3HCEA

Crystal structure of e185d hpnmt in complex with octopamine and adohcy
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLDAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition of physiological substrate noradrenaline by the adrenaline-synthesizing enzyme PNMT and factors influencing its methyltransferase activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 87
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3hceA00
1AQJA 3BGVA 5EMKA 5KVAA 1EQAA 2ZIEA 3E8SA 2C7RA 5EHIA 5LR6A 4C05A 1NW5A 4PIPA 4GEKA 2Y1XA 3EGVA 4C08A 4AZWA 5CUQA 3AXSA 4C4AA 3DH0A 3SM3A 1G8SA 3G2MA 5ERGB 1WXXA 3GJYA 1L1EA 1JTEA 2XYVA 4E2YA 3E05A 4PYNA 4RTMA 3OFJA 2IDKA 1KPGA 2A14A 3JWIA 1VL5A 2LD4A 3NVMB 2PXAA 4HGZA 3KQMA 4QQNA 3EVAA 4CKBA 1JR4A 2I62A 3C6MA 3CJRA 5FHQA 5ICFA 2G72A 1XXLA 1X1CA 1F38A 2G8NA 3HA7A 4GF5A 3EVCA 4DCGA 1QZZA 1O9GA 4IWNA 3HM2A 1I9GA 3BXOA 2OB1A 3IHTA 3ID6C 3B7PA 5HOQA 3PX2A 3FPJA 4GBED 1N7IA 2OXTA 3I64A 4QDJA 1Z3CA 3FPGA 2YX1A 3GRVA 1YB2A 2GPYA 4QDKA 5HIIA 5E8RA 2B3TA 1HNNA 2XBMA 3DLIA 2P3QA 1G6Q1 1YFLA 2PT6A 3I9FA 3MQ2A 4FS8A 3EVFA 3JWHA 4P58A 1EAMA 2ZTHA 2OYRA 3UJBA 2WA1A 5LQAA 4PGGA 2C7OA 3OU7A 5EZSA 3DP7A 3G89A 3KQVA 5EZQA 4KDRA 2IH2A 1XVAA 5DWQA 2F8LA 1R8YA 3P8ZA 4RTQA 1SQFA 4DA4A 2YQZA 4U7TB 3HCFA 2O0LA 3G88A 1YUBA 3KQPA 4RVHA 3SSOA 5K8VA 2ZBRA 1B42A 4HTFA 1Q0TA 4GOOD 4KVZA 4P7FA 5K0LA 3SSNA 4AZSA 3R0QA 1X1DA 3IEIA 1DUSA 2ZZKA 1T43A 1UFKA 2IIPA 5EOVA 3FRIA 3UA4A 3GCZA 3JWJA 4OQEA 4HSGA 5T64A 2AVNA 1FPQA 4RV9A 2NXEA 5B1SA 3BUSA 3FPHA 3K6RA 2IH5A 3KR1A 2IH4A 5DTMA 3LDFA 4YV1A 5EHGA 2P8JA 3R6TA 2PX2A 1I4WA 3KPYA 5EMLA 2PX5A 4XUCA 5EQJB 4MTLA 1L3CA 5E2AA 4RTNA 4KWCA 3TM4A 4BLUA 