3HC7A

Crystal structure of lysin b from mycobacteriophage d29
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
SKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMWPSVEKGVAELILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHILPPTGRLHRFLHRLKKVIFWGNPMRQKGFAHSDEWIHPVAAPDTLGILEDRLENLEQYGFEVRDYAHDGDMYASIKEDDLHEYEVAIGRIVMKASGFIGGRDSVVAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPHLYNRYPAVEFLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacteriophage Lysin B is a novel mycolylarabinogalactan esterase
pubmed doi rcsb
source organism Mycobacterium phage d29
molecule tags Cell adhesion
molecule keywords Gene 12 protein
total genus 90
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1120 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hc7A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hc7A01
4J0KA 3WK8A 4Q3KA 3RM3A 5IVHA 3FCXA 1WPXA 2CJPA 1ZGCA 4JYPA 1H2XA 1EVEA 1W76A 3C45A 4FBMA 4QWWA 3WWOA 5FXMA 1Q0RA 1YSCA 2Z8XA 5K3AA 3D4LA 1K4YA 3RK4A 5ALQA 5A2GA 4AN1A 4DYHA 4B9AA 3W06A 4E46A 3BDIA 4RGYA 4C4YA 3GROA 4YASA 2AJ8A 5T4BA 2HA2A 2ZYRA 5JATA 2OGTA 4EY4A 1DTEA 4L72A 2YASA 3C6YA 1BU8A 3NOXA 4W1RA 3WKEA 2OG1A 2EDAA 2VEOA 2XLCA 1ZI9A 3KXPA 3O9VA 1CUFA 5DYTA 1CEXA 1H2WA 1XZHA 4QDUA 2WFMA 4WDQA 2XT0A 4DM7A 3C6XA 4EUSA 2JEZA 2WIFA 5EIEA 4P9NA 3WK4A 1SFRA 1M33A 1VZ3A 1JKMA 5AKLA 1UWCA 1UKCA 3IVMA 3DD5A 2JBWA 4GHWA 4ZRDA 2H9YA 4BC1A 3FYUC 4U2EA 1DT3A 1YASA 3M3DA 1C4XA 4M0EA 2XUJA 4ZREA 4IH1A 2Y1KA 2QMQA 4OYYA 4MYSA 2XLBA 1GQRA 5E4TA 3WL6A 4IHAA 1G42A 4QDOA 2PU5A 2JF0A 3AINA 1XLUA 3EQ9A 1EB9A 5AK3A 5AJHA 4XVCA 5AK5A 1FFCA 4F21A 4MWSA 1UK8A 3HEAA 5AI6A 4OB7A 1GZ7A 5AI0A 2QUAA 3KDAA 4H18A 1XQVA 3H2IA 4B85A 4DLNA 3FYUA 3IUQA 3F98A 5CH5A 1HDEA 4FKBA 1ODCA 1QJ4A 2HA7A 4Y2TA 1CUDA 5JYCA 1DQZA 4BDTA 2I78A 1MX5A 5FPPA 2WJ6A 4UFOA 4QWMA 3QITA 1UT6A 3MUOA 5K3DA 4BP8A 2PVSA 5DYYA 3X3HA 2ROQA 2WLSA 4LKOA 1MT3A 3BF8A 1CLEA 1TCBA 2C7BA 2GBGA 1VLQA 3WKAA 5ALTA 5AI5A 5JD5A 1SC9A 2B61A 2W6CX 4RE5A 5CXUA 2HFKA 1ZI8A 4B84A 2C0PA 1D07A 1JU4A 4JYMA 3UUFA 4WJLA 3DQZA 1YAJA 2OPHA 3RARA 2C5GA 1A8QA 5DWDA 2OCGA 5DTIA 1E8DA 4UBKA 4MEAA 1F0PA 3VXKA 4QZVA 1YS1X 1B41A 5AM5A 3FSGA 1QTIA 2WHPB 4MYDA 1LPPA 4UBMA 2XUAA 2XUKA 1SCQA 1HLGA 5K3FB 4ZXFA 1PV1A 1YB7A 2WHPA 2CUTA 1QONA 4X95A 1UKAA 2ZYIA 4QE3A 4BVJA 1CUIA 5AKGA 1S8OA 1LBTA 1QOZA 3DKKA 5ALLA 5ALMA 4H77A 3WJ1A 5CBKA 4QDTA 2XI4A 1GKLA 4IH4A 1K8QA 4A23A 3DLTA 1JJBA 4HZGA 4LYDA 2G63A 3FLBA 3O4GA 3CCCA 4CG3A 4X00A 2CBGA 2ZJ6A 1QIHA 3ILSA 4Q3OA 1JJFA 1SOMA 1CIJA 2XUGA 4Q1VA 4BC0A 4LXGA 4ARAA 4TVKA 4BVLA 2VSQA 1CR6A 1FJ2A 4CI9A 4JEIA 4G8BA 4LHEA 4BATA 1QFMA 4BRZA 4PV7A 5HF9A 4MWTA 4BCCA 5FOQA 5YASA 4AB1A 5LP1A 3W05A 1MJ5A 5DJ5A 4X90A 1QIFA 1UOPA 4AXBA 2WIGA 5DTJA 2DQZA 2XMCA 1MTZA 1NU6A 4OUKX 3AFIA 1Q0ZA 4AN0A 1JT2A 1DU4A 4H7IA 3WKBA 5HZGA 1QFSA 4J0CA 1JJIA 1ORWA 2C58A 5AP9A 4H7HA 3S2ZA 3HZOA 4FHZA 4AO8A 2PBLA 4Y2XA 5AKEA 4Z49A 1N5RA 1DWQA 4C88A 2Z8ZA 1JU3A 4BAGA 4FFWA 1BN6A 1WHTA 4G4JA 5AKKA 1XZJA 3V1NA 1TCCA 5AM1A 5EFZA 4HXGA 2BFNA 5ALWA 4LXIA 2CZQA 5T4FA 4H7FA 5FUMA 4EBBA 4BTVA 2H7XA 5HF5A 2RONA 3WLAA 3IBTA 4FOLA 3GBSA 2Z3WA 3SX4A 1CUVA 4P92A 1K6EA 1CV2A 2YH2A 3AIKA 5AKZA 4I4CA 1AZWA 4PF1A 2WTNA 4K6HA 4AMYA 2DR0A 1YA8A 1CUBA 4BCDA 1LZKA 2PSDA 4UFPA 5ALIA 4Y2PA 3V1KA 4AO6A 4Q82A 2WG2A 4U2DA 5ALXA 2XQJA 1Y7HA 1UFOA 1VZ2A 1P0IA 1XKLA 1CUJA 3FYUB 3HXKA 5JAPA 1DT5A 3HC7A 4PNZA 5ALEA 4J0DA 2RAUA 3IUJA 3BIWA 4I3FA 3WWEA 3MVEA 3H2HA 3DL4A 1AGYA 2B20A 3WKDA 1C7JA 1BCRA 4L9AA 2EEPA 5CT6A 5LKRA 4DNFA 5KWJA 3G9TA 4ZV9A 5AM0A 2C5FA 3WWDA 3QM1A 3O4JA 5E4JA 3BXPA 4N8EA 5EIAA 3GFFA 3H2GA 3FAKA 1CFJA 2HU5A 3UUEA 5LKAA 1XRQA 2O2HA 4INZA 3D7RA 4OSEA 2ZVDA 5AHXA 3DL7A 3G8YA 4BB0A 4DGQA 2H1IA 2PSHA 3FWHA 4KEAA 1A8SA 1CUZA 2FX5A 1XZAA 2QUBA 3L1HA 2WU3A 1XZEA 4G9GA 4I19A 1YCDA 2XUOA 5C7YA 2C0QA 4B0PA 1GKKA 3W2TA 4Y2VA 5A7GA 1EX9A 4C87A 1USWA 3DOHA 5HCUA 5JAOA 2VT7A 4A16A 3HSSA 1ZI6A 2VQ6A 1XRLA 2ZSIA 2QVBA 1LPMA 5C8VA 4J0GA 5E2IA 1X2BA 5ALDA 1HKHA 5JZBA 1AURA 2PL5A 1QGED 3LS2A 2H7YA 3B3QA 1F6WA 1CUXA 1ZOIA 1ACJA 1LPAB 1ZGBA 5FV4A 4NS4A 5C8XA 3STVA 4BTLA 2VAVA 3AZPA 1P0MA 1QLWA 3W9BA 4KE8A 5SYMA 1DINA 3F8SA 1EK2A 5LZ5A 1A8UA 2PU7A 1UXOA 4EHBA 5H3HA 3PICA 4X6UA 1U2EA 5DNVA 2I3ZA 1WM1A 4QNNA 3DS8A 4AZ0A 4MXDA 5CTAA 4EY5A 2XQKA 2Y2VA 1U65A 3N0TA 5LIPA 3G9XA 4RNCA 1XQWA 1TKRA 3O95A 5IH7A 2R8BA 3AZQA 2NW6A 4KAAA 1VA5A 2HA5A 5CH3A 4E11A 3TJMA 2JEYA 1YAHA 5JANA 4EY8A 3WK9A 1YR2A 4F5ZA 4B81A 4U2FA 3GA7A 3I2IA 1ISPA 1CQZA 4CCYA 5EHXA 5ALRA 2PUJA 2WSLA 5JAHA 2GZRA 4G5XA 1R3DA 4Y2SA 3H2JA 3A2LA 2ORYA 5K3BA 5AKHA 1CPYA 3PUIA 2PSJA 1QIEA 3QH4A 3C8DA 2BGNA 5HF8A 1EDDA 1OCEA 3EQ7A 1A7UA 1HPLA 3I2GA 5I8PA 2R11A 1K5PA 5EHZA 4DSAA 2G5PA 5K5EA 3FSGD 4IH9A 2I03A 4EY7A 2WUFA 3I6YA 4G9EA 5ALOA 2QOEA 3G02A 1XRNA 3IB3A 2VATA 2B4KA 3ZPXA 4QEKA 1XZMA 3STTA 3PI6A 4Y2UA 1L7RA 4CIAA 5ALGA 3BE8A 4U2BA 1THTA 2QM0A 1Q83A 3HI4A 1GPLA 4BRSA 1G5FA 4EA6A 4EY6A 2AJDA 4XWGA 1UK7A 5CH8A 1T2NA 4WFKA 3QYJA 2WIKA 1Z68A 2Y6VA 5AM2A 3PE6A 4H35A 1QIMA 2QKYA 2X5XA 3VDXA 4J0IA 1IZ8A 1IUPA 