3HCAA

Crystal structure of e185q hpnmt in complex with octopamine and adohcy
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLQAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Molecular recognition of physiological substrate noradrenaline by the adrenaline-synthesizing enzyme PNMT and factors influencing its methyltransferase activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hcaA00
1JG2A 1QAOA 3NDIA 4KDRA 4OQDA 5E1DA 3K0BA 5FQNA 4FR0A 3NWBA 3MTIA 2GH1A 4LECA 4GC5A 2I6GA 4RX1A 3HA7A 4EK9A 1XVAA 2NYUA 3LDGA 3UJ7A 1AQIA 1D2HA 3FPGA 3HCBA 3CGGA 3GDHA 1O54A 2PJDA 2Z6QA 4P58A 1O9GA 3P2KA 1L3BA 3HVHA 4KRGA 4Z2YA 2PX4A 3HA5A 3HCDA 2IPXA 5DXJA 1G38A 1P39A 1ZKDA 3FPFA 3GNLA 3GU3A 2B9EA 1NW5A 3P9CA 1KIAA 2QRVB 4OBXA 3DH0A 2H11A 3IV6A 5DWQA 3UA3A 3IYLW 3QOXA 4M36A 3LCCA 4KIGA 3DP7A 3UJBA 4U7PB 3JWJA 4YV2A 2AZTA 4X1OA 5DLYA 4KIFA 3HCFA 4OA8A 3DR5A 3EVCA 1UWVA 3PVCA 4GOMD 5D1NA 1RI3A 3ORHA 3MTEA 3HEMA 2Z6UA 4IV8A 1JQEA 2C7QA 5EIWA 5ICCA 5DRTA 3UJ9A 1RJEA 3B5IA 2ZZKA 3OE5A 3QV2A 3LPMA 4EKGA 3OZRA 1WS6A 3BKWA 5T64A 2VDWA 3DTNA 1XDZA 2PKWA 2AOUA 1ZG3A 3D2LA 5IKMA 4FGZA 2PXCA 3KPVA 3EGIA 4M38A 5EIFA 2ZBQA 3TLJA 3MB5A 1EJ6A 3KPUA 4PYNA 2NXJA 2O06A 5HIKA 3TRKA 5KQRA 3GRUA 2NXNA 1KR5A 1NBHA 2CL5A 1R8YA 2CWWA 4BLUA 1KXZA 2P41A 3LCUA 4YUWA 1BHJA 3BGVA 3C0KA 5CVEA 2AN3A 4X60A 1SG9A 2IGTA 2P3QA 3P71T 2AVDA 2ZIFA 2UZ4A 3Q7EA 1JTEA 1KP9A 1FJXA 5GM1A 4G56A 2BM9A 2EG5A 4ISCA 4M7RA 3FTEA 3R9XB 2UYQA 4GF5A 5CCBA 4UOEA 5DSTA 1JQ3A 3DXZA 4LWPA 1N7JA 4RYLA 1SKMA 3KPWA 5DTRA 1IM8A 5EMLA 3EGEA 5F2KA 4YMHA 2OZVA 5IH3A 3KR0A 2PGXA 4FS8A 3AJDA 4V0QA 1X1DA 3SX0A 4HH4A 1RJGA 3WSTA 4CXMA 3NMUF 3CBGA 4GOOD 2YVLA 2FYTA 2QRVA 3M6VA 5EPEA 1DL5A 2PY6A 3LECA 4JXJA 1JSZA 3KQPA 4HG2A 5K05A 5EZQA 5DX0A 9MHTA 3MQ2A 1VP9A 2E5WA 3MERA 3P2IA 5EC8A 3DUWA 3OU2A 5FA8A 4H0NA 4HGZA 4O29A 2P7HA 3R0QA 1JG4A 2Y1WA 1YZHA 2ZTHA 3JWHA 3V97A 4E2XA 5E8RA 5K0BA 2ZZMA 5KYGA 2AR0A 4KVZA 4HRAA 3GXOA 4BP3A 3G2PA 3KQOA 2O07A 3LGAA 4KWCA 3H2BA 1B42A 2EFJA 3JWIA 4PYIA 2JHAA 3C6KA 3M6WA 4MHTA 2NP6A 2P3LA 3FYDA 3EMDA 5CVJA 4CKEA 2P8JA 5HIJA 5LSAA 2ZFUA 5KQSA 5DM1A 5CM2Z 5MHTA 4PGGA 3T0IA 2JHPA 2OY0A 2ZIEA 3OZTA 4Y30A 3RW9A 3FTFA 3M4XA 3FUVA 4IV0A 4WXHA 1M0EA 2ZLBA 3EMBA 3UFBA 3M6XA 3B3FA 2OB2A 5DTMA 1KPGA 4F85A 4U7TB 1XDSA 1EQAA 5CVVA 2QY6A 2P3OA 2FPOA 2CMHA 1ZQ9A 2FK8A 3KR9A 1F3LA 3L8DA 2OXTA 1NT2A 1IY9A 5GINE 1OR8A 3T7RA 1I9GA 2AN5A 2B78A 3LDFA 3SMQA 4POOA 2NNWB 3EVDA 1BKYA 4YUZA 2YXLA 3OPNA 3KQTA 3NVMB 5EEGA 2XBMA 1XTPA 3S68A 2YXEA 3R6TA 5FCDA 2IIPA 4XUEA 1R18A 2B25A 2YR0A 3UJ6A 1N2XA 1R00A 4E31A 3KQQA 5ERGB 2IDKA 2OBFA 2QYOA 1XCLA 1P1BA 1WXWA 1X19A 3O7WA 5C0OE 1RI2A 3P2EA 4X41A 1FP2A 2JH8A 1KHHA 3FPEA 2FK7A 4QDJA 5FQOA 4CKCA 4C06A 2A14A 2XYVA 2IH2A 2B3TA 4QVKA 3FUTA 2C7OA 3FRIA 4RVGA 3X0DA 4AZVA 5EMKA 3GRYA 4RTNA 3ELUA 3DXYA 3MGGA 2OYRA 4E2WA 3G88A 3OU6A 2GPYA 3EVFA 5E1BA 4AZTA 3M70A 4EMSA 5HFJA 3Q87B 3TKAA 2I62A 4GQBA 5F2OA 4V0RA 1EJ0A 2VDUE 3HCAA 1I4WA 2IFTA 4FP9A 4DCGA 4C07A 5E2BA 2OO3A 1G8SA 3GJYA 3G89A 2XVMA 4MTLA 3ER9A 5FHQA 4X63A 1DCTA 2Q41A 5T67A 1L1EA 1YZ3A 5DT2A 1DUSA 2JG3A 4PYMA 1JTFA 4YUYA 3MHTA 3HCEA 4QDKA 3EVGA 3E23A 1VPTA 4XCXA 5E1OA 4RVFA 4GOLD 3UJCA 4EQZA 3FTDA 4ER0A 1PRYA 3FZGA 3CKKA 4HTFB 3EVZA 5CVDA 2GB4A 2P1DA 1ZGJA 5U4XA 3SVZA 4C08A 5FTWA 1Q0TA 3HVJA 4YMGA 4DKJA 3PX3A 5DM2A 3UJ8A 1SUIA 3T7TA 4CKBA 2V74B 2WA1A 1X1AA 3G2OA 1RI1A 4AZSA 2PLWA 4RVDA 3O31A 1NW7A 3AXTA 2H1RA 5T6BA 5DM0A 3PTAA 2PVCA 3GRVA 4BP1A 5BP7A 3UJDA 2PWYA 5KVAA 3HVKA 5M5BA 3BGIA 4OBWA 3FTCA 3PX2A 3UBTA 3OCJA 3ERCA 1KPHA 1FPQA 4QQNA 4OX9Y 3GRRA 3TPZA 4CTKA 1G8AA 4Y2HA 3SSMA 1VBFA 3A27A 4RSRA 1XXLA 5LQNA 3TMAA 1VE3A 1VIDA 3A4TA 2VS1A 4EVIA 2P7IA 1QAMA 3MAGA 4EKIA 3I64A 1YB2A 3BXOA 4R6XA 2YX1A 3UWPA 2EX4A 3BWCA 4MIKA 5FHRA 4C04A 4RTKA 4HC4A 4ATNA 4E2YA 1UFKA 1HMYA 2PSSA 2WK1A 10MHA 3ELYA 1X1BA 1EAMA 1IXKA 2LD4A 3G5LA 3G8BA 1KYWA 3A26A 4RWZA 2QE6A 4FZVA 3REOA 3RODA 3V8VA 2ONYA 5FWDA 2PXAA 3PT9A 2AN4A 2BZGA 4GUAA 4PYOA 4E70A 5E8JA 3FUXA 1PJZA 3LBYA 4PONA 5LR6A 2UYOA 2N47A 1EIZA 1VL5A 5G02A 1R74A 2ZULA 5D1HA 1JG3A 2XYQA 3MCZA 4ZTBA 4GBED 2WA2A 3BGDA 4MWZA 1SUSA 2I7CA 1M6EX 5K01A 5K0GA 7MHTA 1XDUA 1QAQA 5ICEA 3KU1A 4L7VA 3IEIA 3TM4A 2PT9A 4LWOA 4PYLA 2PBFA 3HP7A 2AVNA 1F38A 2GA9A 3E7PA 3I58A 2G70A 4HTFA 5GIPE 3VC2A 1MJFA 3ELDA 5FADA 3BT7A 1RI5A 3LX6A 2ONZA 3C3PA 3FYCA 4YV1A 2ERCA 3TM5A 3VYWA 3QOWA 5BXYA 3ER8A 3RIEA 3I5UA 2PX8A 4BLVA 3NDJA 1WZNA 1YUBA 1L3CA 3KQSA 2C7PA 3E05A 2PX5A 3GWZA 4QPPA 5GOZA 1JR4A 3R3HA 1H1DA 5GP1A 3TQSA 4A6EA 1HNNA 3P97A 1NW3A 3A7DA 1G60A 1YFLA 3T7SA 2OKCA 3BKXA 4CWAA 4E32A 2YUIA 5EOVA 4KDCA 4ER5A 5JUWA 5LQKA 1XJ5A 1U2ZA 3BWBA 3SGLA 3SXJA 4KW7A 3HA3A 4OA5A 4WVLA 4XUCA 3LSTA 5ICFA 2BR4A 4R05A 4PCAA 3ELWA 2IP2A 4YUVA 5GIOE 1YFJA 2PT6A 1AF7A 4QTTB 2IBSA 4PNEA 2CKDA 3LKZA 3ME5A 5DRYA 2FRXA 5EGSA 1L9KA 3ANXA 4P7FA 4BLWA 4A6DA 4YV0A 5HEKA 5K0CA 4R8RA 2C7RA 4K6MA 5EHGA 2AOUB 5E1MA 1UIRA 5F2NA 2NXCA 1SVUA 2F8LA 3HCCA 1INLA 2CMGA 4C05A 5BW4A 5K8VA 2O05A 3OU7A 1L3IA 