2XVMA 4DZRA 4EMSA 5K09A 2BR3A 3G8BA 3O31A 5LQRA 1FBNA 5EIWA 3PFGA 2BR5A 5KYGA 1WS6A 2VDUE 2VDVE 4R8SA 3SSMA 3GO4A 2H00A 3DXZA 4WXHA 4QVGA 3EEOA 3AWIA 3IV6A 1VLMA 4FT4A 2CMHA 3EPPA 5HFJA 4AX8A 3TMAA 3AY0A 3HCCA 5DT2A 3MCZA 5CIYA 1EJ0A 1XJ5A 2EX4A 2VS1A 4M7RA 5EKXA 3UJDA 4E70A 3SVZA 3G2PA 3OZSA 2PBFA 2GLUA 2B25A 2YXLA 4Y2HA 2H11A 3CJQA 5K0EA 2IBSA 1P91A 2EJUA 1AQIA 3EMDA 3OU2A 4L7VA 2NXJA 1WXWA 4PYKA 2WK1A 5E2BA 4C06A 4EQZA 5LQUA 10MHA 3ELDA 5DM4A 1R6AA 1WG8A 3OZTA 5EEGA 4OBXA 3C0KA 2FHPA 1VPTA 5DTQA 9MHTA 2JG3A 2ZZNA 5CCBA 3U81A 3T7TA 3HTXA 2ZLBA 4BLWA 3UJ7A 3B5IA 3EGIA 3PT9A 5CVDA 2GA9A 4CTKA 3MERA 3KPWA 5CVJA 2ZWVA 4UOEA 3B89A 2VP3A 5HEKA 2HV9A 5P8WA 4LWOA 3THRA 3TM5A 4CWAA 5GIOE 3NWBA 4G56A 3LSTA 4V0RA 2G1PA 1NT2A 3NMUF 1WZNA 3MTEA 3VSEA 2NP7A 3KQOA 5CVEA 1X19A 3HCDA 4ISCA 2B2CA 3NW9A 2VZ9A 3PB3A 3QV2A 4MQ4A 4F85A 5FTWA 4RTSA 1SVUA 2Z6AA 4QPPA 4H0NA 3RODA 4E32A 5DM2A 2R3SA 3EVBA 2P40A 1V39A 5DXAA 5T67A 2JHCA 1HMYA 2O07A 4GC9A 5LQCA 4RTRA 3OE4A 3P2IA 2V7EA 4OX9Y 1R8XA 3BZBA 1P1BA 2AOVA 1G55A 2FYTA 2OO3A 4DKJA 1P39A 4E2XA 4MIKA 3UJ6A 2CWWA 2DPMA 2P41A 4RYLA 2GAFA 3G2QA 3EGEA 2AOWA 2O06A 4DF3A 4GOMD 2AVDA 3VYWA 3BWMA 3DXXA 3P9NA 5LQNA 3MCTA 3OFKA 1DCTA 4B17A 3O4FA 2PXCA 2ZIGA 3P9IA 4PCLA 1KHHA 4RVGA 4AZVA 4DM3A 5HZMA 3DUWA 1D2GA 4PYMA 2R6ZA 1ORIA 2UYQA 4HG2A 2HR1A 2PGXA 5CVUA 1MHTA 1N2XA 4PIMA 2AOUA 2OY0A 3FUWA 3TPZA 2G71A 1NW3A 1OR8A 4M37A 3SMQA 3TQSA 2QE6A 3M70A 5M5BA 3X0DA 2QRVA 3FZGA 1G60A 2JJQA 3KR2A 2PSSA 3HCAA 4PYIA 1JTFA 3ER9A 2UYCA 3PLAE 3DMGA 3G7UA 3P9CA 1O9HA 3ERCA 1NV8A 3KQYA 5BXYA 4PGHA 1VQ1A 1AV6A 3NVKI 5MHTA 5E1BA 2PKWA 5GM2A 3LCUA 3DLCA 2ADMA 2I6GA 4R05A 4RTPA 1TPYA 2GH1A 3L8DA 