3HC7A

Crystal structure of lysin b from mycobacteriophage d29
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
SKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMWPSVEKGVAELILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHILPPTGRLHRFLHRLKKVIFWGNPMRQKGFAHSDEWIHPVAAPDTLGILEDRLENLEQYGFEVRDYAHDGDMYASIKEDDLHEYEVAIGRIVMKASGFIGGRDSVVAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPHLYNRYPAVEFLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacteriophage Lysin B is a novel mycolylarabinogalactan esterase
pubmed doi rcsb
source organism Mycobacterium phage d29
molecule tags Cell adhesion
molecule keywords Gene 12 protein
total genus 90
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1120 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hc7A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hc7A01
1DX4A 4XVCA 1QGED 2V9ZA 1QIJA 1Z68A 3WWCA 2YH2A 2O7RA 4MQMA 4G8DA 3QMMA 1ZD5A 3KWJA 1E3QA 4UBMA 4H18A 2XLBA 4BBZA 1MPXA 1QIKA 1AMNA 2VF2A 4JUIA 4LYEA 3SK0A 4BTVA 4IQ4A 4FBLA 3R40A 4N8SA 2HU5A 1WB5A 5HKAA 4L0CA 4QDXA 5LIPA 4C4YA 5ALOA 1CEXA 4UBNA 3DLTA 1CUCA 4B0PA 3A2NA 3TRDA 4G8CA 4ZREA 3WWDA 1JJFA 3WWOA 4MWSA 1EB9A 5IVKA 2Y2VA 4U2BA 3H0CA 2HHAA 1W52X 4BVLA 1K5PA 1DINA 2J3QA 3EF3A 5LZ9A 3EQ9A 4LXHA 5KWJA 4FMPA 3K6KA 2DHDA 3V1MA 5EFZA 1ODCA 4EY8A 5DYYA 4UHCA 2J4CA 4WFJA 5ALQA 1PV1A 3WLAA 4FHZA 4C01A 4BAGA 1GPLA 5AI5A 4K6KA 4KE8A 3S2ZA 4K6HA 4J0CA 4Y2XA 5JADA 4KE9A 4Y2QA 4DMKA 4EA6A 5EHNA 1MX5A 1W6RA 1XRPA 3U1TA 2WTMA 2XUHA 3MUOA 4RE5A 1Q0RA 4QWWA 2ZYRA 3C6BA 3LIPA 3WZLA 5CXUA 3AZOA 3CXUA 3T52A 1DWOA 1E8MA 4NS4A 5AM1A 2C0QA 2CEKA 2RIPA 2BUBA 1ZD2P 1Y7IA 4X97A 4DNOA 5JD6A 3LCRA 5AI0A 2H7YA 3HYSA 1QOZA 4FWBA 3LLCA 4UFNA 4H7EA 4H7JA 3OPMA 4KRYA 3G0IA 1IUOA 4FKBA 5AP9A 5JD4A 3DD5A 1THTA 4E14A 1EDDA 4EY7A 2PL5A 4CFSA 3WYDA 2BUAA 4W1QA 3KWFA 3W04A 1LBTA 3ESDA 1BRTA 4WDQA 2HA0A 1GQRA 2VA9A 5ALKA 4HTAA 1VA4A 1BEEA 4OYLA 3A2MA 3WK4A 1E8NA 3F96A 1AQLA 1G66A 4BATA 3HRHA 2G4LA 2DCMA 3L1IA 2H7CA 1X2BA 3ZPXA 2CKMA 1QIHA 2OCKA 3F9CA 5AKZA 4UHHA 4TGLA 4AO7A 4J0KA 2WHQA 5DYTA 3G9UA 4GXNA 3W2TA 4KRXA 3I2JA 2PU7A 1A88A 1IZ8A 1XLWA 5JIBA 1ZD3A 3IUMA 1Q0ZA 4X92A 1MT3A 3U0VA 1YAHA 3QBJA 1ODTC 2EDCA 1CVLA 5HZGA 5ALDA 2OGTA 4RNCA 2AXEA 4JYMA 1W4LA 1XZEA 4OB7A 2HA7A 1XZLA 5AIAA 4S0XA 3WIBA 5KBYA 2VATA 1IUNA 2PUJA 2IIVA 1CUFA 3KSRA 1SCKA 4B0OA 2ES4A 2OCLA 3C8HA 2BGRA 4BAUA 4KEAA 3RLIA 1CUSA 3ESAA 1CPYA 1CUDA 3H1AA 3ZLVA 3PFCA 1LPMA 5CURA 3TJMA 2K2QB 2AJBA 1BU8A 2GZSA 4HZGA 3BL8A 1K8QA 5JD5A 2Q0XA 1R88A 5DLPA 5C8ZA 3BIWA 4BVJA 4KE6A 1SC9A 4E11A 3I2FA 5SYNA 4G4GA 3I6ZA 3EQ7A 1QIDA 2XUDA 1C7IA 3R3YA 2JGFA 1ZJ5A 1G42A 2ECFA 5FV4A 2PU5A 2XUGA 1AKNA 1J07A 4P08A 2AJ8A 5CXXA 4U2FA 5LKAA 3R3UA 2O2HA 3R3VA 2VJAA 4AZ0A 1ETHA 4H7FA 2WUDA 4W1SA 2XUKA 4BDTA 4JNCA 2B20A 3QPDA 4JEIA 3H2HA 1VE7A 4B7ZA 3F98A 2XUAA 1GPKA 3OM8A 2EEPA 3W9BA 4N5IX 4WY8A 5A62A 2XQIA 1QE3A 3G0GA 2PPLA 5HFAA 4X71A 3UUEA 3GBSA 4UBKA 4OB8A 2ZYIA 4EZIA 4GEGA 5BWCA 5CH3A 1PJAA 1BCSA 2WG0A 5ALTA 2WIGA 2XMQA 5LKRA 1EX9A 5E4JA 2E3JA 3AIKA 1BCRA 4Q34A 3STWA 4HVTA 4J7AA 1QJ4A 3VVLA 1WPRA 4I3FA 4Q82A 2XMDA 4DSAA 2XUJA 3QZUA 3ESBA 3ZV7A 4BP9A 3WK7A 1XZGA 1N1MA 1P0QA 3JWEA 5D7BA 2HA3A 4L9AA 4B82A 3C70A 4Q05A 1CUZA 5ALNA 4AXBA 5DNUA 1ZI9A 1EA5A 2RI6A 1TRHA 3W06A 4W1RA 5ALWA 2VJBA 3DEAA 1C7JA 5HF5A 2JGEA 1YS1X 1GGVA 4AO6A 5AJHA 1U65A 5FUMA 5CT8A 5EGNA 3NUZA 3M81A 2XUPA 5E2IA 4BDSA 3I1YA 2BUCA 4UBLA 2WQZA 3JYHA 1H23A 3QVMA 1TCAA 2GYUA 1ZGCA 1MU0A 4GLBA 1MX9A 3DYIA 1R9MA 1IZ7A 1CQWA 5DTJA 3WKCA 1H2XA 1WCYA 4ITVA 3I1IA 4DIUA 3QM1A 2AJLI 1XRRA 4B85A 3WQHA 4OU5A 3H17A 1XLUA 1LBSA 2Z3ZA 1G5FA 3WWPA 5T4FA 3DL7A 4G1FA 4CIBA 1D07A 5DWDA 1MNQA 1FJ2A 1VLQA 2ROQA 2HA4A 3R0VA 5ALEA 3O9VA 1XQVA 3I2IA 1EHYA 3DS8A 5D6OA 3WKEA 2W22A 5HK9A 1XRMA 2VJDA 3LS2A 3DJYA 4G4JA 3G0DA 5HK8A 4L3WA 2D0DA 4QEKA 2DHEA 1VA5A 2Y6UA 2IX9A 1JMKC 4OUKX 2HIHA 2ONCA 4EB0A 3PF8A 4Q1VA 4X90A 2GYVA 1LLFA 4WFKA 4G4IA 4A16A 4X6YA 2OGZA 5ALVA 4C6HA 3CN7A 4BCDA 3STTA 4MEAA 5ALYA 2JBWA 4Y7DA 4EY5A 3G9ZA 5KREA 1USWA 5LZ8A 4Y9SA 1JJIA 5K3FB 4A5SA 5AI6A 5LP1A 2ACEA 3C5WP 3DOHA 3LP5A 1RWQA 1R4ZA 4OPMA 2B9VA 5DYWA 4P9NA 4J0JA 4FNGA 5AK4A 5EIEA 1CUYA 1BROA 5CT6A 2CZQA 1XQWA 4DYHA 2PM8A 3R41A 4C88A 3QH4A 3WL8A 3NOXA 5JASA 2DFPA 2ORYA 5A2GA 2O2IA 5A7HA 4Y2RA 1EB8A 3RARA 3O4JA 4BC0A 3FYUB 4X6XA 1UK9A 2WFZA 5HF9A 1UK7A 4BTLA 5FDFA 5JAUA 3D3NA 5AKGA 4X00A 2W6CX 5HQ3B 2H1IA 5DJ5A 3TGLA 3DKRA 5ISMA 4QLOA 2OXEA 2BCEA 3PE6A 1DU4A 1UK6A 2B4KA 1F6WA 4PV7A 1FSSA 5E4TA 2XMGA 1HKHA 5EHXA 1AGYA 1NX9A 5EHQA 1EK1A 1ACJA 5HKBA 2QUBA 2ZJ7A 1WOMA 4F0JA 1MO2A 4ARAA 3RKSA 2OGSA 1EVEA 4KAJA 3IA2A 3ZWQA 5IH7A 1GPNA 2I03A 5ESRA 5E4YA 5AM3A 2GBFA 1DT5A 1LZKA 3H19A 1XZIA 5CW2A 4MJ3A 4AN1A 3B5EA 4Q3OA 1I6WA 3A6ZA 4INZA 5H3HA 3FYUA 5T4BA 4DMHA 4IH9A 1ORWA 1YB6A 3OC0A 2XMSA 4I19A 2O2GA 2ZSHA 1EVQA 2DHCA 1KU0A 3G9XA 1ZIXA 3WK8A 4DLNA 3RK4A 1VZ3A 3VVMA 3QYJA 1GQSA 5I8PA 3M3DA 2YYSA 4KYVA 5IVDA 3Q0TA 5CH5A 4WFIA 5JAOA 2ZVDA 3H2JA 1E5TA 4HXGA 2QR5A 3IIIA 3BDIA 1O6GA 3AIMA 4CI9A 1GKKA 4V2IA 4XJVA 2XUFA 2XUOA 