3DEAA 4JNCA 3BJRA 4OPMA 4WFIA 1E8NA 3R40A 4UBJA 5HQ3B 1BRTA 3KWFA 1Q84A 2AJBA 4DNQA 1XZIA 3IUMA 1XZBA 3R3VA 2WG0A 4B9EA 2HA6A 5ALFA 5AKJA 3YASA 4W9RA 2VTVA 1ACLA 5AIAA 4KE7A 4UUQA 3D3NA 5AOAA 2IITA 1QIKA 2WHRA 4UHDA 5F4ZA 5I9IA 4Q3LA 3EBLA 4BE4A 1H2ZA 1QIJA 5ALYA 4W1PA 3VJKA 2PSEA 2VJAA 1IMJA 1DWPA 3O9MA 5CT9A 2O7RA 2V9ZA 3NUZA 1VA4A 2XUFA 3G0DA 3PF8A 4CIBA 4Y2JA 2XMZA 3WA6A 5AK4A 5FPQA 2WUEA 1CUHA 1J06A 2OQIA 1EVQA 4KACA 2BGRA 1N8SA 4CCWA 3H17A 4DIUA 1XQXA 4KAFA 2V97A 2XE4A 3AZOA 3FYTA 3DNMA 4LXHA 5HFAA 1Y37A 5I7UA 3WL5A 3G0IA 3PDCA 3FLAA 1Y7IA 3GELA 4N8DA 3WK6A 3C8HA 2I3DA 5JD6A 3ED1A 3AJAA 4FBLA 2ZYHA 3JW8A 3ESCA 2PKYX 5ALZA 2JGLA 4HXFB 4WY5A 2XUHA 4N8SA 1F0NA 2YYSA 2QXUA 1CUYA 2DCMA 2W22A 3LIIA 4U2CA 2JGKA 3I6MA 2PUHA 2XDWA 3WWCA 1GXSA 4S0XA 1EH5A 3BIXA 5ESRA 4J0HA 1E8MA 3ESAA 3WK5A 2WKWA 2OXEA 4UHFA 5ALHA 4HTAA 4G1FA 1IUNA 3HACA 3U0VA 4TPKA 1W52X 5AOCA 2BUAA 2DHCA 4KE9A 1IZ7A 5IKXA 4IO0A 5LLSA 3STWA 1MU0A 3F67A 4C4XA 1LZLA 4QLOA 3ICVA 5LZ7A 5JASA 4L3WA 4DMHA 1CUEA 4D9JA 1SCIA 1EDBA 2XQIA 3A70A 3KWJA 3Q0TA 1K63A 2QTBA 3D2CA 3BF7A 3AILA 2G4LA 2WJ3A 2WILA 1N1MA 3ZI7A 5EIHA 1KEZA 5KBYA 3QMMA 2ZJ7A 3MGAA 1OXMA 4AO7A 2OCLA 5AH0A 1ODTC 1HQDA 3SK0A 1UK9A 2DQYA 3I2KA 1NU8A 2AJLI 5AKYA 3WKCA 3I1IA 4GXNA 4ZGBA 4PSDA 1C7IA 4Y7DA 4LYEA 5BOVA 3H1AA 4UBIA 3FVRA 2C4HA 2CKMA 5JAUA 2LIPA 4PSCA 3A2NA 3FVTA 1A88A 3PUHA 5HF6A 3G7NA 5LYYA 2XMQA 3WYDA 2EDCA 4FNGA 2WU4A 2HFJA 3DJYA 4BP9A 2GBIA 2QR5A 2RGUA 1LNSA 2Q0XA 4MEBA 3QMVA 2B9VA 2XUQA 2P8SA 2CMFA 4WY8A 3F9CA 5T4EA 1QO7A 3W9UA 2HADA 2Y2UA 5HK8A 3R0VA 1BS9A 4CG1A 2OGZA 5J3JA 3CXUA 3M83A 4Q34A 4ZI5A 3E1GA 4C01A 4OU4A 4FFVA 1WHSA 3F96A 4H7EA 1MNAA 2WIDA 5ALKA 2HHAA 3VISA 2AJCA 1DX6A 1EI9A 1GT6A 3DKRA 4X6YA 4UHEA 4Y2YA 2D0DA 1CQWA 2HRQA 1IUOA 5A7FA 2DSNA 2HU8A 4GDMA 5JIBA 5D7BA 1AQLA 1YA4A 4M0FA 4EB0A 5IVKA 4OCZA 1U8EA 1VOTA 3HYSA 3ESBA 5HKAA 2BAGA 4UHHA 2WUDA 2RI6A 2WFZA 2WTMA 1BN7A 3IIIA 2HM7A 3A6ZA 4UHCA 1ZD2P 4TGLA 4W63A 5HK9A 5DNWA 4OYLA 1WB4A 3QZUA 4J3JA 4BBZA 3WL7A 5AKXA 1L7AA 4HVTA 4C89A 3C5WP 1XZCA 3O4IA 1E3QA 3V9AA 4HAIA 5T4HA 3G0GA 5JARA 2OGSA 2BJHA 2JGFA 4BAZA 2O2GA 3O0DA 1R9MA 2OAEA 3C70A 2ZYSA 3C6ZA 2QJWA 3LIPA 1ZD5A 3OOSA 3WZLA 1T4MA 3QPAA 5CT8A 4KRYA 1UZAA 3V1MA 5FLKA 1MPXA 4IQ4A 4UBOA 7YASA 4ROTA 1W75A 3T4UA 2WQZA 4KAJA 2G5TA 4QDXA 1CUGA 1HBJA 1PJAA 1G4HA 4W1SA 4OU5A 1WCYA 2OQVA 2VF2A 1R88A 3I6ZA 1QTRA 2HA3A 4JUIA 1H22A 3P2MA 4OB6A 1P0QA 3FOBA 2OCKA 2WUGA 1X2EA 4J7AA 3UMJA 1DX4A 3BWXA 3FNBA 4B80A 1LGYA 3QPCA 4K6KA 3FLEA 4AMZA 2J3QA 2VJCA 1DWOA 4J03A 2HIHA 4F0JA 1VE7A 5A6VA 5CT5A 3D59A 3G0BA 2XMBA 4P93A 4C6HA 1QIIA 5KWIA 5A71A 2XB6A 5AK6A 5FDFA 4X94A 4ZWNA 2X8BA 2QXTA 4UBNA 1UOQA 3HRHA 1JMYA 4BAUA 5HKBA 4YPVA 1EXWA 2ACEA 3JWEA 4UPDA 5JD4A 5LZ8A 1MNQA 4KRXA 3VJMA 4FWBA 4Y9SA 2BKLA 2PX6A 2DHDA 5CRIA 4GWLA 1VE6A 2WM2A 3ICWA 2ACKA 1MO2A 1AUOA 3AIOA 1CRLA 3DYIA 1VXRA 2XMRA 4B6GA 1CUCA 4X3CA 4UHBA 1ZIXA 5AM3A 1BCSA 4N5HX 1QE3A 2V96A 3OTQA 2IX9A 1QZ3A 1VXOA 1XRPA 1EHYA 4GW3A 4WCVA 2OAGA 1N5MA 3C5VA 5DNUA 5JZSA 4EZIA 4NVRA 4WFJA 5AM4A 4RPCA 4J0JA 3M82A 3EF3A 1GQSA 4W1QA 3DCNA 4LIPD 4YK7A 1KU6A 2FUKA 1XZDA 3QBJA 3OG9A 1XLVA 4U2GA 2ZJFA 1BE0A 4CG2A 2RHWA 2VT6A 3T52A 3WZMA 3SWWA 1WPRA 4BDSA 3VJLA 1JI3A 4MQLA 1BROA 5BV7A 1R9NA 1GPNA 1EB8A 5CXXA 1LLFA 4ETWA 4MJ3A 1ZIYA 1JMKC 4PO3X 4F60A 4X93A 4P08A 3H1BA 2GYVA 5LZ4A 2AXEA 1IVYA 3ZLVA 3IA2A 2VA9A 5JALA 1E5TA 1O6FA 2K2QB 4XX1A 4KJXA 1U4NA 2GYUA 5A7HA 4DMCA 3VKFA 5LZ2A 3WQHA 2JGJA 3MUNA 4FLMA 3WMRA 1R50A 5HQ3A 4O08A 2Y6UA 5CURA 4BCBA 5AIBA 1RP1A 2J4FA 3BDVA 4Y2RA 5K3CA 3L1IA 4BVKA 5ALPA 3I2HA 1PFQA 3NWOA 3GZJA 1XFDA 1EDEA 2DHEA 1W1IA 3C43A 4OB8A 2X76A 3I1YA 1WOMA 3KSRA 5FKJA 2VJBA 1AC5A 3LP5A 5LZ9A 3G0CA 3WIBA 3ANTA 5JADA 4UFNA 4HRYA 1EINA 3TGLA 5K3FA 4DNPA 1ODSA 6YASA 3ZLUA 4L0CA 5CMLA 4X91A 3WK7A 4C4ZA 4MQMA 3DYVA 5JZ9A 2J3DA 1B6GA 1W4LA 1J1IA 3ESDA 3OM8A 2D5LA 5C8ZA 5A62A 5C81A 1ZD4A 3RLIA 3STYA 4X6XA 2HA4A 1ETHA 3SC2A 1YB6A 1XROA 3WJ2A 4K2AA 3CN9A 3U1TA 5EI5A 1TQHA 1CUAA 3KOOA 1HL7A 2ES4A 4FMPA 2UZ0A 4B0OA 4HS9A 3I28A 1TRHA 1ZICA 4GLBA 1J07A 3BL8A 3H0CA 5D6OA 3CN7A 3IURA 1SCKA 3AIMA 2XQGA 2JGEA 3E3AA 3S8YA 1EA5A 4G8DA 1EK1A 1G66A 1L7QA 3CCBA 2QRUA 3DDUA 5FP0A 3TRDA 5EHNA 4FLEA 1LPOA 5DLPA 1MX9A 3E0XA 3HABA 3D0KA 4G4IA 5SYNA 2WHQA 1ZD3A 2JGMA 1FFAA 3GUUA 3STUA 1P0PA 1R4ZA 4KE6A 4E14A 3D5EA 1TK3A 1XQYA 3V48A 1XRRA 4FNMA 5DYWA 1XZKA 4DSZA 5AI9A 1UKBA 1CUUA 2XUPA 4B83A 1TCAA 5ALNA 1E89A 1AMNA 2ECFA 3DOIA 3R41A 2HDWA 3LLCA 1ZJ5A 3N2ZB 3R3ZA 1I6WA 3WYNA 5AICA 1LPBB 2V98A 2HL6A 2RIPA 2ZSHA 4FLFA 4X92A 1FFDA 3H18A 2WG1A 1XZLA 4H7KA 1CUWA 1GPKA 4DNOA 4JH0A 4UBLA 4WDRA 2VJDA 3M81A 1LBSA 4BE9A 3H04A 3L1JA 1TIBA 3D2AA 2XUDA 4CCYB 1R1DA 1UK6A 2RHTA 5EHQA 2GZSA 1XZGA 4NMWA 3ZV7A 3R3WA 5FRDA 4DMKA 2WFLA 1RWQA 2FJPA 1XKTA 2HRRA 2XMDA 4DMFA 4X71A 4RE6A 1UOOA 3RKSA 2H7CA 1MX1A 4H7JA 3O4HA 2O2IA 3C87A 3FBWA 4AX4A 1QIDA 1CUSA 1FFEA 3BJMA 2VAXA 2PPLA 2BUCA 5AO9A 3B12A 1MN6A 5KREA 5AI8A 3LCRA 2J4CA 1FSSA 2WJ4A 3IUNA 2BCEA 4V2IA 4E15A 3PF9A 5HFNA 3WIOA 1VJ5A 2YXPX 3QPDA 5K3EA 4FDMA 2QJRA 2OCIA 1JFRA 3I2JA 