1ZGJA 2ZBPA 4BLVA 2HMYB 3CCFA 2AN5A 1MJFA 5EMJA 2ZWAA 2QM3A 2PJDA 4PWYA 2IPXA 4FSDA 4KIFA 3SGLA 7MHTA 1ZGAA 5FWDA 4A6DA 1PJZA 2ORED 4V0QA 5EGSA 1DL5A 5FHRA 1XDZA 3HA5A 4KDCA 3NDIA 3E7PA 5GP1A 2CL5A 4X61A 3RIEA 4CKCA 4YUZA 2AN4A 1BHJA 2JH8A 1EG2A 1KP9A 3ELYA 5E1OA 4OQDA 4QTTB 5DSTA 2IBTA 2BR4A 1Y8CA 5DX1A 3LBFA 2CMGA 2CKDA 2N47A 1JQ3A 4P7KA 5FWAA 1RI1A 2O05A 3A7DA 3CBGA 3D2LA 1KPIA 2V74B 3EVZA 3GRRA 3LHDA 4RVFA 5FADA 1JSXA 1SQGA 4RTOA 1RI3A 3GRYA 3ELUA 4MWZA 3G2OA 1O54A 1F3LA 3NWEA 2ZULA 3DR5A 1AF7A 3EVGA 5K0BA 2JHPA 3CC8A 5EKUA 5FULA 2OBFA 3P2EA 3RW9A 4Y30A 4JXJA 1VIDA 5T6BA 1IY9A 2FRXA 2AOTB 4QPNA 2PV0A 1ZHFA 3O7WA 3KR9A 4A6EA 3P97A 5E1MA 3MHTA 2P35A 3BGDA 5E1DA 3CJTA 1ZQ9A 5LQJA 2ESRA 3T7RA 3T0IA 1XCLA 4ER0A 3P9KA 4OBWA 5EIFA 4HH4A 3NDJA 4PONA 4XCXA 5DSXA 3ER8A 5EG5A 4R6XA 3ME5A 2Q41A 5HIKA 2ZFUA 2P7IA 4CKEA 1X1AA 2HWKA 4C04A 5BW5A 2BZGA 2P7HA 3GGDA 1P1CA 2YUIA 4X41A 3I58A 3C6KA 5FA5A 3MAGA 1RI5A 4RTLA 3PFHA 5FQOA 1RI2A 2WA2A 4M38A 3OE5A 3M4XA 5K01A 3OCJA 5GINE 5DTRA 3R3HA 2YXEA 4YUYA 3B3FA 2O57A 3BKWA 2ZZMA 3P2KA 4P7GA 5D1HA 3HNRA 3VC1A 4IKPA 3KR0A 4KRGA 4EVIA 3B3GA 4X60A 2BM8A 5GIPE 3FUXA 3KQSA 3LCCA 1IXKA 4F84A 1WY7A 1TW2A 3PVCA 1M6EX 3S68A 5ICCA 1NKVA 1UIRA 1R74A 1BC5A 2E5WA 2EG5A 2K4MA 3GRZA 3R24A 3REOA 3SR4A 5BW4A 5HIJA 3FTCA 4O29A 3KU1A 4PYQA 4F86A 4PYJA 1XDUA 3HVHA 5GM1A 1EJ6A 4EKIA 5FCDA 4CXMA 3G5LA 3FUTA 1M0EA 5K03A 1NV9A 5F2KA 2IFTA 2XYRA 2Y1WA 4E2ZA 1XDSA 5EVJA 3NTVA 5DPMA 2NNWB 2PVCA 2VDWA 4R6WA 3V97A 3LECA 2QY6A 2YTZA 1NBIA 1QAMA 2ONZA 3UFBA 4OA5A 5DX8A 2IP2A 1QAOA 1L3BA 4KW7A 4EKGA 4FT2A 3SX0A 2AS0A 2B9EA 2FPOA 2JHAA 3HCBA 3MGGA 4XUDA 5E8JA 3FTFA 2XYQA 3KQTA 4IV8A 1KPHA 