1N5MA 1YAJA 4Y2VA 1XLVA 3ANTA 5CT5A 2XLCA 1UKAA 2X5XA 1ZGBA 1DQZA 2AJDA 3O0DA 4OU4A 4PO3X 2QXUA 4XWGA 3N0TA 1DT3A 3HXKA 1AX9A 5AI4A 4FDMA 4FTWA 2JGKA 3FSGA 4J03A 4J0HA 1MX1A 3AFIA 4PNZA 4B84A 1J1IA 3FWHA 3D0KA 4KAAA 2QXTA 2BAGA 1YS2X 2RHTA 1CUXA 1AUOA 4M0EA 4C4XA 3IDAA 1JT2A 3I2GA 5CRIA 3IURA 3DDUA 1YA8A 4RPCA 2WU4A 4W9RA 4H7KA 3E3AA 5ALGA 4X6UA 1EDEA 2J4FA 4Y2TA 3ANSA 1O6FA 3AZQA 4K5QA 3HJUA 1L7RA 2VJCA 2FJ0A 5HF8A 1OCEA 3V9AA 2ZJFA 2ZYHA 1CFJA 3WJ1A 1HBJA 1A7UA 1AZWA 2C58A 4OYYA 4N8EA 3BF8A 7YASA 2G5TA 2PSEA 1VXOA 4ZXFA 4ZWNA 3PUIA 4ZV9A 4B6GA 3HI4A 1W1IA 4CG2A 1MJ5A 1Q84A 4H7IA 1MAAA 2DSNA 3IUQA 3BXPA 3JW8A 2FX5A 4X95A 5AKYA 1BEZA 3LIIA 3WA7A 5K3AA 2UZ0A 4KACA 3C6YA 1TCBA 4C89A 1F0PA 3GUUA 4XIIA 4GW3A 1QO7A 1ISPA 1WHSA 4U2GA 5K3CA 3IULA 4WDRA 4GI1A 4C87A 3D2AA 3PI6A 4DM7A 1NU6A 4OCZA 2ACKA 4AZ3A 1XZAA 4CG1A 1DQYA 2OCIA 3HACA 3IUJA 3O4IA 3I28A 2OLEA 1R1DA 2WG1A 2OAEA 5ALSA 5JAPA 1DX6A 2G63A 2EDAA 2WILA 3EQ8A 5AKHA 4EY6A 3FCXA 4FOLA 4PF1A 4ZV7A 2HRQA 5AOAA 3WMRA 4DNFA 4QZVA 1CUJA 4UBJA 5JANA 2WTNA 3AIOA 2QUAA 2GYWA 4H0CA 2OPHA 4YASA 5AI8A 4G5XA 1HDEA 1XRQA 2PKYX 1IMJA 5AKEA 1E66A 5AKKA 3C45A 1AURA 1EDBA 1XZJA 1B41A 1XROA 4Y2JA 2J3DA 2PBLA 2VTVA 3WK6A 3CCCA 3P2MA 4C4ZA 2RGUA 3PF9A 4BVKA 3MVEA 1CQZA 4BYMA 4UFPA 1OILA 4TVKA 5AOCA 3V1KA 3WWEA 1XKLA 3C87A 4MXDA 3V48A 4OD0A 1Q83A 1EH5A 3FVRA 5LZ5A 4F60A 4QNNA 2WJ4A 4Y2UA 4IH1A 2QJRA 1U8EA 2V97A 1G4HA 4B9EA 4HRXA 2NW6A 2PVSA 4KJXA 2YASA 2XB6A 5LYYA 5ALMA 4ROTA 3O4HA 5A6VA 3WYNA 4FLEA 3R3WA 2G5PA 4BE4A 2WJ6A 2WU3A 3W9UA 4IO0A 2OQVA 3K2IA 5ALFA 2WUEA 4EUSA 1FFBA 4HRYA 4MEBA 2OG1A 5C7YA 3ESCA 1T4MA 4BCCA 3FVTA 3HZOA 2R11A 4U2EA 1UT6A 2C5GA 2JIDA 4HXEB 4UPDA 4CCYA 3ICVA 3I6MA 2XQGA 2XI4A 1TK3A 2IITA 3PDCA 5AICA 4F21A 1GT6A 3HEAA 1XZMA 1EXWA 3KXPA 1Y37A 5EHZA 1CR6A 1ZIYA 3O4GA 4G9GA 2XQJA 3ZI7A 1CLEA 5ALJA 2VSQA 3E0XA 4QE3A 3GROA 4AX4A 3V1LA 2BJHA 4B83A 3C6XA 5CT4A 2WUGA 4WCVA 3WK9A 2DR0A 1CUIA 3G9TA 1VOTA 1QIMA 2XMCA 4LIPD 5CTAA 3BJRA 5FPPA 3ZLUA 5JALA 4MWTA 3STVA 4OSEA 1QONA 3FSGD 2QM0A 2WHPB 4KE7A 3WL7A 3UUFA 2DQZA 3R3ZA 4JYPA 6YASA 5AHXA 5DTIA 1ZI8A 4CCWA 2CUTA 3A70A 4CG3A 3GFFA 1NU8A 1Y7HA 2GBCA 1XQXA 2HFJA 3A2LA 1UZAA 4FLFA 3OURA 3H18A 3AINA 1KEZA 3FOBA 1EI9A 1YB7A 4BRZA 4BB0A 4XX1A 4GDMA 4G9EA 5FXMA 1P0IA 4GWLA 3QMWA 2QVBA 1C4XA 1WHTA 4KR0A 3IVMA 1LPAB 5DNVA 2WIJA 2YXPX 1H22A 3SX4A 4LKOA 5ALZA 3C5VA 4FNMA 5IVIA 1VE6A 3H1BA 5C8VA 3D7RA 1F0NA 4E15A 4BCBA 2VQ6A 4X85A 5D3KA 1XZBA 1L7AA 3FLAA 2WLSA 2PSHA 5AI9A 5A71A 3KDAA 5ALHA 3WL6A 3BE8A 3H2GA 1HPLA 1FFDA 1A8QA 5BOVA 4DSZA 1XZFA 2GBIA 1VJ5A 1JMYA 4ARBA 2OAGA 1H2WA 5D3ZA 3W05A 4X94A 5LZ4A 5ALLA 4CIAA 1SCIA 1CUWA 3DCNA 4DTCA 4IHAA 1J2EA 5CT9A 5JYCA 1LPNA 2P8SA 3CN9A 1R50A 2PSDA 4Y2PA 1ZICA 4PSCA 1CUHA 3WKDA 2VT6A 1J06A 5HCUA 2HRRA 4P92A 4U2CA 5J3JA 1QZ3A 2C7BA 1H2ZA 2FJPA 3N2ZB 3STUA 5FP0A 3AUKA 1F8UA 2BFNA 3D4LA 4N8DA 5CH8A 4KAFA 2RONA 5K3DA 5HF6A 4F5ZA 2H7XA 2XT0A 1ACLA 2HU8A 2QT9A 4DMFA 1ZJ4A 5F4ZA 2JGIA 3CCBA 3WK5A 1VXRA 3MUNA 4QLAA 4UHEA 4QDZA 5C81A 2XQKA 3M82A 2PX6A 2Z5GA 3QPCA 4BC1A 5JAHA 2RAUA 4J0DA 4UFOA 1GZ7A 5K3EA 4AB1A 1UK8A 1XZKA 4X7BA 3D2CA 4WJLA 4LXGA 1A8SA 1M33A 5AM2A 3C43A 5JATA 4QDTA 2D5LA 2C4HA 1UKCA 2WUFA 3EBLA 2PSFA 5FOQA 2X8BA 3OG9A 5JARA 3GELA 3GZJA 3FYUC 3PFBA 2HA2A 5CBKA 1OXMA 2GBGA 4FLMA 2WFLA 2WM2A 3C8DA 1X2EA 5ALRA 3WL5A 4GHWA 5LLSA 5BWBA 1UWCA 1YCDA 3VJMA 1TKRA 3I2HA 2HM7A 3E4DA 3H04A 3GA7A 3L1HA 4N5HX 2QRUA 2I78A 2WFMA 1YASA 2LIPA 2HA6A 4NMWA 2R8BA 4ZRDA 1FFEA 4PSUA 1U4NA 3G7NA 5ALUA 1BN7A 2CB9A 3EIOA 1TIBA 3DYVA 3B12A 3T4UA 5HQ3A 3S8YA 3I2KA 1R3DA 3H2KA 2QJWA 2C0PA 2WHPA 1BN6A 4OB6A 1QIFA 1LPOA 3G0BA 1DTEA 2WJ3A 5AO9A 2QMQA 1MN6A 3VJKA 2AJCA 1EINA 4U2DA 1N8SA 3BDVA 3KD2A 1CUUA 3DQZA 1UKBA 5JZBA 1JFRA 4QA9A 2WIDA 3QITA 2HADA 3X3HA 3WA6A 1W76A 2JEZA 4ZI5A 3ILSA 3FLBA 3G0CA 4UHFA 3VISA 1HL7A 2ZYSA 4YPVA 4Z49A 4DMCA 2X76A 1E8DA 2XUQA 1CUGA 1QIEA 2WIKA 2Z3WA 4EBBA 4ETWA 4BP8A 4H7DA 4E46A 5EIHA 2V98A 4PSDA 4HXFB 2Y1KA 5C8XA 3MGAA 3BWXA 5IKXA 4BE9A 3DL4A 3NGMA 4M0FA 2O7VA 1QFSA 1MNAA 1SFRA 1XZCA 2VT7A 1JJBA 4UHDA 2WG2A 2XMBA 3WKAA 1GXSA 4ZGBA 1TCCA 4TPKA 5EI5A 4FFWA 3L1JA 4RE6A 4IH4A 4RGYA 2Y6VA 3FLEA 4AMZA 1XFDA 1LGYA 4PW0A 2GZRA 4K2AA 4CCYB 1B6GA 5BV7A 2JGLA 1U2EA 1YR2A 2XDWA 1N5RA 3SWWA 4MYSA 4DGQA 3KOOA 1WB4A 3STXA 1QLWA 1K4YA 1JU4A 4X93A 5HFNA 2CMFA 4M0MA 1CUEA 1RP1A 3PUHA 5AM5A 4G8BA 4AN0A 2ZJ6A 3QMVA 1UFOA 5KWIA 1H2YA 4AMYA 1TQHA 3OTQA 2VAXA 3VXKA 3D5EA 3HSSA 5CMLA 2QZPA 4FFVA 2I3ZA 3VKFA 2RHWA 2BKLA 2QTBA 1ZOIA 5FKJA 4AQDA 5FLKA 3WKBA 3R3XA 3BIXA 1XRNA 5AKIA 5AKLA 3K9BA 3F97A 4BZWA 2OQIA 3WJ2A 2I3DA 4EY4A 5IVHA 3ZLTA 1QIIA 5ALXA 1BS9A 1THGA 4Q3KA 5AIBA 1LPPA 3M83A 4NZZA 4BRSA 4J0GA 4YK7A 4H35A 1CUAA 1UXOA 4H77A 4W1PA 2WIFA 4MQLA 4JH0A 2WHRA 4UUQA 4LYDA 3Q8WA 2CBGA 2WFLB 1XKTA 2QKYA 3G8YA 4FBMA 1K63A 3QPAA 2H9YA 1VZ2A 4X3CA 4DNQA 1ORVA 1IUPA 4L72A 4DNPA 1JI3A 3F8SA 1P0PA 5AK3A 1TAHA 4MYDA 2OCGA 3IB3A 3AJAA 3DNMA 1LZLA 1FFAA 1RYYA 2JGMA 3F67A 1KU6A 1QTRA 3D59A 2XMZA 3DKKA 1AC5A 4HS9A 3FBWA 3BJMA 3OOSA 5T4EA 2HFKA 1VKHA 2PSJA 4LHEA 1LNSA 1CV2A 2HA5A 