JEJA 1N2JA 1PV1A 3C3DA 5FPSA 1GDTA 3IHUA 5K8LA 1BEEA 3A01B 2TRSB 2XB9A 2OBBA 4EYKA 4X0EA 2GZ3A 4YCJA 1E1CA 4JLMA 2GZAA 3JASB 4PHFA 4G1MB 5BN3A 2CLFB 3U4GA 3WKAA 1ZRCA 4ZHQB 5E6UB 2BY0A 1EKXA 5BQPA 4KA4A 1RRGA 3BMCA 2R6AA 2ZYHA 3ICOA 4DA0A 3PYMA 3L93A 2QD4A 5EOVA 2E1RA 1Y80A 1LQTA 4OKNA 4N76A 2RJNA 2EA2A 1YDFA 4ETNA 2DA2A 1XQWA 1TYZA 5JEDA 5GTHC 2G67A 4A93J 3V3KA 5CPRB 3ELYA 3RFXA 1ZVQA 1THTA 4FETA 3OWXA 1C30A 1RACA 4E7PA 3TTUA 4MCIA 1E5TA 3ROQA 4R54A 4LDQA 2I71A 3T8RA 3V8LA 3GPDG 3QPWA 4N0PA 4HDSA 3G8BA 2GPSA 5ALTA 4B8ZA 2VYVA 3W5SA 1XJWA 5LBQA 1MV8A 3WFJA 3CZ6A 2VXZA 1JIKA 5D6NA 3JSOA 3QFCA 5LD2C 4EHLA 3AJEA 1MT0A 4BHCA 5LKAA 1K4KA 4MV9A 1ESEA 1GXQA 3UHOA 3FRJA 2OYSA 2NOGA 3MWKA 3ABSB 5EGSA 1DC8A 1UK7A 3GT3A 4UUPA 2VJMA 3O8OB 3K1TA 3LMKA 4FFWA 1R9MA 1S2MA 1L7XA 2JF0A 1WZEA 2YW9A 3BOQA 2RB4A 1LD3A 3G2LA 2OZLA 4EX7A 2UXCB 4DJFC 4X8HA 3KIOA 1KSHA 1OY1A 1SPBS 3PF9A 3EEBA 1U2GC 3C0KA 1PR5A 1YC2A 3LNCA 2LBFB 3CEPB 3PX7A 4JGBA 5CG1A 2J5OA 4GUDA 2P0WA 3BUSA 4MZDA 1GAXA 4RSRA 1IULA 3TEDA 2Q2QA 3K9CA 2KIMA 1UODA 3AI3A 1YIOA 1I5RA 4N9WA 1NUHA 2OTLI 1REQB 2NVUB 1IK6A 3EN0A 4QTYA 1J97A 2GXGA 1TD9A 1D0SA 3C6XA 2RKBA 2ZYRA 3EVEA 2X76A 2PWAA 5H7XA 3QU9A 1BGWA 3DNMA 2ZROA 4CF6A 4YP6A 3DU6A 4HDNA 3LSGA 1PD0A 3VYSB 3K15A 4G12A 1NOJA 4RZIA 4W8GA 3RVBA 1YG2A 1Y63A 4IIFA 4E4TA 5JLAA 3FYUA 5DW0A 1NX6A 4LHXA 1QG0A 4JLJA 5DTJA 5EZHA 1V1MA 5EPEA 4HEA1 4DW8A 2E4ZA 1KZ9A 8OHMA 3WYDA 1DADA 3V8BA 5JBIA 4WZBE 3Q3EA 2WP0A 2QKMB 3HPRA 1EFPA 2O59A 4P55A 4DY4A 2H1VA 2VHEA 2VQCA 1WFXA 1Z2DA 3ASNH 3JATA 1EH7A 1E20A 1JNXX 4I50A 4GNRA 1S3SA 2VOEA 3P9IA 3TLCA 3ZZ1A 1ISJA 4DWVA 3ZNQA 3JD0A 1HTWA 4BEVA 3ITEA 4QDUA 4AZ0B 3MCTA 3KP1A 3NBXX 1CS0A 2HJWA 3OP1A 4NDNE 1LY1A 3BJAA 1WD5A 3ROTA 1E9EA 3NRBA 3G1TA 1FYDA 3PC6A 4NFHA 5KQLA 1SRQA 3CYFA 2V1XA 3DMFA 3X2FA 3EEYA 1YVDA 3SG0A 3L7IA 1L3LA 4CYCA 2X4HA 3ZE1B 1G42A 4M6WA 3DMPA 3L6OO 3W2IA 4BU0A 4PLZA 1WMFA 1D4AA 2IPAB 4QNMA 3GP8A 4RHFA 2HQ1A 3GWZA 1TNSA 3CVYA 4HS4A 5EWJA 2DPDA 4ENVA 5A6SA 3FHNA 2QDKA 4BKPA 3CCUI 4V38A 4UEJA 1Q16A 2ENWA 1CF7A 1QWSA 2AOXA 5EWMA 3UMJA 2JTVA 1P1RA 1EBBA 3LUCA 3VOSA 3EIEA 1FIAA 4BXOA 3S2GA 1QZEA 2JSCA 2CNKA 2W6ID 3QU4A 5BN4A 5FTNA 1TIKA 2G8NA 2BEUA 2OV3A 2PSDA 1Z2NX 2ZBDA 4GVXA 4I6EA 2PBIA 1RDFA 4J01A 3HDHA 5FTKA 3E1KA 5AXDA 4Z86A 1STOA 2FHSA 3ZWVA 3DOJA 3WLTA 4KQGA 4KQ2A 2VTEA 3RZDJ 5ARBA 1RQRA 1SD2A 3R0JA 2IE0A 3PVZA 1J7KA 1ENZA 5JOQA 1LWNA 1LV8A 1RC1A 2OAZA 1ZUD1 2ZVJA 5FADA 1E1QA 4CMIB 3NVMB 3I59A 1KP9A 1JJ7A 4OJYA 4BBRJ 4ZVUA 1U04A 4OTZA 1L5YA 2XI4A 1FUKA 1FSEA 3CDHA 2EL9A 3WK9A 1R6RA 1SPXA 1GV5A 3RT7A 3F5FA 1YTYA 5FJ8J 4LBZA 4KRFA 3I9JA 1XCJA 1G7RA 2RJOA 3E7LA 3ILXA 1HDXA 2BZSA 3HI4A 2A6EF 2DK8A 1KVSA 2PSJA 3RWMB 5K2MA 1LDJA 1BN6A 3BPVA 4A0YA 4MEXF 1NJGA 4EHBA 3ELUA 2YZNA 3CINA 3CCQI 1IPFA 1R6UA 1Z07A 1U3FA 4IWXA 1YOBA 2ECBA 5ETJA 2R4TA 1P45A 4X1OA 1ZD4A 1BI1A 2GARA 3O83A 3N2KB 3E2MA 1U2WA 4AF6A 3MCZA 2EINH 3PWKA 3VNQA 1AG9A 3SZLA 2A30A 4P53A 3KC2A 2AG6A 5DGXA 3BWCA 4AF7A 1I6HJ 5FLKA 1INLA 4A12A 3CCEI 3MXOA 2I1LA 5AJYA 3NLLA 3LT4A 4KE7A 1MNMC 4ZHSA 1K6JA 1V0JA 5B7GA 5ICMA 4CLOB 1RWBA 3TP3A 3RIXA 2MBFA 3S1LA 3TQIA 3HNRA 3DOOA 4JCCA 3IDFA 4MFDA 2R93J 1PZEA 3EEFA 4R0VA 1X1EA 5FBQB 2GAUA 2H4ZA 5IVKA 2CNWD 4KX5A 3MSCA 3KELA 4QOFA 3TLMA 3QK7A 5IUJC 3BAFA 3HR7A 1PJCA 5A04A 1OTXA 