2DFPA 2QS9A 4XJVA 3B5EA 4AZ3A 3OURA 4N5IX 4KYVA 5ALSA 3NGMA 3PFCA 4X85A 4OD0A 2BUBA 3V1LA 3R3YA 1BEEA 5CT4A 2WFLB 3WL8A 2HU7A 4BYMA 4AQDA 1MAHA 5CW2A 1X70A 2JIDA 4GEGA 1FFBA 3KD2A 2XMSA 4KR0A 1KU0A 2XUIA 4YX9A 3ZLTA 3FCYA 5BWBA 5BWCA 3H19A 1AX9A 4GECA 2GYWA 3K2IA 4FTWA 4G4GA 4GBGA 3C6BA 1QO9A 3K6KA 1OILA 5AI4A 4QLAA 1DQYA 4ARBA 1WB6A 4GI1A 3EQ8A 1ZJ4A 3IDAA 1ORVA 3G9ZA 3HJUA 3G9UA 3H2KA 1O6GA 2JGIA 2HA0A 5ALUA 2FJ0A 3VVLA 4QDZA 1AKNA 1W6RA 2CB9A 3IULA 3QVMA 4Q05A 1NX9A 2O7VA 1YS2X 2Z5GA 2OLEA 3ZWQA 4NZZA 4PSUA 1QIGA 2Z3ZA 4PW0A 3STXA 5IVDA 1CVLA 4X97A 4XIIA 3HLKA 2XMGA 3R3UA 4CFSA 3VVMA 3R3XA 5AKIA 2CEKA 5D3KA 3F97A 5ALVA 4G8CA 1J2EA 3Q8WA 4B82A 1XZFA 5ALJA 4BZWA 1THGA 5AOBA 5ISMA 3D2BA 1TAHA 3A2MA 2QT9A 4BZZA 4DTCA 5IVIA 2ONCA 4H7DA 4X7BA 3OPMA 2GBFA 1E66A 2IIVA 3AUKA 3WA7A 1H23A 2PM8A 3ANSA 3OC0A 5E4YA 2GBCA 1BEZA 3K9BA 3QMWA 5D3ZA 1VKHA 4A5SA 1F8UA 1LPSA 3WI7A 3JYHA 3PFBA 3EIOA 4ITVA 1H2YA 4K6GA 4ZV7A 1XRMA 1XLWA 4PQEA 4H0CA 1LPNA 4HXEB 2WIJA 4B7ZA 4HRXA 2E3JA 1GGVA 3I2FA 4K5QA 4Y2QA 4M0MA 1WB5A 3WWPA 1RYYA 2QZPA 2XQFA 5EGNA 4QA9A 3E4DA 1MAAA 2PSFA 3TEJA 3W04A
chains in the Genus database with same CATH superfamily
1VIAA 2XT6A 2IH4A 3B78A 3HUEA 3KJNA 4N4AA 3E9NA 3MM4A 4Q3KA 1E6EA 1Y4ZA 2G67A 3RM3A 1K2VN 1M5RA 2FMLA 3IV7A 4KR9A 1AQJA 2QUJA 1VPDA 4M0CA 3ZS8A 1CHNA 4E5YA 3O8LA 1AXRA 2FCRA 2VHCA 3A26A 3HSKA 4QNRA 3RSLA 3ABKH 4X64B 1KEEA 3FKQA 5F78A 1CVIA 1X6VA 5EYPB 1ETXA 2L02A 1GG9A 1SA0A 1P4HA 2ZMEC 2YICA 4EQ6A 2CJPA 4I0WB 4QWWA 3NALA 2O9JA 4QFMA 3N2KA 1Q0RA 2EF1A 3GK3A 3GT4A 1RQLA 1J8DA 1E0EA 5A5DA 4E94A 4XONA 4ESHA 4ZKDA 4LSMA 1U5TA 1K4YA 3HHPA 3QU9A 1Y8ZA 1XKQA 3O74A 2ORED 2PZAA 5E3IA 3ZI0A 3VODA 1SANA 3B9QA 2BKUA 3BWYA 2M6KA 3UK0A 1ZWKA 3F6YA 1B8PA 3FDZA 1MD9A 2G83A 4EI2A 4P7BA 4UUSB 3QSYA 3INGA 2Q5JA 4QDKA 1FL9A 4LDNA 4E21A 1DBQA 1D0XA 3BDIA 4P4SB 4QVKA 4WX2B 3WG9A 5IDXA 5KC8A 2O8BA 5FBRB 1VGRA 2I2AA 4YASA 2ODWA 3CGWA 3MWFA 5T4BA 2D00A 4HAYA 1DTEA 1E2FA 2CNOA 3IP4B 1I5EA 1ULYA 2A30A 2GPNA 2X7JA 5FBLB 1BU8A 3NOXA 4W1RA 3CZAA 3WKEA 4LF6B 5H2FC 2DY0A 3ZHCA 2J07A 4F84A 4IHJA 4LVCA 2VEOA 3BGWA 4BWGA 4ESFA 1DXQA 1F6DA 4D9MA 2QX4A 3GT3A 3RFXA 2MT9A 4A2WA 3KXPA 2YV5A 4WOCA 4MICA 5JAQA 4PRLA 5J4VA 2YZGA 4GMXA 1CUFA 2Q6TA 1D2RA 3R5FA 3HN6A 1NVMB 4MO2A 5DYTA 5TDHA 2O8EB 5DHQA 4P4NA 4C7BA 4EKDA 1XZHA 1IY0A 3DL0A 3QHPA 3SS9X 3G1LA 2V6MA 5KTTA 3EZ7A 1G20A 2AOXA 3MTIA 2GIVA 2WFMA 1SU7A 1N57A 1RBMA 3E2MA 1BWQA 1JPUA 3B85A 4XPZA 4DYDA 5KQPA 1ZRFA 4WDQA 1VMIA 2DH6A 5LBTA 5FNVB 1LRKA 4F4UA 1PL7A 1AK1A 4B1FA 1V5GA 4FE3A 3E6BA 1GL3A 1NNI1 2JEZA 3IAS6 2D5BA 1GPUA 2RB4A 4LF9B 1Z0XA 1V71A 2WIFA 4MVJM 4ZVVA 1XNRB 3PD1A 3V46A 5DIZA 1E2HA 2M8GX 2BLNA 2A9VA 2HXSA 1FUIA 2W90A 3R7FA 2FMIA 1NBIA 4J8PA 2DQLA 4RD1A 5D87A 4YCCA 1BQ3A 1PI3A 2HMAA 2CUNA 2PRSA 1NJGA 4Z6KA 4QBIA 2P78A 4KFSA 3W1VA 3L7CA 3HGQA 3SE7A 1P45A 1BHO1 3NH6A 3GO5A 3RVRA 3R9KA 3C8MA 1CWUA 1LVKA 2HWKA 3I9KA 1NHWA 2J5PA 1MZVA 5HIMA 1MQ8B 4J43A 2A1TS 3OU7A 2LPMA 3Q6MA 2YMMA 2GPJA 4GHWA 4JKOA 2JLYA 5D84A 2ALJA 1QJCA 1X7WB 4B8XA 1ZARA 2C2OA 2IJLA 3AKEA 4W7IA 4YAOA 3NKFA 1G7SA 4YT4A 1DSSG 3CF5F 3FYUC 4IYRA 4KWEA 3V5NA 4AUNA 2D8AA 2PX9A 3BPXA 2X0LA 2BGJA 4MIEA 5EQTA 5FUBA 3TTUA 3P7NA 1BR4A 1J8QA 3VH1A 4X7MA 4ZZ1A 3D31A 3HE3A 1P5JA 1J0AA 2GAOA 2KW5A 4ENNA 4HNUA 1MXFA 2XUJA 2VQDA 3TG8A 2XYHA 3EOBI 3EA4A 2Z1DA 1FW8A 3LLVA 3FTPA 1AA9A 2C42A 4BRWA 1JTVA 4II3A 2Y1KA 3TQNA 2FE3A 1NZJA 4MPDA 4CH7A 2ODEA 2JHCA 2HCRA 1O54A 3AI2A 3P5BA 3HGGA 3BR0A 2NTJA 2Z2SB 3U3DA 3LV8A 4PJMA 1X7WA 4FFRA 2R6ZA 3FPSA 4UASA 1LQUA 4O29A 4IFIA 1GQRA 4A0QA 3WL6A 4YMVA 4RHYA 1LNZA 1QYDA 2PMUA 2EBWA 2YY6A 1VPTA 4GGMX 4C5CA 2PU5A 3AINA 5EESA 2JF0A 3V97A 4DLXA 3LY9A 2XOKD 2D2XA 4M0PA 3H8JA 5EYRA 2DXIA 2IYWA 4L9RA 1Z3IX 2EV6A 2WSIA 2D0IA 1JZTA 3JD1A 1QQTA 4UHKA 2YHAA 2FSWA 3VBEA 4R6WA 1R6VA 2PUTA 4A0XA 3FCAA 3AXSA 1U8CB 2WFAA 3I52A 3Q6NA 4H31A 4MV5A 2F6CA 4P7JA 4UAUA 5D5UB 4CCLA 4L0YB 5AJHA 3SS8A 5IVPA 1QK3A 5J5CA 3RYFA 2D1FA 3FMQA 4XLZA 1OC4A 1UK8A 4X6LA 2I3GA 1Z88A 4K8OA 2VJMB 5AHRA 3U3RA 4HQEA 3BT9A 2ZSJA 2GBYA 1R2QA 2A5JA 1GSIA 2VKVA 3QP9A 3F49S 4HLCA 5LJLA 1AUQA 4AS1A 1AUVA 3LPDA 3PQEA 4GMDA 4I2NA 1P2FA 3SEAA 5H6QA 4EENA 1DIRA 1U0EA 1YRLA 4OPMA 4DLNA 3FYUA 3OSZA 3G68A 1G5IA 2XWSA 4RPJA 1DBWA 3GG9A 4EB8A 2GUGA 4BLVA 1HL3A 3D8UA 3LBFA 2BZ0A 1JHZA 4AMUA 4BO4A 4BGDA 1T1SA 3SJ7A 5BV8A 1Q16A 2GM3A 4BFWA 4ZZIA 2XF7A 3C7DB 4EEZA 2DBZA 1QJ4A 2A6EF 2IX3A 2M32A 3WADA 3PWZA 1T2VA 3T35A 1R5BA 2O3TA 1DQZA 3UUGA 4BLTA 1IFXA 1E5XA 3IO5A 1E3TA 3M1IA 1YHZA 4A6PA 3ONQA 4OMZA 3IQDB 4NK5A 4G89A 3KO8A 4CM3A 5BV2P 4MW2A 5COQA 4C4TA 5HHTA 4TVBA 5IOYA 4UFOA 3UEOA 2QDXA 4FGJA 3MS4A 2CL6X 1ZRCA 2WAMA 3OT1B 4BQRA 2FF5A 1OBVA 4J4HA 1BI2A 3GMEA 1IDZA 1DCFA 1FBSA 3NXKA 1R0XA 3S8EA 3K15A 5AVOA 3H3VK 3WL3A 3VPGA 3JASB 3M9LA 5DYYA 3MINB 2AMFA 2ROQA 2WLSA 4W1UA 1XXHE 2HF9A 3KT6A 3KOMA 4LKOA 4G6ZA 2JIPA 3VH4A 3CVWA 2H07A 1G20B 1UZMA 2IEAA 2PMDA 1W73A 1H8EA 4DBLC 3MTAA 2GBGA 1Z13A 4LN1A 4G63A 1R6TA 2E4UA 1SD6A 1C7EA 1BZYA 2IVZA 3MJDA 3WKAA 1LDKB 4OLAA 3FKSA 2D2WA 4BKPA 2R2GA 3LP8A 5JS8A 4JXZA 