4RVDA 2OPBA 4E30A 2KW5A 2QYOA 3LX6A 2PT9A 4RTJA 1G8AA 4GC5A 3M33A 4YUVA 1JG3A 1QANA 4YMHA 3I53A 1KR5A 2I7CA 3HVKA 3KQQA 4WVLA 4BP3A 1U2ZA 5LSAA 5ICEA 4OA8A 3CVOA 2EFJA 2HNKA 4X63A 4ATNA 4RWZA 1RJEA 2IDJA 3DOUA 3WSTA 3M6WA 2XVAA 3C3YA 4PCAA 2DULA 5KS2A 2FCAA 3G8AA 4HGYA 3UA3A 4YV0A 1NE2A 1XTPA 3P71T 5E9JA 3TKYA 3ELWA 4E33A 5F2NA 4MHTA 2NXNA 3M6UA 3MB5A 2PY6A 4YUWA 3PTAA 5CM2Z 5DM0A 4YUXA 2AR0A 5BP7A 4PINA 3E23A 1ORHA 3G5TA 2EJTA 3K0BA 3GDHA 1G38A 2AOXA 5DRTA 3NJRA 5K0CA 1N7JA 1BOOA 2PLWA 2BM9A 2I9KA 5K0JA 3TLJA 3UJAA 5FUBA 3HVJA 4U7PB 3MTIA 4KIGA 5H02A 1PRYA 1JQDA 1I1NA 1QYRA 2ZW9A 3EVEA 3LCVB 3TKAA 2ZIFA 3LKZA 1R18A 4NECA 4AZTA 2JH9A 5HIMA 2Z6QA 3A26A 3GNLA 2YR0A 1VE3A 2ONYA 5EMMA 1D2HA 3GXOA 3LDGA 4PYOA 3HA3A 5EC8A 5K0FA 3A27A 2PWYA 2QRVB 3HCEA 5IH3A 3FTEA 3BGIA 3BKXA 5C0OE 5E9QA 3UBTA 4YMGA 4E31A 2ZVJA 2G70A 3CGGA 3LGAA 3VC2A 1L3IA 4BP1A 3ORHA 5DM1A 1H1DA 5K05A 2UYHA 4HC4A 3AJDA 4XUEA 5EEHA 4ER7A 1JSZA 3FTDA 4YV2A 1FJXA 4BY9E 4Z2YA 1NBHA 2OB2A 2PX8A 4FP9A 3TOSA 2UYOA 4LWPA 2ZBQA 5G02A 3M6VA 3QOWA 2Z6UA 3FPFA 3EVDA 3FRHA 3FUVA 3OU6A 1YFJA 3KQWA 3DMHA 4IV0A 3F4KA 4X1OA 5DX0A 3UJ9A 2YVLA 1KYWA 2ZSUA 4RTKA 1SUSA 2FK7A 5CVVA 5GOZA 3H2BA 1XCJA 1IM8A 4GOND 3UZUA 5KQSA 1UWVA 3TR6A 1JG2A 1FP1D 2AN3A 3LBYA 3M6XA 3BT7A 4ER6A 2H1RA 1YZHA 3KPUA 1VP9A 3QOXA 1X1BA 5IKMA 5U4XA 2BH2A 1KYZA 4HRAA 3EEYA 3KHKA 2UZ4A 3JWGA 2NP6A 3T7SA 1BKYA 1D2CA 1ZKDA 5E9WA 3FPEA 1RI4A 2GS9A 3AXTA 4M36A 5C1IA 4ER3A 3DXYA 1KXZA 5K0GA 2ZCJA 3ANXA 1NW8A 2NYUA 5CCXA 3DTNA 5ICGA 2AOTA 1NW6A 3BWBA 1L9KA 4RX1A 3I5UA 2NXCA 4ER5A 4QQKA 3PS9A 3TFWA 1YF3A 4LG1A 4CTJA 2IGTA 4FZVA 4C07A 2OZVA 1YZ3A 2C7QA 1Q0SA 4GUAA 1RJGA 3GWZA 5KQRA 2GB4A 