1RJFA 1SQGA 1FBNA 1KPIA 2VP3A 5FA5A 4DMGA 3KR2A 2AS0A 3EPPA 1AV6A 2G72A 2YXDA 4PIMA 4B17A 2IDJA 4RV9A 1X1CA 2AOVA 1V39A 2AOWA 2HNKA 2ZWVA 3DOUA 5DTQA 3CJTA 2O0LA 2YQZA 3UZUA 5JR3A 2V7EA 1Z3CA 3BUSA 4ER3A 5HZMA 3AWIA 2IH5A 1P91A 4FT2A 4PCLA 1BC5A 2PX2A 3FPJA 3BWMA 4PWYA 2Y1XA 4ER7A 3GRZA 5LQCA 2BR5A 3HNRA 4PINA 2ZWAA 5E9QA 2BM8A 3I53A 4F84A 3KQYA 4RTSA 5EMMA 1I1NA 4QTUB 4FSDA 5K09A 3EVEA 1TPYA 1MHTA 1P1CA 2VDVE 5LQJA 3DMHA 1T43A 2ZVJA 3A7EA 3CC8A 3KQVA 5K0NA 4DA4A 4P7JA 5HIMA 5HOQA 5LQUA 4QQKA 4DZRA 3C3YA 1R8XA 2ORED 3KQMA 3HVIA 2PXXA 3HM2A 3LKDA 5H02A 3DMFA 1QANA 3PFHA 5DPMA 3PFGA 3R24A 2OPBA 2HWKA 3KQWA 3SR4A 5DM4A 2PWPA 5EVJA 2JH9A 4PGHA 2O57A 4DF3A 5CUQA 4PYJA 3EGVA 3EEYA 3G8AA 4PYQA 5EKUA 5E9WA 4BY9E 4RTJA 8MHTA 4AX8A 3F4KA 2FHPA 2ADMA 5GWXA 1TW3A 2ZBPA 4PYKA 3PB3A 2GLUA 5DSXA 3TOSA 3B7PA 2ZIGA 2UYCA 2HR1A 1NW6A 3A25A 2H00A 3M33A 3P9KA 3GGDA 2IH4A 2AOTB 1NV9A 5E9JA 3CJQA 5EG5A 4E33A 4LG1A 3B3JA 3KHKA 4DM3A 3CVOA 1JG1A 2G8NA 3THSA 3GIWA 4CTJA 3P8ZA 4R8SA 4GEKA 3E8SA 5FWAA 2VZ9A 2AOXA 2DPMA 2G71A 4IKPA 4IWNA 1WY7A 2KW5A 3VSEA 2P40A 3K6RA 3LBFA 3P9NA 2IBTA 3FUWA 2GS9A 3FRHA 2OB1A 5EEHA 5ICGA 1ORIA 1M6YA 3NWEA 3SSNA 4RVHA 5C9ZA 2QM3A 4OQEA 4HGYA 3G7UA 4P7KA 4P7GA 1JSXA 2R3SA 1EG2A 1XCJA 3OFKA 5DX1A 4E2ZA 1D2GA 3LDUA 2I9KA 4F86A 3M6UA 1VQ1A 3NJRA 3DLCA 5GM2A 5BW5A 1RI4A 5FUBA 2XVAA 3PS9A 3C6MA 5EKXA 5EQJB 1TW2A 5KS2A 2ZSUA 5CVUA 5HIIA 3O4FA 2BR3A 5EHIA 3BWYA 3NTVA 4C03A 2FCAA 3I9FA 5C1IA 5K0FA 1ORHA 4RTMA 4PIPA 3OFJA 5CD1A 2ZCJA 4DQ0A 2ZBRA 1G6Q1 3EEOA 4XUDA 4X61A 2EJUA 4RTLA 4RTOA 4AUKA 1N7IA 2GAFA 4E30A 5K0EA 4RTPA 1O9HA 2ZW9A 1Y8CA 2ZZNA 5LQAA 4DCMA 1SQFA 3GCZA 3OZSA 1VP3A 5EMJA 2BH2A 3SM3A 2NXEA 2JHCA 1NBIA 3G5TA 3P9IA 3OE4A 5CCXA 3BZBA 3IHTA 4HSGA 2K4MA 4MQ4A 3JWGA 4ER6A 5K03A 1BOOA 2HMYB 3KPJA 2B2CA 3AY0A 4M37A 3ID6C 1NE2A 4RTQA 1QYRA 2AOTA 3CCFA 3DMGA 2NP7A 2R6ZA 5B1SA 1YF3A 4AZWA 2JJQA 3B89A 5DXAA 3UJAA 3NW9A 1D2CA 1WXXA 4YUXA 2EJTA 3PLAE 1NW8A 1ZGAA 1RJDA 2P35A 5HILA 2YTZA 4NECA 5CIYA 3LCVB 3DULA 3FPHA 5P8WA 4RTRA 2HTEA 1NV8A 3GO4A 3FUUA 5LQRA 2DULA 3KPYA 3G2MA 3LL7A 3TR6A 3TFWA 4FT4A 2ESRA 3HTXA 1G55A 2HV9A 5EZSA 3SSOA 2XYRA 3DLIA 3EVBA 5E2AA 3KR1A 3B3GA 3CJRA 3U81A 3MCTA 1Q0SA 2PV0A 4QVGA 3UA4A 3G2QA 3DXXA 4R6WA 1FP1D 1R6AA 1ZHFA 1WG8A 3TKYA 5K0JA 1QZZA 2UYHA 4QPNA 3KKZA 4FSXA 5FULA 1AQJA 3AXSA 2Z6AA 3LHDA 1VLMA 4GC9A 1KYZA 5K0LA 2G1PA 3NVKI 4GOND 1JQDA 1NKVA 3EVAA 5DX8A 3VC1A 3THRA 4C4AA
chains in the Genus database with same CATH superfamily
1E5LA 1QAOA 1QH1B 2G4VA 3FM9A 4D0GA 1H0SA 3IH5A 4FR0A 4ODIA 2FFQA 5AK4A 1NRWA 4NMMA 5FAXA 3RYFA 1YE5A 2V6JA 3ZY4A 3TSAA 4CHTA 5EP1A 1D2HA 3BEOA 3LC1O 5E6SA 1N0UA 2PJDA 3HJAA 3NH9A 4NVRA 3V6MA 4ZJPA 2CFCA 4DCPA 1XQ6A 1QC5B 1Z83A 2J9GA 1RM5A 2VP9A 3VSDA 3G6KA 5B12A 1EQ2A 5AVOA 5JH7F 2YWRA 1O6CA 3FTNA 2H11A 3QENA 5DWQA 1J5PA 1FDOA 2XMPA 5DZSA 2ZREA 4XASA 3FPCA 3KQUA 2WZQA 2WWTA 4DA9A 4MWTA 2XA1A 1NJ2A 2Z04A 3WLPA 2KYRA 2Q6LA 3K6SA 4OGWA 2XDQA 1O5IA 4UVIA 5KWEA 1VMDA 3FNRA 1IXZA 2WTBA 3BJZA 1RBQA 5EXDA 4C5CA 4ZN6A 1U6JA 2F9LA 4GPIB 1KGSA 1VJ1A 5ER6A 3UJ9A 4DAOA 1I2ZA 2ZZKA 4HLUA 4JT4A 3LPMA 3EEFA 5CA0F 1Y1TA 2VJBA 3O0TA 1E2LA 3TE7A 3DBIA 3DL2A 1VG1A 1W19A 2JIBA 4G86A 4X8LA 2DCMA 3D2LA 3EVTA 1HYQA 1NUPA 3N2GB 2Y92A 3OJCA 3PEUA 4M38A 1DOHA 2Q8PA 2C4UA 4NV0A 3JD1A 3WLSA 3ZBPA 4F1KA 4HDSB 4Y2GA 5KNDH 1IRXA 1S2OA 2PLRA 4K9LA 1AMOA 5LZ8A 1U3WA 5FEUA 3B12A 2GI4A 5LOVF 2H63A 4WVFA 4WY2A 1OTYA 2OBXA 3HBNA 1E0KA 5TMBA 4CL3A 3LCUA 2QN6A 1PHPA 4G0WA 2IXAA 2HMSA 3QU4A 5B3JC 5HS4A 1PS8A 2BP7A 4PC6A 4D0RA 2JASA 3DC2A 3PVSA 1UPUA 5CX1A 4MS3B 5HUHA 3DG9A 2AQKA 1P4HA 3ESQA 2QTMA 4MRAA 4OHKA 1XTVA 2CDAA 2XMBA 4G56A 2BM9A 2R86A 2O50A 2ZTVA 4EX6A 4FM9A 3UK6A 5DK4A 1PSWA 3T4EA 1SKMA 1GSHA 2B82A 4LX0A 5DTRA 4JYPA 1IJBA 4M0UA 3RRFA 1IBKB 1OVMA 3F5MA 2P1RA 2FOIA 3G2JA 3NM4A 4FS8A 1X1DA 2YWBA 2BRUC 1FSZA 3DE1X 2GPWA 4BKPA 4D57A 2GD6A 3IODA 2Z2IA 2QJWA 4LZPA 2D7DA 1X7ZB 2QE7A 2IS2A 3L8ZA 4JXJA 3G1TA 2AA3A 2XPCA 4DUZB 2Q3FA 3VO2A 4EG4A 3G1WA 2PWBA 3P2IA 4OSOA 3W8NA 4QUAA 2VP4A 5FL7D 3G9UA 3WHIA 3ZWBA 1IM2A 1WVGA 1NVEA 2YCBA 1SG0A 5E8RA 1D7OA 5YASA 5HHTA 3FPLA 4DBVO 1L4BA 4B4VA 1F8XA 5T3UA 3KQOA 4P4LA 4R2KA 3DEFA 4EFMA 4WCFA 1P72A 5FUVA 4DXHA 3A6ZA 2EFJA 3DFIA 4GG1A 4MR9B 1V11A 1E6KA 4R54A 1M1YA 5LJIA 3FYDA 1LZLA 2C57A 1GZ4A 2D3WA 1ZONA 4OFBA 3GZ4A 1KU0A 2QN7A 3LT4A 3BMCB 5DHRA 2X3YA 2DFTA 5DLPA 3W90A 3U17A 3ZK8A 4PGGA 1JAXA 2CXHA 2VCEA 1GPAA 4EY4A 5DFAA 1P6QA 4C2BA 4DA7A 4MGYR 4DLKA 2I4LA 3R20A 3L7DA 3V8NA 4AQYB 1UBTS 5G0SA 2EGGA 3RFFA 4RF4A 3GPBA 5IXJA 5CVVA 1RJ9B 2UVPB 4ZZ0A 5JECA 1ZQ9A 1OXBB 3SHQA 4QO8A 3R7BA 3WRVA 3W2FA 3E3NA 4OHYA 2XB9A 4AAYA 1NYLA 2NNWB 4OMFG 4CKBB 3A1FA 2F9MA 5BN3A 5BVHA 5AK5A 5KSPA 2KI5A 1TRKA 4QOFA 3NVMB 4PG7A 3UM9A 4NYJQ 3H75A 4BZPA 4IQGA 5IT9A 1PFGA 2YXPX 4RMGA 4Q4HB 4MRVA 1KK2A 1C0PA 1M8PA 4XW2A 2J3KA 3BMNA 4FYYA 2XSZD 2YN4A 1RCUA 2OBFA 4H1HA 4CQMD 1WB4A 1GA1A 2PZBA 4WZAB 4C2AA 4UOZA 5CLJA 2QN3A 2CK3A 3ZOKA 2POCA 1MRZA 2GT1A 2TMYA 4GZ5A 4IKOA 3AB8A 1P3DA 2Y76A 3B38A 