3HLKA 4W63A 5AM4A 4Y2SA 5K3FA 1WB6A 3PICA 2Z8XA 5AH0A 3FAKA 3SC2A 2XE4A 4QDUA 1CUBA 1K6EA 2JGJA 5ALIA 5I7UA 3AILA 1MTZA 2HU7A 4O08A 1YA4A 3TEJA 1QFMA 3ICWA 2QS9A 5JZSA 1XZDA 4WY5A 5YASA 5T4HA 2VEOA 3BF7A 1FFCA 4UBOA 5LZ7A 1UOOA 3HABA 1JU3A 5K3BA 1W75A 2JF0A 4GBGA 1QIGA 4QWMA 1R9NA 4A23A 4Y2YA 5FPQA 2C5FA 3I6YA 2VAVA 2QOEA 1T2NA 5AKJA 1MAHA 2V96A 1DWPA 2ZSIA 2WKWA 3NWOA 1QO9A 4NVRA 4B9AA 3DOIA 2B61A 5EIAA 4B80A 5K5EA 1WPXA 3G02A 1BE0A 5AM0A 4X91A 5AOBA 2HL6A 2DQYA 3WIOA 1P0MA 3WZMA 4EHBA 5LZ2A 4D9JA 4QDOA 1WM1A 1XQYA 2JEYA 1JKMA 3FCYA 1UOPA 3C6ZA 2XMRA 2Z8ZA 3H2IA 3B3QA 3V1NA 2XUIA 4UHBA 1L7QA 3ED1A 4PQEA 1LPBB 5ALPA 5AKXA 3D2BA 4BAZA 4UBIA 4P93A 1LPSA 1EK2A 1S8OA 1XZHA 2WSLA 1SOMA 4K6GA 5A7FA 3E1GA 4AO8A 1ODSA 3AZPA 3RM3A 3VDXA 1SCQA 3O9MA 5SYMA 4J3JA 2Y2UA 1HLGA 5A7GA 2PUHA 2HDWA 3VJLA 5DNWA 3FNBA 4YX9A 1CUVA 3WI7A 4Q3LA 3IUNA 1CRLA 1QTIA 1A8UA 2XQFA 3YASA 3UMJA 3O95A 3STYA 2FUKA 1ZD4A 1UOQA 1GKLA 2BGNA 4HAIA 2CJPA 3FYTA 4LXIA 4H7HA 1XRLA 1X70A 1YSCA 1PFQA 5FRDA 1DWQA 1HQDA 1E89A 5I9IA 3HC7A 4B81A 4BZZA 5AK6A 1ZI6A 3IBTA 4J0IA 1CIJA 5AK5A 1IVYA 4I4CA 4GECA 5JZ9A
chains in the Genus database with same CATH superfamily
4BO6A 1DX4A 1QF9A 2FMYA 1PD0A 1QGED 3GUDA 1RRGA 1Z68A 3GIWA 4Q15A 3WWCA 2FY8A 3CC2I 1ZIDA 1HFKA 5FOVA 1VHJA 2NACA 1JPJA 2QT0A 1QGUB 4I4TB 3JQDA 3L6OO 4PIMA 2BMAA 1ZD5A 4XDHA 5E9QA 4AY4A 2XCLA 3WB2A 4YHHB 3NDPA 1E3QA 5IYDJ 4CYDA 1E3SA 1RCTE 2C2WA 4H18A 3RAPR 4DR3B 1DMSA 4MAAA 2IVFA 4Q00A 1C7QA 1PZEA 1QVZA 4IEFB 4KQXA 3PX2A 1DCMA 1WSAA 1ZVKA 4AIJA 2XF2A 5K3OA 2WIAA 5KVCA 2BP7B 4RIFA 4QSHA 4XLLA 1G8XA 3ESQA 2RHCA 3FBTA 2E89A 1N0VC 1T6XA 2EXXA 3SK0A 4QUDA 3OR2C 3AHDA 1JEYA 4YCLA 4NABA 3TR0A 5ERIA 4FBLA 2GX6A 2CZCA 5G4KA 2QMZA 4Q1DA 5L4LA 2A0KA 2HU5A 2VKQA 1BBYA 5T6MA 1QC5A 1QF6A 4P0TA 4PCQA 3QVLA 3IELA 1ZOOA 3BVPA 4KIUA 1Z6XA 3CX6A 5IUNC 4XPIB 3I59A 3U7RA 1B8PA 5E1BA 1IBLB 4UBNA 3IAM6 2ZETA 3MTDA 1PV2A 3O83A 3P5SA 3RS9A 4AF8A 2HOTA 3DLTA 4PSAA 3ZCRA 3S68A 4GUDA 1S6YA 2Y9YA 1MQ8B 5IY5H 2WB1A 2BEVB 3FG9A 1E4VA 1DXOA 1E4OA 1TZBA 1W4ZA 2I2WA 2XCOA 2UWMA 2YMLA 4AVYA 1HNWB 1SUPA 4JLDA 1BIFA 1M73E 3A2NA 3KR1A 3E1SA 4G8CA 4HX5A 3TPZA 2GTHA 4B0PA 2OWEA 1DKNA 2AG1A 3AP2A 3D02A 4JJEA 4R41A 4RH3A 3WWYA 1JIQA 3GRZA 2JLRA 1HSTA 4MWSA 2RARA 5F5XA 2ALJA 2BT4A 3PTAA 3TCKA 3U7GA 2FB9A 1GCOA 1QSGA 4UB8C 1L1QA 2R7QA 3LAJA 2PN1A 1H8HA 4LOIA 3ZE2B 4E2WA 3LQQA 5F77A 1V8DA 2WRZA 1B59A 3RBVA 2HTSA 3EQ9A 3SSOA 4G4SO 1IM8A 1NVVQ 2I55A 1L3CA 3ZJYA 2IH5A 2GAUA 2HK9A 5KC9A 3I1FA 3KOXA 2OXTA 2V0GA 1GJRA 2Z2KA 1PV1A 3EAGA 2YOGA 4CRWB 1WPKA 4CZCA 5CM8B 5AI5A 2AWNA 2NPOA 1YQAA 3GEBA 5CEEA 2W58A 2C9DA 3CKYA 3OF5A 4KE8A 3RHZA 3L46A 4C0KA 4A15A 4MCHA 1DUVG 1FWZA 1U6JA 2W84A 1H3FA 1NY6A 2D54A 2P5YA 4J0CA 5EXEA 2O3TA 5BUCA 4BXUA 5ERGB 5HUQA 5F12A 3U4GA 1OFVA 2R5ZA 1E4EA 3ZDZB 3IAHA 4B6QA 4HYEA 5L3BA 1AF7A 2OFPA 3DVLA 3QP5A 1BMTA 2BFOA 2K4JA 2HGZA 4IXAA 4OMDA 4OINF 4TS3A 3MUOA 4X1KA 4HATA 3FPJA 1WCIB 1Y0UA 1Q0RA 4QWWA 2AEMA 1US8B 3AVOA 3JQ8B 5EKDA 1EG7A 1G5IA 2GN2A 2J7KA 2RB5A 5EUBA 3WGMA 4EPYA 1LDGA 1QCDA 4EG3A 3RSOA 1FUKA 2PX9A 3MTAA 3FTQA 1VQ9I 2ST1A 2ICWG 3CXUA 1T4GA 3P9IA 5GAEJ 4I36A 4RK7A 3VSEA 1Z91A 2HS5A 1U6GA 3EUHC 1DWOA 2X6WA 1RJDA 1DIAA 2QL7A 3K7EA 4JJ8A 4LYAA 4B4OA 5AM1A 2C0QA 2JCBA 2RIPA 3MWLA 1PLLA 3MJTA 2OVFA 3R7SA 1Z0KA 4EKEA 3ZQ4A 1UDCA 1YC5A 1OJLA 4A1OA 3PQEA 3ZZTA 5J5VA 1G5TA 1Y7IA 1RPWA 2WKPA 3SZMA 4F4DA 4NAHA 2HWXA 4X97A 3TSOA 3U9TA 1UDXA 2WDPA 2I4MA 1L7EA 4UPVA 3EB9A 1W5BA 1WXXA 1KY2A 3BSWA 3E2MA 3OE1A 4E5MA 3FB1A 3ZJVA 5AI0A 4FWBA 1VJRA 3GCZA 3LLCA 2N46A 1AHNA 3QNMA 3PIOF 4MQ5A 2IZOA 2ZJ4A 3PNKA 3Q8LA 4HPJB 1TQ6A 2C95A 4L57A 5JZOA 3E97A 1A5SB 2GVDC 3G0IA 1IUOA 5AP9A 4UU8A 4FGUA 1YE3A 1K2VN 2XB4A 4CM9D 3CZ5A 3LOQA 1E5VA 3REQA 1EP1B 1H8HD 2ADMA 1QG6A 4LQCA 1J9ZA 2JI6A 3D54D 1JUMA 2ODEA 4E14A 4PS1A 5C5DA 1EDDA 3EEYA 1A2QA 3PFKA 1KQNA 2F3TA 2FD5A 2VBCA 1XQ9A 3UB4A 5HRUA 3K0KA 2PL5A 1QZZA 1TM5E 4PYIA 2PJPA 2MSEB 4KKVA 1ZH4A 4RXMA 4CKZA 2X3UA 3BFJA 3PC8C 3WYDA 1ADGA 2BUAA 5HS6A 5EJEA 3UGJA 1XD8A 2O61A 3F6BX 5CBPB 4Z53A 3VSDA 2Q2EB 4EH1A 5GY7A 4DIKA 2GYYA 4D5CA 1C0IA 3KWFA 4PVDA 4U7TB 4BGIA 2P2LA 3DXXA 3HWX1 3JD2A 4N03A 3RKQA 1RLMA 3ESDA 4PWZA 4D4GA 1BRTA 2AYYA 3KKPA 4WDQA 2B9SA 1GQRA 3AERB 2VB6A 2PZBA 4WCFC 4Z9FA 5I9NA 2D1SA 5E6UB 3RVDA 4OYLA 1DFHA 1OI2A 4BQIA 3QFRA 5EMLA 3GUYA 3RBAA 4ER3A 5J1UA 2AG8A 4FR0A 5C7IO 4JLAA 3U3MA 2JGAA 1PS9A 4BTEA 1F9NA 3P1JA 3WK4A 3W2IA 5J1SB 1IQ0A 3EVEA 1E8NA 4DREA 4XFKA 3SQMA 2FHSA 2EJVA 1JJ6C 4Y6OA 4L07A 1V3UA 1T0FA 4YRBA 2G04A 2JANA 5IAGA 4Q4JA 3TSAA 3L7JA 4F1JA 2QEXI 1CEQA 4RNDB 3DZFA 2BZTA 4CMEC 2BYTA 3VPBA 2X19A 4HX4A 2PZKA 2DKFA 4RA6A 1T36B 3L1IA 3DBRB 4WACA 4XIYA 5F27A 1QNTA 3A03A 5HJ7A 5KNCA 2HQRA 5LNK1 4TLEA 1G3QA 3JALA 5GAJA 3TDMA 3OTOB 1TA0A 1QIHA 2OCKA 3WL3A 2CDRA 4HC4A 1U78A 1G9TA 1R36A 1ZH0A 1ZWKA 2FSUA 2JLXA 4ZOAA 5KYVA 1QQBA 4WCFB 1XDWA 3CNHA 4TGLA 4EP1A 3K2QA 3TQQA 3VMFA 4F4UA 4L7VA 5LRRA 2X22A 2WU0A 4QOHA 4KRXA 4Z8XA 4UTNA 3UA4A 4PCUA 1SN7A 2OD5A 4CU2A 1P60A 1Z2CA 1LPQA 1QYCA 4GSKA 3KJGA 2HSEA 2O2CA 1ZD3A 2WBLC 5JIBA 2H00A 