4ECEA 2FRVA 3CEAA 4L9WA 1RC9A 2H4JA 4Z54A 4BWFB 4CQMB 3TR6A 3KOYA 3GRUA 3ZY6A 3JQAA 4ETSA 3MIZA 3MBIA 4MW0A 1KMNA 1QHSA 4GYGA 4PBTA 1PVVA 5ECGC 2ZI5A 1Z47A 4WK8F 3ZP5A 2ZR7A 4FFBA 3EUHC 3VYRB 1ZK1A 4HLNA 3I5MA 5CVRA 3CUQC 3WGIA 5I5EA 4GL4A 4IYRA 2E60A 3G2QA 5FJJA 1ADCA 1KP3A 4GBMA 4LPKA 4FX0A 1EE9A 4P86A 2QV0A 4ZP1A 4NNPA 1PR3A 4L0MA 4QHTA 3QWBA 2OZEA 1DGWY 4MXDA 3PA8A 4XNFA 3DC2A 3D7NA 4HN9A 3TGLA 3WE3A 3FIWA 4YT4A 3HR4A 5KJEA 1QQAA 1TVCA 5BSKA 1YL6A 3FBGA 4MMZB 4Q7MB 1KIFA 4A91A 5MN5A 5DNAA 1VBKA 3EZ7A 1WSDA 3PDIB 3JD1A 4LZZA 3H83A 4HDKA 1ZZEA 5AVJA 3RG8A 2Q1XA 2ZRDA 2K85A 3G2JA 4KIBA 3G9UA 5ELXA 4MV5A 4BNTA 2BVNA 1M2OA 1ZU4A 1Z2OX 4RIGA 4ALIA 4P8RA 4M9SA 1G5PA 3B12A 3FCYA 2YWCA 1YW7A 1JG6A 4X0GA 1L3CA 1OD6A 3PC2A 3W4KA 2R7DA 2ZTSA 3LX5A 3FDJA 4TQAA 3O2PE 4JBYA 5LQMA 4NUBA 1D8KA 4PPGA 4XUEA 2P3QA 1BKYA 4FYKA 1TCAA 2P1DA 4FSXA 2M9HA 4MUAA 3QKSA 2AG1A 4KPUA 4G1EB 1IBRA 2W85A 2Q3BA 2ECQA 2DH5A 4M0MA 5C37A 5HBRA 3MJSA 2HPMA 4IVNA 4CLDA 1RXIA 2OM6A 2L4AA 4O4JB 1SXIA 4JT4A 2C95A 4K46A 1ZOLA 2VP3A 3FD8A 3LP6A 1H4SA 3O2SB 2DQZA 3E82A 1NP3A 2ISQA 4CUJA 5DN9A 3IR6A 3T5AA 4J4BA 1GL9B 2QSJA 3LK6A 2V98A 3N74A 1SAYA 4U2FA 4MKRA 4NJMB 4WECA 5EJMA 3U19A 1PR1A 3C6ZA 2ET6A 4U8GA 3ZLTA 2QMHA 1P72A 3SXYA 3B1FA 5B53A 1ZW6A 4WNAB 1ABFA 1SCUA 4L16A 1F9NA 1J99A 5DX8A 4US0R 1GXSA 3QPLA 1JIIA 4ZU6X 3J80Z 1JYSA 1N5JA 5DOZA 3OSUA 2NX2A 1F51E 4E1AA 1UBHS 2K6GA 5EESA 3ZHUA 3HXLA 2XB6A 4X1KA 3W5CA 5FBLB 3AVVA 2VYND 2VJBA 4N47A 4Q3KA 4BMPB 3MERA 1IE3A 3HOVJ 3QEMA 2P4WA 4IJ6A 4RD1A 3V1KA 3FOWA 2BAGA 1REPC 5BSFA 1ITZA 4BC1A 3G0DA 4IQ0A 2IKQA 2WM3A 3ZDYB 1QRAA 3DKKA 1PN3A 4FI3F 2HCFA 2DPGA 1PQPA 2YRXA 1RWKA 4HX4A 2P67A 3SQLA 1W8IA 5K3FA 2ZXIA 4N4NB 3MLEA 1IN8A 421PA 3ZHCA 4KVZA 4WXCA 4IY1A 3GYBA 1JBEA 3IH5A 2O2GA 2BEVA 3H2BA 1LPSA 1TTYA 1M34A 1Y9AA 4GM4A 2X0RA 2PHZA 5IMBA 2FOLA 3QVSA 6GPBA 2WUEA 3IXQA 2O14A 2DR2A 4JL5A 4GKJB 4AC9A 2IY7A 4L27A 1II8A 1U0NA 4HGRA 2AXNA 4MGKR 1DAPA 4O2BF 5JSYA 3HYCA 5AKGA 4B9EA 1H88C 2CXRA 2CY0A 4PSAA 3F47A 4GFBA 1SBTA 3AF2A 2R6FA 2JN6A 2WHEA 1Z63A 2HOSA 3JRXA 3AUFA 3PNKA 2JGKA 2X1CA 1DIAA 4HDOB 2VP6A 4U00A 4I9FA 4Y4RA 4B7XA 4C3JJ 4QRDA 2I4RA 1TYDE 2JBHA 5GIPE 3D7MA 4ALMA 3NP9A 4JJFA 2O2EA 3NBFA 1NBWB 3NAUA 1RJ9B 5AIBA 2FMTA 3DFGA 3S29A 1XVLA 4XGNA 2BZ1A 4FBGA 5LZ5A 2VPYA 4F86A 2WJ6A 3R7WB 2K9QA 3ELWA 3A1UA 1JT9A 1JHHA 1L4GA 1E0KA 1T1EA 1H4TA 2CDBA 4E7JA 2C04A 1HOMA 2OQIA 2XYVA 3K5IA 4KH0A 3VOAA 1HWYA 1W7PB 5HLGA 1SVSA 621PA 1CQTA 1U1GA 3OZFA 3EAFA 2Q8QA 2AQHA 3GFQA 3A14A 3D6NB 3AL0B 3QPAA 4EHJA 2ATEA 3Q0UA 1PR9A 2N42A 3AQ4A 1AA6A 4UMDA 3TPZA 1XTSA 2QN1A 4LFUA 1PFWA 1D4FA 1L5OA 1VE9A 3IO5A 3FDYA 1W4ZA 4PN3A 3IKTA 4UCWA 3UH1A 1SWVA 4URWR 4UUAA 1C1DA 1E2FA 2EHDA 3FDFA 4DRZA 4F4DA 4XCVA 4XDHA 4C5CA 3GBPA 4JJ7A 1E2KA 2X8JB 4RXTA 2PG4A 5JYEA 3OETA 3LW7A 3GNQA 1XRRA 1Q57A 4U7TB 1C3XA 1DZ3A 2EFEB 1I7DA 4RFSB 3ZIAD 3RRYA 3IBYA 2Q46A 4EI7A 3LY8A 4QPJC 1DG3A 5E18F 1NF8A 2TRTA 3UH0A 1IY1A 2BHNA 3V42A 5JIBA 4HTAA 3FOZA 3A6HA 5CG2A 3FFTA 4E4HA 4CSWA 2P2LA 4XD7A 3KCCA 5AVQA 1Z38A 2I80A 4XAQA 4EGCB 4BQPA 4WXRA 5FWXA 2GDJA 2R1TB 2VDJA 5HZGA 2LP0A 1QXSA 1B74A 2YXDA 1DBWA 4N7RA 4NICA 1VZ0A 4JX5A 1Y5LA 5CLLA 4GNKA 3BR2A 4AXXA 1HSZA 2VXCA 1B14A 1XZNA 3KEQA 3OZ7A 3DT6A 3WBBA 3G8YA 2GK4A 1AUXA 5EKSA 4MR9B 3P2JA 1B1AA 1F14A 4C3ZA 