3HB5X 5JD5A 2BEWA 4BVAA 1YO5C 1EAMA 1T6XA 2IVMA 3IS3A 5B7NA 3D8TA 3BL5A 1I3MA 1Z1DA 5GONB 1NVFA 5FCDA 2VJQA 3MWYW 4DLRA 2WQ7A 1Y34E 1RM4A 4D7NA 2Z09A 3W2EA 1HDCA 1WMFA 3FCOA 1U8RA 5CXUA 5ITSA 3WSVA 3EQZA 3JQQA 1A1VA 4CMHA 4CNQA 4YGXB 1KO1A 4K9NA 1ZXBA 2C0PA 3RC2A 5IYZA 1R8YA 1XZNA 4BNIA 4HTFA 3CZ9A 1C9EA 1A2KC 2GM4A 1YAJA 2OPHA 3F22A 4URVR 4IIEA 1LDGA 4QELA 2BEVB 1RAHA 2GZAA 1TLHB 4IHJF 1Y6JA 1E8DA 1U8TA 2F64A 5KYUA 3ZHVA 3SQNA 1F0PA 1QG4A 3OFSA 3FNEA 1IRIA 3TE6A 3GF4A 3VGPA 2W2QA 4OL0A 3TOAA 1I1OA 1VI6A 5H82A 2VB6A 5IT0A 5DEOA 4Y15A 2NSDA 3F3KA 3DT9A 2OXFA 3MTGA 2V7BA 4G81A 3P2IA 2H1FA 4GMFA 3P26A 3SZPA 2FPWA 1F17A 4RYLA 1SC1A 1I4TD 1ZA1A 1QTIA 3V3KA 1CY2A 5KNBD 4WGFA 4C43A 3EDRA 1RIFA 2X0FA 3CO5A 3RT9A 1REPC 5HOQA 1BWPA 1PR1A 1G9XA 1SIBE 2P9TA 3TMKA 4E51A 3EXHA 4D7AA 2FQXA 3KJFA 3PBKA 4KO2S 2XUAA 2ZJ0A 3MC1A 3EB9A 4B4CA 1TIPA 1WX1A 2IQIA 1YR6A 4DCTA 1BDJA 2K02A 1I4DD 1YRWA 3CUSA 3OE1A 4PLTA 1AQYA 5JXHA 2EXXA 4IZ6A 1JHYA 4HDKA 4ZI7A 3P20A 3OSUA 4O4HA 2COMA 1X9GA 2AE2A 3F8MA 1QZEA 2WSBA 4J1QA 4OATA 4PCLA 4GKJB 2V5UA 3PFYA 2BW3A 3VEPA 1M2HA 1QONA 4RSMA 2AXQA 4RBOA 2CW5A 4DIQA 2WJGA 4NICA 4PCAA 1JHOA 2QN2A 2V9PA 4CF3A 1G9SA 3B5JA 4YAJA 4CEJA 3FXLA 4QE3A 1TM4E 3U4AA 3LY8A 2P35A 4BVJA 1P1BA 1OUMA 4M54A 2WNSA 4Z0PA 3TGPA 1DC6A 3RYPA 3EZFA 4WVFA 4UOEA 4D99A 4NQWA 4EM0B 1UBTS 2IPNA 5A2QZ 2JFUA 3DKKA 2VZ8A 3JX9A 4P7FA 1N5JA 1QDLB 4UD2A 3U13A 5JHFA 5IC4A 1MX3A 3FI9A 4GGGA 3DXZA 2G0EA 2AB0A 3UXHA 5TRDA 2ZJOA 1EE1A 3AVQA 4G86A 5LYJB 4EJFA 1L5YA 3IKLA 3V3TA 3W5CA 3THXB 5EIWA 4ENKA 4JP3A 2XHEA 3KFVA 3O3CA 1MGPA 1JGTA 3S81A 2DYKA 3W5BA 2LCIA 2NVQJ 5HNKA 4W99A 3QKRA 5HR5A 1F9EA 3ND5A 1V43A 4HYTA 4A5MA 4OHVA 4CKEB 1Z3YA 3QVTA 1PVEA 2W6ZA 3R5HA 4Y1RA 4EGQA 2HDHA 5JHHB 4ZU6X 2SBTA 1XTPA 1JJBA 2ZI5A 1WCIB 3KYIB 4HZGA 4FDAA 1JYFA 4UUSA 1UBMS 1FSZA 2VAWA 4I4TB 2G63A 3G2KA 2F3PA 4BNLA 5DN6D 1MJHA 2PD3A 3JQAA 4PX9A 3T0IA 1E9FA 4GM0A 1WXXA 1WI9A 5D5WB 1XT6A 1BC8C 3OX1A 4NYJR 1RC0A 4CG3A 1XPUA 4LHWA 4EB3A 3ER9A 4LJLA 3RT7A 3KDPA 1ZFNA 1MKMA 1F1BA 3ILSA 4IGFA 5CLGA 2RK6A 2I10A 2QRNA 2GJSA 2EFNA 3TAHA 4D0LB 5GVSA 1PV4A 2EZ4A 5DUKA 2Q2EB 1UINA 1DGRM 1JJFA 1NNLA 2JD1A 3BHIA 4RM2A 3M3PA 5GADl 3NDBB 1PYDA 2GEBA 4CKYA 2Z9CA 1CIJA 2XUGA 4U7FA 6PFKA 4BC0A 5AIPA 1NXTA 2VZEA 4LXGA 1WZNA 3PC7A 1AHNA 2CNDA 2VSQA 4NBLA 1CR6A 1PGNA 2HYDA 2QSGX 3NYIA 4M73A 1CB0A 3WU2C 4M1YA 5C3EJ 1EZ1A 2NO5A 1XD8A 1Z5UA 3BFKA 3R0ZA 1P31A 2Q4OA 1YC5A 4Q02A 3TQHA 4D9EA 3F0TA 5CDYA 3CZQA 2WA1A 2WAXA 4UM5A 1MRNA 1UPFA 2OV4A 1OZ0A 4Z9XA 2PX4A 1NNUA 4D45A 1TJ5A 2E4WA 2PWYA 2LBPA 3FMIA 1MTOA 1GLNA 3HB1A 4B76A 1PJRA 2C6YA 1G3TA 5CFMA 1RI5A 4TMFA 1Y42X 621PA 1BL0A 4U00A 3T5BA 1IAWA 2G06A 1I3AA 1D0VA 2VIXA 4J3FA 4I3GA 4GD3Q 3W05A 3FTNA 4N1AA 1ZAYA 2IRFG 5I4KA 3EODA 2Q1XA 4PLPA 3KQLA 4B3GA 5JLWA 2R86A 2P6UA 4KXNA 3RS8A 4AXBA 5BPIA 2OEPA 1FNDA 1A72A 1P9WA 2WIGA 4HNSA 4NABA 5IDVA 3RE1A 4BTEA 4EI8A 1FMFA 3DA8A 1KJ8A 3HRKA 1HX7A 3H0GJ 2MYPA 3HM5A 3CO6C 1KMCA 1C1XA 1Q0ZA 1XCLA 4UVEA 4BUZA 2KJCA 1ZY2A 2BR4A 3OOHA 4KQGA 1BGWA 3IHKA 5CVUA 1AHPA 4DXAA 3FOEC 5FADA 1NOKA 3RREA 3LAJA 3R7WA 2C3PA 3K2BA 1BKDR 3JWGA 1EFVB 4JP2A 2PUDA 1ON2A 1E6MA 1MAWA 3OLVA 4AN1A 4ARIA 4B3JA 3CCRI 1ORWA 3VR1A 2Q5FA 1M2VA 2ZTSA 3U56A 1DG3A 4JSTA 4M9SA 2YUIA 4JJZA 3S2ZA 1IVSA 2VF5X 2JIOA 1G3SA 1U3CA 1WDTA 1IBRA 3VO1A 3AFNA 4AO8A 4CJXA 1YDEA 2LUOA 3V8PA 3H6HA 2JH8A 3IILA 1N5RA 3PQ2A 4KFCA 4FUTA 2HQOA 3CRW1 4C88A 4JOMA 2Z8ZA 1SKBA 2DWUA 5FD5A 1AKRA 1K7XB 1ZSVA 2BBSA 4N4NB 2OXCA 1ZEMA 1BHQ1 3HU3A 3NVAA 3OCUA 5M5WJ 4BO8A 1CF2O 1W8IA 1P29A 2DQSA 2PTHA 2H4JA 2OM6A 3FI0A 1A5JA 2Q3LA 4DE5A 5A2QK 1XZJA 2YC2C 4FGUA 4P4TA 2FV8A 5JPCA 2WJWA 3VR4D 4A6XA 5HVNA 5EAIA 4AYWA 1ABEA 4BKOA 1POWA 4RPKA 4RKFA 5KJEA 3KUXA 2ZK7A 4IV5A 3F8FA 2AF3C 3U49A 5LEKA 2UZ1A 1M76A 2E48A 4HYQA 5EPOA 3S2SA 3GTLJ 4ND1A 4IFTA 1RMYA 3MCZA 3CLUD 5LWQA 3V8JA 1A2BA 3EVNA 3JU3A 3H99A 4BWVA 4DV5B 2TSYB 3MHTA 3OIOA 3I3OA 2B1IA 3WLAA 1L5WA 1MBJA 1AMUA 2XH8A 4KAXA 3IBTA 3O90A 4K2EA 1NZDA 1TGVA 2JJ1D 4YNBA 1JHFA 4OIOF 5FV7A 4Y2HA 5TF4A 5GZ3A 1IB6A 3IVAA 4N0QA 4HW0A 1SXQA 3D1JA 2X86A 3SX4A 1PJ8A 1JLSA 2REXB 4CUKA 4C6TB 4N3CA 3OE7A 4JD5A 5IAAA 2RC6A 4B6OA 5AKZA 2OC6A 4I4CA 1D5VA 2XHZA 4MGRA 2F4OB 4H2DA 3TXXA 5FBQB 1LC0A 2J0EA 4EG3A 2DECA 2MD0A 3LC7O 1MNMC 1N75A 3NOOA 4HSEA 2IEGA 4RJKA 5CU7A 3WDSA 1LZKA 4BCDA 2C78A 4RIGA 4EHAA 4DMMA 4NJMA 1ZSYA 2BYVE 3QWLA 3R60A 3ISVA 3EZ2A 4F9FA 3EJWA 4A3DJ 2H85A 4AO6A 3QRFF 3WAGA 2OHVA 4TWRA 4CDNA 5I9LA 1JE0A 3NV7A 2WG2A 4UJ3A 1YK1A 2LWIA 1VRWA 5FYQA 1FF9A 2F1OA 2WMNB 2ICWG 1Y7HA 4R5MA 3KFLA 1E7RA 1VZ2A 4BO9A 1VHWA 1K5GA 1XKLA 3HGTA 2DA7A 4HH0A 3WIVA 1EX1A 1ZNQO 1GPMA 3PQ5A 2REOA 4WFQA 4QXMA 3KYLA 3SY8A 1Q44A 4F45A 5JAPA 4X65B 4PZYA 2BGLA 3CZ6A 2G7HA 1OHHA 1WMAA 2HHLA 2JH9A 2VR1A 3D3WB 4EG0A 1DAFA 2AN5A 5E4FA 5A0VA 3IT0A 5K4AA 1SVNA 3H2HA 3CZRA 4MGZR 2DK5A 3LQRA 1J5XA 1C7JA 1KMIY 2C2XA 5E3LA 4OI4A 4QGBA 2XV1A 2IHYA 3GXOA 5E1ZB 2P2CA 5FBHA 1C0EA 2OO7A 2X9LA 4JLUA 4YS6A 3VTKA 3OX2A 1EP9A 3S40A 1JH9A 2AC7A 2VK2A 3CVJA 4N6NA 2XZDA 3RODA 5IT5A 4YLYA 3TIXB 2Z9OA 1FUUA 1R6UA 3OMWA 1C29B 