3PHHA 2G25A 2OBNA 3HOUJ 4E7JA 3F2VA 5CLFA 1Q0ZA 4X92A 2IYFA 3VZCA 3IX7A 4A69C 3PD0A 4JT2A 3A58B 1WP9A 3R5XA 1JXSA 2A78A 3IAAA 1ODTC 1JQDA 3ABZA 3DF7A 4YALA 1GUUA 5G41A 2PZLA 3EEFA 3MMNA 4ZO7A 4HQRA 2YJ3A 1CVLA 3KLNA 4JROA 1AKEA 1RI1A 2JK3A 2G0AA 5ALDA 1ZHFA 4L0YB 2H11A 1O94A 3AB8A 1HXHA 2E19A 4RNCA 3RVRA 4JYMA 3AJDA 4MX8A 5CUQA 1Z5NA 3SVZA 4UNPA 1VBMA 4M98A 5F3DA 3Q87B 4R2KA 4RH1A 4S0XA 2Y1WA 1HYHA 2V8BA 3L2VA 3RRXA 2JDIA 4P3OA 3X43A 2AEEA 3NIFB 4PXSA 3AC0A 3ZWPA 2ODAA 4KK3A 3H05A 4RTKA 1RAFA 2W43A 1UAAA 1ZCAA 2EW8A 1NUUA 1ZM9A 4PPYA 1A7JA 1KK1A 1TWAJ 5EYPA 4UEJA 3WLJA 3NX4A 4Z7OB 1FXWA 1B8VA 4IQ8A 4AIKA 5FTNA 4ESBA 1NV8A 4ZAGA 2OCLA 3CZCA 3GTGJ 2QP3A 3GRUA 3OZRA 3H5OA 2V6IA 3PLRA 1Y4DE 2FGKA 2VP4A 2DLCX 2IU3A 2X6QA 3LWBA 2Y48A 2I4LA 3NORA 5E3IA 1PJRA 3UH1A 2NTEA 3UBMA 4Q47A 2EKBA 4EJWA 1C1XA 4LZJA 1CHDA 1GGJA 5L4NA 1LCIA 1RYHA 1C8BA 4KDEA 5CIYA 3IAEA 5B7GA 3ROUA 3PFNA 5EZ6B 2EKLA 4P2BA 4RZXA 5COQA 4ZCQA 5GTDA 1CQTA 2ZXWH 3TRJA 4ZN6A 2H4YA 1Q16A 2AZ4A 1I5ZA 1U8FO 5H8WA 1BOAA 3OT4A 4MPPA 4R8SA 5CURA 1YVUA 4BKXA 2XYGA 4FUQA 1A1SA 4P1WA 2AJBA 4KXXA 2BFMA 4UTOA 1EJ2A 4TOIA 1KZHA 4LG0A 1NF2A 2LP4Y 4PZPA 3EZ7A 3RRZA 3ERMA 3S1QJ 1IHUA 2FLKA 2P5VA 1K8QA 3ND5A 2C4MA 3QFHA 4JC4A 3VO1A 5JAIA 4M9QA 5F23A 3BCHA 4PAMA 1SD1A 4G86A 4UJ5A 4WKGA 2J9RA 5JCOC 1I33A 2PYIA 4UCWA 5FOUA 2BH2A 1ISSA 2VC2B 3CX4A 4YVFA 3K1AA 1N0IA 3CZAA 3R4KA 3QKSB 4L9RA 5AWFC 1QP7A 2WKRA 4M1WA 3SVLA 4GOMD 5J5AA 1QZXA 1YJ5A 1R7RA 5DYMA 1RJ9A 2L19A 3O1HB 1XTJA 1BKYA 3B6IA 3U62A 1TM1E 3E27A 1N2SA 3P0JA 4GC5A 4ZMSA 1UXKA 3JREA 1B26A 5FGMA 4GI7A 5KKAA 1XSXA 4Z4EA 1WMFA 5L3EA 1YJWI 3AY7A 2R79A 5BR1A 3AUUA 2NADA 5IUKC 4DJDC 2M4GA 5D6FA 1BE8A 1QIDA 5GPCA 1MR3F 4MINA 1C7IA 8ABPA 5JWRA 3MK31 2PX5A 1X7YA 3JAKB 1G42A 3IBCA 4WTOA 2O3SA 2PU5A 3M6WA 4IICA 4X8MA 2O6HA 1GV2A 4PLFA 1FYDA 1AKNA 2C4WA 4UNNA 4OHFA 1OLOA 3CO0S 4YP0A 3UWDA 2G9ZA 1CRWG 1YCGA 2QBYA 1TRKA 1BGVA 1X39A 2G3YA 2JL1A 2JLSA 3B9BA 3MJFA 4O4LB 5E95A 2IHUA 4U2FA 3VGPA 3GLIB 2WJJA 3M4JA 1EDOA 1PVVA 1W5AA 3PZBA 3ZEAA 4C08A 5LMUB 2KWIA 3PL1A 5GONA 4GL2A 1P7YA 1SVMA 3E6BA 2Z1MA 3FXAA 3TOAA 2LOOA 1Y1WJ 3A6GA 3K1ZA 4OGWA 4X24A 4GZ5A 4MQFB 1WMDA 5BWLA 3ZGOA 3LCUA 2VJNA 3KT0A 3CR8A 4KLCA 4B4KA 1I1SA 3F6CA 1ETHA 2XYVA 3ZXYA 5H16A 4JI2B 2Y0BA 1QVVA 1P4WA 3LOCA 2JJ7A 2R6AA 3C98A 2VUMJ 1Q1VA 4W1SA 1J0AA 2FMXA 2LY2A 3R8CA 1G55A 1I2DA 1PEAA 4QTXA 4OHBA 2ZRJA 3FDFA 5FUBA 3PTLA 2BRUA 4BDTA 4KPEC 2A0UA 3AGQA 2XAJA 4JNCA 3ETDA 2K85A 3H2HA 5TGZA 3ILYA 3WLHA 4EHHA 4ESOA 4YFYA 4F38A 2ZNYA 1F2UB 3G8BA 5IU6A 3DLAA 3BSSA 2GN1A 1QQ7A 1GPKA 3U9GA 1XL0A 5FUVA 1I24A 2QTVA 3EVDA 1GRVA 1M0TA 1YR9A 1Z8FA 2FWIA 2J3EA 4RLHA 2GVNA 4W7IA 2EEPA 4A0RA 3WX0A 3L0IB 3ZW8A 1AXGA 4BMDA 3SJAA 1D9XA 4U4AA 2O0MA 3K70D 5KKCA 3LUHA 1PWYE 3I59B 1QE3A 1O7JA 2PPLA 2WNSA 3C7AA 1UQRA 2DUNA 3G0GA 4R05A 4X71A 1UB9A 2Q5JA 4UNQA 1NVGA 4YMSA 3VSCA 4XRRA 3ZK7A 1O3QA 2D2EA 3GBSA 2BN4A 1R5JA 4D25A 1MEEA 4RKYA 5ILOA 1REQA 4MYTA 4F2PA 1YJCA 3GCGA 5A4DA 1UIRA 3LPCA 1OZGA 2KPOA 3A6LA 4QJIA 2FW1A 1IYZA 5E8JA 5JAZA 4YXWD 2WTBA 1L3BA 3R6LA 4GEGA 4YAWA 4Y8VA 2ZR7A 1IW7F 5BWCA 1N2CA 4CDGA 3J7AO 4NV0A 4JR1A 1Q1ZA 3BR3A 5LD2C 2NYVA 1PYDA 4LXYA 5TSDA 3Q15C 1QV9A 4E0BA 4HWKA 2GA1A 1ZJZA 2WIGA 4OQPA 3K4LA 3IT1A 5CX1B 3FOEC 3PP8A 1EX9A 3ZEIA 1Z0XA 1Y89A 4TZ6A 3GBPA 1BVHA 1SWWA 1KONA 3CPSA 2E3JA 4TZ0A 4HXYA 1Z0ZA 2YZ2A 1P2SA 1BCRA 1G4DA 4OAZA 1CJTC 1RXSA 3FGNA 3NTOA 4MUAA 5EE0A 2F48A 4EI8A 4M60A 4XKCA 3IQDB 5FUYA 1XGMA 5G0WA 3A9CA 4HVTA 3BE4A 1UXHA 2YFHA 3GDHA 5EJIA 2HLDD 3LDUA 1JHRA 3TI9A 3UG6A 3EEBA 5H83A 5JJIA 421PA 1L4HA 1LRKA 2I80A 2P2ZA 3V8KA 4TX1A 4KYWA 1KA8A 1G6KA 2QX4A 3DDSA 3WGLA 4CMEA 1G3TA 3NHFA 3W6OA 5KOJA 1WJCA 1NRJB 1YHNA 3KJIA 4JEMA 4I5DA 4REMA 2CUFA 2YTZA 3TGWA 1I7LA 2QTFA 2PQ2A 3WK7A 2K9NA 2B83A 2CJWA 4GMFA 1TO1E 4NNJA 3DE5X 2P3SA 3R3HA 3DKVA 2JC3A 4P81A 4PPFA 4TMFA 4YP1A 1OTHA 3AOGA 1P0QA 4B3TB 2Z5UA 4AD9A 2HA3A 3B6KA 3N2LA 3OI7A 4PQRA 2PMUA 1MSEC 4A0FA 1ORKA 2HRZA 2VQSA 4L9AA 4ASUD 2GMWA 3D1JA 3R23A 2W70A 1WI9A 2Y69H 3CDLA 4EJVA 4OWRB 2ORED 1XP8A 4IX7A 4Q05A 5ESXA 3W78A 5DNUA 3TLGB 1ZKDA 3DOUA 2PO7A 4GOJA 2RI6A 2WDZA 4PTYA 1SIBE 1X80B 1AQYA 1I39A 1FDWA 1GZHB 1TRHA 3S1SA 2Y3IA 4BZXA 3JAWA 4W1RA 4WZAE 5ICSA 3NM6B 4Z7JA 3FNFA 4PYKA 2YDYA 4KMRA 3OX1A 1E2PA 3QLVA 1ESMA 1AB6A 2EC5A 1C7JA 1F9AA 3EZ9A 5HF5A 1ZA1A 3PQCA 4A8JA 1LS1A 4U7DA 1E3JA 1YS1X 2VCEA 4MB6A 1GGVA 2HDHA 3FFXA 4J7UA 3RV3A 4JITA 4PYJA 5AJHA 2VWHA 1YS9A 2MTBA 2ZYTX 4XD7A 5IYZA 2Q4TA 5EGNA 1Q0LA 2XA9A 3K0LA 4A4DA 4C4OA 4AZ3B 3M7GA 1UINA 3Q2IA 1GG5A 2MSDB 5IT3A 2ZYWX 1RJ9B 3NUZA 4RKQA 2XUPA 1COZA 3HVUA 2OV7A 1LV8A 4DV2B 1L4YA 1DADA 4L6CA 4CG0A 3TEDA 2IDKA 2V7QD 2VUUA 2XDQB 3IJEB 4L0MA 3U13A 5BV8A 1AV6A 2CW5A 3EDRA 2BUCA 3I1YA 4JB0A 1TK2A 4UBLA 4UDXX 3ZHOA 1HR0B 2H2FA 3JYHA 1H23A 3QVMA 4JQOA 4NDAA 3DF8A 3P9NA 1KO4A 2PJUA 2DODA 2XZDA 2H1KA 3M6IA 3FWEA 2HXYA 3UC5A 3ROKA 1ZGCA 2VZ8A 1FZPB 3IA7A 3H1TA 4DUZB 1LE8B 5IC4A 1VG1A 1MX9A 1SCDA 3F23A 5KTSA 3D81A 4DEYA 1UBHS 4OHKA 4V1CB 2JAQA 1PP4A 1CY1A 5JTUA 1CQWA 1N2GA 2VNSA 4HEA1 4PFJA 2BLNA 3KXKA 1WCYA 3B89A 1OLTA 