5E8GA 3LKZA 3HOUJ 5F08A 2R7ZJ 1DUXC 3RANA 5JSKA 3D7KA 5E7MA 1KMCA 4Q5SF 1EFLA 4HHEA 2G63A 3D81A 2AT1A 4YJ2B 3G7SA 3DQVC 3COWA 4JQYA 4LZOA 1WP4A 2DQ4A 1GPAA 1QE0A 4CL8A 3WL7A 2F55A 2BLLA 3FLAA 3TLAA 5AOAA 4AS1A 2VG8A 1NOIA 3M6XA 5HJ7A 4DSZA 2WYHA 1S7OA 2J3HA 3LDAA 2F67A 2UZ0A 1CR4A 3VX3A 3K0EA 4C2UA 3GA5A 1G2IA 2MMCA 1M1NB 3R6GA 5LZ2A 4CG0A 1AKHA 1TC1A 3O2JA 2BC9A 3H4IA 2FB9A 1OH8A 1N3YA 3EPZA 1QGED 1APBA 4M37A 3HVJA 3NJ8A 2WWWA 1B43A 4BJ3A 2W84A 5L95A 4JVMA 4C04A 2QUIA 4Q4ZF 2DDAA 3QYBA 4J1NA 3WSVA 4D6XA 3GRRA 2HCBA 1AUOA 3W6OA 3HPHA 3KQWA 3MCUA 1W34A 4YAGA 5IT3A 3HP7A 5TMDA 3P27A 4ZV7A 3TIVA 3WWOA 3UKOA 4UREA 1ELOA 2CFTA 4Q4JB 5FPYA 2I03A 3WVNA 4B45A 2DHQA 1UZLA 4KVGA 4OQ4A 4IDAA 2XNJA 4R1SA 1RZ3A 1Z0SA 3DVLA 1ICEA 2XMSA 1OFUA 2ETVA 3S14J 1ZH4A 2J0QA 3HVUA 4QFCA 4KIUA 4CN8A 2E55A 5F9MA 5BUZA 2CDCA 4KAFA 3WGGA 1YKSA 4BZXA 5JZVA 3SYTA 3QEBZ 4YV0A 1X74A 3WTUC 4M3FA 3AEKB 4RZUA 2PWPA 3NP7A 4G4SP 2R7RA 3VTZA 4UVEA 4N6GA 1P60A 2DFHA 4UZEA 2Q3LA 2BHYA 2UVPA 2W70A 3N6RA 4JVSB 2FWRA 3K6SA 3VDMA 4V0QA 3U1TA 4P7GA 1ZUHA 2Y1LA 4NFLA 1H1LA 4A4DA 2CVPA 2QWXA 2OFPA 6PFKA 2EP7A 5JDIA 4RVNA 2IXTA 3DO8A 3RKUA 2L4MA 4PN7A 1QMGA 4BO4A 3SZOA 5ELLA 4PCUA 1LWOA 5LLSA 5IAGA 1QORA 4H4KC 1XB4A 5DI9A 4GAEA 4NMXB 1A5SB 5DKFA 4X63A 1XG5A 4J0HA 2R7TA 1ZM9A 3KAPA 1FUIA 3UENA 3L2CA 1NTRA 3INNA 4FZJA 4M3NA 4A0QA 1HNNA 1UZNA 3ZHBA 2DMTA 3HGYA 1R71A 2NT3A 4B44A 4OMUA 3R7DA 1SQ0A 1EQUA 4LKRA 2FSPA 4RKQA 5DYYA 4YIIA 5AQ1A 2GCGA 3IEXA 1VL0A 4H6PA 2DBBA 2V4UA 5HMMA 5L3QB 3TUZC 1H0RA 1UBFA 1N6OA 5FUBA 3TQOA 3SC2A 4QQNA 1XSDA 2OCPA 4NDZA 4LDPA 5TRDA 2QQAA 5M5YJ 1A8IA 1B6SA 1QUFA 2PRKA 3E9CA 4UBNA 5JRDS 3TVTA 2P6OA 2C54A 1E2XA 3RRJA 1JKIA 3WK8A 4C6HA 5A4IS 3K1NA 4LQDA 5D85A 2NO7A 5T57A 1SVMA 3AOGA 3FNGA 4QUDA 4TWIA 1JE8A 1GL3A 4G01B 1GYRA 3WGUA 1NT2A 1IVNA 5CFLA 2OWDA 1KQ0A 1AQLA 5HUJA 2HD4A 2Z3WA 1FOKA 3LP5A 4NHJA 2WJWA 3ISPA 3ENNA 2ZIGA 4P9UA 4O6JA 4U63A 3CO0S 3D0OA 5EXXA 5T67A 5FH9A 4HV6A 5KTTA 3M3PA 3W79A 2MYSA 1J56A 1YE9A 1DG9A 2J67A 3GGSA 4ZDJA 2YWHA 2RIRA 3U9SA 5J1YA 1VQKI 1H6DA 2QB5A 4KPGA 3BCSA 1TK2A 3UB3A 1PNOA 2DFDA 1SD5A 4Z2AA 1UMDB 5K5RA 3A9TA 3H5WA 5M5XJ 4MDHA 4M88A 1NMXA 4ZICA 3DZCA 4TV8F 2KBEA 4MRVA 4GXQA 1HEIA 2ECKA 4AO8A 2ZB9A 1UANA 1CUXA 1M7HA 3TL3A 1SB8A 1PG0A 3HZOA 1OT3A 1OXMA 3WRXC 4BYMA 1BS2A 1RIFA 1U11A 3CW8X 3EGDB 3HEAA 2V8BA 2BY4A 2H1RA 4WNYA 4L9RA 1ZHOA 1Z4PX 4AFNA 1OXUA 1WKBA 1GCAA 2R6ZA 3OOEA 3QVVA 1P4GA 3FJYA 1Y6RA 4ZT6A 4DCJA 1LU9A 3FI9A 4HDQB 4O4LA 1Z5PA 5IASA 2DMRA 2O8EB 3LKDA 3GPIA 4RB0A 3T9BA 2MDTA 4G09A 3BFKA 3W2WA 4RW0A 1EFCA 1VLZA 1FRQA 3GRCA 4TS1A 1QPMA 4UFPA 3EOBI 3UUEA 2C94A 4PBRA 1LQ2A 1JQBA 3QG5A 2WWFA 9ABPA 4PCQA 3NYRA 4UHDA 2Q07A 4GH5A 1E6EA 1G8JA 3LFTA 2ID6A 4G4IA 1SXJA 3DV8A 4UAGA 4XTRA 4PSUA 1XTJA 3TZLA 1Z74A 3IUPA 2BM8A 4QQFA 2P3LA 4E11A 4IP0A 3DFUA 3L9WA 2ZQYA 4L8WB 3LVRE 1OLXB 1ZY2A 4TTTS 3ESDA 3MBKA 4CIWA 4TL8A 3JY6A 4KACA 4EHFA 3KK0A 3REQA 1HDIA 1CD5A 1A9PA 3EH1A 3BIJA 3CF0A 4BXFA 3LUGA 1UMCA 4HDAA 4ZVVA 1C4XA 1R0XA 3I2HA 3N87A 4A1FA 3KXLA 4FASD 4HNTA 3OZEA 3IRVA 3ZD9A 4G9GA 1T4GA 3CLRD 3D2AA 3HYNA 1ZNQO 1NG9A 2KQRA 3DE0X 1SOWA 2VBYA 4GX0A 3LXMA 5BWBA 4D99A 3OYFA 5IOYA 1I1SA 3WTYC 3RVOA 3U37A 3Q3GE 3LHKA 3SEQA 4KN4X 1MX9A 1Q0SA 3QOPA 4AQ7A 3OLZA 1DAEA 3PGMA 5C5DA 2CNBA 4OX9Y 1FDVA 1RD4A 1DDNA 4DV4B 