3UXYA 3HS3A 4D4JA 2H2GA 4J6FA 4B8WA 3WTBA 1XAGA 1MVNA 1CW2B 3HUEA 4HKTA 2Z5LA 4FS3A 2B8WA 4TYMA 1VHJA 4OUKX 1PNQA 1GFSA 5I9TA 1KDTA 2B1GA 2HY7A 3KQHA 3FDJA 4WECA 3CINA 4WLEA 3A10A 1RYEA 2PZGA 1FFEA 3QF4B 4CODB 4TVOA 1CNFA 4IIUA 3ZWWA 3BSWA 4D9EA 1RTTA 4HAZA 1M66A 1RAFA 1J23A 1GFZA 1YCFA 3LVFO 3TLGB 1F0KA 2H7VA 3D1VA 2W2TA 1Y0BA 3PGVA 5JCOC 3ESBA 1GQ2A 1WMEA 1ZVJA 1E3QA 2Z9DA 1JLMA 2ACEA 3WIEA 4LMPA 4YT5A 2AKEA 1GO2A 2GDJA 3IELA 5BSVA 4NX2A 5LMZA 4GD3Q 4JU8A 1QO0A 1TCAA 4CF6A 2I1WA 5AWFC 3EGDB 1PGOA 3QM1A 3NHBA 4RADA 4CL8A 1E5XA 1PGPA 2QI9F 3KP1A 2CXPA 1EZ4A 2QP4A 4QX6A 3RANA 2XUJA 1Y4SA 2BKLA 4LJ8A 1FFSA 1T1GA 4RF5A 5K3FA 3DCJA 2EVWX 4XR9A 3OJ0A 3DHWC 4PLPA 4LNUB 4OF4A 5FPKA 4EB8A 4RVDA 5CHYA 5ES3A 4AS2A 4B48A 2MSLA 3WGOA 2G6BA 4EGJA 1ADFA 2QD5A 2Z9BA 3EXIA 3N2IA 4FLFA 3UJDA 3S7TA 4QICA 4YRKA 4CKXA 4TV8A 3RYIA 4TKZA 1NURA 1QORA 2ETXA 1MA3A 1L5KA 2BCJQ 1XHEA 3GT7A 3GUCA 3PXUA 4P3OA 4OMUA 3BTOA 3O2SB 3VBEA 1BE8A 2ISSD 2X4GA 3KNZA 4F8EA 4HXGA 1Z6QA 4YDRA 3DZGA 1LV7A 1OPRA 1PFQA 1UFQA 2NX2A 3E84A 3GBSA 3KD3A 3QGMA 4HATA 2C5SA 2DT8A 2P7IA 3U1VA 5IUJC 3JQCA 4LRQA 3EH2A 1GQSA 3UPUA 1T34A 4HC4A 4OLHA 1XJ0A 4UXIA 2WIDA 1ISFA 3TBHA 4B3GA 4EELA 1MXHA 5BUZA 1KZHA 1OA0A 5FR1A 4M60A 2IX3A 1EAMA 1VKRA 2RK3A 1V16A 3V8VA 3ZNQA 3EDMA 2JFFA 3MT0A 1K92A 3OWXA 4UBJA 3VTKA 3VPSA 1U04A 4I3FA 4GUDA 4M1WA 1V8DA 4FFBB 1ST2A 2C9DA 2UYOA 3ONEA 1K98A 1L5FA 1NWHA 1U1EA 1XWWA 2PR7A 2PSJA 2VNAA 3ZXXA 5JSQA 1U2QA 1ZN7A 4XARA 4QAQA 4OHUA 1R8JA 3O91A 1UJ6A 1E1YA 4RZ2A 3UKDA 4B09A 2XAAA 3AL2A 2G88A 3PJEA 3ZBTA 4JCOA 4BKUA 1RXVA 1DRJA 3U48A 2ZJ2A 4EUKA 3TM4A 1CG6A 3I4LA 3PGXA 4KKXB 1XNRB 1VG0B 2EL7A 3PFBA 3QELB 2D1SA 2IEZA 3Q0IA 1F20A 2TECE 4P0TA 3ZUGA 3CSSA 1ODFA 2Y6VA 3VJMA 4IOKA 1YHYA 1F6BA 2D4AA 1ZJZA 1XDBA 4QPJC 4MITA 4L2IB 3KEOA 3ZCRA 1XRLA 3NI2A 5DLDA 1T8UA 1YRYE 1TE2A 2C88A 1QGYA 2X2FA 3RIXA 3WGJA 4OL0A 2QLNA 4CF7A 5JISA 1C3OB 1ZWKA 221PA 2EC5A 3FNGA 4BLVA 2X2EA 3GLTA 1JZQA 1CUYA 2JK1A 5K20A 2Q5FA 4WOJA 1E61A 4EIWA 3TXYA 3MAJA 2GEUA 1JR4A 1RD4A 4G0ZA 2ZJ0A 1EP1B 1ESEA 1U65A 2AFIE 5GP1A 4AC9A 1ZNQO 4GRDA 1M2FA 3F7OA 1FXWF 5A7HA 3AF4A 3DOCA 3JQ9A 3NYRA 1XWIA 2XZOA 1U0GA 3P2OA 1CQIB 2QMEA 4IXNA 2AHRA 3V42A 1GV0A 2NO0A 4QTXA 2QMUA 4Z9AA 1QTIA 5ILOA 2WQ6A 4KW7A 2A9RA 5TNXA 2MMCA 3LSTA 3Q3EA 3SZGA 3ZHRA 2OILA 3K71B 1QUFA 1JIVA 2ERYA 2QZZA 4X0EA 1UP6A 2EFHB 1Q7TA 3AL0C 1Y80A 1DC3A 2J9YB 2WPDA 4QTTB 3VNUA 1E2QA 2Q3LA 3QKRB 4K2AA 2ZUSA 3GZTB 3UMMA 1OAOA 3K7EA 3L9WA 3OIUA 1G2OA 3QA9A 1FCJA 5DLQC 1OILA 6YASA 2DF8A 2PUWA 3DB1A 4J2OA 4EJMA 2O2GA 3QOYA 3UIEA 3H7AA 1CR4A 2VJYA 1ZSVA 2W0MA 3UOWA 3B51X 1BDIA 1QE3A 3NWJA 2CMGA 3OU7A 3VVLA 2B92A 3KOOA 2J4CA 4HAYA 3VOSA 3KR2A 3W6UA 3OG9A 4N8SA 4B6OA 1KP2A 4H27A 4MUFA 2E2WA 4JQCA 2EKLA 1UBNA 1J90A 4G0PA 1H8EA 3CJTA 3OPYA 4NZMA 3F7TA 3WB0A 3QEBZ 1Z3CA 3SJZA 1DJOA 4EHHA 1P91A 2D2EA 4CFZA 3VRHA 4I8XA 4L78A 1HYGA 1O97D 5LQCA 1CNMA 1TJNA 1ZJWA 2DFPA 1M8KA 3QYPA 3ICPA 2K7FA 4TV9B 4EG3A 1H5NA 1X38A 2GGSA 3PC2A 1A7KA 4JYCA 5FLXA 3PRYA 4YASA 4ALIA 4HGQA 4L5IA 4LOLA 4O4IF 4JP5A 2HMTA 4P7JA 5KYUA 3ZHCA 4DZRA 2E87A 6LDHA 5DHFA 4B74A 4GH5A 1CUCA 1SCNE 3RVDA 2V5AA 3VR3A 4DE5A 3R24A 3UK7A 3KXIA 4RANA 3PGA1 5GM1A 4UM8B 1DKPA 1Q1GA 3KQWA 3SR4A 4J90A 4PPNA 5EVJA 4PGHA 1G1AA 2JGIA 3D8BA 4DF3A 1NI4B 3ZKAA 1MABA 1ZU5A 2C58A 4TTAA 5AW6A 1XRSB 3GD5A 2DFDA 4RMNA 2A3RA 1T1JA 2OESA 3OUZA 3LWNA 3SQDA 4B3XA 4DQVA 4Q7QA 4LV5B 4KXFB 2W6OA 4GPD1 5IU6A 1QHXA 1T5IA 2I2FA 2YMLA 3DZIA 3WBKA 2WUWE 3DE2X 3WYFA 2H00A 3DVAA 1U11A 3EGWA 3N2KB 2OBBA 3E35A 4DIFA 1WULS 1WABA 3Q88A 1LPSA 3WLJA 5KYWB 4YQZA 4HVLA 2G17A 2RAUA 2XJ4A 2NSJA 4LE2A 2Q3MA 3VX3A 2DPMA 4IWNA 4UNSA 2KW5A 1T4DA 5IFLA 1CUBA 1N36B 4RZQA 3RD5A 4AG5A 3BIOA 2ZATA 4JT2A 3AKYA 4BO6A 4CG3A 1TYBE 3GFQA 1T10A 4IDQA 1IQUA 1YVUA 4D41A 5HGXA 5KJ1A 1U0BB 2QTRA 3K16A 2YHIB 3GJ8A 4CMIA 4JNCA 1A2KC 2C0PA 3D3WB 3ACCA 1TO2E 4X9XA 1BVRA 2OMKA 1E4EB 1NUAA 2V6MA 3BBLA 1USKA 1N2EA 1HE3A 3KVNA 5BW5A 3EWNA 3PTLA 2Y1KA 1M6WA 2XVAA 4M3NA 1KDPA 5L7TA 2W2OA 4MO2A 2XE8A 4B7UA 2NU6B 1VB5A 1C9YA 1DXYA 1Y33E 4GOKA 3FR8A 2QZJA 3I72A 4M1YA 5IAAA 4B73A 3HRKA 3LQKA 1NUUA 1RWNA 4PS1A 2XYHA 4HJRA 1LJ8A 3L77A 3N05A 4NZYA 2BFBA 3VV2A 3GWGA 4HEQA 4I9HA 4TLBA 3QKUA 4AUKA 1CSEE 1P5JA 4S1PA 2WJHA 3CYFA 1AUXA 1P19A 3N2LA 5T41A 3SNHA 4EHBA 4EJ6A 4KREA 4BNUA 1GZ7A 1DWPA 4RPLA 4PSDA 3WDMA 2RGUA 4WXPA 2ZK7A 1U1DA 2H4FA 3OKCA 1E1RD 3N53A 3A4IA 3L6OO 2C8JA 2JCYA 4C7OB 2JH3A 4FUTA 1E6MA 1GRVA 1N2SA 4IEIA 1L4NA 3GLHB 1NE2A 3ID6C 2NU9A 2AV6A 5B3AA 1PU2A 1CR2A 2YL2A 3CCFA 4JC8A 2W7TA 4YGXB 4B3JA 1JYEA 5ITWA 1IL0A 4EKYA 5KYKA 2NP7A 3DONA 5HVNA 1H4VB 1NA5A 1YQEA 3GCDA 2X40A 3IAXA 1EMDA 4JJ7A 4NCJA 4Y2TA 5EZYF 1XOIA 3T35A 3WLTA 3WFZA 1VL2A 3LO8A 4G65A 3H3JA 5CDHA 2FAXA 1KWKA 4JR0A 4KH0A 1DWUA 2P6OA 5BNIA 5MF6A 1JIJA 1WX1A 1G3RA 1G19A 1TM1E 3B6JA 3BSYA 2GRAA 3EA5A 3ECSA 3QVGB 4XGQA 3UGKA 1Q92A 3ZQJA 5LLTA 4FOTA 2SECE 5LQRA 3TLCA 3FWKA 3LFUA 2PTHA 2MSEB 2WOOA 3VOTA 3EXEB 3PC8C 2LIVA 2A9OA 1WSDA 2JGDA 4EENA 1GL3A 4UCQA 1QGAA 1SUBA 4DV6B 