3LQ2A 2EP5A 3CB2A 4NV1A 5B1IA 3SEFA 5LKRA 1YIOA 1BXRB 5K8CA 3O75A 2NU9B 3G9TA 2HJWA 4KITB 4TVOA 1QA6A 1L4GA 2L7KA 2I0FA 4TQGA 5IASA 2VH5R 4ZV9A 2Y30A 4DC9A 4TOIA 2XOXA 3T1VA 4UW9A 1W0JA 3SZRA 2XKPA 2UXCB 3NTQA 3WWDA 1AVTA 3GLIA 4G67A 4MOWA 3MA0A 2QQ8A 3O4JA 4CL3A 4AJNA 1OH6A 3O7MA 2ZB7A 1X8KA 1Z9CA 1EV7A 5DRTA 1YI2I 3SMVA 3WIDA 4WCDA 3WQQA 4A2QA 4S1WA 1IPEA 3WGUA 4V19K 1A98A 2VP6A 2BGWA 2VJIA 1JR6A 4I4LA 1JSLA 1TF5A 3THRA 5JWRA 3OP4A 1YTYA 1OFVA 1PZFA 1QLHA 4FEGA 5LKAA 9ANTA 4D25A 1XRQA 2HWWA 3CHYA 1L5VA 2HRDA 2O2HA 4I55F 3LSIA 3KK0A 2Q0SA 3K0AB 3KAJA 1RM5A 4REQB 1ZRMA 2JB9A 2ZVDA 3DV0A 2ZRAA 4OXRA 1EM8B 2JWTA 1OBHA 1SIUA 1HE1C 4LLNA 1KEPA 1SBHA 3L00A 4OKSA 5BSWA 2EARA 1Z6PA 1LDJA 3EFOB 2QN6A 5TR9A 1SUSA 2VBYA 3KKQA 2G76A 3N8IA 4O2AA 4YJHB 4XQFA 5J4YA 1NC1A 4KN7X 3MOIA 3VNBA 1GARA 3GCXA 3MRSA 1B1BA 2PSHA 3B7PA 4FJ2A 5P21A 2FUG1 1GP2A 3FPAA 3DKVA 3FWHA 4OQNA 4RIEA 3TOZA 4RLSA 2R1ZA 1E7MA 2M9MA 2VHZA 1RESA 3L7AA 5CCBA 2FX5A 1PUEE 2B6HA 4LBWA 5F1YA 3M7IA 2D4AA 1IOLA 1QYCA 2QUBA 4EHLA 4OIFA 4A10A 4LS3A 3ZQQA 2AN4A 2WWRA 1NWHA 3OMLA 4HB4A 4HO1X 4WA7A 4D97A 1L5HA 4HNTA 4RULA 3AHGA 2XGJA 2GXGA 3H5RA 1OV6A 2ACJA 1A96A 4OBEA 3OPYI 2FEWB 5AW9A 3S2YA 4EKGA 5C7YA 2PGNA 1Y39A 3ZWWA 1DAPA 3OIPA 4EEXA 3AVWA 5DI3A 4ZQCB 3QLEA 2PRZA 4S1OA 4IIVA 1GKKA 1LQTA 1PNQA 3EN0A 4NEGA 4RQBA 3MPUA 1UMCB 1EUZA 1ZJJA 3CX4A 1G8FA 1E4VA 3J80K 2NZYA 2Q3MA 1FU4A 2RKOA 3FHJA 2FEXA 3RJZA 2GEFA 3SSMA 4C6SA 1KEEB 2HOSA 5M5YJ 1A9RA 4CYDA 1L4BA 5KUTA 2ZUTA 4N0PA 4W8OA 4UVHA 4WY2A 1RWNA 4OI2A 2VJKA 3KR9A 2C5BA 3GRRA 1YRNA 1QHGA 2I6UA 2YHIB 4YUYA 1JQBA 2LDXA 3GJYA 4A5NA 2JIQA 3KTOA 4R1UA 1OAOC 3HSFA 3QYFA 1V95A 5T67A 2ZSIA 1C4KA 4EFKA 1K2WA 3QUSA 1SEVA 2REBA 1P9NA 1B42A 2O3SA 2PLYA 3B3FA 3DR5A 1JKFA 1RI1A 3IBCA 4JB8A 4ACAA 4RMIA 2DMUA 1VQ4I 1M1ZA 3TLGA 2QRQA 3KKPA 5DNEA 1J9GA 5JMWA 1GRRA 3SEZA 2IV2X 2YWGA 2L5QA 1EGMB 1YR1A 4KLAA 5HJ7A 3DBHA 3JRXA 3ZG6A 4XORA 2YMLA 3U3MA 3GD5A 2HQSA 4BP1A 1K7SN 5ALDA 3U19A 1DIGA 2C96A 1J1UA 2WOJA 2J85A 2PL5A 3L7KA 1M1EB 3U61B 2PJZA 1QTNA 3S14J 1MH1A 2WD8A 3O84A 3REQB 3SBEA 4HNHA 3AEZA 2JLWA 5E8IA 2C5LA 1CUXA 3DDOA 1RP7A 4XR9A 2DJ5A 2GPTA 3WGQA 5A5FA 3VPXA 4MCAA 5BWOA 2I9KA 2EFDB 3ZWMA 2PXCA 3O26A 3FX3A 4IRIA 1Z5WA 1KI2A 4WKOA 4CTMA 4WL0A 4CIYA 4KUEA 5H3CA 2NP7A 2EIHA 4J2HA 4PBSA 3UIEA 1Z74A 1QLWA 2C3YA 4GVLA 2DTRA 2JFBA 1A50B 4MVJH 1QP7A 1ZELA 4GKBA 4UOQA 3VPCA 4JQSA 5GVRA 5F2EA 1EK2A 2ZB8A 3CA8A 2KWIA 3FYCA 1E9RA 4UDOA 5LZ5A 4ZPJA 2PQ6A 2XITA 1VMAA 3Q7SA 4X1IB 5ENZA 4MI1A 5K0NA 3TLCA 3UHJA 2PU7A 3ORFA 5KAIC 4TS1A 4HI0E 4F85A 2WPDA 2X0RA 5A9SB 3PICA 2IK8A 3BBLA 1D2GA 3KPJA 3L0SA 5F7XA 3WLFA 4WACA 5AMXA 2I4MA 5FWDA 2OZPA 3S1AB 1TJYA 4Q48A 3WB1A 4WMLA 4BNYA 1DC8A 3IELA 1E1RA 4MUBA 1JDBB 1L8AA 3U4CA 1PJSA 4EELA 4WUTA 2ZETA 5F3RA 1NVVR 5EUMA 3OM9A 3IPYA 2A0FA 1FXWA 4MYHA 5CTAA 2WJZB 3GN2A 1XUOA 1NRWA 2XQKA 1U65A 4CM9A 4CL2A 1SVMA 1CE8B 3ABZA 4TKZA 4U0KA 5LIPA 3L8EA 3IV6A 1RR7A 1O4VA 1QHHA 3OS2A 1S3GA 2YZKA 3G9XA 3ISTA 2CC2A 3KUCA 1AS3A 2FFAA 2XD9A 1Z0AA 1IK6A 2XNJA 3N58A 3MW8A 3O95A 4KZKA 4ON9A 4B6JA 2R8BA 1H2HA 5IH7A 1OI4A 4QYTA 5HDQA 9MHTA 4TV8A 1B72B 4MW9A 4WOBA 2CFCA 3T1BA 3D4NA 2ELHA 4R3NA 4OIQF 3DCIA 3N86A 3ZDEA 1R4AA 3NHBA 4E11A 4QXOA 2XCOA 4U7GA 1NJ5A 5CB8A 5CM2Z 4E22A 1KMHA 2P9CA 3EGVA 3M6XA 1YE8A 1IV6A 2FHPA 1PGQA 3CZMA 3ZEIA 2NTNA 4XBFA 5BW4A 3UGQA 4F5ZA 3K32A 4U2FA 4DMGA 2KDOA 3PDHA 4MP8A 2Y27A 1SU6A 1CQZA 1K6XA 2O8FA 5AR1A 1S8FA 1X7DA 2WINI 1FQWA 4LGYA 5ALRA 2W8BA 4RGBA 2G1KA 5T8KC 2X9VA 4JYBA 4M55A 1W8DA 1GGEA 3ZQHA 3CSUA 3FF4A 3CLHA 5JAHA 2FQ3A 5JOQA 2KT0A 2Z4TA 5FA5A 2BH2A 3ONNA 2GX6A 2A35A 3JQ8A 1M2GA 3GHYA 1SGWA 2PYIA 4OQQA 1EU1A 3SBXA 3H2JA 1A77A 2FPXA 5A4AA 5E3HA 5DD4A 2IY8A 2Y1CA 3QLUC 2W8ZA 4D42A 3M6LA 5AKHA 4RDHA 3RKXA 2C1ZA 2V55B 4LB6B 1KQ8A 3QTLA 2BH9A 5EWLA 2BGKA 2VHVA 3KSMA 2PUEA 1VKJA 5KHDA 3E48A 3PUIA 1QIEA 5CYVA 1T3GA 2IF2A 1O7FA 3M4NA 4Y9TA 5KAPA 3VX3A 2EYUA 4CR7A 5KHOC 4UEJA 3EQ7A 3EG5A 1TZJA 4NFSA 1A7UA 4Z3DA 4QD3A 1EIZA 5DKFA 3ZE2B 4YG2F 1BX0A 1UPUA 4KWTA 1Z4JA 5EHZA 5JH7A 3Q88A 5FEUA 3EXIA 4ZYVA 1WBDA 1H1TA 2WUFA 2ODAA 2NNYA 3TFQA 3ULQB 3HVUA 1S2IA 2PLWA 2PWAA 5CA1A 1E6CA 3I6BA 3AX6A 2ZR7A 3CCVI 1VBNA 3G02A 3TS1A 1UBOS 3D6HA 5AOVA 1Z7LA 3OHMA 5AVVA 1U0JA 4BJ5A 4OLFA 1E96A 3A1DA 2RDPA 1HDOA 2GA1A 1SFEA 3M3HA 1DDIA 1W44A 4PHHA 3JZIA 4LSWA 2E2WA 2P5SA 5KK1A 4EJWA 1YMQA 1QRAA 1WSAA 2CWDA 2WWHA 3GJ7A 5AFSA 1H0KA 4F1WA 1C2YA 4R79A 2X1CA 3HA3A 2IC5A 1QRUA 1VCNA 3GMIA 1DOHA 4CQNA 1T91A 4U2BA 1ZMRA 1TJ3A 2D62A 3ZWDA 1JFLA 3HI4A 5LJIA 4BRSA 1XMPA 3TAUA 4H3VA 4U2KA 3OZGA 2FP4B 1BC5A 1D04A 2PGLA 3E03A 2FW1A 2VH1A 4DR4B 1W30A 1J42A 4PSXA 3A2KA 3QYJA 5DTEA 2VHTA 2G82A 2YBEA 3L4EA 3BPVA 2WIKA 1LKXA 3OQ1A 2H5LA 2GB4A 3W5IA 4NCHA 1S1CA 1IWPB 1KP3A 3K9CA 5FJJA 5EWMA 2PT7A 1IF1A 4NBSA 2ZMEA 1NJSA 3G49A 2ENWA 1HC8A 4A8JB 1IZ8A 3V8LA 1IUPA 2KIMA 4AK9A 1NN5A 4FGKA 3BJRA 4M9UA 4CCOA 5C80A 3IUBA 1J5YA 1CK4A 2H17A 3JQRA 3K5IA 4MWDA 2HS5A 3OY2A 4HQKA 5J4KA 3RSHA 2GD6A 4CQMA 4WFIA 2HAEA 3D6UA 3TE7A 3O8GA 1UP7A 5K6TA 3C4VA 5HQ3B 4F5WA 2VBXA 2WY7Q 5DPMA 2BDTA 1RADA 4NV3A 1Z77A 