1D0IA 1R8JA 2VDWA 1U9OA 1ORIA 4KWHA 2QGZA 2C20A 3RC7A 1CF9A 1ZKGA 1ZJ4A 4REQB 4FYIA 3QLUA 3QJ5A 3NWPA 2WWTA 2R62A 2YMQA 2PV7A 4XWAA 2W6MA 3LBYA 2J4DA 1Y6JA 2OAP1 4QXAA 4LV5B 5C8ZA 2JC3A 4HNVA 4IZ6A 4D46A 4F4JA 2PJPA 1NM5A 3GW8A 5FWNA 5C44J 4F38A 5B7NA 3FVWA 4U87A 2OAQ1 2W8ZA 3ONFA 4CL0A 4UEWA 2A5LA 2V6FA 3SQNA 4MMXB 2R86A 1MTOA 4TUYF 4Q37A 1X2EA 3FWKA 3H8WA 4BP1A 4NS4A 1GEEA 1YR1A 1J24A 1QF9A 5EMLA 2CBXA 13PKA 4HGQA 1E4YA 2X1LA 3RFTA 1G1AA 5DCMB 3O4HA 1IEWA 5ILVA 2Z2SB 3VR4A 5AJWA 3AF5A 3FXMA 1E0SA 2XCOA 1EFRD 4UHHA 2XAJA 1K5GA 1NXXA 4X1YA 5C8YF 3HGQA 2QNBA 4FM9A 1WCYA 2IUUA 4FJ1A 1E2JA 4PSCA 3VOTA 3VSBA 2ZPAA 2YVUA 4YRCA 5REQA 2O8NA 4NU6A 1UG0A 5C1DA 4OI4A 1O94A 3ORSA 3PQCA 3OTWA 1L2TA 4E13A 1JUSA 1HX7A 1A72A 2CMGA 4RU1A 4ZHQF 4JEIA 1JU3A 1QVAA 3PE6A 2CFXA 2VHUA 5AJVB 3DKYA 2GX6A 2C5SA 5BWMA 5BORA 5KSWB 2ZIAA 2VJ5A 3CF4A 3E22A 1N6RA 3VR5H 1S29A 5GOTA 5K2OA 2REOA 5ENVA 2M1BA 1UEXC 1K7EB 2C4KA 1IOLA 3EQ2A 3U1BA 1Q92A 2F8TA 4KNWA 5CJPA 4KNYA 2HNAA 2J3KA 1RJGA 3P94A 1T4CB 4OQLA 2R7OA 1ACIA 3ELBA 4ZC3A 3CQZJ 1O7FA 3HOZJ 3B6ZA 1CEQA 1VL6A 3A6PC 1K0FA 2BMWA 3VH4A 4N1AA 4L4YA 2Y1FA 2QTBA 1SUAA 1OXSC 4P4LA 1UKVY 1EVYA 2J7KA 4X84A 4D9EA 3TGWA 1ITYA 3O4JA 3VI4B 4YRIA 4XYLA 2UKDA 1Z17A 3ZWNA 2MMGA 3JU3A 3ND6A 4KE6A 3EQ8A 1YQQA 5EZQA 1V7CA 2DAOA 3SIXA 1NKTA 1A7UA 3PDJA 2VDOB 1P62B 1ZEMA 2XVYA 1QQ5A 5IN5A 1MZBA 5BQXA 1I6KA 3NNNA 2M32A 2WSSA 3PQ4A 1D0XA 2V7VA 1W36B 1H0KA 5C53B 1MH1A 2C3PA 3LSKA 3VQTA 2JD2A 3W04A 5KYVA 2XPVA 2QJTA 1VA4A 1FZTA 3FPEA 1I4EB 4LG3A 5B7PA 5TS2A 4KT6A 1E2EA 2G1UA 4WLVA 5AXBA 4GL2A 4HH4A 2BPOA 3ESRA 4PS1A 4IBOA 1BA5A 4OREX 3E70C 4CQJA 5IUNC 2CRGA 4F45A 3CUKA 4P2GA 4G6DA 1WV0A 3JPYA 2R3SA 1R8YA 3NDPA 5C7LO 1PUFA 1IN6A 1WU7A 4GMHA 1V4NA 3OYHA 5AW8A 1E7WA 2HHAA 3CW9A 2QW8A 3PNTA 1L5NA 2QQ5A 1K7SN 2Z2JA 4EY7A 1DXQA 5D2CA 1U9CA 3KZMA 1R6XA 2Z5UA 5FBVB 5GONA 3F3SA 3KKNA 4LC1A 2XTAA 2J5BA 4NMLA 4M1EA 5HXAA 1LBEA 5IVPA 4QBGB 2Y66A 3H1BA 3ROZA 3M1LA 4IJMA 4CRWB 3R7SA 3EVNA 1IC6A 4YDHB 3LP8A 1E18A 4JA2A 1E0EA 1CLUA 2RCYA 2EF1A 5DJ5A 4UDXX 4AZ3B 3QBDA 1IHOA 4XSXF 4BO5A 2HEGA 4ZI5A 3AR4A 3TRJA 5DN6D 1EX6A 4DG8A 2GIVA 3ZW8A 1H8HD 4FE3A 4WESB 2FSUA 4FXOA 5AI6A 3DXJF 1RAFA 1K68A 2FWIA 2JA6J 3J7AY 2VI6A 1U7ZA 4BVJA 1OYWA 2B25A 1FRFS 2OFFA 5CW2A 1XEWX 3QE9Y 5JY6A 4RIEA 2OE2A 1SD7A 1YA4A 3CKYA 2IX9A 5FUQA 3DBLA 3IVMA 4N8SA 2VJDA 3D8BA 2Q2OA 2F90A 1P9RA 3ETCA 1P81A 2RGRA 4MA0A 4LBYA 5DPMA 2WJVA 2YWJA 1FDIA 5KINB 1MSFC 1IUYA 1C81A 2UYOA 3GA7A 1DAHA 1SH7A 3UK2A 1E9DA 4IUCS 1RMQA 2RGGA 4AWAA 2PE5A 4D3ZA 4B1RA 3K05A 2IPQX 2QORA 1E3QA 4EPWA 5I7EA 1GQFA 4ZVKA 1SVOA 1D0ZA 3PRKE 1IIBA 5LDHA 4LXYA 3P9NA 3BR5A 5ALOA 3ILHA 3GQBB 2QYTA 4V2GA 2VYFA 4WBSA 1T3TA 2OG1A 3WGMA 3QV1A 4R8VA 4EJVA 2IZ1A 1I24A 1N3LA 5F5XA 3K0CC 1O0SA 4OHYA 3R8FA 5H4HA 1LE8A 4DIFA 3PC8C 1GKKA 1QX3A 2AUTA 3RYHA 3DE1X 2XECA 5F0CA 1BW6A 3O95A 1FC0A 1X0VA 1VP3A 3QTLA 4HRIA 5T6BA 4A6DA 3CH5A 4RF4A 5GGYA 2ZSFA 4ZTUB 5C2JB 2HF9A 2ZRCA 1Y6ZA 2IGNA 2I9PA 1VYTA 3G9ZA 2BY1A 2WD7A 4KE8A 5EMJA 5KVCA 4QULA 4M9XA 1ZC4A 1P3Y1 5CNIA 4CIAA 4CLEA 5CB4B 5C8YA 2IY9A 2QY9A 2Z6UA 2HKOA 1A9SA 3A01A 2ID7A 4M1QA 4ND5A 4GQBA 3K4PA 2HBYA 2R6CA 2WIAA 3FG9A 5JADA 4L85A 1MTZA 2I1VB 3FBWA 4M1KA 3RC1A 3JASA 1MORA 3OOWA 2EJBA 3DMTA 1WDMA 2FF4A 4Z9YA 4ZHQA 3IRRA 5E6UA 1RE1A 1UBRS 2X51A 