3HC7A

Crystal structure of lysin b from mycobacteriophage d29
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
252
structure length
252
Chain Sequence
b'SKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMWPSVEKGVAELILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHILPPTGRLHRFLHRLKKVIFWGNPMRQKGFAHSDEWIHPVAAPDTLGILEDRLENLEQYGFEVRDYAHDGDMYASIKEDDLHEYEVAIGRIVMKASGFIGGRDSVVAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPHLYNRYPAVEFLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 12 protein
publication title Mycobacteriophage Lysin B is a novel mycolylarabinogalactan esterase
pubmed doi rcsb
source organism Mycobacterium phage d29
molecule tags Cell adhesion
total genus 90
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01083 Cutinase Cutinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1120 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hc7A02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hc7A01
2XUPA 4ZREA 1BU8A 4KACA 2JGFA 4CFSA 2O2HA 3DL4A 5EGNA 1UOQA 1CV2A 4WFKA 3QM1A 4KE7A 5JD4A 1VE6A 1WB5A 3NUZA 4YK7A 2OCLA 4MEAA 1EA5A 2JGJA 2WFLA 5HF8A 3KWJA 2X5XA 3C8DA 4PQEA 4G4JA 1IUPA 3K6KA 1JJIA 4G5XA 2I3DA 3QYJA 4PSCA 4MYSA 4UHEA 2RHTA 3V1MA 4FHZA 4FNGA 1MN6A 4X95A 4LYEA 1JFRA 2WFLB 2XLBA 1EK1A 1R3DA 4P9NA 2Z3ZA 1QJ4A 4GDMA 4CG1A 3ICWA 3ZLUA 3SX4A 3G9UA 3C6ZA 2HDWA 1QTRA 5ALXA 2HA0A 3QVMA 3WJ1A 1QO9A 5EFZA 1J2EA 3WKEA 4W63A 3WZLA 3DDUA 1SCQA 1J07A 1WOMA 3R40A 4K6KA 4BVKA 4BDTA 2DQZA 2DHEA 1Z68A 3GUUA 3CN7A 5C7YA 2WIGA 4Q34A 1RWQA 1CVLA 4J0GA 5LYYA 5CXUA 1XZGA 4DMHA 5JAOA 4GW3A 3W9BA 2CUTA 4AN1A 3BJRA 4NMWA 1JJFA 3D0KA 3I1YA 1QIDA 5AI6A 3ESCA 2AJDA 3W05A 3BXPA 4WY8A 3D59A 4TVKA 5K3EA 2WG0A 1KU0A 2BFNA 3STWA 1E8DA 2LIPA 5ALYA 4WDRA 4AMZA 3C5WP 4C89A 5I8PA 4MEBA 4KYVA 2PSDA 5AOBA 3D2AA 4PNZA 1N5RA 2DCMA 4CIAA 5D7BA 3IUMA 2QUBA 1GKKA 5EIAA 3V1LA 5C8XA 5DTJA 3PFCA 1CUZA 1XZJA 2PVSA 3T52A 3KDAA 4EA6A 1THTA 3DYIA 4M0EA 1BN7A 4J0KA 4Y7DA 5AM4A 1G42A 1MPXA 1JJBA 1FJ2A 5CMLA 3UUEA 4HZGA 2OAEA 1ZI6A 2GZSA 1XLVA 2O7RA 3IBTA 2GZRA 1H2WA 1B41A 5ALUA 2XMRA 5LP1A 5DTIA 2OLEA 5E2IA 2I03A 2XQKA 5HFAA 3F9CA 3C6YA 4J0HA 4NVRA 5HK9A 1EX9A 3I2KA 4FBMA 3ED1A 4BAZA 4J0JA 3M83A 1TRHA 2YASA 3Q8WA 1LGYA 1EDEA 1XROA 2AJBA 2XUQA 4Q3KA 1QE3A 3EBLA 5ALRA 3WK5A 4XX1A 3AZQA 2XQGA 3BF8A 2V97A 1DTEA 3QMVA 4IQ4A 2PPLA 4OU4A 3WA6A 4BAGA 1EVEA 1NU8A 1UK7A 4E11A 4PF1A 3IVMA 2ZSIA 1CUWA 1ZD2P 5ALWA 1YB6A 4AXBA 2ZJ7A 5HF5A 1W6RA 1QIEA 4G1FA 4FTWA 1VXOA 3WK6A 1VLQA 1XQXA 4EY6A 3DS8A 4OB8A 2GYWA 1CUUA 3WWCA 1GGVA 4XJVA 1CUVA 4X91A 3WMRA 4INZA 4WDQA 3RLIA 5E4JA 1R88A 1CQZA 4P93A 4BYMA 4BZZA 1NX9A 3FCXA 5AI5A 1CUAA 4S0XA 2HFKA 5AOCA 3IUQA 3I6ZA 4Y2SA 3S2ZA 1VZ3A 2HA2A 1TKRA 2J4CA 3DLTA 4FLFA 3RKSA 4XVCA 2Z3WA 3HI4A 2QXUA 3O4GA 1E66A 1CRLA 2WUGA 3AJAA 5LZ5A 2I3ZA 4B9EA 3H2GA 4H77A 4Z49A 1VJ5A 1MJ5A 4U2EA 3HABA 2ZYSA 5DYTA 5BWCA 2HU8A 4KJXA 4K6HA 4QWWA 1CUJA 2BUAA 4W1PA 1XRRA 3A6ZA 4UFPA 1HDEA 2JEZA 5ALMA 4RE5A 3FSGA 5AKZA 5I9IA 1WCYA 1ZI9A 3HJUA 2JBWA 3I2FA 4X90A 4Y2JA 2WUFA 3BWXA 1XRLA 2WFZA 1QIHA 3WLAA 4IH9A 1CUXA 2C0QA 2QT9A 2WHPB 1GZ7A 5A7GA 4BVJA 2WJ4A 4BP8A 4N8EA 1UKBA 5AJHA 4KEAA 3WJ2A 4AX4A 2VEOA 1CQWA 1XZIA 1TCCA 4OB6A 5FDFA 4BCDA 3VXKA 2WHRA 3F67A 2QXTA 5DNWA 3I2IA 1F0PA 1UOPA 3MGAA 1VE7A 1XQVA 2O2GA 4KR0A 5ALGA 5EI5A 3AIKA 1OILA 1LLFA 4EY7A 3GELA 1QIGA 4ARAA 2WQZA 2YH2A 3FYTA 2DSNA 5ALNA 4MYDA 1DWQA 5JALA 3IDAA 2XMZA 3O95A 5SYNA 1VA4A 3WYDA 5AKEA 4ZI5A 3OTQA 2XMBA 2QRUA 3C6XA 3PI6A 3FLEA 2ZSHA 2J4FA 1XKLA 2DQYA 3HSSA 5FV4A 1MAAA 2VJCA 2XUFA 2EDAA 3NOXA 5T4BA 4EUSA 2XI4A 5AKHA 5KREA 1W4LA 1EINA 5CURA 5T4HA 4FWBA 4G4GA 1JU3A 3N2ZB 4N8DA 1MT3A 2W6CX 3ANSA 2XUAA 4RNCA 2WFMA 1IZ7A 2ECFA 3G0CA 5FKJA 2I78A 2ONCA 1WHSA 1XZDA 5HZGA 4C4YA 3G9XA 4I4CA 5ALJA 4J03A 2UZ0A 5E4TA 2ZYRA 1JT2A 3RARA 5CW2A 4BDSA 1TIBA 1YASA 5AKLA 1L7QA 3OC0A 3C5VA 5LLSA 3KWFA 4WCVA 1HBJA 2XE4A 2FX5A 3F96A 4O08A 4AO8A 2WIJA 4AZ3A 3EQ7A 3CXUA 2G4LA 3TRDA 4BTVA 1LBTA 1R9MA 2XMGA 2B61A 1ISPA 4UPDA 3I2HA 3F97A 1P0IA 5CH8A 3WKDA 3VKFA 1UK6A 1I6WA 1PV1A 4BRSA 1ACLA 2OGSA 1CUCA 3OPMA 1TAHA 5AHXA 2VAXA 1F6WA 1U2EA 3E4DA 1QFSA 3D4LA 4I19A 4UFNA 1QONA 1ZD5A 4HXEB 5SYMA 1WB6A 3DYVA 2VT7A 3QMMA 2CZQA 4J0CA 2G5TA 1W52X 4H35A 5DLPA 4H0CA 2XUOA 4DNQA 2ES4A 2XT0A 4UUQA 2BJHA 2CJPA 3FYUA 1K4YA 4DGQA 4QEKA 1AQLA 4IH1A 1AMNA 2C58A 3ZLTA 1VA5A 2Y2UA 4E15A 3H2JA 1K63A 3FYUC 4JEIA 1X2BA 3WK9A 6YASA 3ILSA 4H7JA 2JGIA 3FOBA 5C81A 4EB0A 1O6FA 1U8EA 4OUKX 1SCIA 3ANTA 4C01A 4HVTA 1QIIA 5AI4A 4K2AA 3IURA 3STVA 4YASA 3RM3A 1DX4A 2WIDA 4KAJA 2XMQA 2J3QA 1YA8A 3CCCA 1DQYA 2VQ6A 1P0MA 3EIOA 1QZ3A 4H7FA 3QPAA 4DLNA 4B6GA 2W22A 3WI7A 4MQLA 2OCIA 1YS1X 4AZ0A 1GXSA 3OOSA 3VVMA 1WHTA 2WTNA 3QPDA 4Q05A 1QIFA 1N1MA 3R3VA 3A2LA 1XRNA 2BKLA 3I1IA 4ZGBA 3B3QA 2BGNA 2PL5A 4MWTA 4BCBA 2ZVDA 5AM2A 2AXEA 5HK8A 3FLAA 4JUIA 4UHFA 2XDWA 5DYWA 5CTAA 3QH4A 4Y2PA 1UT6A 4E46A 4B82A 2XMCA 4Y2RA 4BAUA 4DNOA 4Y2TA 2ZJ6A 4ARBA 1R1DA 2QS9A 1CFJA 2XQFA 3DJYA 4ROTA 3WIOA 4BVLA 4C87A 1H23A 2PKYX 2XUJA 3WA7A 1UZAA 1MX1A 2CMFA 2HM7A 4UBNA 3W2TA 4HRYA 3C8HA 4GBGA 5JARA 