4TWJA 1Y8QB 4ITVA 2VYVD 3V4RA 4JA2A 4DRXA 3I1IA 2O4CA 3ZW7A 2Z9DA 1HH4A 3MWYW 1Y7PA 2AJLI 2O0YA 4PHGA 1F8FA 5D3MB 5DM0A 1OU4A 2FFBA 4JZKA 2QY6A 4GO1A 1L4NA 2IE0A 4JLJA 3UO8B 1HY3A 3PXBA 4J76A 4L15A 4J16C 2FSHA 1ACIA 1TWCJ 1SMKA 5J63A 3SF0A 2JHAA 3MHPA 4PLPA 1VKNA 2X8LA 1JSZA 2GN8A 1SXIA 3OIUA 4PHHA 3IE0A 4ZVUA 3MAJA 3OPQA 4I4IA 5HIAA 1QG0A 2QD1A 3KKKA 3VOBA 4L5EA 5ALEA 3CCJI 3WRYC 5KYWA 2A7XA 1VKZA 2RCYA 4BNZA 3GHYA 1VECA 1KK2A 4OMUA 1G8AA 1XQ6A 3CNEA 4TV9B 3VPHA 4HV4A 2JHGA 3IJRA 3FA2A 3G8CA 3NIGB 2LR8A 2DMNA 2WVGA 2FQ3A 3CW2A 1XX5A 2W22A 4ZKDA 3DMTC 3RTBA 3D7NA 1NZJA 4QUBA 4RX1A 3JR3A 4YAFA 1NSFA 2VJDA 1ECCA 4QICA 1LB2A 2A5JA 2KJCA 2IPLA 1N2JA 4DPLA 4G4JA 2O8EA 2E5ZA 3DKXA 4L3WA 4WKNA 4JJFA 4LJ6A 3VR5H 2L4MA 2M9HA 4HHEA 1IE3A 4LCBA 1RZUA 2E1RA 1HF3A 2CXSA 3GDFA 2DHRA 1YS6A 1QVTA 3GVIA 2FOKA 3QYEA 1PDNC 1T1JA 1RJEA 1IPFA 3QF4B 2VJMA 4TVOA 2CUNA 4ZAYA 3SIXA 4RMGA 3UQYS 1AKRA 1RFLA 1D1BA 2NNLD 2EU8A 2XTJA 2DHEA 1U4OA 1A8PA 4J00A 1G6OA 5KTOA 1T0JB 4TKVA 2ZJ2A 4BE2A 4NC8A 1WDTA 3NNDA 1UWKA 4CKWA 3AT1A 4ALKA 3O8DA 1O77A 4XRGA 3UMSA 1PR5A 4ATNA 3ROTA 3K8OE 5TPZD 4ZAZA 2VP3A 2FPGB 4MNUA 2H7VA 5ITVA 3ADBA 2CDAA 1MGTA 1FPQA 4CFYA 4KIBA 2W83A 1M7GA 3FRJA 1HEIA 3I8XA 2OGZA 5BPHA 3KZZA 4C6HA 5HWSA 5A3QA 1V1RA 3TNDA 1ESNA 2GPAA 3QKSA 4B6RA 3STTA 3I23A 2ID4A 1ID8A 4DC0A 1DEHA 3QNWA 4Y7DA 2STWA 3NZEA 1JFFA 2PKEA 2RQQA 4AKSA 4YDHB 4EECA 4UQLA 2IRWA 3ENWA 5KREA 1HKTA 3A0RB 2VOPA 3DEFA 3VR2A 1U04A 3QX8A 4JXKA 2OO5C 2C8JA 2OC9A 3NJ4A 1EK0A 1A35A 3GJQA 3UPTA 3R76A 5IFLA 3ELWA 4L74A 1Q0PA 1TYDE 3LP5A 1CD5A 1ML3A 1JDBC 3ZQGA 4H3VA 1FX0A 2WMNB 2ZJAA 5KTKA 4FYIA 3V7YA 1EWTA 3LZCA 2R1VA 2QN2A 2D45A 2J9FA 4QXMA 1ESZA 5AK4A 3ZMUA 5EKUA 4BMVA 5EIEA 2O5RA 2QAGB 5AJUA 3D6VA 1X4OA 3HDGA 1BROA 4C4PA 2QD4A 3NT4A 5CT6A 2CLIB 1TLFA 3LVRE 3TQOA 4DYHA 4Z9AA 2H85A 1GD1O 5DBEX 1N5OX 3CD6I 3QH4A 3SXPA 3WL8A 3WXBA 2XYRA 3N05A 2DFPA 2ORYA 4QDKA 4RAOA 4EYSA 5A2GA 2O2IA 3I5XA 1KDOA 1Q1EA 1XXHB 4KV9A 3N6XA 1RDFA 4H1HA 3HHPA 2O8XA 5KVQA 2A0YA 4FFBA 3S2WA 2I54A 2IA5A 4PNPA 5IK2D 1CQJB 2YQ5A 1UPAA 2DWQA 4TZTA 2QUKA 4RMHA 2YHAA 2F7SA 3OLYA 3G2IA 2GAOA 4PC7A 4F5EA 1UMDB 4MQFA 5IABA 2WFZA 1K3UB 1W87A 4PFOA 1PVEA 3BCRA 5BRNA 4CF5A 2VHUA 5BPFA 3KM0A 2UYOA 3KUXA 3M9LA 5FROA 4OHCA 2FRVA 5AUPB 2NP7A 2RB4A 5FDFA 4QHTA 2RDPA 1TC1A 2GDZA 2XXAA 5C7OO 1XMVA 4NZNA 1WULS 3U19A 1C9JA 5JAUA 4C7OB 5AHOA 3C3YA 3JQQA 2GF9A 3CBQA 3HJCA 4L7QA 2YBDA 4I5GA 5JV5A 1HORA 3UEOA 3W5SA 4BVBA 1NRXA 4MUMA 4AG3A 3HN2A 4X00A 1XT6A 4ZYEA 5JDIC 1OI4A 2W6CX 3MFQA 5K4HA 1OCZH 2O3RA 2QMOA 5DJ5A 4IHJB 4RVHA 2BFFA 2XTNA 3KYIB 4K9PA 3ZTTA 2V6GA 4YO7A 4NAUA 3ESXA 1JNXX 4CLOA 3PE6A 2EGHA 1S8NA 1YKFA 2E60A 1Z18A 2B4KA 3BTJA 3AMVA 4BXXJ 1IZYA 1FDUA 4O3MA 1O6CA 2WM3A 3FPSA 1T0IA 1W30A 3T4PA 1K88A 2KLBA 3H1GA 3EXFA 1MNMC 1V9CA 3ZV5A 4WKOA 4QG3A 1M6NA 2XMGA 1HKHA 2H09A 1DCFA 3QLUA 4RGQA 1P18A 1ADCA 1R37A 1SHZA 1GRRA 3U3DA 5EHQA 4IRHA 1UBJS 1W48A 2DFVA 5SICE 3NUQA 3WNQA 2GRAA 1EK1A 3ZUGA 1ACJA 4EVRA 4AQ7A 3BXFA 1Q7EA 2KB0A 1P5ZB 5EPUA 3TZBA 3UCFA 2QEQA 5EC8A 5E1ZB 1Y6FA 1R6TA 5A6SB 4XQFA 3CP8A 3FISA 1FRZA 1V7PC 2JIRA 1WVRA 1PJLA 4M53A 2M2EA 1OE0A 4KSBA 4TXHA 1KEUA 1DQNA 1DSSG 2W2QA 2YY5A 2B21A 2PRSA 4KAJA 1M8JA 2OD7A 4P36A 1Q1QA 2IZZA 4QQKA 1S3SA 4RB3C 1WQ2A 4C0BA 1NN5A 1Q44A 2QDKA 1EIWA 4MLCA 3TRFA 2X3FA 4NF2A 3ZQKA 2HZ7A 2NO5A 3GU3A 3GJ5A 1NQAO 3NT5A 4RPHA 2EBHX 2IGOA 2BVLA 3K7AJ 2D4HA 4KQCA 4K9RA 4OQMA 1X86B 2BFWA 2NX2A 2HGSA 4M7WA 3BG5A 3O1LA 2H57A 2WSMA 4FD3A 4YQFA 5I4CA 1W36B 4N39A 1LZKA 1RUOA 4Q7LA 2YHBA 3QBTA 4Q3EA 4XB1A 4MS1B 4JP8A 1C0EA 3B6ZA 3H86A 1MIJA 1XZIA 3ML6A 3JSPA 2IKSA 2VNAA 1CZUA 4MJ3A 2A9QA 2BJWA 3B5EA 4OI2A 1L1RA 3MVPA 5DM7F 2DWCA 4NECA 3A6ZA 3D6FA 2WP0A 4A2UA 4V0ME 3TRIA 1O5OA 4KDCA 2D8AA 3GH3A 3HKCB 4OQLA 1L9XA 4EHKA 4GNRA 4LRYA 1OKKD 2I99A 2D3WA 3T7IA 3VDQA 3W7AA 2FWRA 3ZE6A 5HQJA 5G1PA 2AIRA 1ORWA 5F2KA 3O2PE 1FIAA 2H1OA 4QODA 1XUOA 3OC0A 4IEEA 1E3HA 5B7NA 2O2GA 3WMWA 3HLTA 4NFLA 2L7KA 5IANA 4DLZA 3BX1A 4MS1A 4ETIA 2X48A 3DFMA 5IPFA 1XD2B 5DTJA 1C3VA 4Y1FA 2AQEA 2HVRA 1DI0A 2WJZB 3E0QA 3ZCVA 4RJTA 2JK1A 2MD5A 4NCJA 2ZB4A 4XYMA 2PL9A 5I7RA 3DHEA 1CRPA 3UJ3X 3U56A 5KTTA 2J09A 3RK4A 2DMQA 3EFHA 3EZNA 3UMRA 2QQ5A 3OQ1A 4GF5A 5DLDA 2WY2D 4BUCA 2DULA 3I2YX 4WJZA 4DLLA 2NXJA 3CWZA 3SXUB 5LQRA 3D0OA 1KA9H 2OKCA 4H3HB 3RFCA 4XSHA 1O6ZA 3M07A 2VJLA 2YYSA 1IUKA 3OA2A 4KYVA 4LBYA 1YS4A 1JTFA 1H94A 4BFYA 3PUFA 1G8FA 2NZUG 3K5HA 4HDMB 1A95A 4G09A 4UNIA 2IV7A 3ZK9A 3EF1A 1BDJA 3JZIA 4WXEA 3ITEA 2P2NA 2ZBKA 5KCMA 1NONA 1UAYA 3JVDA 5DBOA 1Z5VA 3H36A 2BHLA 5EUQB 2ZVDA 3H2JA 4C0HA 3URKA 4GOXA 3OEHD 2O2EA 3TW4A 2VK1A 5LCXA 2QR5A 1EK6A 3N28A 4XLNF 2VT2A 1O6GA 4M87A 3UAWA 2FFAA 2ZJOA 3AUYA 3JVIA 3NYRA 5KVAA 2PN6A 4FCCA 2XUOA 1TGVA 5TMBA 2L42A 4FYWA 1QWSA 5CT5A 3TOSA 2XLCA 3U9LA 1M8KA 2HCFA 2X5XA 1PR3A 1TTPB 4DANA 3TSZA 3BIOA 4HDSA 2FZWA 1Z6YA 3HEMA 4FILA 3IQZA 4MK4A 9ATCA 3LW8A 4AJNA 1Z82A 2PUGA 4PO3X 3A14A 4GWGA 1HDZA 3CF2A 3ZW9A 2AR0A 2JGKA 2GN0A 3FSGA 3L5KA 1Z56C 2MA3A 3SDBA 1Q20A 5LWQA 3OZXA 5JPIA 4Q9HA 3H75A 3T7KA 3FWHA 1HA8A 4KAAA 4ND8A 1Z4MA 2C84A 4RK4A 