3CS3A 3MNFA 4MV6A 5IP7J 2OXTA 5GTIC 4DBRA 1E2DA 4F3RA 2OPBA 1JHUA 3FB1A 3CMAI 4XKBA 3MZYA 4MR9B 3E5UA 2XTAA 3EVEA 3I3SR 3OPVA 3A7EA 5CEJA 3MOGA 2LD5A 3LSHA 4DG9A 2FZGA 2NUAB 2UVQA 3HWWA 3QLUA 3U80A 3IWFA 4B6PA 4EDFA 1E6KA 1ZBQA 3NDIA 4F2WA 5AD1A 3BRCA 4MRMA 4BFCA 3CPEA 4HUQB 1N36B 4G7HF 3R3VA 2WG0A 4IL5A 2MSCB 2UVPA 4C5AA 1DTWB 5GTHC 3DMPA 4B9EA 4J4TA 1HDPA 5AKJA 1B8NA 3COAC 1G8AA 1GU1A 5ICGA 2XKAA 3YASA 4A8TA 4FQGA 3Q6IA 1IH8A 4ZEXA 3TZCA 5L3SB 3T1OA 3SIXA 5AIAA 2RHMA 2WQ6A 1OPCA 4WKNA 3IP8A 2W24A 2M1XA 3GI1A 3NC0C 4IIJF 4UUQA 3VZSA 5AOAA 1JHQA 4FFMA 4XRRA 4Z7JA 1G3YA 5LDDC 4TZ6A 1E4EB 4CE6A 5BXQC 1FOXA 4OUDB 2Q0OA 1AKWA 2BEUA 2Z0MA 1ST2A 2ZRHA 1E60A 3OIGA 4LCBA 1KOLA 4RKYA 4BKRA 3FMVA 4IVNA 2BGUA 1XMSA 3EBLA 1R3UA 2GARA 4WINA 2GZ2A 3TKYA 3FX2A 2L3DA 1QIJA 2FZVA 4KB5A 4E5MA 2NXNA 2HH9A 3NCTA 1XRJA 1XTSA 1PX2A 2PL1A 5CLLA 3T9CA 4CV3A 3PIPF 1XMVA 3B51X 4W1PA 3VJKA 1JIIA 3HSYA 2C2WA 2OV6A 2X0JA 1EUYA 1ZD9A 3P0FA 3L7LA 4GL2A 4D0PA 1TKAA 2Z9DA 4ZQHA 3BHMA 2PSEA 1U2GA 1VFPA 1IMJA 5CT9A 1X1EA 3TIIA 5H9VA 3ROUA 4MTEA 1CZLA 1XL1A 1KZGB 3HXTA 4Y33A 2QLTA 2BXYA 2OILA 4JYAB 2ZI4A 3KLOA 4G1VA 2XUFA 3G0DA 3F7OA 1KQ0A 3PF8A 3IH2A 1SFXA 3SPXA 4EITA 5CDHA 3ANLA 2R6R1 4FVTA 3SE0A 1CIVA 2P5LC 1XU4A 1QVRA 3WA6A 5AK4A 5IANA 1DIBA 4Q1DA 5KTOA 4E5NA 3D5LA 1CUHA 3RLFA 1PT7A 1TZBA 2K2WA 4JVNA 1J06A 4YWJA 1AO0A 2B98A 2PNFA 2O2DA 4R40A 5KVSA 4YP5A 3AF2A 5F64A 2QQ9A 1YJQA 3IE1A 3PWKA 2EJVA 3BD7A 3K6SB 2NTYC 3O73A 3AF0A 4FI3F 2EC5A 3L7NA 3FOAA 2I7TA 3JZAA 1QHEA 4KAFA 4NBVA 3BJEA 3B7WA 4TKLA 5EXDA 1N9GB 4KJZA 2OK7A 2WHYA 1NBHA 1JVNA 4EGFA 5JBQA 2BEJA 2XECA 3CEMA 3Q87B 4IUCS 4CLRB 1N2HA 3NGLA 5DMXA 1KMQA 4FT8A 5A4IS 2C2GA 5I7UA 2O4UX 1PBTA 1RJ9A 4HRVA 3OYBA 3PDCA 4H3SA 2CZGA 2J45A 1JN0A 1QRTA 4MTDA 1UQRA 1XGKA 3VV2A 1NUPA 3KR1A 4EG8A 2Q28A 5DH9A 3R8XA 5D4SA 5CFZA 3KQTA 5JLJA 3S93A 1CJSA 1ON1A 4KIBA 1PUFA 2H2DA 3GELA 3MCWA 3NAQA 4N8DA 4QGSA 3NEUA 1ZINA 3THWB 3C8HA 4XFJA 3CH7A 3ZE9A 1SBZA 3FOCA 4PG4A 1NUAA 2I3DA 3T41A 2EA2A 3V4VB 4KMMA 2VDUE 5LM3A 1BO6A 1FK8A 4RB2C 1V96A 3ESCA 4WY5A 4ZD6A 2XUHA 5B53A 4TLBA 4URFA 4E7LA 3KU4A 4IFEA 1G8KA 3I23A 4UU0A 4DA6A 5CDUA 4QVIA 2YYSA 1U0SY 1FLIA 4A5OA 3JVVA 3EW7A 1IJKA 1XNGA 1T98A 3I59A 1GL9B 1NV9A 3B52X 3TB6A 1YFLA 1M67A 2L54A 2DCMA 2FFQA 2QT1A 2XF8A 3AU9A 3KEMA 4QM7A 2OOSA 3LIIA 3I6MA 2YVKA 3NPMA 2YV4A 4DJEC 2XKBA 3QEOA 1KPHA 1MUUA 2I8LA 2GEUA 3A1VA 3IP9A 3FDYA 4IIFA 2OHOA 3BWEA 4MPTA 1XMKA 4DWOA 4Z5XA 3AFMA 1EWRA 2ADOA 5ESRA 5IN5A 2IYEA 2OYSA 4CV2A 4YCNA 1GVHA 5KOIA 3JPYA 1A9OA 1QCYA 1EFTA 2VHWA 2OXEA 2EJUA 3BMQB 1JFSA 1JEYA 1PS0A 3AEQB 4Y6LA 3OOPA 3HCNA 4I8IA 4CKZA 1PG5A 4JB2A 5B3KA 3R9IA 1PLLA 4I9NA 2BBWA 4BH9A 4FHEA 1H1LA 3QRWA 4A0GA 1ESNA 2CYBA 1JLLB 2F3QA 3DP7A 3X1XA 1WHSB 1XZQA 2WA0A 4PIMA 2W43A 4G1FA 4K7JA 2UU9B 2XB4A 1KR2A 1IUNA 4PSAA 3U0VA 4B3XA 2EB7A 4ALJA 4C4RA 4PAOA 4TPKA 3U81A 3VPSA 1XSEA 1W52X 5JZOA 3ZDXB 3TW7A 1T2DA 1QZTA 1T4CA 3HXPA 4IO0A 5LLSA 1ADFA 4I09A 3OESA 3SSNA 3STWA 5BN5A 5T3UA 5E9JA 5AW7A 4J94A 3VWBA 3GFOA 1X7GA 1HQCA 1RYDA 3OUUA 1MV5A 4LYYA 4QLOA 2C04A 3ICVA 3OF5A 4IDEA 1T1RA 1WLYA 4ENPA 3E82A 5A5VA 1UANA 3UWSA 4AUEA 3CRNA 1P7CA 4ISBA 4J29A 4D4LA 2HK8A 1I0LA 5J47A 4ER0A 2H9IA 4DV7B 1KRHA 2BBYA 1CUEA 4IQ8A 3TNLA 5JY1A 1W1UA 1W1WE 3HZHA 3NONA 5BURA 2XQIA 1H4TA 2G88A 2J3HA 3BMQA 1KARA 1WG8A 5FUXA 2XSJC 3RD5A 5CYOA 3C3CA 3PCRB 3T9DA 1YQAA 3ZDCA 3K1NA 2ZRMA 3SVZA 1DJLA 3BF7A 2EFJA 2G4LA 5A9TA 3OOEA 2W48A 5EHIA 4HAOA 2LDBA 2WJ3A 2WILA 4JI7B 2BJWA 2GVZC 2FUG2 5E7MA 4RL6A 3JRNA 1G2HA 1R37A 3BCRA 3DZ8A 4CR6A 5FWYA 3RFUA 1PYGA 1BCSB 3IOYA 2FF4A 4H6XA 1AXEA 2XA1A 2R6CA 3HJRA 4Q6WA 1TM2A 4Y8VA 3L0PA 4CGYA 4PHTA 2IBDA 2ZJ7A 3WGHA 1VIDA 5CIWA 3MGAA 3SU8A 2PYZA 4BMOB 2VJPA 3KD3A 4N65A 1E2PA 1OXMA 5CFOA 3KJIA 5ADHA 3ZWKA 4YFKF 2WMDA 3OEEA 1EFAA 5IM4F 1AB5A 1Q20A 4QSMA 5AUQA 3S3NA 4EY6A 1PWEA 4MYRA 5I3ZA 1DX9A 1GRCA 3ZY6A 4H6PA 3ZMTA 2H7VA 4C2BA 2CJFA 5KNBA 4US1R 4HLQB 5EUCA 4XWYA 3RK0A 3WKCA 1KI9A 5REQA 5KWSA 4D43A 4IRUB 4IIJA 2VC0A 1YMVA 1J90A 2LVSA 2PQ2A 1TJNA 4ZVUA 1G7TA 4LYHA 1BYUA 1G291 1O5TA 5F9MA 2M87A 1FFHA 3K09A 3QBDA 3ZDRA 1RXWA 4Y7DA 3DC2A 2IT0A 2C82A 4MQFA 5DSTA 5JFRA 3N53A 4BHPA 2C4HA 4F1KA 4CLRA 2H4XA 2ZAMA 3OVMA 4ITRC 4JX5A 5KI6A 4EKYA 4Z8YA 4MLOA 2XHKA 1T9HA 3A2NA 4OP1A 2R6JA 4I9FA 1F2UB 1SELA 3P9QA 5I01A 5C44J 2VHQA 4OL9A 3O4VA 4TTRA 3GUDA 3GJ8A 3WTSC 3PUHA 1QHXA 4CCAA 5A03A 2NPFA 5HF6A 3K0HA 4JROA 1O5OA 1FP4B 3B6IA 2EDCA 3RHSA 3DEEA 3PV0A 4KMOA 4XIYA 3DZBA 2AHRA 4FNGA 2WU4A 2X23A 1GG5A 1U7TA 1T5SA 1M2OA 4TLMB 3ZE0B 3L6EA 2FPIA 4UZFA 1XCPA 2XXAB 2YIVX 3P71T 4LRXA 1I33A 5DI9A 1LNSA 2DZDA 2HLDA 3HN7A 4MEBA 2XWPA 3EFBA 3PXDA 4MR7B 4DR2B 2JK3A 2LKXA 4YRQA 2YZ2A 4CCNA 3HPRA 3ZHOA 1TEVA 2AEMA 2QLFA 4R81A 5K7FA 1Z37A 3P0HA 1I24A 5DLQC 1CS0A 4C76A 1SC3A 1FXSA 2XUQA 3HA2A 2CEAA 2CMFA 4GU5A 3LYUA 4IJKA 4LFAB 1TYAE 1A76A 3VOBA 3PWTA 2CFOA 3O4FA 4HR7A 2RAEA 4NNJA 1JALA 2I7VA 1ULSA 3WGZA 3WS7A 3KB1A 3L3BA 2LFBA 5HK8A 6NULA 2H1VA 1PR9A 1QR6A 3L2OB 1FC0A 4X45A 5CJJA 3RC8A 5F3WB 3BILA 3ZQJA 1RKBA 2DTEA 1M74A 1NIJA 4L6CA 3T9EA 4KQ6A 3SVTA 4HGOA 