2Z5GA 1QOZA 5K3AA 4B9AA 2VJDA 4GI1A 1C7IA 1KU6A 2G5PA 1ZGBA 2DR0A 3WKAA 4ZXFA 3G0DA 4UHBA 5FOQA 1G66A 4X93A 4OSEA 2BCEA 4DYHA 2WUEA 3NGMA 4G9GA 3C87A 4LIPD 4NS4A 4QE3A 3VJKA 1Y7HA 3B12A 5JAUA 2WU4A 1W1IA 3WK4A 3VDXA 4QDTA 3R3UA 1HLGA 1LPSA 5ALZA 1XRPA 1CUSA 4KRYA 5LKAA 3R3ZA 2VATA 1JKMA 3STUA 2PBLA 2D0DA 4UHCA 2C7BA 2HL6A 3O9MA 4X92A 3TEJA 3FWHA 1XFDA 4M0FA 1SOMA 5A7HA 4FDMA 1WPRA 5AKIA 4PSUA 3DEAA 4CCYA 4EHBA 3ZLVA 3EF3A 1EB8A 1DT5A 3V48A 4FLEA 3KOOA 2XUDA 1BRTA 3ESDA 5LZ7A 1Q83A 5AKKA 2WTMA 4B0OA 3FLBA 1UFOA 2XUKA 3G0BA 4J7AA 3STTA 4G4IA 3B5EA 3CN9A 2QTBA 4MJ3A 4FLMA 4FMPA 2CBGA 4CCYB 4UBIA 4P08A 5LZ2A 2PU7A 1CR6A 4FNMA 1LNSA 1FFBA 5JAPA 3GZJA 3O4HA 1EI9A 4OD0A 4G8DA 4QDXA 2H7CA 1FFAA 2IITA 4GXNA 3ESAA 4H7DA 4J3JA 4B85A 5FRDA 3OURA 1E8MA 2OG1A 2VJBA 2B20A 1XZHA 4Y2XA 1C4XA 3GA7A 4IHAA 4IO0A 5ALDA 3FSGD 3IIIA 1D07A 1JMKC 3E0XA 1BROA 4FFVA 1RP1A 4C88A 2WG2A 1DQZA 3FVTA 3C43A 3I28A 2CB9A 4QLOA 2VSQA 5EHQA 2GYVA 4H7IA 1CUHA 3DNMA 2BUBA 4J0DA 2Y1KA 1A7UA 3D2BA 2B9VA 3H0CA 1EB9A 3IA2A 3E3AA 4H7EA 3BIXA 4H18A 4A5SA 4FOLA 3QZUA 3G8YA 1K8QA 1W75A 2WIFA 2JEYA 2JGLA 1CLEA 3PUIA 4J0IA 3I6MA 4QNNA 3DL7A 1E3QA 4H7HA 3HRHA 1XQYA 3WWPA 2XMSA 5ALFA 5A62A 1LPBB 3TGLA 4AMYA 5CT9A 1AX9A 2HA7A 2OQIA 5JD5A 4PO3X 4TPKA 5AKJA 4BZWA 3SC2A 5JIBA 5AI9A 1QTIA 1XQWA 1Y37A 1AZWA 3G9ZA 4G8BA 1OXMA 2VAVA 2VA9A 3DOHA 3GBSA 3BF7A 4GLBA 4DSAA 4HS9A 4LYDA 3L1IA 2EDCA 5KBYA 2WG1A 1EH5A 5AM1A 2OCKA 1AURA 1CUIA 5DNUA 3FNBA 1ZIXA 5ALEA 3WL6A 3ESBA 1CUYA 3IULA 1EVQA 3O4JA 5ALKA 2FUKA 1GQSA 5JD6A 3P2MA 4X6YA 1UK9A 2WHQA 4FKBA 5D6OA 1N5MA 2QMQA 2HA3A 3BE8A 4WJLA 1HKHA 1XRMA 5DWDA 5BOVA 3ZPXA 1QFMA 1TCBA 4E14A 1MX5A 1S8OA 3FVRA 3I2GA 3IUJA 4YX9A 3O4IA 1A8SA 2PSEA 3I6YA 3VJLA 1XZAA 1GT6A 2JGKA 3AILA 1VZ2A 1ZI8A 1G4HA 2WKWA 1LPAB 4Y9SA 3C45A 3WZMA 4BC0A 4G8CA 4X6UA 3QMWA 5DJ5A 1IUNA 1BS9A 1TQHA 2JGEA 4RPCA 2GYUA 4W1SA 3ICVA 4AN0A 5T4EA 3WK8A 1Q0ZA 4EZIA 3ZV7A 4V2IA 2YYSA 3DKKA 5HCUA 4C4XA 4F21A 4UFOA 4BBZA 1UKCA 2CKMA 1JMYA 2XUHA 1LPMA 2XB6A 3M81A 3WKBA 1SCKA 3VJMA 4L3WA 2C5FA 2WIKA 2ZYHA 1MNQA 1UXOA 1XZEA 1Y7IA 4DNPA 1BEZA 4QDOA 4RGYA 1TK3A 1HQDA 5CH5A 4UBJA 3BL8A 1QIJA 3IB3A 4FBLA 1AKNA 3T4UA 4C4ZA 4JYMA 1ODTC 4B81A 1QLWA 3WIBA 2BAGA 4LKOA 2HFJA 1ZD3A 5ALQA 2HA5A 3R3XA 4U2BA 2X8BA 2WLSA 4LXHA 5ALSA 3WWDA 2OQVA 5AOAA 1G5FA 2HU7A 3D5EA 1WM1A 1L7AA 3PDCA 2QUAA 1MTZA 2C0PA 1J1IA 3M82A 4XWGA 1YA4A 5AKYA 1E89A 4W1QA 1W76A 5K3FA 4CI9A 4QZVA 2K2QB 3F98A 4KAFA 2E3JA 5DYYA 2BUCA 1XLUA 1R4ZA 3WWOA 3LIIA 4KRXA 4Q82A 4WFIA 2Y6VA 2RGUA 3AUKA 3O0DA 4P92A 1BCRA 3DCNA 3LP5A 1ORWA 2OGZA 5AKGA 1USWA 3MUOA 1GPKA 3SK0A 2ORYA 3PUHA 1NU6A 2OXEA 5K3CA 1DWOA 1ZJ5A 2ACKA 3TJMA 4PV7A 2GBIA 5ALVA 3BDVA 1Q0RA 3BIWA 3G0IA 2JGMA 4W9RA 4X00A 4DM7A 4X3CA 2GBGA 3WKCA 1AGYA 3R3YA 1X70A 4QDUA 3D3NA 1AC5A 2BGRA 1FFDA 3FYUB 4EY8A 2R8BA 3OG9A 2NW6A 3WL8A 4PW0A 3WL5A 1CIJA 5AO9A 4C6HA 2WU3A 5FUMA 2PU5A 4B83A 1WPXA 1A8UA 1PFQA 2XQJA 3AZOA 2FJ0A 3QBJA 4RE6A 4MXDA 1H2ZA 2D5LA 5BWBA 1MNAA 3AIMA 5IH7A 3V9AA 3HXKA 5A2GA 2QJWA 1DU4A 3A2NA 4AO6A 3HLKA 2AJ8A 2HHAA 3R41A 2H9YA 5CBKA 4OYYA 3V1NA 4BCCA 4UBLA 2ACEA 3EQ8A 4QA9A 4A16A 5AICA 5T4FA 5CXXA 1CUBA 4M0MA 1O6GA 1IVYA 2PUHA 3C70A 1YB7A 1FFEA 4H7KA 4DSZA 3DKRA 2ZYIA 5CT8A 4WY5A 4UBMA 2OCGA 4PSDA 2G63A 1N8SA 3WK7A 1P0QA 3H2IA 3PICA 1C7JA 1XZBA 2PSFA 3AFIA 1R9NA 4QDZA 4UHDA 2HU5A 5AI0A 5DNVA 5C8VA 2WM2A 1ZICA 1YR2A 4ETWA 3GROA 1XZCA 4L9AA 5KWJA 3FCYA 2DHCA 5A71A 3M3DA 2WILA 3E1GA 4IH4A 5H3HA 4F0JA 5HKAA 1QGED 1WB4A 5CT6A 5HF6A 1E5TA 1P0PA 2DFPA 4BE4A 2XLCA 2AJLI 3H2KA 5CH3A 1IZ8A 4DMCA 1GQRA 4KAAA 3W9UA 3BDIA 4A23A 1ZD4A 5J3JA 2JIDA 5AIBA 1X2EA 5JZSA 1F8UA 1K5PA 1H2XA 1QIKA 2H1IA 1BN6A 5ALIA 2C4HA 4L0CA 5EHZA 5HQ3A 4GEGA 1EDDA 2CEKA 2P8SA 1BEEA 3H18A 3O9VA 4KE8A 5BV7A 2VTVA 3WWEA 2WSLA 5EHNA 1L7RA 1CUEA 3BJMA 1JU4A 5K3DA 4EY4A 5ALHA 4X71A 4F60A 1XKTA 3LS2A 5ISMA 1HL7A 1E8NA 5HQ3B 3U0VA 3HC7A 4X94A 1UOOA 3H17A 1GKLA 3ZI7A 1ZGCA 5IVDA 3AIOA 2O7VA 4KE9A 5JATA 2V9ZA 1A8QA 4LXIA 3H1AA 4UBKA 4X85A 3HACA 3GFFA 3A70A 1XRQA 4GECA 1MU0A 5IKXA 2VJAA 2ZJFA 4QWMA 2XQIA 2QR5A 2VF2A 3JYHA 3L1JA 2IIVA 3WYNA 2GBFA 1SC9A 3FBWA 4Q1VA 3Q0TA 3ZWQA 4N5HX 5K5EA 1QIMA 4HXFB 1R50A 5JANA 4B84A 2PM8A 4Y2UA 1XLWA 1CUFA 2RI6A 4W1RA 5FXMA 4X6XA 3G7NA 4G9EA 2HRRA 1YAHA 3LIPA 5ALLA 3FAKA 5F4ZA 2WJ6A 2Y2VA 3HZOA 2PSJA 1K6EA 3VISA 4Y2VA 5JZBA 3S8YA 1LZKA 4Q3OA 1ODSA 2R11A 3H1BA 4WFJA 3HEAA 4B0PA 3KD2A 1ORVA 4DMKA 3CCBA 4CG3A 4ITVA 5IVKA 2V96A 4N8SA 3JW8A 4ZV7A 4B80A 2GBCA 1T2NA 5AK3A 5AM0A 4DMFA 3AINA 2HA6A 5AK4A 4OYLA 5C8ZA 4I3FA 1Q84A 5AH0A 2HA4A 4OU5A 3F8SA 3VVLA 3PF9A 5AKXA 2FJPA 5LZ9A 1H22A 2XMDA 2PSHA 5ALPA 7YASA 2XUIA 1CEXA 3STXA 4QLAA 1GPLA 2AJCA 1EDBA 3L1HA 5E4YA 4U2DA 2B4KA 5AP9A 3PE6A 1U65A 3IUNA 2OAGA 2XUGA 3D7RA 4D9JA 1ZOIA 1OCEA 4BP9A 3X3HA 1KEZA 1BE0A 2WUDA 3KSRA 4NZZA 1DT3A 2OPHA 3LCRA 2QOEA 2RAUA 3SWWA 1IUOA 4UBOA 1HPLA 3LLCA 3R0VA 4OPMA 1CPYA 4EY5A 5ESRA 5AK5A 1JI3A 1XZKA 3STYA 1EHYA 1YCDA 5JYCA 4CIBA 2QJRA 2WHPA 5EIHA 5I7UA 2DHDA 4UHHA 5AIAA 5D3ZA 1CUDA 2X76A 3C6BA 4HTAA 1LPNA 2HRQA 4LHEA 3AZPA 4K5QA 5HFNA 1YAJA 3G02A 3MUNA 4Q3LA 2IX9A 