3BWYA 3OZRA 3HP7A 2OKCA 1JQEA 3LPMA 5D1NA 2HTEA 3BWCA 2C7PA 3KKZA 4FSXA 4HTFB 4PYLA 3A7EA 1INLA 4POOA 4FGZA 1KIAA 2P1DA 4PNEA 3EMBA 2PX4A 3UJ8A 4GQBA 1R00A 1JG4A 2B78A 3LDUA 3GIWA 4E2WA 1FP2A 3A4TA 4FR0A 5DRYA 2P3LA 4K6MA 5EPEA 2YXDA 3SXJA 3OPNA 5GWXA 5CD1A 1SG9A 5F2OA 3FYDA 3HVIA 2ERCA 2AZTA 4RSRA 4AUKA 3PX3A 1SKMA 3Q87B 1SUIA 1VBFA 1RJDA 8MHTA 1M6YA 2PWPA 4LECA 5DLYA 1QAQA 4ZTBA 4R8RA 4DQ0A 5K0NA 1EIZA 3C3PA 3DULA 3UJCA 3LL7A 3A25A 5DXJA 5JUWA 3FUUA 3TRKA 3FYCA 5FQNA 4C03A 5C9ZA 2FK8A 3V8VA 5JR3A 3KPVA 3Q7EA 4DCMA 1JG1A 4EK9A 5HILA 3GU3A 1TW3A 3GRUA 3B3JA 3THSA 5LQKA 3HEMA 3IYLW 1VP3A 4QVKA 4DMGA 1RJFA 3R9XB 3DMFA 1ZG3A 3KPJA 4QTUB 3UWPA 2AOUB 2P3OA 2PXXA 3LKDA 5FA8A 4P7JA 1NW7A 4GOLD 3CKKA
chains in the Genus database with same CATH superfamily
2K2WA 2Q4BA 3EAFA 5FA6A 4DAEA 1JV2B 2HT1A 3GP3A 3IAS6 5KNCD 1ISHA 4FYYA 4EI8A 1Y3IA 4H15A 4CG1A 1TA4A 1R9NA 4BB6A 5C81A 1FNCA 4Q4HB 2GAOA 2IV2X 2PAAA 4GYKA 4KH0A 1UXGA 5LDHA 1T8RA 1Q0ZA 2SKDA 3PZBA 4KN6A 4G1CA 4V0NA 4G5FA 3FB1A 3I5XA 3RYFB 5DWVA 4PEVA 4OTZA 1BMTA 3IVGA 4MWOA 4XQGA 5CW1A 4ZAZA 5FTJA 2OV8A 2WG0A 4C6TB 1CY8A 3CKLA 1AV7A 2WSMA 1SWWA 1QHHA 1XJQA 3KDPA 4RNDB 4BASA 1LPMA 2X4GA 4CV3A 3KVNA 3B36A 4UBKA 2PXAA 5JSZA 1HNZB 3P94A 3EVAA 2PFSA 3HB5X 4JV5B 3IP1A 5IF9A 3RC3A 2PT5A 1G4HA 1O08A 5JHGB 1PF7E 1F38A 2WUEA 2XOEA 3AKCA 4WL0A 4E4YA 2F3QA 5K8TA 3HA7A 5LUAA 2VDOB 4L75A 2IHKA 2QN6A 2ZPUA 3JQFA 1OV6A 1N7GA 5KWEA 2CLFB 3DWIA 1HTWA 3KKQA 3PX2A 3EHEA 4PO1A 4EB3A 1I36A 4I9UA 5H9VA 3GLGB 3IKTA 3ZXUB 5HIIA 1CLEA 1W4ZA 3PUIA 2H54A 2GCIA 3WLMA 3BILA 1NPYA 1E3SA 3HUDA 3PGKA 4IM7A 2ZXEA 1QF9A 4R9RA 1LC3A 4X1IB 1PZHA 4KPUA 4E08A 3N5KA 4UTRA 5AKZA 2QV7A 1CRLA 