3N2EA 2ZSBA 4TWAA 2K4JA 3QM1A 4C88A 4Z2YA 4OXKA 3KQOA 1MEJA 1XWFA 2HGZA 4JUIA 1L7PA 3B1ZA 2CYAA 4GX2A 3RV4A 2G8LA 3MYRA 1YZUA 2PEZA 2HA6A 2Y1DA 5CPFA 3T4XA 2X2OA 1XDSA 1Z1DA 1AQ6A 5HPYB 1JVSA 5EA2A 4BNNA 4N39A 1Y3FE 2PX0A 4DCTA 3BL5A 4M6VA 1RYBA 4IV5A 1E6KA 3OWTA 5KAFC 2WVJA 4X44A 2XDYA 2NAZA 4B32A 2VJLA 4WASA 1E3DA 4XEUA 4ZH4F 1PX0A 3DGFC 2G1KA 4LWQA 4DJ5X 1GQYA 3WR5A 2H4HA 2OK7A 3GUCA 2VYVD 2ZTLA 3RI3A 4OJMX 3QLEA 4RAFA 2JGMA 3F78A 4KMOA 1FMJA 4PANA 3L8DA 1QIIA 1K9SA 3VNSA 4JQCA 3BG9A 3FMPB 4IGKA 3O8OA 4D42A 2YOGA 3GLFA 1XD8A 2LD5A 1SVKA 1UWVA 4EHAA 4HH1A 1VB5A 3CRQA 4MWTA 2FZ4A 4I6GA 4AJ2A 1QU3A 3FTDA 3PIDA 3KE8A 4ZO4A 2OCKA 4UQOA 4HO1X 5BR4A 4DC0A 3UUWA 1XZCA 4CDRA 4DMCA 2B35A 1JT6A 4JVNA 6NULA 2E2JJ 4DBQA 1IRXA 3RS9A 2HTEA 2DFIA 1WSAA 3L92A 2X6OA 2QX8A 1SCIA 3DLAA 2Q2VA 1XDUA 4EHIA 3CNQS 4MNTA 2BE5F 2P3SA 2GOYA 2GDZA 2OA0A 5C3UA 2AMLA 3ZOKA 2BHLA 3AFOA 2YXLA 4LZNA 5BWLA 2VNJA 4GWLA 2FK8A 2NVUA 2LK2A 4YECA 5BWOA 4KE9A 4H0CA 3L06A 1I7PA 5E1WA 3CM0A 5B55A 4KYVA 3PV0A 3BJEA 1S7EA 1AS2A 2J3MA 4IDFA 3FOCA 2L19A 1H5QA 4MIOA 4HXEB 4CCWA 3GJXC 1NNI1 4G5SA 3BHIA 2D1QA 3IP6A 1VPVA 3LVFO 2GLUA 3EEOA 3KZZA 1ZVVA 1XTTA 1F2TB 4IQ8A 1QHHD 3ADKA 2CXTA 4RLQA 3HCEA 1XXHE 3RBZA 5IM5A 4J4TA 4NAUA 1DFGA 4QJ4A 3AJ9A 4DNOA 3NTOA 5CT5A 2CJWA 3DR3A 1T9GR 4RM3A 4MARA 3Q9NA 3KSZO 4UNIA 1VG9B 4F55A 1PYOA 3C85A 1DMSA 4R7ZA 5IHXA 3FYSA 1WW2A 4IQ4A 3GYHX 4AZ0A 1GO2A 4P32A 5I9LA 4XL9A 4PC6A 3F9RA 1N7JA 4BE2A 3EFHA 4Y9DA 4KDRA 3PQFA 5KTNA 3DNPA 2JHAA 3IILA 1I13A 3Q2KA 2FRXA 4Y6GB 4XVRA 2WJIA 1DQZA 1N2IA 3SIRA 3D8SA 3UZUA 3PC3A 2B6NA 4U8HA 2H63A 2VHZA 4KMRA 1OWOA 5DCUA 3H19A 1Y1KE 1T8WA 1O6CA 5HF9A 2GD6A 2JLVA 1D1PA 4XQEA 4AX8A 1UZUA 1BN7A 4AJEA 3BDVA 1HNWB 3TQNA 2FEKA 1E9RA 1SOAA 4U0WA 3GJSA 4A0HA 1IVSA 5E4JA 1PT5A 3CPJB 4EKYA 4OH1A 2RHGB 2CV1A 2Z9DA 2G17A 5L3SA 1PDWA 5HIMA 2WAQN 5D7BA 5EKXA 1K6XA 3KWJA 2J5PA 2YWRA 3F71A 1VE5A 5CK4A 1BVRA 3T8YA 3L7OA 1PHPA 5BMVB 5K0JA 2JLRA 2RFLA 5ED4A 6Q21A 4QJBA 3G0GA 5E1ZB 1CRLA 2GEJA 2QN7A 4JDUA 4IJ5A 1ZR4A 4TL9A 3VODA 4ND6A 2W6CX 2P78A 4WKCA 1P7PA 1O0CA 1G5IA 3K0LA 1RPAA 3THYB 2PI0A 4L8YA 1UWKA 4IO0A 4WWCA 1T2CA 1XTZA 1ZHFA 4CV1A 1HDZA 1WUKS 1ID8A 2H09A 1QZYA 4EUNA 3T1VA 2KE5A 4DCMA 3NH9A 2XAFA 4NEGA 1GKYA 3HG9A 1M6WA 2M6KA 1M75A 2HDWA 1YS1X 1EWRA 4J00A 2M45A 2DFFA 4CQNA 2NUTB 4ZYZA 2YKGA 2ZWAA 2AYZA 1YOVB 4CMIA 1U8XX 1B00A 3RFVA 2G7UA 1QHHA 4RV5A 1UBOS 1E1QD 1MRSA 1LVAA 3HP1A 1Y4AE 1TZMA 4B47A 4ITRC 2EJCA 1FMTA 4ENJA 2NU6B 1EDBA 3L02A 3HCCA 3PDHA 3IB3A 1LBSA 1O7LA 4R01A 1EQ2A 2IYLD 2XXBA 3UFBA 2YX4A 3IJRA 2DWUA 2E19A 2FPOA 3OTIA 1N4AA 2IDKA 1E2NA 1TCUA 2I78A 3AGPA 1M1YA 1ADFA 3K96A 1ODLA 4ER0A 2ZSKA 3TZHA 1NXQA 2X5NA 1EDZA 1VQ4I 5BNGA 4NOLA 2AH5A 3EIXA 4JELA 1KAOA 2FWJA 2H1IA 2CCGA 1RWXA 4X1IA 3KEGA 2O7OA 3PUWA 3G6EI 5L3FA 1JEYB 3STTA 3V6LA 3N2KA 1E69A 3LA6A 1E4VA 2E4WA 3HRHA 5B1HA 1NJSA 4C0SA 3L2OB 4XQGA 1Z73A 4A0SA 2CLSA 2EFCB 3Q0WA 1PIWA 4D5FA 4QD3A 4KODA 1WNTA 1PR0A 3COPA 3KFVA 3O94A 3G23A 3DXZA 5KZMB 3Q9LA 4ATNA 1P6QA 3OYIA 5D5QA 3JYQA 1Z3IX 4MRRA 1EIWA 1I4DD 1PGPA 5K8UA 1T9DA 2XUQA 1EUCB 4CLOA 3G71I 3KE9A 2BP7B 2Z1NA 4WI1A 4AD9A 2ODWA 2CF5A 3ZH9B 1GNTA 2I62A 2RGYA 2B98A 5DF1A 3W6VA 3GLIE 4BLVA 5K7FA 4NTZA 4UBJA 3ZD8A 2A6HF 5KNDD 1O97C 1PGJA 1UK9A 4ODIA 3PHGA 5JAPA 5G40A 4AN0A 5EIBC 4FFOA 4FZRA 