2RONA 2WJ3A 4JYPA 1DINA 3H19A 3W06A 2HADA 5HKBA 4CCWA 3G9TA 1M33A 2YXPX 3N0TA 3DOIA 4HXGA 1ETHA 1ZIYA 5AM3A 1DWPA 1ACJA 1VXRA 3RK4A 5K3BA 4JH0A 2H7YA 5CT5A 5LZ4A 1F0NA 3H2HA 4MQMA 2VT6A 4N5IX 4X7BA 3V1KA 3HYSA 5EHXA 2H7XA 2O2IA 2V98A 5FPPA 1FFCA 1YSCA 3K9BA 4TGLA 4GWLA 4B7ZA 3I2JA 1PJAA 1UKAA 5FPQA 5IVHA 1MAHA 5A6VA 4LXGA 1LZLA 1DX6A 5ALOA 1IMJA 1J06A 5IVIA 4CG2A 3WL7A 4KE6A 2J3DA 2C5GA 5JASA 3NWOA 3MVEA 2QZPA 5JADA 4BATA 3WQHA 1QO7A 3H04A 4AQDA 3QPCA 5FLKA 1U4NA 3K2IA 2JF0A 2RIPA 3QITA 1H2YA 4L72A 4AB1A 1T4MA 5AI8A 5AK6A 4JNCA 1EK2A 2EEPA 5LKRA 1RYYA 4Y2QA 4YPVA 4BTLA 2Y6UA 5KWIA 1B6GA 3YASA 5FP0A 2Z8XA 1ZJ4A 4ZV9A 3EQ9A 3A2MA 4DNFA 1CUGA 1FSSA 5LIPA 2QKYA 5EIEA 3R3WA 3DD5A 5JZ9A 3W04A 4GHWA 4OCZA 4ZRDA 2PX6A 3PF8A 3OM8A 5D3KA 1SFRA 4HAIA 2QVBA 4Y2YA 5AM5A 2OGTA 1EXWA 1LPPA 1MO2A 5CRIA 2ROQA 1LPOA 1GPNA 5HF9A 1YS2X 2QM0A 1AUOA 4HRXA 3D2CA 4U2CA 2PUJA 4BB0A 5K3FB 3KXPA 4U2FA 3UMJA 4X97A 1UK8A 5YASA 4FFWA 4K6GA 1MX9A 1ODCA 3UUFA 3G0GA 4BRZA 4XIIA 5LZ8A 1XZFA 1VOTA 1VKHA 4MWSA 3JWEA 1XZMA 3DQZA 4OB7A 4ZWNA 5CT4A 4BC1A 4DTCA 5JAHA 4F5ZA 2Z8ZA 4U2GA 3U1TA 4AO7A 1LBSA 1UWCA 1A88A 4BE9A 4EBBA 1TCAA 5A7FA 1XZLA 2RHWA 1BCSA 2HIHA 4DIUA 2Q0XA 5ALTA 3PFBA 1THGA
chains in the Genus database with same CATH superfamily
3A01B 4P0QB 3Q5DA 4ZREA 1LEAA 1KVRA 1UWKA 5ICEA 2XSZD 4DBZA 5F3DA 1VQ8I 4WFKA 1RXWA 2NM0A 1HTTA 1UPUA 4QYIB 3QVSA 3RK1A 5HF8A 3C2HA 1OJ7A 2X5XA 1G3TA 3L79A 4FHEA 2CJWA 1Z7BA 4J00A 4RVHA 4EJSA 2FU4A 3WTSC 2PS0A 1QG4A 4XDYA 2OGWA 2CQKA 2ZKIA 1EK1A 1PBTA 4FNOA 3RKWA 1QRUA 3A1SA 4YMWA 1V4RA 4CM6A 2HA0A 3HXMA 1HKQA 4KFSA 5F73A 3AVPA 2PKEA 4YCSA 3AVQA 5LHGA 3A03A 3ZHUA 4AMGA 2KLHA 5AVYA 2XXBA 5GGYA 4BVKA 3N0VA 4PCQA 2K3FA 4PC7A 3LX4A 1A82A 4PTYA 2PIAA 2I6GA 4WKOA 5FKLA 3RV4A 4C0KA 2K27A 1A35A 2AFRA 4YYEA 2VR1A 3BJRA 2WD7B 3W05A 2VE8A 2QIOA 1DQNA 2IEAA 4R2IA 1V3TA 3QFSA 1A98A 1Z67A 1G8AA 3OIFA 1JEOA 1E8DA 2LIPA 1R00A 5HPYB 4RK1A 4UJ3A 3IWFA 2DCMA 2VHVA 2CUFA 5E1WA 3NEJA 1LDKB 1T91A 2CDBA 2YFKA 5JNWA 5C3UA 1E1RD 4HC4A 4DLWA 4YRNA 1THTA 3PE4A 1HW2A 5DBIA 1XG1A 3FI0A 3EXG2 1Z47A 1O4WA 2QZJA 2WSBA 2BFBB 1FJ2A 1ZZGA 4NQWA 3FHTA 2V4UA 4XIJA 4KMUX 2ADMA 3JWPA 4DV3B 1XZ8A 1JDJA 1FJXA 5FOXA 3FUUA 1SG0A 3MCUA 3T7DA 3LHFA 5F2NA 4QUIA 4DJTA 1SUWA 1N2ZA 3MVPA 2VNJA 3I39X 3ANMA 2Y8EA 3ED1A 3QKUA 1QQAA 2YOGA 2GEBA 3M33A 2VRNA 4RGXA 1YI1A 1NVUQ 3K53A 2AL7A 3RC9A 3HOSA 3GG2A 3VU9B 1QZXA 4ZD6A 2YZKA 4BNZA 4QQFA 4QTUB 2B0LA 2Q2VA 1NU8A 2R00C 4RPJA 1J0EA 1ZSVA 4H4KC 1G5RA 4AXBA 4JA2A 1POXA 1VCNA 4RKYA 1HZZC 3H2BA 4A26A 3WODF 5FTNA 3S16J 1G4DA 2DBRA 3CC4I 2BEUB 3SS7X 4F5WA 2A5DA 3P45A 4ERNA 3ZE0B 2Z16A 3WMRA 2BEVA 3RLIA 5GWXA 2UZAA 3WLJA 1L4FA 4I99A 4P93A 4M60A 1FMLA 4B3AA 1ADFA 1YO6A 3OZUA 3S2ZA 1WXHA 2ID7A 4FLFA 1P3DA 3ZV4A 1U9YA 3WMWA 1T9HA 4N0PA 1DARA 4IEEA 4IMJB 2Z2IA 3H2GA 3D6MA 2F4NA 3R8XA 2CNLA 5TE9A 3OF2A 4IHYA 5ICSA 3ABQB 3HSRA 3KYBA 1I1GA 3BC8A 5H3LA 2Q1SA 2KE5A 2JH8A 3NHPA 4REQA 4XR6A 2FP4A 2XE8A 5I9IA 2IEGA 4F46A 1CJMA 4ECAA 3JQQA 4MHOA 1DXYA 3NWEA 4E5KA 1A71A 2FSFA 2Q4OA 1EG7A 1UEXC 3T12A 2KJCA 3RYFA 1J5PA 3LCUA 3CW2A 3DE7X 4TZ0A 4MUHA 1OLTA 1EIWA 2VHEA 4ZAFA 1ATZA 4HSEA 5LOVA 4Q9LA 2ZSUA 4D9IA 1ISMA 3K73O 1QIGA 4RS8A 2ZJQF 1QGUB 4C29A 5ALNA 5A06A 2CUJA 5AKEA 3KB8A 2GT1A 4R5MA 1MQSA 4RD1A 2VQEB 4Q4ZF 5IABA 2QRUA 5D1HA 3G2HA 1TZBA 4CKEA 3ONWA 2M0MA 4MUFA 1PWXA 1XKLA 1YVEI 4LVCA 2XUFA 3KCQA 1IF1A 3NC1C 1XTZA 1USIA 3CUQC 3HJGA 3KSDO 1P60A 4BLTA 1QWSA 1C30B 1GNSA 1WVIA 2YY7A 3O0TA 2HK7A 3SBEA 3B1XA 3B8EA 4I4CA 2DN0A 4YRCA 5E4TA 4CDGA 2ZYRA 2NNLD 3FNGA 1QZZA 1B72B 4TUYB 1T5SA 1MMDA 4FB5A 5JSZA 3TEFA 3A7EA 2ERXA 3PLAE 3PQJA 1R9MA 1ZFNA 5DE3A 3FFBA 5B5SA 1ISPA 1E2LA 3F97A 2C83A 3WKDA 5TQVA 1GD1O 3UCEA 2P3LA 1WZEA 1ZN2A 4ZZ0A 1RI4A 3JR9A 2BKVA 1CJVC 1VBMA 4MS4B 3KC2A 2HIGA 2NO4A 1LDEA 1G38A 4IDDA 1YRHA 5BQ5A 4B3SB 4P38A 4WXYB 3HYLA 4XIYA 1VLMA 4CTNA 4ZO4A 3PPVA 2R66A 2EQ5A 5AIPA 2BRUA 1WRBA 1E6UA 4GRAA 5MGBA 5J5AA 3LHKA 2YV2A 3L7KA 2HSZA 2A07F 4GSLA 4XKJA 5DCUA 2ZXWH 3H5TA 2WJYA 1KSFX 5A5DA 5ECGC 1M6EX 5EJGA 3CRNA 4YUVA 3LYUA 2P6TA 3OIQA 3F47A 3WGNA 1T6XA 4ZIRA 4DLBA 3K0EA 4MWCA 3ZI0A 2XF7A 5BPIA 3R9XA 2OCIA 4FDTA 3H87A 2EBUA 2OLKA 5EQJB 2WM3A 1EK6A 2CXQA 2RH8A 4WK2B 4B17A 1ZRMA 3U44A 3A2LA 1JZQA 2R7XA 2M4KA 4FOOA 2VPXA 1TM7E 3B8HA 3I1IA 4M0LA 4PWYA 1QAOA 2BGNA 1YFKA 4BEJA 4G6QA 5DBEX 1FUEA 4CMCA 3ZIDA 4AULA 2ZJPF 4XNFA 1QS0A 2PKCA 5GONB 5LD2C 2ZJ6A 1Z6QA 3TSCA 5G41A 4C87A 3UVEA 5KU7A 4KXYA 2PHZA 1BA5A 2HM7A 2IL1A 4A36A 4WWCA 2HOAA 4W5HA 4DDKA 4ND1A 4BU1A 5CCDA 1ULUA 1QC5A 2M8EA 1J2RA 4Y9UA 4H0FA 4KREA 1YDFA 1NPDA 3ZTTA 4TN1A 5KNDD 4CNQA 3OAAA 3QP5A 1E7WA 3O75A 4MLOA 4LIPD 3VJKA 1Y8RA 2VQHA 1CX9B 2JLRA 5DBHX 3N7UA 1M1YA 3OE7A 4QDTA 4P7GA 1EF4A 1KEEB 2K6GA 2HL6A 3EIQA 1X2MA 1SG6A 3ASOH 5AJTA 4NYIQ 2JAQA 4Q7LA 3FTQA 4B3RB 4EEXA 3PSFA 4MVWA 1P2FA 4ZTBA 1W5TA 1BRTA 1YUNA 1QCDA 3OSUA 5HGXA 1Y82A 4G4IA 1RM4A 3HCFA 3KQUA 2QTVA 4YAGA 2FEAA 3R5SA 1GUBA 3OYDA 1VQ5I 3SFTA 1UMKA 1CY8A 3ZE1B 3BWGA 3QVOA 4CMGA 4H7DA 5D00A 1UR5A 3MBIA 1QDEA 3QYBA 4I9HA 3HB4X 3E7WA 3CFYA 3GH3A 4GXRA 3QHAA 3GN1A 3H1CA 3SBXA 1SBQA 