3R8XA 3ZE9A 4ZO9A 2CLSA 3GGDA 3L43A 1VIVA 3DMDA 4WXHA 5LP6A 1A4UA 2IY9A 3OWTA 2NVWA 2PGXA 3NG1A 2FNPA 3LGXA 2LKSA 3QY0A 4IHWA 2V7QA 3GPIA 3ORRA 5LB4A 4QPNA 4BXOB 3MJDA 2RHTA 1CUXA 4PZDA 3BMNA 3K6SA 4HAMA 3DZDA 1HNNA 2RK6A 3ULQB 3BS4A 3MSXA 4P32A 4LK1F 3DWIA 4F71A 1NVVR 2XA1A 2PLYA 2E5FA 4MV8A 5CRIA 3OYMA 4MHTA 1A3CA 1NP6A 5M3MJ 2ZAGA 2QVLA 3LKDA 4A7PA 3UWMA 3BFPA 2DYSH 3DDUA 1Y3HA 3G68A 4JIGA 1EFHA 2JIPA 3KTAB 3M5DA 4DLUA 4YO8A 4ZK6A 3ZGZA 4IHVA 1WDLA 2Y92A 3PQDA 2P2GA 4H7KA 1LSJA 3RSZA 3H5NA 4G23A 2AOWA 2PMEA 3PYLA 4HB0A 4AG5A 3H2YA 5HLHA 2XRNA 1UT8A 3NFYA 4TQUS 2XAUA 1I3CA 2OFOA 2OORC 2W98A 3E9RA 5JSHA 2IGNA 1Z47A 4OIRF 2LGJA 3QRFF 2JGDB 3GAZA 2PT5A 4Z1MA 4D8VA 1GTSA 4RF4A 4CN8A 3LWDA 5GZ6A 3AZQA 3V6LA 1BHSA 1KEVA 3MZ8A 4XWKA 4JYBA 4Q39A 2FW6A 5A1TA 5HF8A 2FJ0A 1G1MA 5JS6A 2P6MA 3QPUA 4J01A 1SVIA 2IHVA 2PLNA 1FLVA 1V8FA 3JQPA 2YIJA 2ZYHA 5LGNA 1CFJA 1C50A 3FUTA 1HBJA 3KVYA 4MWCA 4XSVA 4X1EA 2Q3BA 4UW9A 4Q1BA 4YACA 521PA 1VL5A 4YCCA 4YXFA 4ZZ1A 2QN1A 3OQIB 3QXSA 3CH5A 2DMUA 4J90A 3PHGA 4EY3A 4QU5A 1KARA 3SBOA 5BW4A 5HLTA 3BPSA 3I04M 2ZROA 4ER5A 1IDYA 3E2PA 3BR6A 4OYYA 1K7EB 5KNCH 1L5LA 2Z4TA 3GVAA 3UC9A 3L0YA 2G5TA 4YS6A 3V7RA 4WNIA 3PQ8A 2FR8C 2NG1A 4HZUB 3UJ6A 3E3LA 4IUCS 1UEIA 3A0BC 5LHGA 1I2BA 3CIFA 5BNFA 4BOYA 4DIFA 3NMUF 4B6GA 2YJZA 3F3SA 5AYVA 3DFKA 1BTOA 1N4AA 1PW5A 3JQCA 4QFMA 1K98A 5I51A 4CG2A 2O1XA 3E84A 4ZVTA 4Q19A 2R7XA 5JOQA 5C51B 1SQSA 1HYGA 5B1AH 3S32A 1LRJA 1K78B 1ZUHA 2WMOB 3PT5A 4NFSA 4IGFA 1WS6A 5CYFA 1E98A 1V54H 3ZQJA 1DQUA 1OIVA 4KUEA 1AS3A 1KHTA 4V0SA 1EXDA 1PT8A 5TIIA 2J6IA 1R66A 5K3AA 1H0HA 1PR1A 3E70C 4HFMA 1H9AA 4LBZA 4KACA 4RYLA 4TT8A 4WNCA 1E5LA 4ESHA 4TVSA 1P92A 3SJ7A 3AR4A 2NTJA 4GPEA 4JJ4A 4XIIA 1X19A 1E3EA 1NPTO 4GW3A 4IYRA 3NNSA 1WHSA 4NBVA 5K3SA 3IULA 4Z4GA 1RYDA 1JQKA 2W4MA 4U2KA 5CFZA 2QX6A 2XE7A 2YZGA 2G83A 2DQSA 3OYAA 2YQ4A 4XJTA 3H99A 3PDJA 2IBSA 1NU6A 1HC7A 3WTSC 3B9QA 2ACKA 3EDOA 3UAVA 4UUNA 2DFTA 2IUEA 3EH1A 1ZD9A 3KQTA 3NB0A 1PVDA 1NG6A 4TYNA 2BEUB 2WUVA 2VQHA 2E4YA 4GMGA 3C7CB 3E03A 2DT5A 1M66A 4ENTA 5B3LA 2F4VB 4DL9A 3A1EA 3M49A 3O8NA 3QK7A 4QBTA 1XPJA 5BWMA 3AONB 3FNGA 3HB1A 2E36A 4LC0A 2W2LA 5FH9A 3V2GA 1A31A 1XMSA 1K66A 4MQEA 2WD7A 3NHMA 3BZUA 1E9FA 1LVHA 2WILA 3AF2A 1GL9B 3IEIA 3GEPA 5E18F 3ES9A 3NJRA 3DXJF 2OR3A 2V4MA 3GFGA 3LKBA 4IKOA 2GA2A 1UFMA 2PG4A 4HI0E 4IRUB 4XYGA 4WBNB 1Y7LA 4M8KA 2CJXA 4F91B 3HLYA 3H97A 3LXRA 3S2EA 1FS5A 3VV3A 1R9TJ 1ADYA 2M7AA 4MGKR 1MVNA 2A14A 2DY1A 4CA0A 2P41A 4MIOA 2W6MA 4LGYA 3O75A 1Q1HA 1NLZA 3RG2A 2Z56A 3ZTYA 1ONBA 5CJ9A 2B4AA 4G2NA 5ITSA 5L40A 2XUBA 1QC5B 2P6RA 3WMRA 1R9GA 1W0UA 2AB0A 1WMEA 1LDEA 3EOZA 2VTDA 2JI4A 4A3JJ 2XTZA 2E6KA 1H69A 2I2BA 4J1QA 3RYIA 4A3SA 1D2EA 2NS8A 1V8PA 2R6R1 3OOYA 1JTYA 1RRPA 4MUHA 4PZLA 4QXOA 2F4NA 3M9AA 4DCOA 1X14A 4R8RA 4QZVA 1NUSA 2AFHA 1I2ZA 4A1FA 1I4OA 2W6IA 5EKXA 3D7LA 3HM2A 5JANA 3LZ6A 1CZRA 3RJ5A 3IAS2 3AIOA 4CLHA 5B6IA 5IEBA 2GYWA 4FDVA 2ZIUB 1QP8A 2EKPA 2HF7A 1W0CA 2G5CA 3DVQX 4I0WB 5T64A 3UHJA 1GPUA 1IV6A 3HOSA 2IIBA 2QW1A 3EGVA 3NHSA 5JDIA 5AW8A 3SU8A 3ND6A 3PWZA 3RVPA 4D79A 5KI6A 1HDEA 2ESNA 2C5AA 2O3JA 1P3DA 2PXHA 3MT0A 1CK4A 3EE6A 4BU2A 4R6XA 5K7SA 3RC9A 4HLCA 1NE2A 1S0UA 1X80A 1P9LA 2AQFA 5LGUA 1XG5A 1KDVA 2A33A 5EWJA 2IYAA 4B4WA 2PQMA 2IP1A 2QPAA 5FTWA 1R5HA 1EDBA 1W46A 5ELXA 2EGUA 2IXDA 2OENG 2GEDA 3HO8A 1B4DA 3O84A 3OZBA 2OZVA 4RZIA 5G3YA 3NCHA 5EWJB 3AESA 1IRGA 2AEJA 2ZVJA 3GC6A 3IIEA 3JY6A 3NC0C 1KAQA 1LC0A 3DDOA 3RRNA 4C6RA 3S8EA 3IE1A 2H2IA 3CVUA 2J3DA 4I08A 4QT0A 4BNLA 3RK0A 1RFGE 3FMVA 4U5QA 2Q2EA 5EY5B 3ZIDA 1G7CA 1YFZA 4AL4A 1FUUA 1J7JA 1N0HA 3ZHRA 3I1JA 4IXNA 2SHKA 3H8WA 5IW8A 1F4LA 4IRGA 1QPBA 1OVGA 2Q5IA 2DCUA 3A37A 1MH4A 4Q3DA 4XX0A 2EJWA 3SS8A 3HFRA 4BFWA 2HPZA 4ESEA 4RJLA 3OAAD 4F3QA 3IR5A 5TF4A 2OBFA 4BYMA 2PL3A 5JPCA 1C81A 7MDHA 1RYZA 4TVKA 1IB6A 4DAOA 1S6LA 4F93B 3HYRA 3WWEA 3ZK8A 4IJWA 5CDFE 1IF1A 3C87A 4MXDA 4KCGA 4OD0A 2GCGA 4I5IA 1KBOA 3NARA 3KCCA 4MGYR 4I5EA 3L2RA 1SXHA 2ECQA 3LY9A 4G4SP 3FVRA 4NG4A 1WD5A 5LMCA 1MRZA 2QN9A 1MKYA 3DMGA 2ICAA 4G56A 3LMMA 3WGVA 1U5TA 4XM2A 4MUXA 5DGIA 1OX4A 4EG8A 2G9QA 4Y2UA 3ZOKA 2ATXA 4U0KA 2GN9A 1N1DA 2FFHA 3NUGA 3OTWA 2ZYUX 1YZLA 2NW6A 1JWBB 1SURA 3VR4A 1MVOA 2PVSA 4D7MA 4KJXA 2YASA 1P6RA 4JJ7A 1BA2A 2CV1A 1M2VB 3BTSA 4DA9A 1L7OA 3TL4X 2RHHA 1AY0A 2QY9A 3TOZA 4F6CA 1IAWA 3FR7A 3OY7A 1NYQA 4F55A 5ANRB 5MF6A 1JG7A 4WCFA 2ZB2A 2ZXEA 1BAPA 1T6NA 3ISTA 3ZBTA 4MDEA 3G8DA 4RD6A 3HFSA 1E7MA 1MD0A 1IJEA 3BQYA 5HDNA 3HG9A 2G5PA 2WJ6A 3W6UA 2NIPA 2WU8A 5LQKA 1HW5A 3ZXSA 2K9SA 4G07A 1Z77A 3W9UA 1I7QB 3K2IA 2RGRA 1BVYF 3ZS8A 3ABTA 4W5OA 4A3FJ 4CI0B 2N47A 3Q8MA 4UE3S 5I9BA 4YFVA 2PRKA 1WF3A 2W8ZA 3C3KA 4UM7A 1PJSA 4NESA 1KYVA 2OBYA 1NXPA 1QZTA 1B8UA 2H06A 4ZTFA 3H0KA 1BEUB 4OJYA 1YE8A 4R54A 2V7PA 4X54A 1KYWA 1HRKA 4BGUA 5DUKA 1U02A 2VN2A 4GCVA 1YU9A 1ZM3A 2H51A 4RQBA 4IMRA 2PLWA 4IOLA 4HH1A 2R11A 4U2EA 1S2IA 2X9LA 4WRRA 3V34A 3BG7A 3IAFA 4V1CI 1UT6A 2PH3A 1Z7EA 4GZLA 1UUFA 2BGMA 4G24A 2BM9A 1Z88A 4N5LA 4HXEB 2Q0QA 5EHGA 5J9FA 3TLAA 3UPUA 1FJGB 3BCAA 3LC7O 5D6NA 5LDGA 3W79A 1Z5ZA 3A1DA 3A6FA 