4CCYB 1XALA 3G13A 3K8OE 1GZVA 1U7OA 1X1RA 2QAGB 1A2KC 4CQMA 1C8VB 4QWMA 4EITA 5A5EA 5JCJA 1Z5ZA 4DCGA 2MC4A 2N46A 5DX1A 2FN9A 1E2QA 4E7SA 1M2VB 2XGSA 3JQAD 5KTMA 4AVPA 1UQUA 3KXKA 3R41A 3ONNA 4JHLA 1Q0LA 1CUDA 2VUMJ 4XRSG 2ZJYA 4F72A 1RI2A 2Q3FA 5EZYF 5JNTA 4G65A 2V26A 3UMYA 1CIVA 2GH1A 5HKKD 3TL4X 4AT1A 4BBAA 5C7OO 3RFCA 3MD2A 3GJ0A 2KP6A 2ZUFA 1R5GA 4R9VA 3KPVA 4ZT7A 4U7JA 2VATA 2GXSA 2BGRA 4U2GA 2VP4A 4J7UA 1JQJC 3IOEA 4FIZA 4QU9A 1YQUA 4UVBA 1QZTA 3VZPA 2R4UA 4G0VA 4D4JA 1D2MA 3PDIA 5AVZA 4KNVA 4ZO6A 1DKRA 4Y7DA 2FLKA 3MAAC 2RHDA 4XB2A 3RKXA 4KITB 1BA3A 2ID9A 5K4GA 4A0GA 4FZ5A 4I8XA 4C3IJ 4D9MA 4ML3A 1DINA 5I7AA 1M2GA 1JMVA 4OQDA 4R05A 1TTHA 4PG6A 3H4TA 4RO0A 3UK6A 3RUCA 3UKJA 1UJCA 4B17A 3FTQA 3FWZA 4ZEWA 1ZG3A 3IQIX 2XRYA 3PQ6A 3Q0VA 5JO9A 1I3NA 5A4JA 5KYGA 4NYJQ 5K99A 5F77A 3MS4A 4KPYA 3GVAA 4PPNA 1ZRHA 3NWJA 3U81A 2C42A 4G8JA 4MTCA 5MHTA 4BKUA 2PCJA 4P93A 4UAJA 4R1NA 3P0RA 4FJ2A 1Y7HA 4O4JA 3EPLA 2K2QB 5M3BA 5AOBA 5C8DA 3Q3SA 2ACKA 5JD4A 3ENKA 5KNDA 4RENA 3DTNA 4EAQA 1OVGA 3DONA 5F33A 4F56A 4GGOA 2ZLBA 1N2EA 4UPEA 2I55A 3I8OA 2MH9A 4NJMA 4XBFA 1N7HA 2IDZA 5KYUB 5FFMA 1E94E 1M0WA 4MV4A 4TN1A 2AR7A 4R9SA 3E3MA 4WNAA 1NW5A 2Q5QA 3CZCA 2J3DA 5E20A 4DCCA 4NARA 2J4CA 2HPHA 1WQ1R 4B7UA 1OBOA 3SQWA 4UV8A 3EUFA 3JWIA 4BACA 4V24A 2BGCA 5E79C 3VSLA 2FUG2 3VEPA 5CYOA 1U0GA 3S3OA 1TK9A 4N6OA 2WC1A 3FNQA 2X1DA 1YB7A 1ZJYA 2PKWA 1P2FA 1TT7A 1EX1A 5HKKA 1TKAA 4O3MA 3PSIA 2FPPB 5BV1A 1ZSVA 1G60A 4PPYA 5DW3A 2ZCWA 4IJQA 1I50J 1SIWA 1U5AA 1TLFA 1JJ8C 4OJKA 2AEEA 2P2SA 1DAOA 2MA3A 1Q14A 4BQOA 1XRJA 2HGSA 4WERA 4ZN6A 2RBEA 5EGNA 2I87A 1XLWA 2C7GA 1ACLA 1I39A 1GG5A 2ZYGA 1ZHHA 4ZTFA 3KP2A 4IJUA 3DDWA 4K9KA 1P9QC 1U65A 3BM5A 3KOMA 2GNAA 4B34A 4OQFA 3NQOA 3ZE8A 5CP8A 5CFPA 3R0XA 4JFAA 3A6JA 2FMYA 5CM9C 1FSZA 5CA0B 5JMPA 3I4FA 1Z0JA 1TC3C 1XTVA 2P75A 4X6LA 4CLHA 1NW9B 3BQZA 4ON9A 3OZAA 3DL7A 3CWCA 4P08A 3S1SA 1UC5B 5ESXA 1TA4A 3R75A 2BF4A 1UBJS 1BX3A 3GD7A 2GILA 4I36A 3ESAA 3HCOA 3L1UA 2OCLA 1V9SA 5B1IA 2H8WA 3OYJA 1XA0A 4IIGA 1W9MA 1OX6A 1E3SA 5B4TA 3ZJ5A 4YJHB 2JI9A 1U3VA 4C6RA 4EL5A 1COWA 2XC7A 1RJ9A 2OSVA 3TK1A 3ZI4A 3JQGB 3D6FA 1QF7A 1JG2A 1ZVKA 1HFWA 3PJDA 3L8ZA 3BRWA 4DB4A 3E7WA 4X66B 3R7WA 3SOZA 2AKAB 4F21A 1IUFA 5H8WA 5CFOA 3F8CA 2NPOA 2HHLA 5AD1A 3DP7A 1O6GA 4D9NA 2UU9B 2Q6OA 4DKXA 2IA2A 1JFFB 3DL4A 1UMQA 1JKFA 3TJRA 4DPLA 1W7PA 3NH6A 6YASA 3IDQA 4FINA 2BV6A 3HYTA 2Q41A 2BTEA 4MUFA 4N8DA 2XNKA 2ZT7A 3DO5A 1JFRA 3N05A 2UZKA 4QFBA 3ZR8X 5T8KC 3PNOA 1LPAB 3RQSA 3OV8A 3Q12A 4ZFNA 3A6ZA 2JGDB 3HHPA 3C18A 2XODA 5CVEA 1CY8A 3GNLA 4FKZA 2DKFA 4DDUA 3WRYC 2R7AA 4YRRA 3FOAA 4RGUA 2F59A 2A61A 2QYOA 1CP3A 4WQMA 3FDIA 1GL6A 5EJ4A 2KRHA 3GFIA 3EG9A 1KYXA 3VSAA 2OC9A 3DXXA 2X8JA 2WADA 1DIRA 1CHDA 1NH3A 3LUPA 2QJWA 3PYXA 4Q9NA 3BTUA 4PZEA 5ALYA 1SZDA 4UVHA 3AJRA 3RYFB 2RNJA 1V8DA 3STUA 2AC4A 4G0XA 5EZYA 3VGPA 4UARA 1GGVA 2PVSA 1EVIA 3V33A 4KN9S 1KU3A 5A4KA 1Z88A 2HLPA 1VG8A 3KP7A 4JOQA 1CR0A 4LF8B 4MI9A 3F6CA 1DGQA 5FWYB 5HOOA 4R16A 5I4CA 3GRAA 3TEJA 1M1UA 2OCCH 4XRFA 3MS2A 5IWCA 2JA2A 3W5AA 2BGLA 1IYZA 3IAS2 3WDMA 2P4HX 4XD7D 4IFTA 1CEEA 3QA9A 3HCBA 1TI7A 5JRJA 4AS3A 4ZDWA 4MPDA 5A9SB 1IHYA 1CP2A 4MR9A 2YV2A 1JVBA 3J7YJ 3NTRA 1GVHA 1H6BA 4GX1A 2NU9B 2HY7A 2HFKA 5C0OE 1E4OA 4YJ3B 5J6XA 4YJ2A 4P5PA 2PGJA 1M10A 3U7QB 4GF5A 5GM2A 2IGOA 