1RP1A 4FGJA 1DQZA 5BN3B 4HW0A 4YFKF 4LI0A 1TIKA 1Y98A 1CR1A 2GYVA 4H7IA 1CUHA 1M2WA 4EM0B 2PLYA 1SA0A 2R2AA 2DKOA 1KZHA 4Q03A 1SY7A 3WIDA 3S1SA 2YJZA 5CNJA 1F3LA 3K69A 2ZT6A 3Q2IA 5DK6A 2BBOA 3EXAA 4FOLA 4TLAA 3QZUA 4R79A 3C5HA 4PZ9A 2WIFA 5JXGA 3ND7A 3LY5A 2Z5UA 3PUIA 3RFXA 5TXGA 1XP8A 2BFDB 3DKXA 1LEBA 1YVPA 4E5VA 4FR2A 1Z4IA 4AMYA 1W4RA 4MDEA 4UU0A 4XD2A 1BEUB 3OQ6A 5BOXA 2COEA 3ACDA 3NDIA 2HMSA 3FFXA 5ARDA 2H9IA 1KHTA 3R23A 5K0LA 2YX7A 3MNFA 2ZFWA 2Q9AA 4RPGA 1ZJJA 3T0GA 3C3KA 3ITEA 3AG3H 5IAGA 1A4XA 3QOFA 3VOBA 1VRCA 5KX5B 1DPFA 3PCRB 1P73A 3A4NA 3R6DA 4DCUA 2VTKA 2BFWA 2XDQA 3H9JA 3HUEA 1VYUA 3O9ZA 1FBSA 5TPZD 1WSBA 2Y1LA 2EQBA 1NFRA 1RRGA 4BUJA 1E2QA 4HQMA 4D82A 4ER6A 3IUYA 5F35A 1K2WA 5KVAA 4IL6C 5HJEA 3U5TA 2ZK7A 1MX5A 4NCNA 2X9DA 3N3BC 3SMQA 2BGLA 1AO3A 3AV0B 5CLGA 2O0YA 1UFQA 1LLQA 4HO1X 4R9NA 1AUPA 4UE6A 4FW8A 3L09A 2ECKA 3OQNA 1WW3A 3T0YA 1L5ZA 3GRAA 1II8B 4GAEA 2QNRA 1IB0A 3AR7A 4AN0A 3VVCA 5JCJD 4RULA 1N6RA 1Z38A 4A3DJ 1SBZA 3QENA 1DAKA 4MZXA 2MFZA 2VK1A 1NF3A 4R9UC 2O8CA 3RASA 4E7ZA 2VHWA 1E7MA 3KOWA 3GT4A 1TZJA 4Q3NA 4C3VA 1HQDA 3TQFA 2F1OA 4C4ZA 3Q6IA 4XKCA 5EERA 3ZN2A 1EP1B 1Z88A 3NXKA 4J1QA 2X8BA 3D8HA 3BIJA 1DV1A 4LSWA 1R58A 2ZANA 3H3UA 3RYHB 1OAKA 1YZLA 1UPFA 4ZOBA 1X1CA 5M3MJ 3QOWA 2XZOA 3CRRA 2GJAA 3P97A 3KR2A 5EWLB 2B1IA 1X7ZB 3AR9A 1HO3A 1RPNA 2YRWA 4XVQA 4G0VA 3FPBA 4MLDA 5KAPA 1R16A 3GYBA 4I2VA 4WZBA 4KGXA 1U0HC 1XALA 1H0MA 3RODA 1COZA 3VKGA 3IOCA 2DBVO 2O6LA 5F5NA 5FBWB 2O4UX 4WKBA 4HGYA 4ER5A 3RVMA 4TTRA 3VR6H 3EAQA 1EVLA 4OHYA 2GTPA 2AXQA 4OHBA 1HTWA 4XYLA 3NYWA 3F49S 1SIWA 1NUQA 1FBNA 4BO6A 1VPTA 3KFVA 5EXDA 3K1AB 3L46A 5JJKA 2PX0A 5J1YA 2WYIA 3HBAA 4C6HA 2F5CA 1ORDA 3ZNQA 1H2ZA 5E3JA 5E6RA 1JJAA 3ZZMA 3FHOA 3LVRE 3C3YA 2IT1A 1PUIA 3DBRB 3SAJA 2RAEA 1S7EA 1IEVA 1UC9A 5J47A 4CKYA 5T4FA 5CXXA 5B1HA 4G4SO 4J0QA 1D4OA 2EIHA 1GXSB 4CCAA 2YNMA 1MB2A 4GRIA 2PUBA 4DT1A 2FV8A 1RE1A 5LQDA 3SZ3A 5CA1A 3ZWXA 1R9NA 5IT9A 4UHDA 3OV8A 3LX8A 3IBCA 1FRFS 4J0EA 3TLZA 4HWTA 5KWJA 2ZB8A 3P9IA 1OFUX 3T5MA 3TIIA 1P0PA 5T6MA 4LMYA 2DT7B 2W48A 3T1HB 2ILTA 3IC7A 4KAAA 3VAAA 5FWDA 4C0SA 4K2EA 2E48A 3LPNA 2AHQA 5FWXA 4PGHA 1XPRA 3ENNA 2EWMA 1JKJB 4LCJA 5H8WA 3U7JA 1EDDA 3U09A 4IF6A 3E9DA 3O9VA 4RMGA 1K5DA 4BY7J 1V2HE 3WWEA 3Q9UA 1CYEA 2I7XA 4IHKA 4LRYA 3WZ2A 4HDAA 1XK7A 3QV1A 2Z4RA 2Q9CA 5DGCA 1X39A 1T15A 3ZZUA 3OTGA 3S14J 3EH2A 5LGNA 4CXFA 1G8JA 5GZ1A 3HB0A 3W3AH 2F3QA 2G5CA 3FNFA 5IVDA 3PR2B 1HKSA 1YNOA 4YLEA 3F6OA 1JVSA 4UPVA 3T7TA 1BIFA 2GGSA 4DWVA 3WYNA 4DG8A 4Q7MB 1CFZA 3NCHA 5HZKA 4Q1VA 3ENQA 1TOAA 3DE0X 4XMYA 4H60A 4Y1EA 1P1JA 5I9SA 4N5DA 2ZTMA 4YREA 2DLNA 4G9EA 1YAHA 2I1LA 2GM5A 1Z2EA 1QMPA 5ALLA 2WJ6A 2N0SA 2PSJA 3GPIA 4DNXA 4DRYA 2C88A 3E9RA 4YAJA 4DMKA 4TLMB 1LX6A 1GVDA 5C31A 3CJQB 2XWQA 3U9LA 2OWDA 4BL5A 1X0VA 2IVZA 2ORIA 2DTXA 5JV5A 4X62B 4LOLA 4EB6B 4E3ZA 5HOQA 3B2NA 3LPAA 4MWZA 4GPAA 3F8SA 3EXG1 1U6GA 5DNEA 1PV4A 2PSHA 1TUIA 1VL6A 4Q1DA 5ESXA 2NYXA 1CEXA 4M8LA 1E9AA 2COMA 4GNRA 3FPLA 1SXJE 3BD7A 3HJNA 4M7PA 2B4KA 1X7YA 2Q3LA 4UNNA 4C06A 4I81A 2Z58A 3V8LA 4RIIA 2AFVA 3EOAI 2IEBA 5IN5A 5I7AA 1C0WA 3O2NA 1P29A 3WSWA 3EUFA 2O4CA 1LLCA 2FWRA 4WI1A 4BHTA 4QPZA 2A33A 2E49A 2GSWA 3L0OA 2OPHA 3OZBA 1E2FA 4QXOA 4O2LA 3A37A 4MI9A 3DXYA 1YL5A 2EVWX 4DIMA 2XA9A 1JI3A 2O7SA 3F9KA 4WKGA 3DE4X 3IOEA 4TZ6A 2LR8A 3LGSA 3HUTA 2VRCA 1OZAA 1YAJA 4PCLA 3MUNA 1PWYE 2M2IA 4QVIA 1XX6A 5BW6B 1U3WA 2AFIB 2DGDA 3L8YA 4A12A 3RBZA 4H08A 5FTMA 1MDMB 4PRZA 2QGFA 2A1UA 1VGVA 4JXXA 1KYZA 2DFNA 2C2XA 3SR0A 1Q77A 2LGJA 2F8MA 1ZIYA 2OB2A 1ACJA 4RZ3A 2BMFA 5L95A 1U0NA 3I0MA 1DC4A 5MFZA 1DUXC 2JB9A 4LIUA 2Q2OA 3OM0A 5DLYA 5HSGA 4R2WA 5IEBA 3IIEA 3NALA 3BYZA 1SVUA 4EPWA 2VF4X 2VI6A 4BUPA 4XLEA 2P2ZA 1KXJA 5CDSA 3VH1A 1ETQA 3EZ2A 2J3DA 2COBA 2GCEA 1ODJA 2RN7A 1VHTA 3COJA 4WOPA 3T0IA 5LHHA 3OMYA 4AQDA 4UD6A 4B74A 5L51A 4TXMA 2A6HF 3IQDB 1T4MA 3AEZA 2W2TA 2WVGA 3H5IA 2R9VA 3CLUD 2FEKA 4L2IB 4Z4CA 2Y6UA 4PHCA 1B6GA 2Z8XA 1DOAA 5AONA 2LKXA 2BZGA 4MV5A 5HP4A 3GCWA 3FI9A 1OREA 3DJFA 2R25B 1IMOA 1PUXA 3HN6A 5JAZA 2R7ZJ 1E3JA 1T1EA 4XARA 5K8VA 2FBKA 3MPUA 1YIAA 3TJRA 3ROPA 4AJ2A 1MGOA 3WLPA 3OZEA 3PWZA 1O54A 2Z5LA 3M89A 3UMRA 1PP4A 4FCWA 2A84A 3PFYA 1FCJA 2CC2A 4FFWA 4EL0A 3RAFC 4UMFA 4CR6A 5DCMB 5CM9C 2E60A 4PCVA 4D3FA 2C04A 3QBEA 4DTCA 3LUPA 3O3OB 4U7WA 5J2UA 3R77A 2CCKA 5GM1A 2D1VA 3IT1A 3EGDA 1G17A 3LRPA 3LK6A 3WBJA 3EUKL 2VYVD 2YWXA 4ZAGA 4B32A 5DO9A 4M1ZA 3OLCX 1NMQA 4Z4GA 1P61B 2JGFA 1OR8A 4URWR 5FEUA 2D74A 4XWOA 1G1AA 3E9NA 4DUPA 4C3IJ 3R3SA 2MYSA 4OI1A 3RLFA 2PWPA 1VE9A 2WFLA 1RKBA 2V4MA 3ZQ6A 3E9EA 3QF4B 1WDLA 3HU5A 1S5PA 4YG2F 3QY9A 4TTIA 4NULA 1XA0A 5MFPA 4PLVA 3LCCA 5TMPA 1R3DA 4XQGA 4RSMA 3T99A 3ECOA 4OQZA 1OU4A 3DWLE 4V0LA 1QMGA 3UATA 2I4MA 3W4KA 4G25A 1FX0A 5BPHA 2HR3A 3VNUA 4RB1A 5KSOA 4R2MA 1SCQA 3G9QA 4HI0E 5JJ5A 1TC3C 3IKJA 2VZLA 4EDHA 3DLBA 4IIJB 3OZIA 1MIHA 4MS1A 5HDKA 3IAXA 2QCOA 3WJ7A 4CM9A 1P77A 5C7YA 3HUGA 3CPSA 3NT4A 4D2IA 1V9LA 2Q41A 1Y81A 2XCUA 4JEMA 2NPOA 4ZVLA 1SUEA 4GPEA 4CWAA 4AF6A 1B3RA 2AJDA 4TTJA 1HXHA 2I2XB 4Q19A 4C7XA 4C9BA 2H0AA 3RVQA 2WM9B 3K4KA 2P6PA 1U2GC 1HDOA 