2BE9A 2JAOA 2WVGA 1PJBA 2PL3A 3ANXA 4OU4A 2IPAB 3PEYA 1ZH6A 5T57A 1D6MA 2EKQA 1LPQA 4ID3A 5G0WA 2YMPA 1PX0A 1TO2E 3TW0A 2D7CA 4LVUA 4QTXA 4TYMA 2IA2A 2M0CA 5ALKA 1I13A 3TLXA 4ZZDA 1T2EA 1X8JA 1T36A 1Y8RA 2EAUA 3Q7EA 4RHTA 5A3JA 2AJCA 4ANJA 2YSRA 2X1DA 1G17A 1I4OA 2CE2X 3OICA 4L95C 3ZKWA 3JTMA 3PQKA 4E7IA 3C3EA 1GY8A 4LMYA 3A01A 1L5GB 2VOOA 2R4QA 2QI9F 3E15A 3DVRX 2FR0A 5E3MA 1RZ3A 4GGPA 2Y9YA 3PM1A 2A94A 3PFHA 5J5AA 2CNLA 1ZIDA 4KDPA 4HUQA 4GFDA 4AROA 1ULZA 4JUCA 4G8XA 4Y2YA 5F4BA 3KQKA 3J7AY 5BNFA 4ANFA 2F67A 3VC2A 5E6SB 3HKZN 1NLFA 2DPHA 1OWLA 5A7FA 3ABMH 2DSNA 2W0SA 1HLVA 2AMLA 3DWGA 2E2HJ 3Q7QA 3GIWA 1JG7A 4JLMA 3TLZA 4IMIB 2JGDA 2J3LA 1N3IA 3GLHE 2E71A 1JZQA 1SA0B 2HQAA 1FU7A 5IM4A 3U60B 1H2FA 4GDMA 5JIBA 2ZYAA 4QAJA 1L5QA 2JFVA 1R0BA 4KN5A 3LDAA 4AZWA 5BMVB 1EAYA 4BKQA 3MJHA 4L07A 4YQEA 1V8ZA 3VKWA 1VI2A 3EVCA 4EO7A 1JEQA 4KPUB 3F8CA 3AUXA 2F5CA 2F9LA 2H52A 3QWFA 5DN9A 3SHVA 2PSSA 1GWNA 1YS9A 4NJEB 4OHRA 5ERYA 5CQEA 2B2NA 3T4PA 2HVSA 2BSQA 4LMPA 5BNGA 1PHPA 1ZITA 1YQQA 2HNBA 4V03A 4IKEA 3WR5A 1XHEA 3JYLA 3BQZA 1HEUA 1H6BA 3GJ5A 1P4GA 2KJQA 3IPLA 4II2A 2PZMA 2V6JA 2IEZA 1JTYA 2VYQA 2HVRA 2XCUA 3OQIA 2RI6A 2N47A 5GAHJ 4NJMB 1BN7A 1KP9A 5BO5A 1L5ZA 3ESQA 2NQ2C 4WOKA 1U0BB 1T08B 5I9NA 3HDTA 1IUYA 4RVGA 5D3QA 4BHBA 1JPVA 1RRFA 2E1RA 3GLKA 1ZD2P 2G6BA 3AR4A 1UHWA 2H65A 1FY2A 3MQFA 1JEQB 2P4SA 3CH6A 1AB6A 2DLDA 3NWEA 3KCCA 2IA1A 3EGEA 3SQDA 5GIOE 3OF3A 1RXCA 1Q7GA 3JD0A 4H4DA 4D7MA 1AO3A 3L9XA 1PS8A 3QX8A 2PLNA 1RI2A 2IP4A 4J3JA 3K1AB 1KO5A 3IP6A 1TYCA 2GETA 3GJ0A 2V6CA 4PC1A 4D3SA 1L7AA 3MMSA 3AAFA 3AIIA 2VIIA 4U0YA 3M4OJ 1BFUA 3ZN1A 2FN9A 3C5WP 4IF6A 2R7VA 2RG7A 1J5EB 5F98A 1Z4PX 1ZWLA 2A8YA 4WLEA 3IVXA 4S2UA 5AXDA 2YVLA 3OKFA 4JDUA 5J4LA 3B6AA 2VKEA 1E3QA 1EWTA 1ZUNB 4RDUA 2G9RA 1BM9A 2R6HA 4RA6A 5E2AA 5GMOA 4K9OA 4UNPA 3RIXA 4AU1A 3H86A 2W85A 1GCOA 4IDQA 5BSFA 4I1VA 4M1SA 3FXQA 1GGKA 1CTQA 1TFUA 2G72A 3OPQA 1O9GA 4Q4HB 1IBSA 4IVQA 4W5NA 1DPGA 2PUBA 1E77A 4HC4A 5JEDA 3I01A 4YRDA 4BAZA 3B20A 3JRAA 1G38A 3Q3SA 2OBLA 3KVRA 4CM6A 2HK6A 1I01A 1OBOA 1WHTB 3H3FA 2R4TA 4Q9JA 2ZYSA 4OX9Y 4PLGA 4R1OA 1H8HA 2QJWA 1IXZA 1PKXA 3KTFA 1G2OA 1FLAA 4BEHB 2PV0A 3QPAA 4I50F 1Y9JA 1HXHA 1SD5A 3C97A 1LS6A 4TUYA 1XDGA 2XEDA 1XC5A 1T0FA 4C3IJ 5LRSA 4E3ZA 2PJRB 3UAYA 2FE4A 2DFNA 2Y0BA 1MPXA 4HJRA 3DZDA 2GFIA 2ZMEB 5DULA 4AVPA 1W75A 1SG6A 3QF4B 3KTAA 5KIAA 2O7NA 5JDIC 2CHVA 2WQZA 1P62B 1UDXA 4FFSA 3J80Z 4EGSA 2VWGA 1XVLA 3A31A 1JR3A 5EWJA 5BSHA 3TCNA 2F59A 3B3GA 4IDNA 4YDHB 2PUCA 1GUUA 2CMDA 3AG3H 2ZQYA 4OU5A 3ZP5A 4W1SA 1GFZA 2NZJA 1TO1E 3LF1A 3BZ6A 3SZLA 2OQVA 2XVYA 4DARA 1TNDA 2QMOA 2VF2A 4F71A 3RNOA 3TEMA 2GKOA 2HA3A 5IF9A 2CW8A 4XJXA 1ZO8A 1OKKD 3AEXA 5ESXA 4G3XA 1T9KA 3ZDFA 5KVRA 1P7YA 1T4GA 2YFYA 1P0QA 1PEAA 2IDZA 3I1JA 3V6MA 4ENRA 2EF0A 1D6JA 4OJMX 3Q0EA 4YRIA 2H3EA 4INPA 1OHHD 2OTJI 3IAUA 1L5KA 4B80A 4ER3A 3PXXA 2CW0F 4RPLA 1XTJA 2I91A 3FLEA 4N49A 4O02B 5IRCD 4IRHA 3SHFA 4O2BF 4G23A 4F4DA 1D09A 4AMZA 5E3JA 2CXTA 3CMCO 3R0IA 3RTRA 4QLBA 4EABA 1T9AA 2HCJB 2J3QA 4URZR 4TMWA 3TD2A 2GXQA 4ROSA 5L3QA 4WT7A 5E1OA 3QFFA 1VE7A 1OFIA 2Z6VA 1NLMA 3NHFA 4XVQA 3PNQA 2AWNA 5DCWA 4MUAA 1LDNA 2PMWB 1Z5GA 3G0BA 1SKMA 1I5OA 2HMYB 3MZ0A 2CDAA 4QHTA 5SY9A 3RS7A 7MHTA 3QFHA 1U2ZA 3QKSA 2G4CA 2R79A 3VSDA 4MHGA 2R5ZA 3RW9A 3TRIA 2NP6A 2WV0A 1O57A 3A9VA 2QX8A 3LWZA 1UJ4A 4AIIA 5FDFA 3KQVA 1ZOLA 3P2JA 4X94A 4MPPA 3CX3A 4ZPXA 3SIWA 1IOZA 1GSAA 5ERGB 3ZD8A 4UXNA 2A9KA 3NR2A 5KAMA 4E4TA 4P34A 4RK1A 2OJED 3IQWA 2A1UB 4B4DA 3DFGA 1X7YA 2I6FA 3T38A 3BT7A 2VPYA 3IXQA 1GV2A 4GPZA 2X15A 1UBEA 4DV0B 1H9CA 2ACEA 4GXRA 4JBGA 1Y8CA 2CLEB 4UPDA 3MWDB 2IQ5A 1DUXC 4G0YA 3NBKA 4LBZA 3L1VA 1XXHB 4MVXA 1MNQA 5HRCA 1N9GA 3FCUB 5L3DA 3IIJA 5TMPA 2E4ZA 4ITUA 5DV9A 3TNYA 3EPLA 3ZH9B 2F3SA 3DEKA 1UAGA 1LK5A 2WD7A 2WW8A 2BKLA 2ZVQX 3JTEA 3QVSA 4FWBA 4L0DA 5JSYA 3HLTA 1FP2A 2JA8J 4MTCA 3EGDB 2NYXA 5LMZA 2A1UA 4P81A 1S6LA 4ESVA 1MA3A 1A4XA 1K75A 1C4OA 2XTJA 3JRWA 3PQ4A 3T06B 1VE6A 3ILXA 5U9CA 1QKKA 2FUG6 4QLCU 1ISJA 2VP0A 1QPBA 2YVQA 3ACDA 1SKUA 1LFDB 2VBFA 3GLHB 1Q91A 3A6GA 1QOPB 3N2IA 1RWKA 2YRXA 3AIOA 3N75A 2O57A 1GQFA 4V0QA 4ZDWA 5KDLA 1NN3A 4DXDA 4HX9A 1B72A 2E1NA 2K9QA 2R7ZJ 1VXRA 2B1GA 1KKMA 1YUBA 4B6GA 2XZTA 4MUNA 2F1KA 4TKUB 4ZN6A 1L5SA 1KQPA 4FYJA 4GC5A 3SR3A 3ZV6A 3VAZA 4RIHA 1MJGA 1ZP6A 4EHKA 1MIJA 2R4UA 1L3CA 1Q5PA 2ZBRA 4M9CA 2C7QA 2V96A 4GVXA 3HU1A 3CIFA 4OBBA 3S0JA 2QLBA 4BZPA 1Z0IA 4UXJA 4RB3C 2IX9A 3RSFA 2NIPA 4NMLA 1QZ3A 3ZYCA 4PHFA 1EHYA 1GGHA 3BJOA 1XLTA 3EOZA 5KYKA 2PXAA 2EK5A 3R0AA 1NLZA 5IX8A 1V5WA 1CY1A 4KQEA 2VDPB 4GW3A 4JUAA 2UUCB 1S7OA 3C5VA 5FO0A 1TWHJ 5ECYA 3ZZTA 5I4CA 2Q50A 1USKA 4DOZA 2I2FA 3EF3A 3M82A 1NXWA 2IZZA 4TV9B 3K7AJ 4LIPD 5DLYA 5TPWB 5B6PA 4FASD 4W5RA 3CKMA 4MVYA 5NULA 1BHSA 3O94A 4W8HA 2WJIA 2NSJA 1JXOA 4H6VA 5KQLA 4IGAA 3BGDA 3INRA 3S8MA 1W93A 3MN2A 4IV8A 1DAMA 1WZUA 2VP2A 2WABA 4UAGA 2VUTA 4KV7A 4BL0B 2ZJFA 4PN3A 3UQZA 4IJAA 2DDAA 3PUBA 4N4OB 3FB4A 1ZDMA 2DKFA 1RRVA 2RSLA 2G9WA 2KRFA 1TUEA 5SZHB 1PBNA 1RAAA 1QQAA 4Q39A 2PA0A 3HL4A 1JI3A 2VEDA 4MQLA 4ZVOA 2C8VA 5D1HA 4ZT5A 1R9NA 1NF3A 