4YPVA 4LRSB 3UGJA 2WINI 5AXCA 2HK8A 2HWWA 4E5PA 4ZPXA 4XQ9A 4LE0A 3GRKA 4XH9B 1UODA 1ZHFA 2VCYA 5NULA 4WGGA 1P0FA 1EFHA 4BQFA 4FJ0A 4L73A 2AUMA 1MHPA 3NYQA 3LTNC 2JLVA 1H2EA 3LHDA 1CDEA 4ES6A 4CQJA 2G1PA 4PC1A 4JLUA 1DBRA 3S2YA 5D3ZA 4EHKA 2ZR7A 4DL9A 3THRA 1HETA 3NHYA 4R8VA 2UDPA 1KGDA 1ZK3A 3CUEF 3GARA 3HXPA 4W9NC 1IRIA 1LTQA 2VF2A 3DTTA 5FPPA 3IDOA 3RGWS 5CA1A 1Y8QA 2GH1A 1U7UA 2I6GA 4MLDA 2CV1A 2OCXA 1Z06A 2QWXA 3HQ4O 1NPYA 1Y3CE 2HSGA 3R8XA 3SY8A 2P78A 3IALA 5IG2A 1UJMA 2V4ZA 3LOUA 1LU9A 4LCEA 1LTHR 3CLRD 3EJWA 4P58A 3WTCA 4EDFA 2XHEA 3CE9A 2FRDA 3A2LA 4U7DA 1JI0A 4KRXA 5LYJA 3TFOA 1S8FA 2E85A 4P4UA 3ET5A 1MNQA 2YNMC 4MLPA 1FX0A 4UHDA 3ZWOA 4C2TA 1LX6A 3I01M 2IPLA 4KN9S 1RRKA 2YV5A 5IW8A 5BMVB 3DP7A 3DA8A 4U7PB 1FLNA 3FFBA 3OM9A 1C8VB 4OI4A 2VXOA 3TCXB 4ZT4A 3S6JA 1SVKA 1DAPA 4O2AF 1NNEA 1CJCA 2A30A 3TMKA 3GLGB 4WINA 1A97A 2B8JA 4MGEA 4MIOA 4WZ6A 1LPPA 1HL7A 3PICA 5JASA 4JLKA 5BMOA 3A9WA 4FNAA 2OV1A 3RJTA 1UMCA 2H51A 3BL5A 3AHGA 1QX4A 2AOUA 3C5VA 3L79A 3K2QA 3Q12A 2C9MA 4LDNA 4NULA 3RAJA 3DE3X 4C29A 3HACA 2ZJ5A 4DILA 4TLAA 1KI6B 3WOVA 4LWQA 4YBZA 4UFNA 1L2TA 5D6OA 4N54A 1O97C 5AVZA 1O03A 4I9NA 1RTKA 5KTOA 4OI0A 1HLPA 1QGDA 1U2GC 2MT9A 3HCWA 2CHQA 3O94A 3PEVA 3STHA 3WA6A 4WBNB 4XI9A 1P1IA 3J7AC 1C30A 3D7NA 2CW5A 3BREA 1CXZA 5CVCA 4JI5B 2H17A 2PSHA 2Q4DA 3HM9A 4EB0A 3CPJB 1O95A 3OAAD 2WZDA 3SZMA 2JFGA 4M7RA 1X7WB 4ISCA 3OHSX 4AUMA 4EG7A 1BX3A 2REOA 2R1VB 5JI2E 3PF8A 4UUBA 1IQRA 3AP2A 1I7PA 4OK3A 5HQJA 2HRBA 3EY4A 1JG7A 1AKTA 1RWPA 2J3EA 4PVDA 4KSBA 5JS1A 2FFJA 2JLAA 4P31A 4QRIA 4FI3F 5TGDA 1YB6A 4HDNA 3MHPA 3CUWA 3GAAA 3H18A 1GPDG 4RK1A 4XDGA 2J6IA 4XYEA 4WBSA 3I28A 2C2GA 2OGWA 3OSUA 4DR2B 2AZXA 3REQB 1R27A 4R9RA 5K0EA 4DRXA 3IESA 1ARZA 2Y1WA 5B4TA 1W34A 3ESAA 2FJUA 4HVAA 3WAGA 1SA0B 2FY8A 2YRWA 4RK7A 2OXEA 5KYGA 5EUCA 1YJBA 2QR3A 1FTSA 3WGTA 3AZPA 4KWCA 4WDRA 5EHQA 3RTBA 1SUEA 2I4NA 3ZDEA 2YWDA 4UHJA 4YQEA 5IDYA 1NRJB 2FJ0A 3MYRA 4MVJH 4P35A 1E2HA 1FLAA 1ONNA 2C9ZA 3B9BA 5CGQB 3G0HA 4CKEA 1UBKS 4IUCS 1KY5A 1NU8A 2F48A 5JH7A 3CLKA 4E3WA 4MYTA 1BMFA 1YK0A 4XCVA 3BXPA 1SEPA 1VE1A 5KJ6A 3C1TA 2FLVA 2VR1A 4B3TB 2GWRA 4MKZA 4JQOA 5JY1A 3DKIA 1RWVA 4YAIA 2MYUA 1M54A 4B3SB 3K0HA 3J80A 2QRHA 2FX3A 2GMWA 3CNNA 4EYQA 1EUDB 1LBHA 4WOBA 1KU6A 1R66A 1XDDA 3IBGA 4KKVA 4G5GA 1O89A 1F3LA 2QZPA 2BFDA 2F7SA 1F06A 1KOFA 3OHPA 3PUJA 4TS9A 1IUKA 1JXAA 1GP2A 2PL3A 2AXPA 4LDJA 2AFHA 1Z36A 5LZ7A 3EVDA 3TFQA 3DAPA 5ALOA 4I8IA 1BKYA 1TCVA 2FUKA 5EEGA 1BXZA 1QH8A 1K86A 3ACDA 4GLOA 2BBSA 2CF5A 2YXEA 4NYMQ 2IYWA 1NUSA 3K4HA 5BWMA 2QMQA 3ZGYA 4N0DA 3B5JA 2AF4C 1YUNA 3N6XA 4R7TA 4O4LA 3NHMA 1J9GA 3NWOA 3ZTWA 1JTVA 3VR4H 1RZ3A 4E14A 2GYVA 3QU9A 1Z0AA 4JJFA 3JYLA 2NQ8A 5C46F 3KZKA 4U9IS 2PBRA 3ZHBA 1HTBA 3RIMA 4DDVA 3OQVA 5LWHA 2J8ZA 1TT5A 5IT5A 2O3TA 3OU6A 5E1BA 3KTAB 5FBZA 4LF5B 2G83A 4LJ4A 4RNCA 3B8HA 5KI6A 4XUGB 4ZC1A 2VDUE 1WTCA 3M3DA 4MYSA 3VPBA 1I7SB 1OH7A 5E2BA 2QXTA 5DBGA 3EA4A 4EB3A 3TAHA 2ANBA 2JZNA 1OA1A 3BS4A 3IQHX 3X2EA 3OCXA 3QOFA 4L50A 4NWIA 1J2EA 2FEOA 3K9LA 4PQGA 3R40A 4BP8A 1FP7A 3LP8A 4G1CA 4TTJA 3MS2A 3EVGA 3LMKA 4EUSA 2DOKA 3RSCA 2RAPA 1IBRA 5K4GA 4RD2A 2GVNA 1C1DA 1P81A 2CNLA 4KQFA 1K7FB 3IDAA 1GZUA 4U2DA 2H8GA 4UQOA 5U4XA 3UG7A 4DPMA 3ZZ1A 2YZ2A 1YB1A 4YMUA 3L7KA 4O8CA 1N1EA 1CY4A 4DIUA 1OH6A 1X1AA 3AJEA 1ANKA 1V48A 3K0AA 2Q4OA 4OO3A 4AZSA 4F7DA 1PFWA 2WU1A 4B5LA 3SKYA 2JAWA 3NVDA 2X76A 3IUSA 1Z18A 3U61B 1TT7A 2BT4A 4GSLA 3UHFA 5A4FS 4RDXA 3ZVNA 3NGLA 1RWWA 5GOTA 1T2AA 1ZMTA 3U4MA 1L5WA 3B1JA 3ZVKA 2EBWA 1XZMA 3GRPA 3ZY3A 3FE2A 3GDOA 4E5DA 2ZYUX 2D5BA 1UT5A 3H13A 3NKFA 2COKA 4JJAA 3CEAA 3A27A 3QKIA 2XRMA 2VPTA 4RUKA 3CLRC 4BMXA 1P17A 3VR6A 1MAVA 2WZCA 4D79A 2YX1A 4LSZA 4UZEA 5DIZA 3ZPXA 1TF5A 3PENA 2I5PO 3UWOA 4B81A 2OGSA 3RS5A 4BDSA 5LVAA 3N8GA 3QBJA 4GQIA 3HUFA 4G0MA 5AT1A 2A1IA 2V7GA 3U37A 4F5ZA 3WIUA 1JR2A 5JNVA 3VV3A 1BW9B 1DXQA 3ZEIA 1KYWA 2RGAA 4Y6GB 4D5EA 1R5BA 3HY6A 2ZJ6A 1GYQA 4UUMA 4XEHA 3PUXA 1DDIA 3V7FA 2GD1O 4FX5A 2XGGA 4FC7A 1VL1A 1Z39A 1V4BA 1ZGZA 2NTEA 1KMHB 2HUPA 3C8MA 4MW0A 3N8IA 3MOIA 3MUEA 5K3DA 1QK4A 1U8FO 1D03A 2ZE5A 2EARA 3LY7A 3WGKA 1WR8A 3AI1A 2Z30A 1SUSA 2WU0A 1ADGA 1KJWA 2HLDA 3VAZA 3MJ4A 1K2VN 1JFFA 3REGA 4Y6LA 3LP5A 1SPBS 3FMFA 5AK0A 3GB9A 2WHPA 3EZXA 3QK7A 1NF2A 5HTOA 3QU5A 2QX7A 2YMMA 2GA9A 4QC2A 3JU3A 3VU9B 4NBTA 4YCSA 2FPWA 4QBGB 2RC6A 4G5HA 3GUYA 5LB4A 2ERCA 2XAUA 1YZUA 1CHDA 2WAAA 5BXYA 5C1OA 1CUWA 3HKCB 1N6OA 1U3FA 1IEWA 2GJ9A 1YUBA 4PQRA 5SYAA 13PKA 1OHHA 1OFTA 1GQOA 3MRXA 5BOSA 1S8AA 5COAA 1UJNA 1JWLA 2K6GA 1SRRA 4MYRA 4YIHA 4UM5A 3WBJA 1NW3A 4KTVE 1YFLA 4J8PA 4J1TC 1M2OA 3DBOB 2Z8YM 1WDTA 2V5VA 1GTMA 2ZKLA 3M4ZA 4CWAA 4DM4A 4Z4GA 1GUAA 2KMLA 1WQ4A 3BDAA 4W8OA 3F73A 1XZDA 4FYJA 5TF4A 1NW9B 1B6RA 4QREA 4XUCA 3RNLA 3SU8A 3TD2A 6Q21A 5HQTA 3ELWA 1WZCA 4XVHA 1UK7A 1JEEA 3Q3VA 2VSNA 4CRWB 1U8XX 1MXFA 3F9IA 4PNEA 2Q45A 4D9BA 1X15A 2R8XA 1YDFA 4IIFA 1OBCA 1Z5PA 3OBIA 5EYPB 3R7SA 2CUTA 4A82A 5L45A 2MSKA 4GM4A 2HMWA 5HZHA 1HOXA 2V9ZA 3Q8KA 1UIRA 4QPCA 5A7FA 5F2NA 5LIRA 3DEKA 5K8VA 3TOVA 