2DW4A 3J80K 4NZMA 4V2UA 4F5EA 1B0AA 1SOMA 1OKKA 1YASA 4ZDKA 1EIZA 4OSPA 4TTVA 1F2DA 2BGJA 4K8RB 3OYNA 4QUGA 3VO9A 3PENA 1G9XA 4FD3A 5CW1A 5DGIA 1AB6A 1XZGA 3W8FA 5D84A 1OUMA 1M1NA 3R6DA 2TCTA 5JANA 3FOEC 1X7GA 2BBWA 1CK4A 4N7JA 1Z6YA 3KT3A 4HRYA 5CXSA 3TQFA 3AUJB 3DB1A 2OD9A 5TQJA 3BRCA 5KNBH 1TZCA 4OIMA 3DW1X 4A6EA 3M1AA 1BVYF 2HN9A 4XUGB 3W9SA 3I56I 3AKCA 2P7IA 4NJEB 4AZVA 5E3OA 4QJ3A 2NO0A 1Z4KA 2NO6A 4MYHA 1OPCA 1YVUA 2ZE8A 3EIQA 3FHTA 4Q4JA 1OBHA 4MO2A 3KPUA 3UYLA 3ICPA 3WK7A 2XZTA 3NEJA 5D1NA 4JLDA 5BNTA 2COUA 2ZR0A 3T7EA 4AJ4A 3LDFA 3PGKA 4KLRA 4LMAA 2HNKA 4UE2A 4RANA 5LD2B 1TQ2A 3GZ5A 2CUZA 2C8VA 1V2GA 5KCMA 4LXQA 3F97A 1G59A 1N2CE 3ZTTA 3M1CA 2PAFA 4NX2A 4DNXA 3VYTB 3AEKA 3VNRA 3HDGA 2R7MA 2F5FA 5T3YA 2AS0A 1VI5A 4A15A 4X6UA 3ZYCA 4O4LF 4UUTA 4U1RA 4WV3A 3HBLA 1CUFA 3VGJA 4CI9A 5DYNA 1THMA 4OQYA 1XDWA 4IOMA 5E3IA 1E1DA 5SYNA 4QX6A 1XAGA 2OV2A 3V80A 1DFIA 4XQ0A 4RGVA 1PR4A 1HXDA 4Y6RA 1OFIA 4UVDA 2QHXA 2IHYA 2ADOA 2MR5A 2HUPA 2QRZA 2R7NA 5D51S 3KUDA 1GZ3A 3OR1C 1EP3B 3NRVA 4JLAA 5DEOA 2QBYB 4GZ3A 3FSRA 4AYWA 1TZBA 3E9NA 4MIKA 1QCDA 4J3JA 3VU8A 2C99A 5JYCA 3FNHA 2JPCA 2AB0A 4KXVA 2IX3A 3G6KA 2IH2A 4U6QA 3U48A 5L3QA 4UD6A 4Q7EA 4H0FA 2Q5HA 5LMCA 4HMOA 2F3PA 1MPXA 1USUA 5EQJB 1USIA 1RRFA 3OCXA 2A67A 3FMRA 4Y15A 4UQLA 1HL3A 5AK4A 1WRBA 5EJ8A 4RWZA 2R7FA 2Z3ZA 4FNAA 3UAWA 1DOHA 2VQ3A 3AR7A 1T5BA 1X1SA 2XNHA 2CNOA 2R7LA 3O90A 4DF3A 2ZBKA 3EHDA 3GU3A 4AVYA 4YHHB 1MQ9A 3AV3A 1CUUA 4KQ6A 2PUJA 2JGNA 4UE3S 4R0MA 3PIPF 2JVKA 1JKOC 4BKXA 2ZAIA 3Q0IA 1LNQA 4CQLB 5AONA 1HY3A 1CNMA 2XB2A 1X86B 5J63A 1ZMTA 3W6UA 1JR6A 3HWSA 4WOCA 2JWTA 1T2VA 5FO1A 3S7TA 3OZVA 4WZZA 5KS2A 4XIYA 1PLKA 3GJ6A 1IWBB 3EZXA 1RFLA 1UMDA 1X1AA 4I0AA 3GCXA 5B57C 1XSXA 3IV6A 3RKSA 3D8HA 1JG4A 1VIDA 3TXAA 3THSA 2D6FA 3EGDA 2IYSA 2RARA 2G83A 3CLTD 2GTHA 2OBNA 1U8BA 1A76A 1ZIPA 4OINF 3WTBA 4OFBA 3F6VA 2NYUA 2CHEA 1M6VB 2HU7A 4AWXB 3PG5A 3BD9A 4K6MA 3SYRA 4B3MB 2A7XA 5IY5H 4KXFB 4OYHA 3C16C 2O8EA 3HXQA 3QEKA 5EL0A 3QW2A 2ORYA 1ML4A 4NBLA 1ZD5A 2B82A 3HCDA 2X2PA 1X7WB 3KZKA 3S2EA 5F7ZA 4CR6A 2H85A 4IO1A 1DEHA 4RMGA 3VC7A 5AP9A 1YL5A 4EEKA 1KQ8A 5DUIA 3ZV4A 2XVZA 5E4TA 4F60A 1B8NA 5HDKA 4P5DA 1JAYA 5DLYA 3FCCA 1F8YA 1OBVA 1GAEO 3OMYA 3CCSI 5C4JJ 2WJGA 1EFVB 2WZQA 4FMPA 3DFKA 2VYCA 4UXJA 3W2EA 1HQDA 2X77A 3F6OA 2QVXX 3BTIA 2QJOA 2XE4A 3JQFA 3CP8A 3LQ4A 1SXJD 1OLXA 1K5PA 3LLSA 5YASA 4F8YA 4E3ZA 2YNMC 2Y93A 2FUG1 4GP6A 4ZAVA 2UUPA 4F96A 2HIAA 4CDNA 3C2QA 3UK1A 2L7ZA 3EXIB 1IXYA 1EUDB 4GM0A 2VIXA 1G0NA 4TL6A 2NXEA 3J81k 3OKCA 4ZEVA 5F2KA 2Z4RA 5FTWA 4YMTA 1JSXA 2W6PA 3GCGA 1IZ7A 3WGOA 3IODA 2PL1A 1UFVA 3I37X 3CUVA 3IHWA 5D5PA 1XV5A 4WOKA 3AF4A 3C5VA 3IGFA 1W2GA 5KO2A 3BIFA 2BHSA 3KQKA 5J1SB 4JBAA 3HJEA 4ZVPA 1SU8A 1KSFX 4H59A 2ODPA 4RCVA 3DL0A 1LLCA 4I9NA 1VG0B 3OI7A 1TRHA 1ETUA 3A6EA 1TJ4A 1KH2A 1P4JA 2LDBA 3T7DA 5K6AA 2QGNA 1UPUA 3G6WA 3BGWA 4L5AA 1QUEA 4REQA 3BERA 1P6RA 2JARA 1U7WA 1FX0A 1XRLA 1B73A 2YN2A 5BQFA 5BV2P 2I34A 3AY0A 3X1KA 4D79A 4NESA 1QR2A 4CMEC 2UZ4A 1Y6FA 3HDDA 5ITWA 4DSNA 3DP9A 4FNGA 3CDIA 1H65A 3OX3A 3JW4A 4EDFA 3ADBA 3OC6A 3WLLA 3UV6A 4NZPA 1FY7A 3I6QA 3OICA 2WA2A 3ZWWA 4W9NA 4G9BA 3DOHA 3NWEA 1MX1A 2ACWA 1O6FA 1QCZA 1HC7A 5AM5A 4PZYA 3UEOA 1QM5A 1XELA 4ZQBA 4H1WA 2R00A 2CHQA 5DCMA 3QTBA 5A03A 4MGHA 1GLGA 3OLWA 4HN4B 4AY3A 4QREA 