1E6UA 3BORA 3IV6A 4ZEMA 4I4LA 4FVTA 1DKQA 4IDGA 4U7PB 4U7FA 2XI4A 1TK3A 2ID6A 3NHPA 3L0ZA 3QW2A 2GK4A 3OYKA 2D7CA 3JZFA 2VPYA 3MWGA 4AF7A 3S2FA 4E7KA 1PX2A 3EDQA 1IZ1A 4KISA 3JTMA 3HRTA 4OA5A 1WU8A 2FHPA 5TQ0A 4IMJB 1YE9A 1WAMA 2P9QA 2ZYAA 3HP4A 3OYJA 1EXWA 1VF9A 1JSXA 2CUJA 4QUGA 5DULA 4B76A 1ECBA 3E5NA 4RHEA 1NK2P 1CR6A 5E6RB 1XS9A 4U63A 3IOYA 4AIHA 4CR7A 1ZONA 4AJPA 3G2BA 3RU3A 5AD1A 3G2KA 3HP7A 2RD2A 5BWOA 4ZT4A 3N7UA 2OESA 3DL2A 2GD2A 4IS3A 5M34A 4OQXA 3A02A 1FQWA 2QRVA 3OLWA 2C61A 1RE1A 2YV1A 1V7QA 2PH1A 3MCZA 2C78A 4FDTA 4ZDOA 3TLZA 2B30A 4B83A 1E1DA 1QK4A 4CM9A 1D04A 5BN1A 1Y1KE 4G0PA 5CT4A 1M5RA 1GV5A 3R3SA 4X66B 1ZLJA 2C9OA 5B6PA 2C7QA 4YCNA 1W34A 5M04A 2I4TA 1QS0B 3GLFA 5L3FA 3L6DA 1BMDA 4DA8A 3RRFA 2DQRA 3UK7A 1XKXA 3PD7A 5KYUB 2JKZA 2X6TA 4YWHA 4B6PA 2RK4A 1U1CA 1EP3B 1KQPA 1IXKA 3S5UA 3BJRA 3USES 1OYVA 3B6EA 9LDTA 1YI8A 3P9SA 5INTA 2XGGA 2H2HA 4ERNA 1SBZA 2WI8A 4MWTA 1SG6A 5FWXB 3L6BA 3P7NA 1FS4A 1L1FA 4RADA 5IN5A 3RHSA 2WHPB 1REQB 3WYAA 4FW9A 2B4YA 1SJ9A 1HDPA 2DQZA 1E2DA 1M10A 3ISJA 2XVXA 1ZC4A 5JVDB 6YASA 1OXXK 4NSNA 5A5GA 2HW8A 2BHTA 1ITZA 1JDNA 1WW2A 1ZI8A 4OATA 3RC3A 4IJUA 4RTQA 2C54A 3E5RA 2O4UX 3QJGA 2YU3A 4KO8A 5EMKA 3ROQA 1SZDA 1U0FA 3OEYA 2J5RA 3NHBA 1HG1A 2RGNA 1XLTA 2RI1A 2O8VA 2FP4B 4I0AA 1T24A 1V1MA 2GJSA 2Y1FA 3A70A 3OM9A 4HZIA 3TRHA 2E71A 3BZBA 3ZTWA 4C07A 2I7VA 1Y7HA 3IALA 1CNFA 4FYHA 4M38A 3VNBA 5BVHB 1AN0A 1KAOA 2CJFA 3ELUA 3HUEA 3I4LA 1M2FA 4HBZA 2EQRA 1U6KA 3GJRA 2BOLA 4G3XA 2C3MA 2EZLA 3UKJA 3I37X 1GPAA 3QLUC 2M0MA 3OYBA 1D1AA 1VC2A 3TJRA 3U16A 2NO6A 1V3TA 4ZPXA 3DJFA 2GT1A 1JH8A 5CYGA 1N25A 3H18A 4TMXA 3ZY6A 5FLVA 4Q3CA 5E7MA 1M2KA 5A3SA 3VFZA 2NVBA 3SSAA 1NMYA 1WCWA 4K6CA 1MA3A 4BJTA 3DDCA 1X1PA 1U0LA 3LUBA 1N0WA 1CZHA 3RGWS 1KQ9A 2Z99A 2OFWA 5AW9A 2QUHA 2HGCA 2HJRA 1A50B 3MCUA 4I4NA 2FX2A 2PSSA 3DLIA 4YIIA 2ZATA 4BFXA 5FFXA 4TTIA 4ZDKA 4HQFA 3TCXB 5FXMA 2K5CA 4QAJA 4XI9A 1EXVA 5D5HA 3CNNA 1IHOA 3L3BA 4RXUA 5E9AA 4KB5A 4BASA 1F1ZA 3QMWA 3K9HA 2JFUA 3OA0A 1D0XA 2P78A 1QWOA 2YJ5A 3N53A 4DBQA 1FBTA 1I1NA 2ISCA 4J2TA 3TCNA 1F8XA 3BQNB 5DNVA 2HR1A 4LF9B 3RAGA 3G3EA 3QE9Y 2GO1A 1EE2A 1M67A 1SRQA 2Z58A 3JWPA 2I6TA 4R83A 2JAUA 3K9CA 3CVXA 1D8KA 3T5DA 5KYGA 2CDCA 1OXKB 2Y0SA 3OIOA 1IHDA 2CF5A 3M89A 3SX4A 3WJ7A 1YA6A 4U3JA 1O89A 1N4DA 1O9HA 2PWBA 2SICE 3C5VA 4D0NA 2MH2A 2ZUBA 4IIXA 4RVCA 1AKMA 3RKWA 5BSGA 3QU6A 3OSFA 1T2AA 4QG7A 5IYZB 3LSKA 5DV5A 2XADA 4NICA 4M7OA 4L5CA 4CT5A 4TYPA 1NWHA 3LKZA 1QP4A 1DDNA 3OZEA 2C2ZA 1C9NA 1G41A 4IHJF 4BCBA 2K6GA 2JCGA 3AP3A 3GT0A 4ALLA 4UEQA 5JS2A 1KORA 1K7YA 4AMBA 1JUSA 3JQFA 4X85A 4B35A 4AJ9A 2EKDA 4EA8A 3MJ4A 4GVPA 3FLAA 1L7AA 3HJRA 2QRJA 3CISA 1HSZA 5ITZA 4GP7A 5AI9A 4F72A 3CJNA 1TKCA 4OK3A 1GUBA 2GLXA 3OD5A 4WK4B 1W1WE 3ZYCA 1H6AA 5HS9A 3Q7IA 2FPRA 2NWQA 4MV0A 5KHLB 3QYFA 4DCCA 1NVDA 3BE8A 2BEUA 3RSQA 3GEZA 5G1NA 1R71A 1Z7BA 5LC1A 4CQLB 4HVCA 2REQA 4KODA 1HPLA 5TE9A 3C4JA 3CNQS 3I32A 3WBKA 5BOVA 4C0JA 2IA1A 3ZWNA 1XZFA 2H63A 3E5UA 3AWIA 1VJ5A 1AOXA 3GH1A 3ZU2A 1JMYA 1Z26A 1GNTA 3ZMDA 3A2KA 2VBXA 1KKMA 1ZNZA 3DWFA 3NH9A 3QU4A 4BNTA 4B4CA 2XAQA 1FU8A 1KVUA 4M0DA 2P79A 2XUZA 3CW9A 1M76A 3GXBA 1Y3DE 2ZU0C 3NH6A 3OOHA 4FR5A 5T3UA 3K09C 2I7CA 3T35A 4JX8A 1GKYA 5LZ4A 5BOXA 4M71A 1EE1A 3O4FA 2CNWD 2VP9A 1Y1LA 2R4QA 3QVGB 5BSUA 3W5CA 1PV4A 2HSDA 1C7EA 2VHJA 2YR0A 3IBFA 3V42A 3L1VA 3N76A 1GR1A 3QEMA 5HE8A 1J2EA 1L5WA 1MMNA 1BXZA 4BX2A 4MQ4A 1Z4OA 4RB0A 3CLTC 4ZC1A 3L6RA 4FX5A 4E08A 1DAEA 3CUQB 5ECGC 3RWBA 1R8XA 2EYQA 1LTHR 1UJ4A 3EXAA 3VNAA 4C78A 4AKIA 4JP5A 1CUHA 3WKDA 4F6LA 1GRCA 2BTOA 2PS1A 2HRRA 2ELHA 2CVOA 2VZ0A 4CV1A 5IBCA 5DOVA 5JD3A 3OZAA 4NAVA 4RETA 3DQPA 3AI3A 1NDQA 1CF7A 2C4TA 2FMHA 3ROFA 4YQYA 1H2ZA 3N2ZB 4IWXA 1QKJA 3STUA 1IN4A 5FP0A 2AX3A 4CUJA 1Z5GA 3CVVA 4P86A 1F8UA 3BH6A 2AE2A 4X63A 1RI3A 5IDYA 2M30A 1JFFB 1NKVA 2BFNA 1P72A 3D4BA 1ZKGA 1AQ6A 1UEXC 1OISA 1DBQA 1CY4A 3L1KA 1NFRA 2CL5A 4S3MA 4CLRA 2BFBB 1ORRA 4DZTA 5K3DA 3HEFA 1TYEB 2ZRHA 2F5VA 3QX9A 2VA8A 2VVTA 2ZBPA 3TMAA 4F5ZA 4N49A 1EXMA 2XT0A 2PIDA 2IY8A 5FQNA 5HZMA 3L9WA 3K1JA 1D1QA 4PU0A 5FYQA 2Y76A 1CQXA 4JQSA 3MTIA 3F7NA 4IL5A 1ZDMA 4FEYA 3WYGA 2JGIA 4WXDA 3JQFC 4KR6A 4JQZA 1U3VA 2WP8J 1LSSA 3TAUA 1F8GA 1MJGM 4RPKA 3KEGA 4WVFA 1CQIA 3MUNA 4MR7B 4QLAA 1PQUA 1I2AA 4UHEA 2CWWA 2ESHA 2P0WA 1U99A 2QSHX 4YT5A 5C81A 4BJ6C 1KJ9A 3OLQA 1XRJA 3ZE8A 3KZYA 4A8JC 3I3OA 3M5PA 1QKKA 3SKYA 4LOCA 1I0LA 2DFDA 2FWAA 2HSJA 4G0VA 4B3XA 1BJTA 2AUTA 1DTWA 3FOAA 4UE2A 5AW2A 1DRVA 2V1NA 1NOIA 1Z34A 4BC1A 4W6ZA 1ZZEA 4UTVA 3KSAC 3KB8A 5AXAA 2I65A 2FZEA 2ZWMA 2IU0A 4J0DA 2JKYA 2PUWA 1GZ7A 3E5MA 4UFOA 1Y6GA 4HH4A 2P0EA 2Z33A 1SPXA 1UK8A 2CYAA 2J87A 3EEQA 4MLDA 5K1YA 1DKOA 1E5DA 4X7BA 2O0LA 3D2CA 2PZFA 4GD3Q 1YW9A 1KF0A 2P68A 4YDSA 4DMUB 1URPA 1NJ2A 3UOGA 1SVUA 1M33A 4G5RA 3TTUA 4C9BA 3OD1A 3C43A 2JBHA 3FXUA 3G2LA 4LJRA 3K3PA 2JJ8A 1RBMA 3HU1A 1E2MA 1GTG1 1O03A 1U5BB 4KUHA 5FOTA 4Y3OA 1Y1SA 2FW0A 3QTLA 1NRWA 2P30A 5DMXA 2QWXA 4XTRA 1EVZA 1YR7A 5FR1A 3PO2J 4HDKA 3UJCA 3QHPA 4DLPA 4DAEA 2ZWPA 3GTKJ 2X8BA 4IIUA 4NYJQ 4OHUA 1JTEA 2E2JJ 2H9AA 3WGIA 3FYUC 5LBQA 3GZJA 