1V8OA 1B8VA 4RA9B 1E3OC 1T9CA 5D7NA 4N47A 2C9ZA 2X0IA 1Z3CA 3R0JA 3F23A 4DWVA 2HZTA 4L9TA 4INJA 4ETWA 1RKWA 3ZDBA 3PX7A 1A9XA 1V5EA 3SXUA 2C8JA 1RPZA 4TL9A 2RC5A 2XPUA 5DOVA 1DIHA 4PO3X 4RUKA 4HNAB 4X93A 3L0DA 3H1BA 3M1YA 1Y3DE 2QUIA 4WN9B 2GYVA 1E1DA 1JMVA 1D0YA 5LZ4A 2AXEA 3IAS1 1JJ6C 1V6CA 4BJ5C 2FN3A 3ZLVA 4A2PA 3RAGA 3IA2A 4DXHA 2DR2A 3K9GA 1V26A 5HS6A 3OWTA 3H1FA 3LSPA 3PGVA 4JI5B 2BKAA 2EFCB 3FWPA 4TZKA 3VUFA 1O6FA 1XAJA 5ER6A 1FVHA 4XRSG 3KEFA 2K2QB 3OE4A 4XX1A 4E5KA 1ZW6A 1A4IA 1DBSA 3DBVO 3QUAA 4NF2A 3ABLH 1T0HB 3KCQA 5TQ0A 4ARUA 2GYUA 4QQRA 4IWNA 1OFCX 3A6PC 4CYMA 3VKFA 3M5PA 1ZK3A 1ISRA 2JGJA 2M6RA 4N82A 3WQHA 5B30A 2JD2A 5DNAA 1FLNA 4TTSA 1GHCA 1ZOOA 3MXTA 1BCRB 1ONPA 3GCGA 3WMRA 4AMVA 3EMDA 1RTKA 4XDGA 4HX5A 4JLPA 2Y69H 4KIWA 4Q9HA 4EF6A 5KWVA 3IAEA 3D54D 2DO7A 1WETA 1X86B 4F52A 2O2YA 3KAQA 5CURA 3SAJA 3KQYA 3T54A 4MQ9F 4M6XA 3DE4X 5B3AA 3N2GB 1EE2A 1L4UA 4YJ2A 3G8BA 4WX9A 1MG0A 1P5ZB 2PKCA 4L02A 2O8CB 2NO9A 1ZKGA 2F2EA 1PFQA 1QQ7A 2INGX 2P40A 3HXMA 3NWOA 5F1KA 2BHSA 1RAEA 5IXYA 1OD6A 3C1DA 1FNBA 2DRIA 5IC5A 3TUJC 2ZJ2A 4C30A 1ZQ9A 2P11A 3EIQA 5IT9A 3ELYA 3IGFA 3IB6A 4HHEA 3Q8MA 4IOCF 1NYTA 3M6AA 4N7RA 1QGOA 5JHGB 2JZYA 4JBHA 3K6RA 3S2GA 5IARA 4KYTA 4UVGA 2F8MA 1WOMA 1NZFA 1PYOA 2VCHA 1FUYB 3UYLA 1T24A 3R74A 4JS0A 4JKIA 3ET5A 1RRCA 3I8OA 3AG4H 1QRYA 2GEVA 3G0CA 1KH1A 3WIBA 4IIJB 3GTQJ 1Z38A 1OTHA 2O7OA 1EFDN 3BERA 3TGLA 4KK4A 1OCZH 3LFKA 4R1HA 1ODSA 5EJMA 1Z7UA 2VJMA 4BU1A 1YI8A 4L8YA 5FUYA 4UE3S 4ILEA 3EJ6A 4X91A 3I64A 2WE7A 2VDWB 3IQHX 1Q7EA 3DFMA 4HN2A 5KSPA 1VI0A 4EATA 2R25B 4AF8A 5JFTA 3ZD6A 5I5GA 2WD7B 1OZGA 3VU8A 2KQRA 1F2UA 4H17A 4Q1BA 3SYTA 3GLSA 1Y7LA 4ZVPA 2VK1A 3ESDA 4C21A 4BNUA 4QXQA 2Q1UA 1LUAA 2D5LA 2DPGA 3EISA 4LX8A 5KKCA 2XVAA 4QPOA 1VIMA 2WF6A 1RLOA 3PS9A 4MKHA 1ZJZA 3X1MA 3DEIA 4XA8A 2IKQA 2NOGA 4FD3A 1UJCA 3IBSA 4X44A 2ID8A 3KKOA 2OHGA 2QVCA 3UOWA 2YXDA 2J5XA 1EM8A 2HIAA 4Y0AA 5DXFA 5F77A 1EGVB 2IHTA 1H8HD 4HB0A 2K86A 2O19A 1U5TC 4JP0A 2F43A 1EH7A 2HA4A 3SC3A 1A0OA 4A0ZA 1PZNA 1ETHA 1TVEA 1VYUA 3EPRA 3PSAA 4JJIA 4JT2A 1KH2A 4FONA 4P36A 1T5TA 1NUSA 3NCHA 4QJBA 3THYB 4K2AA 2OTLI 3FKIJ 3RPUD 1KDOA 1S3IA 2F3RA 3CN9A 2FJ1A 2AMYA 3NDRA 1Z5PA 1P72A 4BMVA 3F5MA 4BMYA 4L4SA 4MDEA 2VH2A 1O94A 2Z5LA 2ES4A 3BCSA 3GGOA 2O1XA 4FZVA 4H9GA 1P9RA 2UZ0A 2DMQA 2IW5A 2GPBA 1Z39A 1XJCA 3G1WA 4G37A 4YB8A 1MW9X 5A6SA 3BL8A 1YZYA 3HCRA 2X8WA 2A3SA 4V2FA 3W8RA 5D6OA 2KFDA 1K4SA 3CN7A 3I5YA 3IURA 4YIHA 3IRQA 2IPOA 2ZDQA 3AIMA 4RX1A 3H84A 5IAEA 1N6OA 1WDKA 3QIVA 4BX0A 3E3AA 1PK8A 3D81A 4QODA 4AWAA 1EP2B 4TXJA 1BS2A 3LX4A 3IP5A 2UDPA 5LWHA 1G66A 2ZUEA 2ZIXB 3CCBA 1ZX1A 4J1SA 3TRDA 5ITZA 3HWRA 1YO6A 3QE4A 1NKVA 2HXOA 4WXMA 5DTMA 4FLEA 4QYXA 2RGNA 2W11A 2YINC 1MX9A 3HABA 5JROA 5E9QA 1Z0KA 2ZBFA 3CG0A 4U39A 4BQSA 2AR7A 1R5ID 2CQQA 2VYND 2LKDA 2R5FA 3HBFA 3OZSA 4G2TA 1ZN2A 5EIFA 1BIBA 2B4TO 1HLDA 1OAOA 1IN6A 3A4YA 3QVWA 3STUA 1WH7A 2YHSA 5JSQA 5J8CA 4F9EA 2H6CA 2B30A 3R2JA 1EA3A 2IOYA 2CUKA 5LA6B 3S5UA 5CEEA 5EIBC 5J2TF 5FAXA 3JAWB 1AKYA 4JBLA 4BNWA 3PCTA 4MUXA 2ISQA 4EP1A 3TH5A 1VB3A 5EMLA 1HZZC 4PGFA 3W8FA 4WXPA 5K8IA 3RYCA 4LZNA 1ETKA 2JIMA 4D9CA 4OJKA 3M9XA 5CBPA 3A4CA 2R66A 1FTNA 4B44A 2FVXA 2QZZA 1KHTA 3CRZA 4EG4A 2EH3A 2C7GA 1Z2DA 1M7GA 5K0JA 1TZ2A 3VO9A 2NZ8A 2DUUA 1M5TA 1I1GA 1JG2A 1OGJA 1UKBA 1YZHA 3DEFA 1IQ0A 3BXEA 3ISJA 3TR5A 3OBBA 1P61B 2B63J 2HWUA 3GLFA 1VL6A 1Z2PX 2L7FP 1L8QA 3Q9VA 2YWHA 4HBGA 1DKNA 4HPWA 4JBNA 1BMQA 4RH1A 3TJZA 4ABTA 5KYYB 1WMBA 2QNRA 1GVDA 3DHVA 4GYIA 1BS1A 4P0QB 3DOIA 5EKXA 4ZVQA 1US8B 4CLEA 4ENQA 2HDWA 1IGNA 1PJCA 1RJ9B 1W0KA 2AQIA 3TL4X 1IG7A 1UC9A 2DGDA 1ZOPA 2I80A 3LLCA 3QHQA 3AR2A 1H0RA 2AOWA 1XXHA 2QG4A 3R3ZA 1TC3C 4WASA 4X60A 1WNTA 5KYVA 5A9RA 2ZBUA 1XRSB 4V02A 2O3QA 5AICA 5HLTA 6ABPA 5J59A 1IULA 2N42A 1MJ9A 2DA4A 3VC3A 4Y9UA 2VTBB 3L04A 3AG2H 4WXHA 1KEWA 1WMDA 2CF5A 4DCCA 3LTEA 4FFOA 1IZ9A 4PR0A 3F6PA 4QUHA 2NNLD 4MIMA 1NWCA 4DV2B 1USSA 3H18A 4WBXC 2WG1A 3LT4A 3KZCA 4G7OF 4MEYF 4HF1A 3OH8A 2FG6C 1X9IA 3GRAA 3LBAA 5LPNA 5FKNA 3E22B 2EGUA 1HYQA 2ZUBA 1ZD1A 2DUWA 4G1BA 2DTDA 1R9GA 2AWOA 4EHNA 5E3NA 2P6SA 3UJ9A 4PZZA 4MW4A 4DNOA 4JH0A 3T61A 1BSVA 1NOJA 4UBLA 4N9WA 2ZVJA 4M88A 2Q45A 4JBIA 2O2SA 3J81A 1MO6A 1NLUA 3H04A 3C2BA 1OF1A 1MB0A 1GV0A 1CRPA 2PRIA 2H1RA 3MGGA 3N8KA 3REFA 1LVGA 4PINA 3OEHD 4HWGA 1T5HX 3CLRD 1ONOA 3ZDZB 3QENA 1R0KA 3VU0A 3CNQS 4B6SA 4C4SA 2AQ8A 2XUDA 4R1PA 4CFZA 4CCYB 2P5KA 1SVWA 2RHTA 1MIOB 3IJRA 2W4QA 2GLUA 1VTNC 4KPUA 4ONEA 4PQRA 3BSFA 4WNIA 3TQFA 3IEVA 1XZGA 2Z08A 1EWQA 2O20A 5DM2A 3WYAA 4ZVLA 3IIKA 3ZV7A 3E58A 2EYQA 3DMYA 3R3WA 2V7EA 2VHYA 3RG2A 4K0RA 1EK6A 1ISHA 2QY9A 4NCIA 5IKMA 3HBLA 5J1RA 4L2IB 2PT6A 2WY8Q 2FJPA 1XKTA 2J32A 4X24A 1P5HA 1RS0A 4FEAA 4LYFA 5FI3A 3EEQA 1L1QA 4EGJA 1L4NA 4X71A 1KRXA 3UWPA 5F9FA 1XD9A 2OCBA 4G1UC 4M8KA 3VR4H 2VJNA 2YR2A 4M2LA 2PH7A 1I1HA 4ND8B 1SD1A 2Z3VA 4TLDA 2E55A 4Y1FA 4N9IA 1F4LA 3VNAA 3DPTA 4E33A 3O4HA 4AP6A 5F23A 4DUPA 5AHOA 4EUFA 4LJ9A 3N3BC 4BFZA 3NH9A 1NXXA 3GAMA 2FGKA 1ODKA 3COZA 4Z9BA 3TWOA 1R0WA 1U2TA 2JJ8A 1Z4NA 2NO6A 5LDHA 4ID9A 3QE9Y 2V1XA 1PL6A 4AX4A