1T2FA 3GLSA 1FBNA 1EWRA 3KB8A 4MKHA 4DMGA 2OBLA 4L16A 4LVOA 3H4TA 4OB6A 1UXGA 1XK6A 3CEMA 3DFKA 3OTWA 2PL5A 2ZB4A 4H7KA 4IH1A 4IOLA 1V39A 1U2EA 2AOWA 4PV7A 3D54D 4R4JA 4D8YA 2CV2A 4XPIB 1JDSA 1TTHA 3HUTA 2HTFA 4S0ZA 4IIGA 2M6KA 4L0QA 4P32A 3IKLA 5CFLA 2WV7A 5L4NA 1KK1A 4Q4LA 2BEVB 2ZU6A 3VXKA 4A8JB 5JAMA 1ZXLA 2BR5A 1EP3B 2M98A 1YOBA 2ZJOA 1U0SY 2ZBDA 3TBKA 3IQXA 4A03A 4C87A 1LBEA 2M1ZA 1MQ9A 1Y9ZA 4G85A 4U2BA 5DNUA 4RTSA 2O7RA 3LHIA 1ESDA 3EVEA 4NONA 4D3YA 1DV2A 1P1CA 5F1KA 4GXTA 3E1GA 1MEJA 4YRJA 1C50A 2GK4A 2VQ3A 4BE9A 1T2NA 5IKOA 5ELLA 5B3LA 3SYNA 2Y9MB 3V4ZA 5L3QB 3AF6A 2A67A 1NLFA 2CN1A 3C5WP 5J4KA 4DKXA 2QZ9A 4P7BA 4P3NA 2AMYA 3GIDA 4YDSA 3HBLA 4Z49A 4NBSA 1HFEL 3E3LA 3DTVA 2FG7C 3R5JA 3LUPA 4JASB 4WGFA 3RUPA 4CBVA 5C4MA 7ABPA 3TKLA 5FWXB 4F97A 3G8AA 4H59A 2IYEA 2MJLA 5EKUA 2P5UA 3GJTA 1RAEA 4BY9E 1Y5MA 2W00A 1VE5A 2VSQA 3ECAA 1DT3A 2ZBPA 5IKEA 5IYZA 1K9VF 1CU1A 4TL7A 1QUEA 4E1BA 2OA0A 3PB3A 1TVEA 2JFPA 4P0PB 3GLVA 4DR4B 1SURA 2HDOA 3A2NA 3P9KA 4FDUA 3CJQA 3O8RA 2O8DA 1G98A 4B6PA 1FXWA 3MNFA 3THSA 1FXUA 1GTJ1 1E8MA 4ZAWA 3Q10A 2G4LA 4KYVA 5HUJA 1E3LA 4ZU3A 5IJAA 4L27A 4ZOLB 1N8NA 5A0VA 1JG6A 1G5QA 1UR5A 2QG4A 4HFNA 2ZRBA 1BXGB 3IMEA 4Q4JA 4ID9A 4DLSA 3BD7A 2GCOA 3NWEA 3OCYA 3WDSA 4Z4EA 2O8CA 1E58A 4NV3A 4HGYA 2YV2A 1CZOA 2NN3C 4M7WA 4C76A 5BN4A 1DLJA 1JJ7A 2WT8A 1PFUA 2KM1A 3EIUA 3FDZA 3IILA 4KIWA 1Z6PA 1ZX1A 3K9HA 3R0IA 4KMRA 1U4OA 4LV8B 3RR2A 1OTXA 2WWVD 5BPHA 2KB0A 3AETA 2W8BB 3FOCA 1IJFA 1PGQA 3GPIA 3PNQA 1KJ9A 1BE1A 1DFGA 1Q95A 3C1UA 1N8KA 1NBME 3KUXA 2OCIA 4N0QA 5JVDB 4DDKA 1E79A 1JE0A 2P2DA 4L4ZA 1BJRE 3AUXA 2E6UX 3SC3A 3TQHA 4ARVA 2IU6A 3AC0A 4C0QC 4G0VA 1R5JA 1T1IA 3AR3A 2IZ0A 3BWYA 3LCRA 4JYBA 3LLUA 3QLTA 3VKFA 3BZUA 1T9CA 4ILKA 4YAKA 3Q8LA 2QT1A 4PX9A 2IIQA 3IT0A 3RYFB 4ZI2A 1NQUA 5K9ZA 3EEOA 4H2DA 5C7LO 1XXHA 1VBKA 1N7GA 2X0JA 3K1YA 3O8DA 5H9VA 1NMQA 3OC0A 3AI2A 3DDSA 5E6SB 2XYPA 1LK7A 1RRPA 3BK7A 4OH7A 3YASA 4DLZA 4Q9AA 1VP3A 3MTDA 2RKBA 3GZNA 2C1XA 4EYGA 2CLFB 4KR2A 4O4IA 5L7WA 1W0JA 5AVQA 2OFOA 4IXMA 1G7TA 2GLXA 2C78A 3QVVA 2NO9A 3IEVA 5J43A 2BGKA 2QX9A 2B4YA 4JOCA 5ALKA 3TI9A 3PPIA 4EO4A 1N5RA 3ISTA 5AW2A 3IPLA 4B9EA 1X9HA 3UTCA 1VLHA 1ZITA 3DO8A 1HZZA 3VTFA 1LPAB 1Q6YA 3QUBA 5AHWA 3K6SB 2XDQB 3FPHA 4GMHA 3W9SA 2XODA 2XBLA 2R68A 5ALJA 3EXHC 4AT1A 1ULHA 3T3OA 3GO4A 2V96A 2WJ3A 1GA4A 3A6HA 4RYDA 4B85A 4F3TA 2KS6A 1UMDA 3TFWA 3I61A 3HPQA 1TB4A 1UM9A 1UOQA 4N5HX 3OOWA 3EVBA 4MRSA 4O4JB 2HK7A 3DAGA 1C9DB 3W79A 4Q47A 1CJMA 3QVSA 3MCTA 2FPRA 3IXMA 2BEUA 2CFRA 2G7ZA 4L0CA 4OHCA 1WG8A 3NR2A 1GXSA 1O6GA 3FKJA 4KEAA 4GYKA 2CSXA 5CB8A 4LIPD 1NOKA 3RSLA 3B53X 4S1VA 5D84A 4J16A 2RHGB 1G6KA 3HLYA 3R3WA 3ZK9A 1FNDA 1V3QE 2G77B 1Q0UA 3HUUA 3GRCA 3I01A 4GOND 3R0VA 4J7CA 4UJ3A 3I45A 1JG2A 2VPZA 2H5EA 3NDIA 4QHYA 5CX1B 3VH3A 1E2BA 4RX1A 1GG2A 1Y7TA 4J7AA 3TZHA 3LDGA 4BFSA 4EVRA 4QGGA 4FOPA 4AKTA 3EC2A 4HGRA 3WIBA 4YH1A 5FPQA 1N5IA 3QVOA 3P2KA 1L3BA 4WOKA 1W5FA 5TS2A 2WYVA 5DSZA 2A3NA 3TAUA 1HE8B 1PJSA 1QFMA 1NASA 2DTEA 2IY9A 3JRWA 5EXSA 5I4CA 3ENVA 3WLMA 4OD0A 2OV4A 2VF8A 4OBXA 1CR6A 1H0HA 3E9ZA 4QYIA 4Y2QA 1XZEA 4FONA 5EJIA 1WHSA 3RU2A 1I4EB 3QX8A 2CLHB 4PLHA 1UKVY 4FTWA 5L7YA 2ACVA 1PO7A 5C8YF 1JUDA 1X42A 4GI2A 2A1UB 2CLSA 1V95A 1JH8A 3HCFA 2AHOA 4JBLA 5HR5A 1IK6A 4MGHA 5BQOA 1H85A 1RI3A 4DBLC 2KE5A 3PA6A 3V2UA 2R1ZA 3EISA 4WCFB 1JQEA 1LK0A 4G1MB 3H2HA 1V1RA 3RSQA 5DGTA 1V11B 3JR3A 4GL2A 1M1YB 1NLUA 2O1SA 2IXFA 4F2PA 2XRZA 3UQYS 4R41A 2ZROA 2CD7A 3HI6A 1ZJYA 1GQRA 1THGA 1OW3B 2IBMA 4I4LA 2LVBA 3IIJA 4C89A 4D2IA 4B6SA 4EW2A 4UE6A 5IJ0A 1X74A 3R4CA 1RYDA 4BO9A 4I50B 4J2HA 4Q21A 3TL3A 4UW9A 1KKMA 2NXJA 3JSXA 5EZYA 3GRUA 4DT1A 1KR5A 1PQUA 4AF8A 4MWGA 4ZV9A 2OG1A 1JHPA 2P41A 3E6AA 1WY5A 3L7CA 5L40A 3TYXA 1E7QA 1CUXA 1D0SA 1HRKA 1Q1QA 1VHTA 4ZI7F 4AMZA 1SG9A 4K5QA 1VKZA 4AFNA 4RORA 5FWNA 5BN3B 5BVHB 5JSUA 4FLEA 5E7IA 5AW1A 1TYDE 2OSVA 3KTOA 5F35A 4DARA 1NWCA 1B8PA 2WLTA 3IAUA 2DY0A 2F8TA 5BSUA 3ZLTA 1CEEA 3ZGXA 2B4QA 3ZI7A 2OZVA 3BMNB 1KL7A 3W8DA 1P29A 3W2HA 1JIIA 2J59A 2X6RA 1TF7A 5AK3A 5HE8A 2D3TA 3FNIA 4OQYA 3UMSA 1P3Y1 3ZGLA 2YWXA 4DC9A 3BL6A 3A3OA 3AY7A 2C4MA 3GOQA 4AZ0A 5DWVA 1GDHA 1HE5A 5A2GA 2GVDC 5EZQA 1BS9A 1T9AA 2GPSA 3MERA 4OJNA 2X1LA 3UQZA 1NKSA 1F2UA 3BPSA 2V03A 2WMNB 4DNOA 2HSWA 2OXRA 1T3HA 1YZHA 3W8RA 4D9NA 4LE1A 3L82B 5ESRA 2GX6A 3RHZA 1BN7A 4M0CA 1CY1A 4BWGA 4D0SA 3JATA 3TIFA 1S7GA 2RGGA 4BP3A 4KUHA 1YQQA 2HOQA 1Y9EA 4BVEA 1W35A 1V35A 2WT4A 2ZS9A 3I12A 4Q7MB 3QQ5A 2P30A 3K94A 2DUMA 4A26A 4JSTA 2IEBA 1J97A 4RZSA 1G5HA 1XNJA 2CXXA 4MW6A 4UHHA 5I6DA 2EHDA 5LLDA 1ZH4A 4OB7A 4WNYA 5HF8A 1KZ9A 3ORYA 3R9WA 4KXYA 3MWKA 4W6ZA 5KYVA 3TK1A 5EPOA 3BH6A 4MVJD 1EGMB 4OSEA 3C3XA 2XWSA 1G8FA 3RUAA 3D4PA 1X2BA 1A76A 2GNPA 3IT3A 2OB2A 3K0FB 3WNDA 5JCPA 2WJJA 4KXXA 1AHIA 3MBKA 4P3YA 4DY4A 2NNLD 2PKXA 1XE3A 2QY6A 2Z3WA 5FO1A 4XVCA 3HYTA 1TJPB 3FGOA 2WJWA 3OIVA 2R6CA 3QJGA 2J9FB 4YTEA 1D6NA 3BWDD 2HGZA 2V1UA 5K3FB 5LC1A 1T2EA 1VDZA 3T7RA 2OHOA 4NH4A 4Q7LA 1O8CA 1VSUA 1GOTA 4NZ9A 2OGZA 3NIWA 4YUZA 1G3MA 3SC2A 3TSZA 