2ZATA 4KQMA 2FZVA 4HMPA 4FMDB 1N6NA 3VH4A 4U7TB 2CFXA 3ILVA 5AOBA 3OM9A 1BXKA 3J80A 1AA9A 3EEOA 1OH6A 4B3IA 2B8NA 3S0JA 2H57A 1OKRA 4D57A 4BLVA 2HOQA 4DLAA 3UH0A 1OZFA 3FTDA 3Q7PA 3OZXA 1P5HA 2WM8A 4N9IA 1ORKA 1OISA 1RPAA 3GJRA 3R9WA 3CLOA 3GEMA 2R44A 1NSFA 3ZK8A 4DF3A 1P5RA 1VB5A 3WTVC 2QENA 4II3A 1A95A 5BO5A 5I4KA 1PVVA 1ZNYA 2PMUA 3EULA 1JQKA 2YASA 1EDEA 1SO8A 2KPMA 1N0IA 2EHDA 3AZQA 3B6IA 2B63J 4HQNA 3VC2A 3RVJA 3OSFA 2V97A 3GLHA 1RLIA 4MO7A 4ML3A 4NCBA 1YR3A 1I6HJ 1SB8A 4EAQA 1L8XA 2JATA 4IICA 2XCRB 1SC4A 1JHXA 1K8XB 1JA9A 3VYUB 3AFOA 5CVEA 3TECE 3O3MB 2FTKE 4BX3A 4G1FA 6LDHA 1PT7A 1TNTA 1A9QA 4BRUA 3IRUA 1E2PA 3IPCA 1QQTA 5IT9K 3ZKWA 2DT5A 2XYRA 1CUUA 3MS4A 2BM0A 5G02A 4N6OA 4QYMA 4KK4A 3A4MA 3FIUA 3DDSA 5E4JA 1Y8QA 1CQZA 1MVLA 1RBZA 5DK4A 1CNFA 1CUAA 4S0XA 4LVOA 4HAYA 4JVLA 4BNGA 3S2YA 4MW1A 3BWYA 3DZIA 4I1RA 3V2HA 1LC3A 2OCEA 2B4YA 2GCPA 1B8IB 4N6GA 4LX8A 3AJAA 1VJ5A 3GZ5A 5KSYA 5DYTA 1MXFA 3GQBA 3BFXA 2FUG2 1C4WA 2Q5JA 2ZWMA 4OTZA 3SCZA 5JZMA 1V3QE 1NF9A 2FKAA 1IGNA 4OLJA 5BXQC 4DIBA 2XNSA 3RFUA 3C2QA 1L2TA 2XAHA 1WCYA 1OI4A 5K0BA 3ZS9A 5F1YA 2Z08A 4RJ2A 1GNLA 1W4MA 2HXSA 2FPRA 1EFRD 1HNNA 1XRLA 2ODBA 4UTRA 4KLNA 1Q3HA 3K1PA 4HSRA 3O93A 3UB4A 4CTJA 2IUFA 4A91A 3EQZA 3OZFA 4MUEA 2GAAA 4CODB 4I5GA 2LC2A 4YXWD 3E23A 2P3QA 4BZPA 1M6YA 1HRDA 1XZIA 4R8HA 1AHDP 5IBRA 2IGNA 3G6KA 3MGBA 3I2IA 3ESZA 3HR7A 1FJGB 4Z7NB 4KR0A 2JIPA 2QK4A 1SD7A 5FULA 4NBNA 4FFBB 3G71I 3NM6B 3QUTA 1Z0JA 2D8AA 4CLRA 3KEQA 1P2GA 1IHDA 3H36A 3THWA 4WNYA 4CHTA 1VA4A 2XPVA 4EKDA 3L8EA 5EJMA 4NOKA 1RW4A 2WJJA 1MXHA 3OTQA 1LNZA 1N2OA 3X1MA 2FE4A 4LZLA 4ZYDA 2NU8A 2OCCH 1D0ZA 1L5NA 1F1JA 1ARZA 2ECCA 2QEQA 5BVGB 1U1GA 1FTTA 4L0YB 2X8JA 4OHOA 2KQUA 2L42A 5I8ZA 3GRCA 1VGQA 3LUAA 2IGKA 3ZYCA 3S28A 3CUQB 3DUWA 4AP5A 4ZOEA 4JLJA 1HC8A 4XOPA 2ECFA 2NAZA 5CQEA 3CRQA 3FPKA 2DY1A 4EV0A 2KLOA 1JG1A 5F1RA 1S3IA 2I10A 4LRSB 2R6DA 1NC3A 3ISJA 4YCNA 4A2UA 5LLSA 1KJNA 1WXXA 3E35A 3R0IA 3CMYA 1NVWQ 4D26A 3L4SO 3QNMA 4JLAA 4FEGA 4BTVA 4IQFA 1LBTA 2B25A 2OZKA 3EPPA 4FX4A 3EUHC 3MUFA 3VKFA 3H84A 1IM5A 1LJUA 2NAFA 4G5HA 4HEQA 2L0KA 2I2WA 1ULTA 3F0TA 2QR3A 2VYND 4OMCA 2XCIA 2IW5A 3C3WA 1C50A 4EJ2A 4PRYA 4MPJA 4N48A 1OWNA 2FG5A 2GVNA 2P65A 1KI6B 1AMNA 3ZLTA 2ZB7A 3ZZTA 3IP1A 3CO5A 4KTTE 3Q3SA 2WY8Q 1Q1HA 3O82A 2OBLA 3FOBA 5E4FA 4C01A 3PRYA 3S27A 4ALKA 1W9MA 2G7HA 4K46A 1KOGA 2QG9A 3MOIA 3JZMA 3ZHZA 1B0ZA 1SBHA 3SICE 1G21B 4J94A 4HFRA 1FDTA 3T3GA 3HKDB 4C6SA 2B83A 2QL7A 4C6TB 4HQKA 4MIMA 1CZRA 1Q7RA 4L5EA 4P9UA 3O8QA 4KQGA 5JS2A 2PL5A 3U3OA 3P9ZA 2VUMJ 2OO7A 3AHGA 3DVRX 2Z57A 4UHFA 3T3PB 1B00A 5J2TA 2VPWA 4P34A 1NI4A 2TCTA 4QVKA 4Y2RA 2XHZA 2L5QA 1L3LA 1YHZA 1R4NB 2WV1A 3AR2A 4HDRB 1YQTA 3U1DA 3GLFB 4M3FA 3FZVA 1WR8A 4UQLA 4UTPA 4HWOA 3GFBA 1QOZA 5EJ6A 2I54A 2C7PA 3WWZA 1ZVVA 3NHFA 2IOYA 2HI0A 1WBDA 5AD1A 2GASA 5E3LA 2PL9A 1NW8A 4UDXX 3OJOA 4IDNA 3ONDA 3MILA 4Q7EA 1EBUA 2CXPA 2XAAA 4BJ3A 4CMEA 5DTQA 3S40A 1D2MA 4MGIR 1SM4A 4TWAA 1NBWB 5I01A 1W93A 1T3ZA 1X92A 1C3EA 1DXHA 3B78A 1ST3A 1YB2A 1GV2A 2VXYA 5A7HA 1GTMA 3D4NA 4LYHA 3SYRA 1NXVA 3I9MA 3G0OA 5AWFC 2WAYA 2UVPB 2Q6TA 3DE3X 2QN2A 2QTNA 3QKRA 4A3FJ 2XB0X 1JGTA 2VHJA 2GN9A 3STTA 4EMBA 1G8MA 4FLMA 3RVNA 5AXAA 4AKEA 3EVTA 5DHFA 1ZQ3P 2W2XA 3ZXIA 2L7MP 3N8NA 5GJVC 1O8CA 4FGWA 3T7AA 5L3GA 1KEWA 2HUNA 1S4MA 2QT1A 4HTFA 2W00A 2QQ0A 3NOOA 2OBNA 4ZCMA 4P54A 2H7CA 2IE8A 4MWEA 3K3PA 4XKWA 1I3OA 4J3JA 4UCQA 3SEZA 1YRAA 3V4GA 4EVIA 1MNMC 3A6EA 3A4TA 1GGEA 4IFEA 1N7JA 1YJCA 4LQ4A 1ZL2A 5JBNA 4J7UA 2PMFA 3CUKA 2JG3A 4XM2A 1IM8A 1RCFA 5E6SA 5IT4A 1TXGA 2J9FA 4ENMA 1CY1A 1OVGA 3LGXA 4HNHA 1F38A 2X9GA 5B4VA 1T1GA 4OIOF 1EDOA 4ZVPA 4A5SA 4NLLA 4EYSA 1P2BA 1RC9A 1ZMBA 5DHPA 3A32A 1NP3A 1N2CA 4HNGA 3EGVA 4PEVA 1FFYA 5JSFA 4BE0A 4U00A 4BFZA 1FTNA 1D0IA 3TGLA 5H82A 4GZ5A 4ARCA 4LF4B 1JVNA 4H7PA 1UL1X 3NETA 3GDHA 1ADJA 1GUYA 1SCUB 2Q2QA 3J80K 4ZVRA 3WLSA 1C3OA 3MXOA 4JV5B 1AN9A 4NEHB 3QUQA 4FFLA 2AE1A 2IS6A 1IRXA 3AR5A 1CUYA 3MT0A 1YMQA 5ALKA 1OXVA 5KOIA 5PNTA 1SFOJ 3P2MA 2JA2A 3OFJA 5DM6F 5B3AA 3BE8A 1BGVA 4B6OA 3LFKA 1O4XA 4HAMA 2VDWB 3AEQA 1XMQB 2XSDC 1R2QA 2ZB2A 3ZXUB 4JQOA 2VXBA 3UJHA 3BAFA 2B5VA 3VJLA 1UJ5A 1GT6A 2BGGA 1SC3A 3DWFA 5E0OA 1EGAA 4G7HF 3TDMA 4C3ZA 1G4HA 3ORRA 1LPAB 2Y30A 1DQUA 4MYCA 4NCAA 3IC5A 2G1KA 5A3JA 4AK9A 2W2NA 1FNMA 4HV4A 4MR8A 4A6XA 3H6HA 2FWAA 3OJEA 2A0KA 3OR2C 3C3PA 4GGPA 3ER9A 2BFPA 3E97A 3MT7A 3PM1A 2YMPA 2IYNA 3WBFA 5FUVA 4EKNB 1KI3A 3DQQA 3FHJA 1G2HA 4NHJA 4CLOA 4PIMA 2FN3A 3AG2H 1U7PA 2XWPA 1XTAA 1SCKA 3PE3A 2X13A 2ZYHA 1ZG3A 1NW5A 1BEZA 1V1JA 2C1XA 2VPQA 1LDBA 1RYDA 2C2BA 3HV2A 3D6HA 4QPPA 1W1UA 1ZNQO 3BMCA 2HFJA 1VQKI 3OX3A 1ZD3A 1ZUNB 2AQIA 2HK8A 4FOPA 2YZ2A 1T0PA 4B35A 3JVIA 1OR7C 2OQVA 4H1UA 1NVMB 5D5VB 1VQ1A 1ZAOA 4XWGA 4OAZA 4Z7QB 4F4UA 1KQPA 1U2TA 3HCNA 3SHWA 4RTLA 4N7JA 2BSAA 5EG0B 2R8ZA 1HT3A 2F55A 1BKDR 1E20A 4XOIA 4XLNF 1R4ZA 4ENUA 4IQ8A 3KP1A 4E4RA 1M9NA 4P0TA 2XY4A 3IEUA 4FGLA 1Q0SA 3HR4A 2P1ZA 5CVVA 1LWNA 4Q15A 3LP5A 5ELMA 4MQBA 2NNWB 1NU6A 3QIVA 1V9SA 1C9DB 4XI9A 4WNIA 3ESRA 5AVSA 4YPOA 3OCUA 3AB7A 4Q4AB 3P2KA 2XOEA 1B23P 2X0LA 4L8GA 2IWHA 3QWAA 1E3EA 2HOEA 