1JE8A 1YZGA 2IEIA 2JFQA 1Y82A 3PFBA 1ATZA 3M1EA 1PL7A 2HA2A 2YNMD 3PUKA 1VCMA 4G1MB 4GAEA 3QIVA 1EX6A 1OXMA 2VRWA 4FLMA 1ISGA 3FPLA 4M72A 1MGOA 1EZ1A 1RM3A 2DFFA 3BWYA 1K7CA 4REQB 2EKZA 3EVGA 1TMYA 3G7UA 4JCOA 3TIIA 3GX4X 1U8YA 4IXDA 1JG6A 3WL5A 4CUZA 3K4PA 3K94A 3SICE 2OXFA 2BF4A 1G7RA 2FUG2 3U7EB 4DLBA 1YCDA 1CULC 2IH4A 2IUFA 3L6CA 3VJMA 4OFXA 2YWBA 2WM8A 1F20A 5JBNA 3CUSA 1VQLI 5E9WA 1X7ZB 4E2YA 5B5SA 2O2ZA 3OYIA 4XUEA 3WAJA 3AF6A 4GYGA 4LDJA 5E8IA 2QRUA 2ZIXA 3VR6H 3UM9A 3GA0A 3ZQUA 2XNSA 1H1LA 3E9DA 4ANFA 4BV9A 2XKKA 3PX3A 3JALB 3QUTA 1WSBA 1DJOA 2Q2NA 3QJYA 3EMVA 1CEYA 5FJIA 1J21A 4HF1A 4NMWA 4C06A 3T1HB 4IQ0A 5GGXA 2XC7A 3BGIA 3HCPA 4GEKA 4OH1A 4A26A 4IHXA 1DG3A 3KSDO 4G97A 3X1XA 4FDAA 1I30A 1OLXB 2A1TR 2QN6A 1SQ0A 4MZDA 3VH4A 2CHVA 4ZU1X 4M8SA 1EFLA 5FNVB 2GEBA 4Z1MD 5EJ9A 1DO0A 1Q7RA 3EIOA 1TIBA 1KQ3A 3A25A 3DYVA 4WNAA 3ESWB 3S8YA 3ZDDA 1ZH8A 4YEJA 3ZDCA 1KP3A 3DTNA 3HV2A 5K5QA 2ZJ8A 1F0KA 3BSYA 2HMAA 2QQFA 3GXOA 5J6XA 2GXBA 2RK3A 3DONA 3NWJA 1QHSA 3H2KA 3EHDA 5FCDA 1ZD8A 4BN5A 5LOVB 3T3HA 3DFUA 3WTBA 3WGUA 6PFKA 1KS2A 4GH5A 4DE5A 4DLSA 1ABBA 5KEIA 3ZHUA 2K86A 1LPOA 2QZ8A 1SEUA 2CMPA 1CU1A 3MS2A 5CGZA 4YMIA 3ITDA 1KO5A 2GXUA 2P91A 4BQFA 1DC7A 2V4JC 2NVTJ 3WIDA 2Q3CA 4XDZA 4R8VA 2J48A 1G8KA 3MKZA 3AG3H 2ADUA 1HOXA 1V41E 5FBZA 1HQYE 3UXYA 2YPRA 3VJKA 2X1DA 4BBRJ 1NE7A 1P2VA 3CO7C 2A57A 2VYNA 3AGPA 3DT8A 1I6XA 1N8SA 2KRCA 3QPTA 1UBUS 1RHUA 2JASA 1YQ9A 3BUSA 3D5TA 3KD2A 2XROA 4MVXA 3COVA 4NBRA 4S35A 3FGPA 5HM6A 3CX8A 4OXQA 1NQVA 2E5LB 1KFBB 4S1NA 3FCEA 1KSFX 2ONYA 1L9KA 3QGMA 3WB0A 4CMIB 2HADA 4P4TA 3X3HA 3HXOA 4LJ4A 3V8RA 1N2BA 3P2KA 1R1VA 3RQIA 4XUGB 4D8UA 2R86A 3ILSA 2ZSAA 2KW5A 3FLBA 4UHFA 4YTEA 4F52A 3VR0A 4BB6A 3CMMA 4BEJA 2TSYB 3VR4H 3CEAA 3VISA 1KU7A 4KXYA 2G1UA 3BL5A 5FUQA 2OF7A 2VOEA 2RGAA 2ZYSA 1G2OA 2I0FA 4G37A 2VP0A 4PVCA 3THOA 2XVMA 1E8DA 2FQXA 4JB3A 3PRKE 5HCNA 3G4SI 1J2YA 1GPDG 1CZLA 4EM2A 1XTBA 2P2CA 1EZZA 2A6HF 1B16A 1H8EA 1N6NA 1Z3IX 2RGNC 3PA6A 1ZQ3P 3GJ0A 4JIMA 3MJCA 4ZARA 1VSBA 3FCOA 5JNVA 1J49A 5EZYB 4JGGA 2JFHA 5H02A 3N97A 4QYXA 3LXMA 3ED5A 4ZVQA 3LFUA 1X3LA 4KOEC 1JHXA 4PSDA 4CDNA 3D4OA 1Z6TA 2W4SA 2A6EF 5AK0A 3J81K 3WU0A 1LX7A 1NQXA 2Q0SA 4E7LA 1OWMA 4M3BA 3WQBA 1H89C 2PMKA 3RJTA 4NDNE 2WAYA 1GYRA 3PJEA 4JJ6A 2ZM5A 3H11B 1MC1A 2Q1YA 3A0UA 3GFRA 3NGMA 4M1ZA 3WTZA 4M0FA 3LFHA 1YUMA 5DBIA 5JQGB 1RIIA 4JKYA 3G1MA 1SELA 3B13B 3F1LA 1US8A 1W35A 3IAUA 1TQPA 3IIJA 3W1WA 4CHGA 3F7TA 1HEYA 1JJBA 2AXLA 5LHIA 3BHJA 3PG5A 4UDOA 1YRYE 3AI7A 2DT7B 1B15A 4RMIA 2ZZKA 4FK8A 4J1SA 1XLTC 2NT4A 4L4YA 4B5KA 4PX9A 3RF6A 4CMGA 2IXEA 1QV6A 2IY7A 4RLFA 2BP7A 3HA2A 3OJWA 3VX3A 1J9EA 5ADWA 2D7DA 1UMBB 4LHWA 2R5YB 4ZGBA 2QROA 4P9FA 1R8JA 3DG9A 4CT0A 4IX1A 3CEHA 3EODA 4DDWA 4TPKA 2ZBUA 3GUZA 5EI5A 3D4IA 2JA7J 4FFWA 4B74A 4ZAWA 3AUXA 1P8JA 2EG9A 2HMWA 5M3BA 1GYPA 1V39A 3COSA 1YQXA 4QRIA 4RGYA 1C30A 1ZARA 1G21E 2OVBA 5CFQA 1NLYA 4AMZA 5JW6A 3PGLA 2ASEA 4MI1A 1VBNA 3BREA 2BEKA 2X58A 4EG0A 4NU0A 2GXAA 1CGPA 1B0AA 1YDMA 1RAHA 4OP1A 2CFCA 4EW1A 1U2GA 3FWPA 3A1FA 4TMKA 1PGQA 2DA4A 3BBPA 4W9NA 5FA5A 1TMGE 4ZVVA 1B6GA 2NZVG 4KI7A 5BUQA 2HKOA 1KJYA 3AG2H 2DA3A 2JGLA 2B8TA 1QVRA 1U2EA 4XPZA 1UDRA 2HOAA 2XDWA 2E2IJ 4MMYB 5EDNA 2F3PA 1DBSA 4GSLA 3S15J 4OQZA 4PN7A 4A10A 3KOOA 2DR2A 1ZGHA 4EB6B 1QUFA 3PDWA 4B8XA 1ORTA 2GCIA 2GZMA 3A27A 2JRLA 1F38A 1CVRA 3O1IC 1XRSB 4TN1A 1VPWA 3NLLA 1PHPA 3CQZJ 1BDIA 4KHPB 1FY7A 3KPHA 4Z5XA 1HT0A 2YC4C 1Z16A 2Z8YA 2R44A 3EYWA 2XAHA 1IAQA 3PDIA 4M7PA 4PZ0A 4RENA 4B3MB 1UC5B 5IM5A 2ZRDA 3JSOA 4HD8A 4NJEA 1JU4A 5JLAA 1EG2A 3DT9A 1EBFA 3KVOA 1BWRA 1T08B 4LTMA 5DN6A 5I9TA 5LL6P 3EPLA 1NVXQ 5KSYA 1XALA 3O2JA 1LVAA 1RP1A 5F0CA 1LLCA 3DQVC 1O5TA 2IZ7A 3E3VA 2PAAA 3H42B 4WNYA 5AJYA 4BB5A 5JDCA 4G8BA 3DEZA 2VDQB 3H65A 4JI0B 3MTQA 5T8KA 5E7QA 2IDZA 2FNAA 1VTNC 2YX7A 5F08A 1Y81A 3KSUA 2X42A 4MJLA 2OHGA 4QHSA 5TNXA 4DIBA 1Y4AE 4MYUA 2Z9CA 4WJKB 4IHYA 1W1UA 1AUPA 2FJ1A 2WF6A 3KR9A 1AWCA 3D5EA 3NVMB 4INAA 1Y3IA 2AN3A 3HSSA 1SEVA 4ITRC 4JEUA 4V0LA 5CMLA 1HLVA 4KQJA 2I3ZA 5EJAA 5CVEA 4EHDA 4XIDA 1FY2A 2BVMA 5KAFC 3QOWA 4LVCA 7GPBA 4NOMA 2JPDA 1Y3BE 1TYAE 1WR8A 1J5EB 1PZMA 4MUBA 3ONDA 4JVLA 1X15A 4YRRA 4Y9RA 3SZGA 1JS1X 2FZLA 2IPMA 5EMJA 2GAAA 1ZOPA 4MUIA 3ZMVA 1U8UA 3OTHA 5TX7A 2IYQA 4ZI3A 4P0QB 1M75A 2R4GA 5FKJA 1BQEA 4AQDA 4OH7A 4U87A 4UVDA 2FRXA 3A7DA 1V25A 4NP6A 4R16A 3FF5A 1SG0A 4ZQFA 1XRNA 1UMBA 1P45A 3HRIA 3KLBA 1FMTA 3KHUA 5DCMA 4Y52J 2V7BA 5AKLA 4I1YA 4R1QA 5LYJF 1WNTA 3KNZA 3C6KA 3L41A 4JP2A 4BMPB 1G17A 4N5NA 1G19A 1MDMB 2W2TA 1YMVA 3OPMA 4DMGA 3AR9A 1WVMA 4DW8A 5K0NA 4EY4A 5JMOA 5KTRA 3ABMH 1TLTA 4XLCA 4F4IA 3OSUA 2Y27A 2IQ5A 1OC2A 4BLVA 3ZLTA 2DA6A 1O6BA 4OIQF 2A67A 2CHGA 2IOFA 4M76B 2KBEA 3L0SA 4TTTS 1AKHB 1P7VA 3OT5A 3JQGA 1QRDA 2LMDA 1FXUA 3QQPA 3I5AA 4FIZA 5KVRA 3EDYA 3CCSI 2LSOA 2IXSA 4HQMA 5EVCA 5KSWB 3DWLE 1B1BA 3A28A 4RL4A 3MD9A 3TPFA 4TV9A 1UHWA 4JBNA 2ZSJA 4AJJA 4GUAA 1VBKA 1UXOA 2V4ZA 3VKUA 3VUFA 1GEGA 3IT2A 3ZVMA 4QOSA 3HU5A 4OLBA 5B37A 3IVGA 3NOOA 3DV0B 1OI7A 1ZAKA 2KL4A 3OZVA 3TEFA 2UV1A 10MHA 4PPNA 3DBHB 3LA3A 2R7NA 1A9XA 1PS0A 1U0OC