1L7OA 4ZYXA 4TMVA 2WP0A 1RQ7A 3MBOA 4Q39A 2Z1DA 4TV8B 1J2JA 4RAOA 3RYIB 1R00A 4QYXA 3KQQA 3LQFA 3PJFA 3QPWA 1EKXA 5MFPA 4QQRA 3FOAA 4Y0AA 4HNHA 1RKVA 2YJ3A 4JDUA 2DHCA 4CMAA 3RC9A 5D5PA 3RH0A 5KQLA 1JJFA 1CULC 3K73O 4K26A 4IJVA 3TZEA 4KPGA 1DINA 1V6SA 2PX3A 3FBGA 3MTGA 4OVKA 4PX5A 2B3TA 4RBNA 1PBTA 4D8VA 3QVUA 5I8WA 4KFCA 3TDMA 1JP7A 5EMKA 3TE6A 1PLLA 5KB3A 3QYAA 2DFVA 3E5RA 4WKNA 3ORFA 5EIHA 3I5XA 1CUUA 4YA6A 3VR4D 1CB7A 3JSAA 1Z0FA 4YB8A 3CKMA 1L5HA 1F9AA 2BHTA 4I1UA 3JAMA 3HYSA 2OBYA 5F2OA 1U31A 1EJ0A 3D2AA 3D1LA 1V16B 4HDAA 2PWZA 4IFBA 4B3RB 2VKTA 1G8SA 3CW9A 2GO7A 2JHFA 2GTIA 2I3BA 2MR5A 3PXEA 2QLBA 1N5JA 1QX3A 2CLIB 1O08A 2O2SA 2QRQA 4OV6B 4D80A 2PZMA 1ZUHA 2RHHA 2ZJ1A 3C7CB 2J5RA 4LF9B 1CETA 1JE1A 1C1XB 2V7QD 4JJ8A 4M9SA 4YRQA 3U9SA 3W5AA 1HE2A 1X7DA 1DHTA 2QY9A 2CJWA 4R7GA 3BFVA 2DH5A 4Y18A 3BH0A 5D00A 3FZGA 5KHOC 3FOFC 2WDZA 3E5NA 5B1HA 4U02A 3SEQA 5AUPB 1W49A 3TQTA 4ZFNA 4MK4A 2FZKA 3WP0A 1EK2A 1TYAE 2R00C 1EJBA 1SUIA 4CM1A 3L6BA 5D3KA 2V74B 4MLZA 4JSYA 4B75A 1TZBA 2B7CA 3OF2A 1EYZA 4D9KA 3S2EA 2RC5A 2MCFA 3E7XA 1X94A 2UAGA 3I6YA 2CDRA 2OXFA 3DO6A 3BOSA 3S2SA 5F98A 3TPFA 1LFDB 3ZIAA 2XWBF 4PZZA 2AJCA 3BG5A 5KAMA 4C4RA 4WFIA 5LP6F 1YR8A 3IE1A 4WCDA 4YV7A 3I52A 1XV5A 1ZFNA 4JENA 2VK4A 1IULA 3CM0A 1NDHA 4UJ5A 4CIAA 2BI7A 1K08A 1W36B 4OHFA 5GONB 4BNYA 1RHUA 3VR5D 4Y1EA 1N0WA 1Z26A 2BJVA 2XMQA 2I7XA 1UC9A 1K6EA 3L0IB 3WZ2A 2WSIA 1FSFA 1YVDA 4H4CA 4U6SA 1K9SA 1TMKA 4LISA 2W2LD 2JKZA 3CZ5A 4MV4A 3RODA 1MQAA 1GSAA 1T0IA 1KXJA 1XLVA 4N3BA 4RWZA 1W73A 4UBMA 3SR0A 4IIJF 4XD2A 4P5DA 3HDHA 5AKXA 4X84A 4BMDA 1SQ6A 2BZGA 5KVCA 2RGEA 3LBYA 1KMNA 2QX8A 2R751 3JARA 5EP2A 3RLFA 1VL5A 1M6VA 4XTRA 4U5XA 1R0SA 5HG0A 4YHHB 1JG3A 3ESYA 4CU5A 4FZ3A 4EA7A 3Q11A 2JDID 1DZ3A 2I8LA 3GUVA 4I55B 1LQ2A 4N7MA 1XKTA 2VHVA 3H2YA 1LBSA 3OPYB 4B0OA 5DNCA 2QMOA 3WZMA 3Q3JB 3W6PA 4DR5B 1FY2A 2PA3A 1T2VA 4NL4H 4UHFA 3TQRA 4ZCPA 4ZANA 1NRXA 1EA7A 2O2DA 3IVXA 4WERA 3ELDA 2EXXA 1JXMA 1RKXA 3CLVA 1FJ2A 1RI5A 1L8XA 4UBLA 2V9PA 3QEMB 5IM4F 3HWWA 1U7HA 4XJSA 2GARA 3T5BA 5DOZA 4BBZA 3VYWA 1AJEA 2QJFA 4N82A 3M6FA 1M0WA 4C3ZA 1F4LA 3HZZA 1V4VA 3Q7TA 3I6BA 2W11A 2C7PA 5KYUB 4BN0A 1A9OA 1QM5A 2QQFA 4I4TF 2RHRA 4QPPA 2GM5A 2V5UA 3FLMA 2RHOA 1PP4A 3MJFA 4UEOA 4JL5A 3A2MA 2P65A 4R3WA 3V1UA 1P5HA 3NFRA 1JHAA 1HDCA 3K1AA 5DLEA 2H92A 5ALWA 1QHNA 2WYWA 3F71A 4ER5A 3NEJA 5HS6A 4HNTA 1OV4A 3FN4A 4TSFA 2GXSA 3GY0A 4WVLA 3TW8B 3K2BA 4TQ9A 2XOKA 5E6UB 3DKVA 2IP2A 1XTJA 2C94A 2VHXA 1KMQA 1KSFX 2O0HA 3HLTA 2IS1A 4EKEA 3CVJA 2RGDA 2DHQA 4XFDA 2CKDA 2X4DA 1R9JA 3HB7A 2JBAA 1U1IA 3ANXA 4J75A 3V1KA 4Z53A 3DPIA 3DVAB 1FTQA 5DYGA 3LXMA 3UHJA 3SC4A 4R8RA 5J1SB 1CUAA 1KYVA 1Z6GA 3C3BA 3KZXA 4A2QA 1VCMA 4WKGA 4AJJA 3G1UA 3WLIA 3PLRA 1TU3A 1BJTA 2H5LA 3O83A 2XEXA 1RJFA 2OOKA 3KKMA 1PS0A 3BE5A 5B1IA 5DBFA 4EUNA 3RRYA 1MO6A 4LKRA 4RH3A 2QJRA 5JR3A 3IOMA 4KX3A 5TQ2A 4LTMA 2AN9A 5DASA 4CIDA 2H1CA 5ALEA 4CMIB 4EBFA 5JLAA 1ENZA 2WVHA 3R3JA 3VDRA 1NMXA 2HPZA 5AH0A 5BV2P 1CR0A 1FVXA 1SCUA 2IZ7A 1CERA 4LGVA 5ADVA 1JLLA 3I53A 5A71A 1IZ0A 4CLEA 4Q1VA 4F84A 5CDYA 1THMA 1W1IA 4WJKB 1W76A 2R79A 1LQTA 2PRZA 5EXTA 1PZHA 4NIMA 3RSFA 3PR1A 4DEXA 4FFMA 4RPKA 2REQA 1ISGA 4YP7A 3TNFA 4DA4A 2RHDA 1ZA2A 4JI2B 1G9XA 3AZOA 1EAYA 3OPYI 5CNIA 2VAMA 2OBMA 1QIEA 3DJYA 4PG5A 2QQ5A 1FL9A 4X5OA 4KOEC 3X1MA 2BFBB 1DQZA 3FJYA 4TKVB 1AURA 4FNGA 1EDZA 3V7WA 1SQSA 2YY6A 3O7MA 1TX4B 3OY2A 3PI6A 4DLLA 5CB4A 4YXFA 1ZR4A 4U3JA 3PQ3A 5JJKA 4QZVA 2G1JA 4Z0NA 3QX7A 4ZT3A 5BQ3A 1SCQA 2ORYA 3R7WA 2NYVA 1SD2A 3LYHA 5KX5A 3D7MA 2HA5A 4PYKA 1ZVKA 4IG4A 3Q8MA 4FN5A 3KUCA 5LIPA 1R88A 3TOSA 5IJ9B 2JEYA 2HR1A 3R41A 3ABSB 1EUZA 3IRUA 2NU9B 1US8A 4LJ6A 5FF9A 3D3QA 3MN1A 3ASYA 4WFQA 1EFVB 1CY2A 3F97A 3KJGA 3R3YA 1KJQA 4XCQA 4AMUA 4BRUA 4ZEWA 1V1JA 5A3RA 2XZLA 3L8HA 4WOCA 2G04A 1CUIA 1UBUS 2C3YA 4KSYA 5AJXA 3UAGA 5JPCA 2VZ9A 4YALA 2GJAA 1MB3A 4H35A 1O4VA 5AM1A 4CZ2A 1UINA 4KQHA 4C0KA 4G09A 1PZFA 3TLXA 1Z22A 3G6WA 3RJZA 4XM1A 4G36A 4CT0A 1I5RA 3ILYA 1HQKA 2FB9A 1M6YA 2W4IA 5F73A 3ZU2A 1ZK0A 3NBFA 3JZDA 4EJSB 1RKBA 4BZXA 3BAZA 4AMVA 3VVBA 1NFQA 3CE6A 1IOWA 3E9CA 3IAEA 1IBCA 2C98A 1Q11A 1W5AA 3EQ8A 4I2VA 5DI9A 3SZOA 2VWGA 1AH2A 2VJAA 1MNAA 2PKRA 3UH0A 3UUGA 2XNJA 1SCDA 3CHYA 3WMRA 3NJRA 4AKEA 4EF5A 3GJ7A 2AI2A 4XIIA 3NAZA 3P94A 4FD2A 4MAMA 5KYXB 4PRZA 3CZPA 4AB1A 2X0EA 2ZSUA 5I48A 2M2IA 5LBIA 3B7WA 4IGEA 4QOEA 2JJ2A 3RJ9A 1GKYA 1GEGA 3S4YA 2EYUA 5MN4A 3T34A 4ZP1A 1R64A 3G23A 2X5JO 4Q9LA 3RIYA 1XTQA 3JX9A 3IUMA 2VTBA 5CA1B 5FR2A 4LPKA 4C78A 5LWQA 2GEJA 1Y8QB 3BB1A 4GZ6A 4O2RA 2WQ7A 1GN8A 4I1SA 1GG9A 1PNVA 4J0FA 2I54A 3NALA 4JROA 4MZXA 2FPIA 4FMDF 4ZVMA 4CG0A 1SIBE 2B4AA 2PS3A 1Y8CA 2ZW9A 3QBTA 4TVKA 2WVAA 3HV0A 4ZQBA 3X1WA 1NYRA 1FNBA 1SQFA 2JLQA 4UDYX 3WL8A 8LDHA 4KLZA 4Q3DA 1UBOS 2Y68A 3CNQS 3U39A 4GOXA 3AONB 5KNCA 1F9EA 2C9OA 4Y3UA 5LYJB 2Y93A 4QWMA 1MAUA 4XOIA 1BAPA 2B2CA 3QFRA 3DFFA 4X6XA 4LUCA 2NYAA 3LF2A 2IUEA 1LC0A 3MINA 4R0VA 4RK5A 3IUYA 1Z0DA 2R6ZA 4C30A 4BX3A 3ZVMA 1GCIA 4P3XA 1F4PA 1BGVA 1FW8A 1T3LA 2PKYX 2Q8NA 3PV0A 