2C5HA 4W9RA 3V6MA 5K7SA 2ZBPA 1EFPA 1MJAA 1ZOSA 1YB5A 3GJQA 4NTZA 4QDUA 4YT2A 2GEKA 4X65B 4C1BA 5ERYA 2E7XA 2ZAOA 1FVOA 1FNSA 3PV0A 1V7CA 4J0FA 3JWJA 1MC1A 4CKCB 1YJAA 2X5NA 2VYQA 5L3DA 3V9AA 3K4CA 5A2GA 2QJWA 1JHMA 1Z4NA 4O2BF 1K3UB 1KYIA 1PN3A 2EFYA 3UYLA 2GXGA 3IVRA 2H08A 3GWGA 1J7KA 2R65A 1I2MA 2O2EA 1YRLA 2PT9A 2OYCA 2X42A 2AR9A 3K70B 2QMEA 1GSHA 1CJSA 3UPDA 5JMWA 1ZW1A 3W5JA 2DT6A 1YB7A 1QGAA 3ONVA 4IS2A 2PXCA 3DKRA 1H8EA 3DPTA 4JJEA 2B82A 2XB5A 4M73A 2W2LD 5IAAA 1H69A 1Z06A 4M72A 3L6UA 2R5FA 3FR7A 2X0KA 3AUFA 3B7PA 1Z2PX 1SG9A 3R7BA 2XXAB 1C4OA 2W4MA 1PVEA 4QOSA 3ZXSA 2HMYB 3HH8A 3ZQQA 1VQ7I 4O2BB 4RVDA 4F71A 5CD1A 1P1KA 3BMNB 3BVPA 1P9OA 3TTVA 3ONEA 1YJQA 2E5ZA 1P1FA 2ZWIA 3AR3A 1F6BA 1WLYA 1AZTA 3BDIA 4O59O 2JLAA 4CETA 1UT8A 4HGQA 2JRTA 1XEWX 2M2EA 2Z2ZA 4QJBA 1GTZA 1LBIA 4WUVA 3O3CA 1B4AA 1N0HA 2A58A 1QQ6A 2NXNB 4X7RA 5CG2A 3ZE8A 2JJ8A 3E5NA 3KOMA 3NO4A 2J4DA 3M3HA 2JHCA 2NMVA 2WU8A 2IPXA 1ECJA 2HIAA 1UDXA 2P4EA 1K0UA 5IARA 1L5GB 3BG6A 3T7RA 3NVAA 3IQZA 3ESQA 1NOIA 4J4BA 4QU8A 2BL4A 2VLIA 3L7YA 3F7NA 2VJAA 4GM0A 2PMBA 3CQ9A 3K2ZA 4ZYUA 2HWYA 1RJ9A 2EGUA 1NC1A 1OYWA 2NT3A 5CA0F 2DETA 3D6FA 1FP6A 1CE8A 1QTNA 1SC1A 1CS0A 5D5HA 2F2EA 2A9OA 1R6AA 4W1RA 4L15A 1C0PA 1ULZA 3GEBA 4OUDB 4NABA 4FZ3A 5LEKA 5D8DA 2LP4Y 3F3XA 4DR2B 1RTTA 3HUDA 2HJHA 4BN5A 4LK2A 1YXMA 4OU0A 3UC9A 1BC7C 3E1KA 2R1TA 1G64A 1FSFA 2ZYTX 2K7ZA 3HDHA 3JW8A 3CA8A 4B80A 5KJCA 5DHAA 2P91A 1Z83A 4DMFA 9ANTA 1NVVQ 2B0CA 1AM4D 2ZKLA 2RAVA 3OUZA 3F3KA 1JHZA 3CZMA 2VDOB 1IQ0A 4LUCA 2J3LA 1OY1A 2RREA 3VSKA 2NZVG 1FMFA 1X74A 2EF1A 1NY6A 4F6CA 3EK2A 2KYRA 3QFTA 1YCGA 2I7VA 2QRJA 4AZTA 4RTOA 3VI3B 2B9SA 4LG0A 3LDUA 2GPWA 2G1JA 4TMWA 4ER0A 3JY6A 4KNYA 3L7BA 2REQB 1BE0A 4LK1F 1J23A 3OBBA 1NOJA 2H7VA 2HCBA 3UXMA 5ERXA 5C0OE 1TYEB 1XZKA 3SC2B 3I4PA 4BKRA 2BFOA 3AM1A 3EHDA 4QPNA 2ILVA 5JXJA 4EH1A 4PSXA 3I5MA 3G1WA 4F6RB 4JASB 2I55A 2HUPA 3Q2OA 1CHNA 3B2QA 4GZ3A 4IIEA 4EBFA 1XD2B 4YRKA 1E98A 3C6BA 4GXQA 1OXXK 1EX7A 2KIFA 2AZTA 5TJJA 3COWA 5IZ4A 5SICE 1MBZA 3G85A 5ITZA 4CGYA 4QRIA 5KHAA 1IG0A 1N2BA 3OJXA 2GILA 2BEWA 1O7LA 3ZQIA 1K7EB 3URKA 1V8PA 2PZKA 3ORYA 5JSYA 2E1RA 2YMQA 2FR8A 4EEZA 3K1YA 2VHTA 3K72B 2IU3A 4MQMA 4X7BA 4HUQA 2C2HA 4UAUA 4P86A 3KKMA 4DIEA 5LUAA 2CN1A 2QXYA 2Q45A 3DMTC 2NRAC 2A1TS 2MSLA 4OP2A 2VTBA 4FYMA 4D4MA 3CNHA 4AM3A 4GWLA 3AY6A 3F5MA 4M55A 1MAHA 4LXGA 1IN7A 1U02A 3DVQX 3WFIA 3RFTA 3GYGA 2OESA 2R86A 2FUG1 1NG6A 3TR0A 3ZGZA 1NW9B 1RPJA 3BK7A 2G0NA 2XROA 2JF0A 1TU4A 5HGJA 4RD2A 2NOGA 1CVRA 1Y8ZA 2I1VB 1XCPA 3UT5B 1RYYA 4L74A 4JR0A 3L8MA 2ISYA 2F3UA 2XC7A 3B6JA 2YFHA 4W5RA 1D2NA 3N8KA 3GCMA 3BCHA 5LCXA 4FQ7A 1FUIA 2DQSA 5G53C 5E7IA 1LFBA 5AVRA 2QRZA 3AJEA 4AX8A 2KIMA 1JECA 2CEAA 2QVBA 3R5JA 4XN0A 2WZCA 3GZTB 2CMGA 3AV3A 4K0KB 2PRZA 1LPPA 1J9IA 3CNEA 3ABMH 3TO9A 1VE1A 5F76A 1N7IA 2FWBA 3FSJX 4KODA 4BB0A 3U7QB 4GQIA 1JIUA 1NW3A 1QO0A 1TYBE 4HUJA 1Y5NA 4BGEA 3HBNA 2R6GA 3E9ZA 1ZK1A 4G1VA 3Q7QA 3RBXA 1RMTA 5THKA 1Y4DE 2EKBA 1O6CA 2QD5A 4GOJA 5B6PA 4NG4A 3HP4A 2R7UA 4NE2A 1BYIA 4R31A 4RLFA 1WH7A 3RVLA 2XT9A 3SEAA 1N5JA 4HF7A 2ZBGA 1SUCA 3CEMA 4CIYA 2Z6AA 3DL4A 1BC5A 1Z05A 1OMOA 1XYYA 3PO2J 3EPRA 3QKTA 2P7VB 3WB0A 1TWFJ 1E4EB 3GAAA 4LC0A 2E1NA 1ID8A 3SZPA 3R76A 3Q8LA 3GTJJ 4DRZA 2KPOA 3O1HB 4B4OA 1V8BA 2X3FA 2O2CA 4V03A 1A1VA 4LYEA 4AFNA 3PJRA 1FDRA 4G56A 4P9NA 4V3CA 1D7AA 4GDMA 3SYLA 2EL7A 5IXSA 4LE2A 4G85A 5ALXA 4PJ0C 4U7JA 4OX9B 3NRCA 3BZUA 3QWIA 4ECEA 1JR4A 2J33A 3VOTA 3TUZC 5L3SB 1WOMA 4M6VA 4H3HB 1F8GA 3EAFA 2DHEA 2B1GA 4QULA 5DSZA 2JGDB 1CETA 1DAIA 2AE2A 4CF6A 4RVUA 5IAEA 3TW0A 4DMHA 1Y8CA 4AN1A 4J16A 5FI5A 3I1YA 1BJKA 4CM3A 1LE8B 4TVKA 1HDDC 5HNKA 3LPMA 2ZR9A 1QH0A 2YYYA 5JAQA 3OUTA 5B3JC 1RJGA 1NA5A 2FU5C 4DCSA 2C5SA 1IEQA 1ZUIA 3EISA 4C89A 1EFVB 4BP1A 2KQRA 1GKKA 3TSAA 4JSRA 2A5YB 2J5PA 2OECA 2AKAB 2XYQA 3SIPA 3DOOA 4YUWA 2Q3BA 5JPCA 4IHJA 2NG1A 4WZ6A 3F6RA 1TAGA 2V7UA 4V0OA 4RBNA 1FS6A 3DF9A 3HL4A 1EQUA 2VI5A 4G6ZA 4AMVA 4Y6PA 2ZETA 3SQNA 1YZKA 4M8KA 4KXFB 2VDMB 1ZUWA 1US8A 1H2WA 2XMRA 5JR3A 4OJYA 2MD5A 2GK6A 3VPGA 3QE9Y 4TMTA 2QY9A 1ZMTA 4CL2A 4K9NA 4ETSA 3PIPF 4NVRA 2XUZA 1NUUA 5AHRA 4BEBA 4PE5B 2O6GE 4ESFA 3GLIB 3NZEA 3KT3A 2JBAA 3EVDA 4AD8A 2WJWA 1XCOA 4KLAA 1VHWA 4F4DA 2PPLA 5IH3A 2YUTA 3VO1A 4CF5A 4S0ZA 1M7BA 2NOAA 1DSSG 3C6QA 1ENYA 3T1BA 4ON0A 4C4SA 2YRXA 3T7CA 3WIUA 4MEJA 3CV3A 1KU9A 4JB2A 3C4JA 4QASA 1VFCA 4FTWA 4LHWA 1YS9A 2DUMA 1WA5A 4EY6A 5FR1A 2DF8A 3WWCA 1GGVA 1AHPA 2HI3A 3QPLA 1F3OA 1XOIA 5E9AA 1XZNA 2HKXA 3OQVA 1DB3A 2NACA 4D44A 4WNCA 2V7GA 2AMJA 1VZ3A 1NLYA 3CW8X 3EGWA 2VQFB 2HQAA 3ETJA 3LSGA 4NU6A 3WMEA 4QPOA 5T3UA 4BFTA 4YUXA 3NM5A 1GAJA 3N2YA 2Q49A 3NANA 2CL0X 4EA8A 2Q07A 3K0CC 3EXFA 3O8RA 3AR8A 3M4XA 4URUR 3R7SA 1CUJA 4JVMA 4DCVA 1L8AA 4UFPA 1U7UA 2XRMA 1N5OX 3F5SA 1J0BA 1CP2A 4J4HA 3EW9A 3TOVA 3THYA 4GBJA 2G88A 4TS3A 1PSZA 2IRFG 4MGZR 2DT8A 3K6GA 2XWBF 2XNHA 5FV7A 3OYJA 3M34A 5AVZA 4LOIA 3G5AA 1QQ5A 1BXRB 1WHUA 3JD3A 2FY8A 4L02A 3B1ZA 4YO8A 2Q0HA 1N32B 3C0KA 2LNBA 2P5SA 3O4VA 4MUAA 2P9FA 4GMGA 5UKDA 3HKZN 2PZJA 2QE7A 2X0NA 4Z7JA 2MSKA 4XORA 4WLFA 3AIKA 3OJLA 1LLFA 1FNNA 1RADA 1XDSA 