4WDRA 3QI7A 4OQMA 1SCNE 1G4UR 2J6BA 3U4MA 1WQ2A 3CV3A 4MVCA 1TYBE 5GONF 3ZDQA 2X14A 3LRXA 2NXWA 3L4SO 2VNSA 3VR4D 4WLNA 4N3AA 4EK9A 5CYPA 4MITA 2P5KA 1MKYA 1U8TA 2XW6A 2WZBA 3C3BA 2H7VA 3WMWA 1D04A 3H5AA 2PKYX 3T1QA 3COZA 1O94D 3GGCA 3RJTA 3PL1A 4HMQA 3CUQB 4D8XA 3IMEA 5B1BH 5TJ9A 4ZRDA 4NNJA 3DDHA 4KR9A 5F2NA 1I3QJ 4G7ZF 3QE2A 5CEJA 4DR7B 1ULHA 1MUUA 2EDAA 5TT1A 1E6UA 3X1YA 1FUEA 2DFNA 3IAHA 1DOAA 2CXUA 2GBFA 4DCUA 2LCFA 4B3DA 3S32A 1M9NA 3UT0A 1T4CA 2XBMA 1FW6A 3FCUB 4NDLA 2ZUCA 3T7KA 3L82B 3KIPA 2GN1A 3VKFA 4GP7A 2JDID 2BHRA 5AUQA 2IW3A 3RSLA 2RHWA 1F8XA 2WHPB 4YR7A 3PFHA 3K0FB 3U1KA 4BX0A 3AZPA 3I23A 3PC4A 5GGXA 3HYRA 3RBXA 2UUCB 4QPQA 4J1TA 1P1KA 3ZEAA 4HKTA 1PJ3A 4F2WA 3MUFA 3WLKX 1FBTA 3WOHA 1CS4C 5E9JA 1IEVA 3F1LA 3IAS1 1OFGA 1RPWA 4E51A 5AQEA 5ICGA 2ZYSA 1XAIA 1DIHA 4QLCU 3QYJA 4Q18A 1GCOA 3FROA 1JHXA 3AK4A 4ND3A 1HQCA 4MEBA 5DO9A 2NNWB 3ZCQA 3N8IA 5H16A 1G4DA 3WDLA 4LFBB 4N03A 3T7AA 4PQFA 4MGEA 3E7XA 2EW1A 4KQWA 3BL6A 1TFUA 3V48A 1K79A 2WSSD 1USSA 2R97A 5J1TB 3W8RA 2WVHA 3DWFA 4REOA 4K9NA 4EVQA 3KBBA 3RKYA 3P9CA 3I05A 3WKEA 3QP5A 3L0ZA 1EJ0A 3MTJA 1WXDA 7GPBA 2PUVA 1NBME 2O3RA 2COKA 1DKUA 1DMRA 3L7KA 2NZXA 1CPYA 3FJOA 2Y69H 2MSLA 3D64A 2JFUA 3WNDA 3CIFA 3UJ6A 4LXGA 2B99A 3FFXA 3LMMA 2QM7A 2P69A 1NX9A 4H6XA 1F60A 1UR5A 5HIIA 2Y92A 1SVWA 4IL5A 2JFNA 1EGHA 3ZV5A 2HU2A 4JY7A 3LA2A 4LZJA 4BNXA 4RK5A 2P65A 3CUOA 4RFLA 4P82A 3WHPA 3O8BA 2RBGA 2UAGA 1L8LA 1Y39A 3IXMA 3Q1KA 1ORWA 4J0DA 1CRWG 3GEBA 3PUBA 4C7JA 1OJLA 3MLBA 1FE8A 1NVGA 4EG3A 4D5GA 2C61A 1YK0A 1RRJA 3R0VA 2WF9A 1BDMA 1L4LA 2AFIA 2ZJ0A 2GS9A 1O03A 3KD2A 4D3SA 4G85A 3WTXC 1T8SA 4G9EA 2CQXA 2PDAA 4PYIA 4O4HB 2ZTHA 3DV9A 5AOCA 1VKRA 2YL2A 3CLUC 1H2HA 1W85B 2X9GA 1L7VC 4AKIA 4TT3A 1FTSA 2F3RA 1SZPA 4J6FA 1RKXA 5AVWA 5A1TA 5DRYA 2JDIA 4WESA 1F7UA 3RRFA 2GBLA 2HK8A 1EF4A 4I02A 4B85A 1E6MA 4K6FA 3ELKA 2QX4A 3ZLJA 2E1CA 2W6NA 2C2OA 2LD4A 2DSTA 4H35A 4R9UC 1P44A 2XKOA 1FXSA 2FAXA 4FQ7A 2GUGA 3N2LA 4GPEA 4GWGA 1L5RA 1RJDA 1BOBA 4KQCA 1NL3A 5JNWA 3AG6A 3RVLA 1E2HA 3U0VA 2PPVA 4C5BA 5GZ3A 2UXDB 2FX2A 4KI0A 3AUSA 1CY1A 3LA7A 1G21E 2IJLA 4IZHA 4IGIA 1N5KA 3LU1A 5BPIA 1EP2B 1SKYE 4NMHA 3KZIC 1NW4A 3OE7A 4PFPA 5I9BA 2OYCA 5ILSA 2C0QA 8AT1A 4IX9A 1ZREA 1KRHA 2XWPA 4HDUA 2J5RA 2PL3A 2DHCA 4Q1AA 1GYPA 3WGHA 5JC8A 3NTUA 4LY6A 3WHIA 3GQBA 2EQRA 4ZZ2A 4I2VA 2FSVA 1FNNA 1WS6A 2DQSA 4M7OA 4KISA 1GUZA 2F1OA 1X7HA 3FZEA 4E94A 5BMVF 4MWSA 3RTDA 2OM2A 2WT9A 4IXMA 1I0LA 1ZXLA 1XZMA 1Z4MA 3S1QJ 3D6VA 2J1LA 1ORDA 1YR2A 1UPFA 3IMCA 2VT3A 3MA0A 2DA6A 2WFMA 2DULA 4OMZA 1SKBA 2BFMA 2Q3CA 4JXZA 3V1NA 3DB2A 4Y30A 2WJAA 2J45A 1OA0A 2XMBA 5EE3A 3TP0A 2ZI3A 1V5FA 5E3JA 2C00A 3OOUA 2E2IJ 3GN2A 2E87A 1EEXB 4BKMA 1FP2A 3IO3A 4HB4A 5CB4A 3VPSA 1OPRA 1M2NA 3EPJA 2H06A 2E4UA 2TMKA 3WMXA 1G5RA 4WINA 4MS1B 4HYQA 1TECE 4M9ZA 3WTSC 2V79A 2RVCA 4PJMA 1XN4A 4KXYA 1Q11A 2GMWA 3MAGA 4YC7A 2ILVA 3VHRA 1XDDA 4FOTA 4HF0A 4A92A 2BTOA 1OV6A 4LJ7A 4L5EA 4DDKA 5GZ1A 1NLYA 3HB9A 2C9BA 1Q0HA 2BHZA 3UCXA 2O2IA 1EM8B 1PGOA 5AKXA 1G66A 2DPMA 2WC2A 1RYMA 2UVDA 1U4SA 4M22A 1A7AA 4AMUA 4DVGA 4XLTA 1ULZA 5CXXA 1O1YA 3M49A 4BLUA 1TBXA 4B4VA 3J81Z 4UATA 1QVRA 1ZH8A 1RXVA 3FX2A 1XEXB 3U9LA 4P7JA 3BROA 4EFKA 4G6TB 3UM9A 1A6IA 2GK3A 4HMPA 5LQSA 1YHQI 2VDKB 3SBDA 3RF6A 4ZOAA 3IA2A 3JS5A 1JVNA 3PSAA 5FA5A 1GSOA 4IDCA 3WWCA