4NFHA 3RK1A 5JW6A 2YVQA 2AFVA 4K0KB 3GAMA 3FFXA 4NECA 4R9UC 1U0OC 3LBNA 5AVSA 2ZI4A 3F8TA 4J0HA 4QJ3A 4JI7B 1XNHA 4FMCF 2UUCB 4WY8A 1QYWA 5J2TF 1CLEA 4YFYA 3UC5A 2DULA 3Q1KA 3LL7A 2ZVPX 1IHOA 1FFYA 3O9ZA 3IPAA 2HT1A 4MULA 3SSAA 3B1VA 3QWFA 1UMCB 1QBGA 4WA8A 4Q3OA 3KQNA 1SC4A 3DSRA 1RHQA 1HT0A 5LZ9A 2CFSA 2O0KA 3B3GA 3QFFA 4PEVA 2WSBA 2C04A 2NTJA 1Y8RA 2CNOA 1FSSA 4HQOA 1FRQA 3QUAA 4B33A 3L7NA 1R6AA 1Z4IA 4RSHA 2X9QA 3QLEA 4F60A 2CBGA 4LJ7A 3KKZA 1SULA 4GBMA 4B34A 1E32A 2R2AA 4GC9A 1I2AA 3U7IA 4ZMSA 4URXR 5EJ6A 1PG5A 1NKVA 2VCHA 1C30B 4W63A 1G8MA 1P6UA 4MWSA 4OIFA 3GEEA 5DM60 4BNHA 4KVFA 4FR2A 2Z43A 3NCHA 1ISMA 3K1JA 3ZCUA 5AJZA 1OYOA 3SFVA 3PHGA 1AQIA 1ZAYA 3OZIA 5B58T 3AUTA 1I94B 4EFKA 2ZWOA 4MKRA 1L8AA 2VTVA 3S5JA 1K0FA 2PX4A 2ZRGA 2OLJA 1KYYA 3OI7A 5IJWA 1P39A 4NE9A 2W2PA 3ZCVA 1RWKA 2C8KA 2V3WA 4UAJA 4HDNB 3RU9A 3L7AA 3EFBA 2X1HA 4R5HA 1J0EA 1KVTA 3UA3A 4DXDA 2PEZA 3QKSA 3A1VA 2UXCB 2WTMA 3HVUA 2RH9B 5LQSA 2FSIA 2XVXA 4DRXB 1OFIA 5K3BA 3AR5A 5IUNC 3VO9A 2NMVA 3DCYA 1Y37A 3UV6A 3H87A 3DR5A 1A7JA 3LK7A 4TM7A 3PVCA 3LTEA 1NT4A 4GOMD 4CE6A 5LUAA 1RC8A 2Q5EA 3D6AA 5M29A 1X70A 1ZRNA 2XA2A 3N2ZB 3ORHA 4HDKA 4RQUA 4YP6A 4EAQA 1J7JA 2I66A 2W6ZA 1FRVA 4QNNA 5EMNA 5JS6A 3OOSA 1IOLA 3B6EA 3FVRA 3INTA 3FF1A 3HJNA 4PG8A 3N5KA 4XRRA 3TX2A 3DWFA 2YFQA 3BKWA 2DR0A 3MTQA 3OZRA 3WLNA 2HQSA 1QOZA 4K1LA 1T1EA 1J25A 2G9UA 2QX4A 5BN5B 5JYDA 1KMMA 4ZJYA 1ZN9A 3LQRA 4MUEA 2VVTA 1U7ZA 2H2FA 5JSYA 4D3SA 4HLNA 3IMFA 3H5VA 1D2AA 4JL8A 4KWHA 3OIFA 4NF2A 1UJCA 4YP5A 4HN9A 3QVJA 1MG0A 3OFND 1FA9A 4INOA 3VQTA 3WK8A 4RJKA 4W8GA 1VJCA 2BFDB 4HYYA 2IU0A 5JXJA 4HNQA 1LSSA 5G0WA 1X39A 5CYPA 4B43A 3BCUA 4BVFA 1YCGA 2AFHB 3KYCB 3KDPA 2X6QA 1NFRA 4MWOA 2UUOA 4KPFC 3TR0A 4S1OA 1NVMB 1KYIA 1FFGA 3DM9B 3NYWA 1UC8A 2Q28A 3ZNNA 3U44B 3Q0EA 7ADHA 3BGOS 1VG9B 3ESRA 1G4UR 1KIFA 2PGAA 3L2OB 4IDBA 2YH2A 2YJZA 4NPAA 2AN1A 3GJ4A 3KR0A 1M6NA 2FEMA 4J4TA 1U3TA 2CJFA 4J03A 4V0QA 4C3VA 3KAJA 4JLNA 3F5SA 1KEEA 3EARA 1OIVA 1F5NA 3CBGA 1WD5A 1JHVA 3GVIA 2IEDA 4JB2A 4O4LB 4QUKA 3EE6A 5FOSA 3P9RA 3ONVA 3IDSA 2G08A 1E2GA 1WBBA 2BBOA 1YV9A 4HGZA 2QENA 4B3IA 4Q6WA 4MGIR 1TT5B 1TYZA 1NF8A 2VOJA 4H1VA 2VP0A 4MYCA 2J3IA 2DWPA 4B7AA 3K9QO 1E3TA 5B53A 2G9ZA 2ZBVA 4LQCA 4IFEA 3JWIA 1PV1A 2V8OA 3C6KA 3AW9A 2O7NA 3B2QA 1GZ3A 2BEKA 2IGBA 3B48A 3M5DA 1SB8A 1V8FA 4QPDA 2QVXX 5A5DA 1UPXA 4M7OA 2B6HA 3PHIA 1PR0A 4EGAA 2JHPA 2BHLA 3N5CA 1KVRA 3FZNA 5J4YA 2FLWA 2I4MA 2CXQA 4Z9BA 1EDBA 5C8YA 3ZHSA 2ZLBA 4QARA 4Q3LA 4CMHA 3ZDYB 2J3QA 2Y9PB 3I9V6 4PZCA 4B80A 4HY3A 4UZSA 4FKBA 3H2KA 1V7PC 1W4BA 3EODA 1E6WA 3R23A 1KAQA 2IKSA 1B4DA 1DJNA 2VH5R 4DLTA 3G2IA 3CTMA 4M9CA 3ZGOA 5JFTA 1RXEA 2BH9A 1S2LA 3I05A 4FU0A 4GAEA 5I9BA 1D6SA 1NOIA 3IJPA 2WHQA 1A88A 1QTNA 2QUAA 1NM5C 1PZMA 4E09A 4GECA 5E38A 4OUDB 5DCLA 5G2OA 4G84A 4JEUA 4MCIA 3K6KA 1Z4PX 4RH1A 3PT5A 4O63O 3R6TA 3P9XA 1TM3E 4K9KA 2B25A 3AG5A 1IY0A 1R0XA 4UVHA 4DDWA 3ZQUA 2OAGA 3C3EA 4G0YA 3OQIA 1ML3A 4LZOA 2F1OA 2KSQA 4QU9A 4I6EA 1W4RA 1HNZB 1U5AA 1UZLA 2EIXA 4TS3A 3TQCA 3EPLA 3GG2A 4ZI7A 2QJTA 1SXIA 4FW9A 5K8UA 2Z1NA 5FOQA 1SKBA 1L4LA 3BXEA 1UUFA 3GJRA 3I2FA 3NTUA 4G0NA 4JDPA 4XX1A 2ZYIA 2HQ1A 4LXXA 3T41A 3W9BA 3OZWA 4LHEA 5FBLB 1FJHA 3Q5GA 2OCYC 4PAGA 2YICA 1TVKB 3GVXA 4C0SA 2A58A 3MT8A 1D4AA 1AA9A 4YRSA 5SYNA 2DBYA 4EHNA 4KWEA 1VIMA 4YLGA 1T91A 2MYPA 5ESDA 1Z6XA 3WMWA 3GVPA 4KXLA 4G24A 4MHSA 5FWYB 1CF2O 4YVFA 1VZ3A 5FH9A 3WMEA 3QPCA 4DR6B 4YCLA 1KO5A 5K1ZA 2FZVA 2R1TA 5T4HA 1FBTA 2JFBA 3A6KA 1JFFB 1USUA 3M1AA 4LY9A 4MPRA 4HQ6A 4DCTA 3CG4A 3PJRA 3Q15C 1T8WA 1RPAA 4ER0A 1KY3A 2AUNA 1XD2B 3U56A 2R7AA 3QKTA 1JPNA 2WIKA 1ZL0A 1EIWA 1UANA 4QM6A 1HKHA 1E1CA 5ADHA 1ACMA 3SJUA 1OTHA 2XECA 3DGFC 2XCTB 3LL4A 4KR0A 4B46A 4L8WB 4JCCA 4KI0A 5HTKA 5JEDA 2PVCA 5GGXA 4Z9XA 4LCJA 4NBWA 1U9IA 3L8FA 1DFHA 1QPZA 4NYIQ 3D6HA 3HVKA 2B8TA 4LFCB 3RVJA 4IS2A 2QNIA 2VYFA 3C6YA 4Q5IA 4ZZ2A 3PX2A 2W90A 3ETGA 3Q5EA 4J4HA 3G8DA 4XKJA 5K6AC 3BIJA 3IEXA 4PFJA 5HKAA 3OJWA 2BE9A 2QX6A 2C3OA 4HB2A 4DR7B 2ZSEA 4JLPA 4PGMA 1EXVA 4PG6A 4Y2HA 5CM8B 1XA3A 1VBFA 1Y6FA 3QSYA 5LQNA 2ZUBA 4NMXB 4Z4CA 4I1PA 1YU6A 2WSSD 3NNNA 4HAUA 1KAGA 2DSNA 2ZSDA 4J1NA 4WKOA 1P7WA 4DYDA 4DV2B 2EX4A 3LW7A 4HEA6 2P2SA 3BEDA 4MQUA 2GYYA 4O4HA 4UXHA 5DIFA 4ZVSA 1EHYA 1JQLB 4K87A 2L82A 2COUA 3T5DA 5WRFA 4BFXA 1RPZA 4N5NA 3PZRA 1YRQA 1IXKA 1I0IA 3KXPA 3CFYA 2H3HA 3A26A 5DHAA 4EX7A 1H65A 3E4DA 2C5EA 3KCNA 3OM1A 3TJMA 4ML3A 4QGFA 5SY6A 1VA5A 2FSVC 4PONA 3DMTA 1GZSA 3U4AA 4NOLA 3PGMA 1P77A 2HIGA 2YZKA 3FOBA 5CAEB 2V0CA 2FR0A 3CQ9A 1SM4A 3DAHA 3DEHA 4Q6BA 2SBTA 1ZK2A 3K9NA 4C6RA 5TR9A 2PPVA 3BH7A 5J5VA 1F14A 3IEIA 2QAGA 5ALVA 5EKDA 1IB0A 1Y6JA 4B2YA 4LJ5A 2HSDA 2O8BA 2HPAA 1I3OA 1V3TA 4BAUA 2HA6A 3OWHA 2C82A 5FADA 2ZUDA 2TS1A 1BHO1 4EGCB 1EBFA 2O3RA 4BMVA 4MNTA 1F8YA 3DW3X 4GE0A 3I4CA 3RGGA 1K7EB 3LWZA 4OP1A 4N3GA 4NCKA 3ER8A 3BILA 3W3AA 5I7EA 3HEAA 5EZ5A 3CU5A 1DJLA 3SDBA 3N2YA 4AKGA 5JZMA 3MVEA 1P2UA 1TZMA 4X3OA 5K0ZA 5TT0A 2GN1A 1QVAA 3KFXA 3C6ZA 4YJDA 1I1OA 1ZCAA 2DFNA 4GRAA 4NEHB 3P97A 4US2R 4ZGWA 3WZLA 