3EVBA 5TC4A 3BR3A 3RRZA 4AT1A 5JH7F 1EQ2A 4RSGA 4UPEA 3T4EA 2NO1A 3GHHA 1AXRA 3IRVA 2GM9A 3FXAA 1NJ6A 3BRWA 3FYHA 2J4FA 2ATIA 3TLYA 4HH1A 3NEAA 2QD2A 1CY6A 1SQFA 4UUPA 5ICGA 3HFSA 5MN5A 2CV1A 2Q1YA 4ZHQF 3ZV3A 1ZD1A 1A4RA 2PT7A 4DY6A 5IM5A 3FUTA 3G2JA 3CF4A 4IV5A 4UNSA 1XEAA 5LPNA 1K5GA 1VC2A 5JFGA 1VQ9I 4TV9A 2AXTC 2PX9A 4ID3A 3AAFA 3JQFA 3SX2A 1WHSA 4MVJH 1W2HA 1XMAA 3UWPA 3ZEAA 3ZGLA 4LJLA 3E6AA 5JJBA 2ZXJA 4Y15A 2XAJA 1WAMA 3UJAA 2W6NA 1QLHA 2NOJB 4JL5A 4CM4B 4V2FA 4ZYZA 5CPRB 2P0YA 5KYNA 1XT6A 2EC5A 3JASA 3RUDA 3LVFO 1P9LA 3FK6A 2WIJA 3LDHA 1DAEA 5LLDA 1E77A 1G3WA 3QWBA 2KISA 5HS8A 4F7ZA 2XMGA 5FHRA 3WO1A 3E5UA 4UNPA 5I5GA 4YMGA 3FXOA 1JQ3A 2YJTD 1P17A 2XGCA 3RUIA 1PHPA 3KAKA 1ILEA 3PFIA 2E1CA 3A3YA 2NSYA 2L9VA 5CYVA 1QONA 3MOSA 2PIDA 1W52X 4RWEA 4MNUA 2OHIA 4RACA 3LQRA 3QVGA 1BKYA 3PDUA 1CDOA 3IEMA 3GGSA 5DU2A 2QX8A 2F59A 4WADA 3Q10A 1NW4A 3AGPA 1SUIA 1BOAA 1LK0A 2OZLA 1ZNXA 1O89A 2QM8A 4JKOA 1U8EA 2HAEA 5ULLA 2HYJA 4UOEA 1B74A 3WU0A 3QU5A 1QIIA 1TYDE 4HEA2 4JJGA 3AM4A 2V0NA 3I1JA 2B35A 4PGAA 2XF8A 4XICA 2JHGA 4YJFB 1DAPA 3M7GA 4N5NA 3K70C 4TMYA 3D5SC 1FA9A 4UKDA 4AY6A 2X1CA 1C2YA 1XJCA 3IPAA 3HB1A 1PHRA 5KYWA 5JNUA 3U7FB 1RIOH 4J1TA 3FDZB 2QSFX 1OTYA 4IDPA 1H2AS 3M6AA 1YVUA 1UP6A 3NNNA 1LBHA 3SJUA 2I76A 2GUWA 1Q12A 4JI5B 4FDUA 3OFND 1QV6A 3ZWCA 3MMNA 2CF5A 1UMBA 1L5LA 4UBNA 1L5RA 2V7QA 3SSMA 4EA7A 5L40A 1OX4A 1I39A 4XYBA 4BMCA 2XUBA 4ZXFA 2VQDA 2AMFA 4F55A 3KLNA 4QHYA 3DZFA 4IV0A 1HE8B 1O8BA 3A9CA 4A0YA 3MKLA 5CCBA 3VR4H 3ELUA 3ZXXA 3CKKA 1RHUA 2QL9A 1BDHA 4YAKA 4H27A 2BFCA 4XGNA 3DXZA 1HDYA 5FLMJ 3EUWA 5AVWA 2DAOA 4JP2A 4OO3A 5BV8A 4CL0A 2VP3A 3EXIA 3R0JA 2A5FA 1XFDA 1YQWA 1KPHA 2Z56A 2IAIA 1CNMA 4KP7A 1MVOA 1G8FA 1KY4A 4LDJA 2JFXA 3EF3A 1V37A 3AVOA 3JQ6A 4I98B 1M5UA 3DSRA 3LPDA 3KZMA 3FTCA 2P62A 4IDBA 1P75A 4QU9A 3A4YA 4C7OB 3CZQA 4I1YA 5BNGA 3A0RB 4UBIA 2LRDA 5GOTA 4U7PB 3MSCA 3H4MA 4ZO6A 1JWLA 4OGLA 2QQFA 1CR6A 5DYMA 3CX6A 2R00A 4TSRA 3GZJA 3RNLA 2AXLA 2BY1A 2NU9B 1IEXA 2OO5C 4TRRA 4QDXA 4RV5A 1GKYA 1GN8A 2VT2A 4W82A 4RFSB 2I6UA 4EKYA 4X20A 4MKXA 4NONA 4IO0A 3FSGD 3K5IA 2IY7A 3EPZA 3PPXA 4QLOA 5JNRA 1DU0A 4V0RA 1JXOA 4D9MA 3A1YA 1KE2A 4JC5A 4P4UA 1JV2B 4M8SA 4F8YA 2DRIA 1DE0A 1B8PA 3FPFA 4BUZA 3PVSA 1FOKA 2FRDC 1YQUA 5D5PA 2JGLA 2LMDA 1J4AA 2MH9A 1E7QA 3EBPA 2XZLA 2K5UA 3RUPA 4AYTA 1FYWA 1JIXA 2PUCA 3UXEA 1EZ4A 2VF7A 1OIVA 3TQHA 4QNRA 1S9DA 5HIMA 1WXFA 1TO6A 4D0PA 3FMOB 3HCRA 3BSSA 5JIBA 4WK8F 5CGQB 2C31A 4TLEA 3DP7A 4TWIA 3OOWA 1FS5A 5FKOA 1OT3A 4GLBA 3S5JA 3ZQ7A 4ZQIA 3OTIA 3TG2A 1R0XA 3NFYA 1PR5A 1RRJA 4FW9A 4I55F 3PU6A 3GEPA 3ESBA 1USKA 3L0SA 5B1AH 3FNIA 4YT4A 1Q22A 2FPSA 2B3DA 2P90A 2QMQA 1XNGA 3K15A 1OB2A 2ZDQA 1NDQA 4LY0A 1TCBA 1L1FA 4HGNA 2IEYA 3VX4A 4EGFA 4QATA 1LB2A 1QHFA 3FISA 1EFLA 4OQEA 4JLVA 3W1VA 1F2UA 3BR6A 4DOZA 1JLKA 1VJTA 1Z4MA 2E4UA 1OZGA 2Y1EA 3T1NA 2R48A 1YWGO 4BC0A 1BHQ1 1DDOA 1NM5C 5FBZA 4M71A 1PZEA 5FPTA 5CDGA 5CG1A 3IUBA 2V4ZA 1ZH8A 1JKFA 1I4EB 2BGMA 4H1VA 4PYLA 3AF3A 5L3QB 4MRSA 5T5QA 3F23A 3M2PA 2PZBA 2IGMA 4KR3A 1OBCA 4RL6A 1Y7IA 4LGCA 3IB3A 1AKNA 4B81A 3IMEA 2P35A 3PCTA 3WAJA 3FKIJ 1R22A 4F3TA 5IDQA 3FRJA 3ZHYA 3O7WA 1WBJB 3LQQA 4PGMA 1SXJB 1VE5A 2YCBA 3BA1A 1J1IA 2ESHA 3M82A 4V02A 2X86A 2K40A 4K6MA 1YR9A 3PIRA 5A3SA 3HU2A 3MRXA 1W76A 3BXHA 1PJZA 3T41A 3WG7H 1XIVA 5KPDA 1D1AA 2LBFA 3AG1H 2PQ2A 2Y6VA 3AUKA 2QPOA 1BCRA 4TT3D 3DCNA 2BGKA 4K6FA 3UV6A 2OGZA 4EG7A 1F2DA 4L85A 3T3NA 1NLFA 3CZCA 1ZWKA 1DBQA 2PMZA 1XU4A 4RIGA 4B7XA 4MYUA 1AMUA 1Q0PA 4W5JA 2DFTA 4QYWA 4IJKA 3A36A 2FZ5A 1P39A 1Z6GA 5JMPA 3ECCA 1S4QA 1FDIA 1W5FA 4O0MA 1G5QA 4ROSA 5EKSA 4K8OA 2AC2A 4RD3A 4XFJA 1MAUA 2C57A 3D2LA 3KTOA 2QMHA 4ZYVA 1FFDA 4KLZA 3ZDXB 5L3ZA 5EEAA 3ZN1A 4F38A 1RAEA 1S3JA 2EZLA 1JHPA 1Z2NX 3OQBA 5KQLA 1B93A 5HZHA 5EF6A 2HN9A 2I4LA 4NK4A 4R0NA 1XJWA 1ULYA 3HLKA 1IZ9A 5LMZA 3R41A 3KWMA 4F04A 1ZSYA 2LOOA 2CL6X 2ACEA 3KYCA 5SZKB 5LDHA 3KR1A 3ZZ1A 5KHOC 4CDMA 1OOEA 2RH5A 4G1EB 1Q2UA 2NXWA 5EN4A 2C9CA 2IHBA 4MRNA 2ZM5A 1YR8A 2Z99A 3HA3A 1FTGA 2CFIA 2VP5A 3GAFA 3WK7A 4LVNA 2XCOA 1XZBA 2OXFA 3PWKA 2JI8A 4HPJB 4MWGA 4Q4JB 5LBQA 2H4XA 3ZZ0A 1NBMD 1GZ4A 5CKTA 2PD4A 3MELA 3WY9A 1UC8A 3FTEA 1DEKA 1SVSA 4MDFA 1KBZA 1JG6A 5H3HA 1SQGA 2EFCB 1FB5A 2XSZA 1WB4A 2XB9A 4BE4A 4N5MA 4ZEWA 2AJLI 4XQ9A 5TS2A 1GPH1 4A3IJ 2EFNA 1VHQA 1PKXA 3W9UA 3KIPA 2FW9A 2C96A 4BFYA 2W1OA 4YV1A 1UWLA 3RPUD 2HHCA 3HFJA 4INPA 1MJNA 3C4QA 2BGUA 5LXTA 3ZHXA 1YI8A 2HIMA 1QB7A 3L7DA 4ZMSA 3VYTB 1H5QA 2QX6A 1VSBA 2ISQA 2YRFA 2WSLA 2R6ZA 1UF9A 1YO5C 4Z6KA 4J8PA 5KAMA 2QPLA 4KE9A 1VMIA 4BPBA 1IRIA 2Q7OE 3ORFA 1NNI1 4GMHA 5LN1A 2HH9A 1MU0A 1PVOA 4TKVA 2GLOA 1B9MA 3TEDA 3DFKA 5JBQA 5TGZA 1KEVA 3JPYA 3RT9A 2RI0A 4HXFB 3U40A 5E6UA 4XRSA 2F90A 2VEDA 3GL9A 4RY0A 2MYPA 1M1NA 4X6XA 3BJZA 4NCKA 4ND8A 4G0PA 2NUPB 1MIOA 5CYPA 3W5DA 4IDOA 3VISA 5CB6A 2QVYX 3FMRA 2EX4A 3N0XA 1JHQA 3CHYA 2BEJA 1YULA 4GWKA 2ZRCA 4BO3A 1B42A 1MMNA 2BT4A 1HTBA 3DMFA 5CGZA 5K1ZA 2Q3FA 1GLGA 3OQMA 5DI3A 3H0DA 3L4KA 3IP5A 2C7OA 3R74A 4OYLA 2GN1A 3ON5A 2ID9A 4PLCA 4RY8A 5LZ9A 2XMDA 1EAYA 2WMDA 3BM5A 3RSFA 1KK3A 2E1OA 4IKOA 2D8MA 1O7JA 1TT5A 3BE4A 5I6DA 4PZCA 4LJ4A 1DWUA 4WVFA 5IHPA 1WX1A 3TM4A 1T2VA 1Q91A 1TIPA 4K87A 4W8HA 1FP4A 3MJDA 3AG4H 1DT3A 1FRZA 1PQYA 3S99A 5DXFA 1CQIB 1EDZA 2ZUSA 2DODA 2KT0A 1GCGA 4JUCA 2YMMA 2C8LA 5D3ZA 1RYNA 3OMLA 4IVQA 3FB4A 4OMZA 3EFOA 2HRQA 4IDGA 3AHCA 1PJSA 2FPXA 4JOCA 2WJ3A 4ZGGA 2XVMA 4GYYA 2BHTA 4AROA 1G3SA 1HYQA 4TV8F 3PC3A 1G8XA 4AJ9A 3NWPA 5TRTA 4Y9TA 2I3AA 3RK4A 2OZUA 3AFGA 3L0BA 1DBIA 3HDTA 4FJ2A 4IVNA 3VR5H 4H1TA 3M6IA 2HPHA 4TXNA 1RFGE 4GQAA 5GZ3A 5LFAA 1DPGA 1OWLA 2PUDA 5DPMA 4IIXA 1E0KA 3DOFA 4AXXA 5COQA 3RUFA 2FE3A 4INAA 5JC8A 3K9BA 5HJ7A 1IXYA 2FPOA 5IVHA 1M2JA 1MJFA 1EUYA 2UXBB 1DX6A 3KKEA 1UHMA 3WL7A 3PKZA 5FO5A 3Q7EA 2H00A 2OCPA 4LEIA 3AESB 4N4OB 2PBRA 3CEJA 1Z3YA 4IIYA 3ASUA 4OAPA 1BMTA 4JNCA 3SYNA 2HNBA 4BTLA 4CQMA 2P2CA 4ILKA 3NUQA 2HNKA 1BNCA 2QZ8A 4PJLA 3IVGA 5REQA 3SXUA 1ECBA 2FZKA 1W35A 4M88A 1KSGA 3PQCA 1S72I 2SNIE 1E9BA 3W8DA 3LTEA 1U8FO 3G7SA 4HAIA 3USCS 2QNIA 4HX2A 3KZCA 2RFLA 3BREA 5EPUA 4PLFA 5C1DA 2X6XA 1TTPB 5E7QA 3OPYI 2I3BA 1OV6A 2OR3A 2BE7A 1NQVA 2QM0A 8ABPA 1ABEA 2W0MA 3KEGA 2AF3C 2IDMA 1XWFA 3MERA 4BE7B 1TVKA 1B6RA 2JD0A 1VP9A 4OFZA 4UB8C 2JJMA 1R5HA 3S3OA 2JVJA 2BMJA 3A01A 1VOTA 3ZBQA 3JTMA 3T3MB 5JAHA 1ETXA 5CT4A 1FPMA 2MCFA 1U5AA 4PZPA 2DO7A 4EBBA 5A7FA 4JJ7A 1MEOA 1Q19A 2YWHA 2FK7A 4EHFA 2HIHA 4JX8A 2X5OA 4UMEA 1V5FA 2CY0A 1F4VA 2ZIXB 4KQKA 1SWVA 3CF6R 1BU8A 4YJ3F 4D4HA 3GFPA 1OC4A 4BHCA 2XA2A 3UOGA 4KRFA 3L7CA 4L6IA 3HJBA 2OCLA 1EA5A 4FHGA 1BQ3A 3OZWA 1PE0A 2C2KA 2Q4BA 1V54H 4ETIA 1QYIA 4UAGA 4PQEA 4L22A 1C1XA 1NHGA 4HNQA 2MABA 3C41J 2DWCA 1NVFA 2PV0A 4K28A 2H59A 3RDIA 3KQHA 3IIMA 1HLPA 1N9ZA 2BI8A 2WE7A 1B7GO 3K7EA 3OHSX 2HCFA 3GD5A 3UGQA 1DPRA 5AW4A 2Z3ZA 2RI1A 2CU7A 3CVJA 2WWIA 1WQ4A 3O8CA 2X6WA 3I5AA 3MTEA 1GFZA 1FLVA 2AYZA 1UZMA 2XIJA 2HHHB 5K4HA 3D0RA 3GF2A 1IB6A 1M74A 5K6RA 4PJJA 2QX9A 1UC5B 3HKZA 2WD7A 3W5CA 1EIZA 4MUKA 4O63O 1E3IA 2FOIA 2IHTA 1USVA 4XUEA 3OZAA 4J0GA 1T6SA 5KNCD 1KQOA 1RQPA 4GW3A 3FYCA 5FGMA 4Q39A 4FWTA 1ZZEA 4FKMA 1B1CA 1DJOA 4MPRA 1TKCA 1X38A 2GXAA 4BO1A 3M7IA 5CEEA 2IYFA 4HEA1 4WDRA 4BFUA 3HU1A 3C5WP 3PP8A 4KYVA 2VPZA 1N5RA 1NQAO 3OFKA 2NVQJ 4YAWA 2JAUA 3BB1A 5HE8A 3V1LA 4ZCQA 4B6SA 4E32A 3X1YA 4LFUA 3OLWA 1GRNA 3WAGA 2J3EA 3ETNA 3K9QO 4ESVA 4RJLA 1DKRA 4AVYA 1C8BA 2DPLA 3KRTA 1HYGA 4YRJA 2IEDA 4QQ8A 4R3NA 3ZQKA 1QPMA 3FBNB 3FMFA 2I7DA 4EI8A 4ZDWA 1UPXA 3DCIA 3H6GA 3M8EA 4O1HA 4QUGA 4NDLA 2L7FP 1QRSA 1SVNA 5H68A 1ZM9A 1VQ4I 3PNSA 2XODA 4MARA 1XLTC 2IXBA 3KT8A 3SJMA 4WZAE 4XX1A 3MS2A 4UVBA 3KTAB 3IAS2 4HQOA 4PHTA 4H16A 2O3FA 3IPRA 3WTTC 3CCLI 2I1QA 2A9JA 3I34X 2LNDA 1FYDA 3QELA 3A06A 1XDBA 3EC7A 4A5MA 1S2IA 2BEUA 3KK0A 4PF1A 2YMLA 4LOAA 3UXYA 2H65A 1ZDMA 3RYPA 3MINA 1B0AA 3RAGA 1W19A 5HVQC 2JIRA 3IH4A 1J49A 2C07A 4QBIA 3L9WA 2I80A 2OY0A 2GYWA 5BY2A 4GRDA 1CUVA 2QQ8A 1UFVA 4S1VA 5C3EJ 2QMUA 3GJSA 5F4BA 5CHYA 5D4RA 4PO1A 4OIFA 5D5WB 2QL5A 4IFBA 3PBKA 5JYBA 4ZU3A 3QG5A 2UYOA 1RHRA 3LFUA 5IDWA 3EPHA 4XCXA 1GA1A 1GA6A 4XM3A 1E1DA 1E9FA 2VQCA 3B6KA 4PPGA 2OHHA 3BD6A 4UUBA 3E8MA 2EV9A 4JROA 3ZQCA 2HDCA 3OEYA 1T5LA 3AF2A 1U0OC 1VSQA 1T4GA 1YBHA 5BNIA 3Q3HA 3B5JA 3WLHA 5COBA 4RJKA 3RT7A 3HJUA 3H3FA 2GAJA 3JWIA 4LSGA 4ZO8A 1P0FA 4ZGWA 2OV3A 4TL6A 1N8NA 1WO8A 4RB3C 1SN7A 2TRSB 4FZJA 5A7GA 1HDXA 1GZSA 2W6QA 4G09A 2B6NA 3KVVA 3ZGNA 5K8TA 3IR6A 1X8KA 3KSBC 3NGLA 4BCDA 3HRKA 2OUIA 5AUNB 3WTZA 3PDIB 4HDMB 2O2GA 1VQOI 3CF2A 1Z8DA 2RH4A 1P4AA 3F8CA 5ALGA 2I5PO 3SQMA 5IMSA 3GTLJ 3AI3A 2DH5A 1KZ7B 4ARAA 3E8SA 4Y3UA 3ZJ4A 2XKAA 4E2XA 4KMFA 3AOEC 2GAFA 5FNVF 1SUDA 2C4TA 2WC2A 4KI7A 1NN1A 3O3NB 1RVDA 4WGFA 2ZMEB 1P1HA 1FNBA 1M54A 3HXOA 1WVGA 3GTOJ 1EFHA 1BI0A 4WXRA 3W77A 3DAOA 2BMEA 1POGA 4YQYA 2QLTA 1OPXA 2VJCA 1SAXA 5J4LA 4TSFD 3LOCA 3UV3A 2H85A 1N2IA 3KKPA 3G1UA 2O07A 1WLSA 3G2NA 5TPZA 2I7TA 1EWRA 4CEIB 1Q1NA 3VU0A 1NNSA 3T61A 4TUYA 4WIAA 3FXKA 3PQ4A 1P72A 2A92A 5CEFA 1AQUA 3U3KA 1JR3E 2NS7A 1XZDA 3FIWA 1T8WA 3AF0A 3CCQI 1U0EA 4INOA 1XMPA 1T98A 2GN8A 6NULA 1TIBA 1YZTA 1NQXA 3FFTA 3KWFA 1SXJC 3D4PA 3RZDJ 2XE4A 4YELA 2BE5F 1AB5A 3RKRA 4IXTA 1E6LA 1VSVA 3JALB 4RAGA 4MA0A 2X8AA 2CS3A 3IERA 2BHSA 3OWTA 4D5FA 1HEIA 3QYFA 1W5SA 1UP7A 4GPTA 1K9VF 1Q74A 1WMBA 4BWYA 2B7CA 4Q4HB 4V0ME 2EQRA 3KELA 1V3VA 3CF5F 2BZSA 3C3AA 4EECA 3T94A 4Q6WA 1BIAA 4MI3A 1JB1A 4ZPXA 2QAGB 4DCMA 3CIOA 2BJHA 3HNRA 1V3UA 3CO0S 4L8LA 3AEYA 4IPAA 4LN1A 2X0JA 1VA5A 5C4IA 1IONA 3BXXA 3ZGKA 3LNCA 2F4VB 3AVVA 4DMMA 2L54A 4JEIA 1QAMA 1UDCA 1EH8A 1RLTA 2O5VA 1C80A 1A9SA 4DKJA 5HRUA 4MPTA 1FNCA 2KFDA 3MPOA 2R8PA 2P1DA 2B1QA 1W25A 1RZ4A 5DLQC 1TI7A 1WXDA 1J9ZA 2IYQA 1W4BA 1STOA 4XM1A 5GONA 2VBIA 1RCTE 3V6LA 1L1RA 2QUZA 1PNQA 4AZ0B 2HZ7A 4E09A 5G3YA 4HLUC 2ZB4A 4TVOA 1R5JA 1T43A 4JLWA 4RZUA 2WA0A 3OPNA 3ND9A 3I4CA 4FT8A 1NULA 1YZNA 2C7QA 3RRMA 3RQSA 3HE3A 2QM3A 5DTDA 4D46A 5BR8B 3WA7A 5JARA 2RGGA 5GAJA 3UWKA 4HLNA 1TFRA 3N76A 4YIFA 2O9JA 4D9BA 1FU8A 3HJFA 1C9NA 2K4MA 3WGGA 4IS3A 5JCXA 2RARA 2GERA 2DU8A 3U81A 3KZZA 4Q5IA 4RENA 4BECA 2WUEA 1SKQA 2E87A 3W8EA 4NS4A 3D3KA 4O5AA 5DS9A 4DXHA 4J1NA 3Q2KA 3K8QA 3I58A 1T3HA 4I9FA 1LPSA 1OYYA 4OP1A 3ZMDA 1XRPA 1ITZA 2WNHA 3MJFA 2M98A 1JKMA 3BJA