5LN1A 4H0FA 3RHFA 2IJGX 4PLGA 3T7SA 1N9GA 2OCBA 1XN4A 2VUHB 2X4LA 3WNBA 3WKBA 3DTVB 1P0PA 2A1TS 2O7SA 4U2CA 4IINA 4C0JA 1U0HC 3H1FA 5LPNA 4FCTA 1M34A 3G0DA 2QLLA 2HBQA 2Q99A 1UJ4A 1V41E 2GCGA 3DO5A 2BR4A 3PVZA 4XB6B 4PCAA 1PKXA 5IYZB 4R81A 1GITA 4UVDA 5ECWA 9ABPA 2AI1A 5B2ZA 1AX9A 4XPZA 1I2BA 2PMKA 2FRXA 4BIMA 3PD1A 4L57A 2HSEA 4HWSA 5D6NA 3AYZB 1ZU4A 3IB3A 4PTZA 2O8DB 2VYCA 1A98A 5EHGA 4A9AA 1GZDA 1IY8A 1E63A 5LP6A 2WWWA 4IHJF 4MXDA 4MUXA 5HSGA 4P81A 3LRTA 3BRQA 5AKHA 4GW3A 3LP6A 4RF2A 5D01A 1G4HA 3AKEA 1CVRA 3AFHA 2VEOA 2AOVA 4Q4JB 3PDWA 3SQOA 2GCOB 721PA 4C4PA 1RR6A 2XVYA 4KP7A 2WJIA 4FFPA 2A84A 3LIIA 1Y6QA 4IPTA 4RM2A 1ZVVA 2FWAA 2QM7A 3AU8A 1M7GA 1FLVA 1G20A 2ZVDA 2Y1XA 3E3AA 3FDZB 3GEPA 4LC0A 2GHQA 2QE7D 2D7CA 5K2MA 2XTZA 2CL7X 3UT5A 4DSZA 3QPUA 4XWKA 4JXKA 1I1NA 1M2EA 4YUAA 2NO5A 1O0CA 4QT0A 1TIPA 4OHVA 4HDMA 4UZFA 2YWJA 1MJ5A 3TLEA 5FB3A 3GJ3A 4KQ6A 4P84A 4AXXA 1TGYA 3GLHE 1R8XA 2XGJA 1PLKA 1EE2A 2BFAA 3ITEA 4ZOEA 2DYKA 4HNGA 2GPBA 3PFGA 4MZDA 3ZTYA 4JKYA 2FUEA 1ZC3A 5TPZA 1C7EA 3HCPA 3C45A 4DCNA 4P53A 2HWXA 1QOPB 3QP9A 1NXPA 2YHSA 4OFWA 5TMEA 4XYLA 5FNVB 1ICIA 1MUUA 3EGVA 5IM4A 2O2EA 2BKVA 2XTMA 1WF6A 2ADMA 1XCPA 1LLFA 1M2VB 3GOHA 3DHYA 3HCOA 4OAPA 4O4IB 3NDRA 4UU0A 1XVUA 2VRCA 1AGNA 2W6NA 2D0OB 1X92A 1DC7A 3OE1A 4I8DA 1B8UA 3T7JA 4A8JC 2Z09A 4ESVA 5ELXA 3CPHA 4LX8A 1QRTA 4ETWA 1DU4A 4KPUA 1DAGA 1MDFA 3DUFA 3P8ZA 3QHQA 4FFDA 4FMPA 1ACLA 1IJEA 2C03A 2PZLA 2Y99A 5C8XA 5JMTA 2CHEA 4MS1A 3VSEA 4XFKA 1DOZA 1YO6A 2QPOA 2RB4A 2I6FA 1EBBA 3EC1A 5TEVA 1ZICA 1MEOA 2J6CA 2GS9A 2R6GA 5FIUA 1V5GA 3TRJA 4LAFA 3OPXA 4UAGA 4II7A 3AKCA 4ARAA 1UJ2A 2O2YA 3IURA 1KP3A 4JI0B 1RWMA 1UMDB 2WU3A 1YS7A 3BXZA 5F4ZA 5KSZA 1EG2A 2J0UA 4DLAA 1UM9B 4ENPA 1H93A 4CN9A 5DX1A 2CK3D 2X13A 2YYZA 4LRTB 4NOJA 3UJHA 4ECEA 1J2TA 2HZ7A 2FMFA 3M6UA 3DV9A 3AF5A 4M8KA 4ZJZA 2YRFA 1BXKA 4MTCA 1QU3A 1NX6A 3TW0A 1GXSB 5C34B 3V5NA 1VPEA 3CB2A 4Q24A 3UUFA 2Z3VA 2YWCA 5KS2A 4NXNB 3ELBA 4JC4A 4KH1A 4HN4B 3WJAA 1SWWA 2ZBUA 5EHIA 4YJ2B 3SP1A 1PJRA 2FCRA 2X9NA 4RIFA 3GQBA 3GLKA 2GAIA 2I6SA 1ZOIA 1TEXA 1QRSA 2CLKB 521PA 1R1DA 4DQDA 4EL5A 2WYHA 2Z2YA 3WRYA 1OFUX 4TLCA 1RWBA 2DTDA 1HO3A 4AVYA 1N9KA 3LKVA 1NAIA 4HZGA 4XE5A 4EPYA 1X7YA 2X58A 3HFJA 1QWSA 2NPOA 3GLGE 4PQFA 3U6KA 1T9HA 3JASA 2GZHA 1EESA 1JR3A 2YINC 3T9EA 2UVQA 4I6JA 2NXEA 1QO0D 4DJJA 1F51E 4RENA 5T8KC 3NTQA 4QYIB 3WGMA 3K70C 1N33B 4TYWA 2VYNA 1WHSB 1KI9A 4MQBA 1E3WB 1JBQA 4MV5A 1YQGA 1DJPA 5CLLA 1RW4A 1T15A 1Q22A 2YN0A 2QEQA 3AF3A 3NVAA 2AI3A 3TCKA 3UH1A 4PO9A 4BGEA 4NAHA 3LFHA 4HQLA 5TQJA 3RTDA 1GGVA 1EVQA 2IPNA 2M6LA 2FFAA 1KK0A 2IYYA 4I1YA 2P35A 1Y5LA 5HF5A 1WXFA 4AY6A 4Q1EA 3DULA 4EFLA 1RM3A 2FXVA 4FCCA 2PUEA 3RVRA 2XTNA 5FJJA 5FDFA 821PA 1NV8A 2BE7A 2EW8A 4BB5A 5L3ZA 3O8CA 4HDQB 1NJSA 1M5RA 4MMXB 3FYSA 4LJAA 3TR6A 3UANA 5TX7A 1LSUA 1V1MA 1WLYA 1OLXB 2PZJA 3DFUA 2QKYA 3OCZA 5EZSA 3SSOA 1L1QA 2F90A 4FQ7A 2IYLD 4CCYA 3HR7A 4Z51A 3UBTA 1PUIA 3H97A 1T2CA 4P54A 3ZYZA 5B7QA 3ZIUA 3GUZA 1H2RS 3KYIB 5AOVA 4TL6A 3D4LA 1FRNA 1H2FA 3SR3A 1P62B 3WSWA 4DT1B 5D86A 1A8HA 2YXBA 3BFPA 1BFDA 1VFPA 4FSXA 2J0QA 3SBEA 4OXXA 1W5BA 3EXFA 1U02A 1L4UA 3IA2A 4DLWA 5J47A 5I51A 4XFJA 3DV0A 1O0SA 4LYFA 1AO3A 2C2KA 4RIHA 3HXKA 3MTIA 4NKRA 1GCAA 3ZHXA 2ZTUA 4OQ4A 4IY1A 1KKUA 1JU3A 3D8NA 3SDSA 1YR2A 1S5PA 1Q50A 4GSKA 1L7MA 4E88A 3H6KA 3VM6A 3OZUA 1G38A 4F6LA 4FFRA 3VSCA 4EHDA 3FPFA 1NN3A 2YVAA 4UVEA 1DDOA 4HLUC 4X7RA 4CKWB 4AZ0B 2X2OA 3DH0A 5FUWA 2YY5A 1FUUA 1Z88A 1LXCA 3IV6A 3AVTA 3GG9A 2X5NA 3L06A 3IR5A 4FOSA 5B1EA 3NG1A 5FO0A 1UBLS 4I1OA 1U8YA 1F2UB 2JI6A 2AD5A 1A7AA 4YRLA 3UJBA 4BOYA 4EARA 1YC2A 1YGPA 1P1RA 3FFAA 1DB3A 3G2HA 5D1NA 1T0UA 4LMBA 4P0QB 4P22A 4WEOA 4PN3A 1PTJA 4RL4A 4XTCS 3V7YA 2EL9A 1L7NA 1UBRS 3FROA 4CEHA 2JPDA 3N87A 3ZWDA 4CEJA 1ONOA 1T5HX 4ZEMA 1ZJ4A 2GYUA 3KSDO 3EFEA 5FLYA 4C22A 5LZ2A 1O57A 4EYSA 1JHUA 5ADUS 1P1KA 3KSRA 1J20A 3OPVA 1RYBA 2XNHA 3UVEA 1T0JB 3UOGA 4GKKB 2BJHA 3VYSB 2XXAB 4FNMA 2AK2A 2Q6IA 1L4FA 1C3VA 1W36D 3QFTA 4MCAA 3NJ8A 3PHBE 1GGKA 3WRXA 3P4YA 3QJYA 4A8HA 5IZCC 4X1IA 3NIGB 4L02A 1G9SA 2OQIA 1WTAA 4QASA 3V00A 2HCTA 4YUWA 1B76A 2WPDD 3QLUC 1EX6A 3R2JA 4LOHA 3QNUA 3WJ2A 3NTLA 4F4IA 5KIAA 5F2EA 4H60A 3ZDBA 3GR6A 4YJHA 2HO5A 3P71T 4OXQA 4E46A 3RUIA 1N0VC 4C43A 1MB9A 3C4VA 2C8LA 2D0IA 4LXTA 1RXIA 4OM8A 3SC2B 1HT2E 1TM4E 3WL4A 3QTTA 1XQWA 3ZBQA 4IUDS 4BEVA 4WCFC 2NQ2C 4BNMA 5GJBA 2PGXA 2J3JA 1NG9A 5CYGA 3B82A 3P5BA 2ZJFA 3FY4A 4CFYA 1G2QA 1E2JA 4M1TA 3NDPA 3KALA 4MRMA 4ZVUA 1H8ED 4DMCA 4AL4A 1TM7E 1E99A 5EPEA 3SS8A 4CM6A 5AW0A 4RIGA 1Z2EA 4Q1FA 1P0MA 4QHTA 1OAKA 1JALA 2I3GA 2PJZA 2B4TO 2Z4TA 3CF6R 5KHAA 5EIFA 4XVUA 3O21A 2CL0X 1UJ5A 3JWHA 3V97A 4BZZA 2BI4A 1NC3A 3QITA 4FILA 1L5HB 2WWGA 2XB8A 4WH0A 2C00A 4IS3A 3WIVA 4OHRA 1O2DA 2FP3A 4MDHA 4Q9IA 4ZQHA 3BE4A 5AKGA 4B9AA 2FF7A 5KINB 4JJKA 4FYMA 2OHHA 3I30X 4JUIA 4PE5B 3VR3D 5DM1A 1EB9A 4M21A 1Y3FE 3QG1A 1XROA 4LXHA 5IAJA 3UAVA 3UICA 2WYUA 3UCEA 3DHNA 3ZXUB 1YQXA 3SD7A 5A4JA 3UFXA 1Y4DE 3OE7A 1E6LA 1WB5A 1A9QA 5B55A 3H0EA 1SWVA 1L4YA 3CS3A 1TJ4A