2OYRA 3UJBA 1SGWA 2ALJA 3DT9A 3BJIC 1Q0LA 1Z2OX 2C7BA 1XX6A 4CIBA 2OTCA 2V7TA 4UDOA 1SKYE 1XMVA 3CXRA 4BO7A 1RPZA 4MX8A 1W7AA 4GGOA 4R68A 3KUUA 3WGTA 1MO3A 1WBDA 3OLWA 4PXYA 3TRDA 1EG7A 1BROA 3BMOA 4YJKA 1NUTA 4JI2B 2Y0EA 4DIOA 2FX2A 4PAOA 4DLTA 3L46A 1G5PA 1R8QA 3BA6A 2BEUA 2RHCA 3L6BA 1QQ7A 3O3NB 3G1WA 4ZT6A 3TTWA 4C01A 3D7MA 3TZ6A 4EFKA 4YRBA 1NTOA 1I0IA 4C4RA 1EKXA 1PEAA 3MJ4A 4RV9A 3TL2A 4BQSA 1A5SB 2X2EA 3OZBA 4QTYA 3SIRA 1SVMA 3VZPA 1QP8A 1F8FA 2ZYGA 3KZ1E 4MS1B 3NUZA 4NE9A 4NENA 4EPWA 5EIXA 1J70A 3GQBB 4EKDA 1Y48E 2GBLA 4PPGA 4XD7D 3G0IA 4CMHA 4MV8A 3TB4A 4BLUA 4EI9A 5JJCA 1XNHA 2V3WA 4XWYA 1C9KA 2ZB8A 1VMKA 3VGPA 2P4UA 2IDZA 1KQNA 2LW7A 2QZ4A 4BJHB 4XJXA 3U3RA 1HT3A 2FW1A 3UCEA 1HFEL 3IPXA 4DXAA 3ICQB 4REQB 1F8UA 2BGGA 4QO7A 1ZM2A 1KO7A 1S2DA 3O4VA 4IIJB 5F33A 3IDOA 2ZIXB 4EQ6A 3C97A 3NEJA 4ETMA 4FFPA 4F93B 3IT1A 4N3GA 4X0EA 2NTYC 2ODNA 1ZHHA 4MKHA 2DM6A 1KI2A 3PR1A 3ZV3A 1TLLA 2IBMA 4J0DA 3WRXC 4ZO6A 4FOLA 1P91A 1IXSB 2WHPB 4UPEA 2IBSA 1KEWA 4HXEB 5C5CA 4C06A 4FB5A 3D7KA 3FH0A 4WNCA 3INTA 1PGNA 1GPKA 4DV6B 3UFXB 3OZTA 2JCXA 5EEGA 3WXBA 3ZTWA 4NZMA 5HNKA 1IBKB 1CVRA 3H9JA 5DTQA 2O2ZA 3IEVA 2QAGA 3QWFA 4DNPA 4KOEC 3JX9A 3SFZA 3HTXA 1NURA 1Z5PA 2W00A 4AYWA 1H8EA 1ZNYA 3B5IA 1I7NA 4Y6PA 5CVDA 5F4ZA 2WAXA 2A67A 4IZHA 1RAGA 3BH0A 1C3EA 2MMCA 2ZWVA 3NQ41 2HV9A 4RXMA 1V3TA 1WR8A 2ZSJA 3DEIA 4OX9B 2ZVPX 1GJRA 2HMUA 3OE1A 4KSYA 2GVNA 1DKQA 3TI7A 3VR6H 4AMBA 1S2GA 1X19A 3TXAA 2ZS8A 3LCRA 4N9QA 3U1BA 2P5TB 3MRVA 2Z3ZA 4IGAA 5FTWA 3RODA 4UUQA 4C4PA 2GAAA 2WICA 4FD3A 5JAOA 2G0TA 1P1BA 2FYTA 1YU9A 4ZYVA 2YRXA 1T9DA 3BXZA 1W5AA 1SOAA 1VMAA 2AK2A 3K1TA 4HYEA 2V7WA 2CE7A 2HNAA 4P5EA 1Y9EA 2XTNA 1AHHA 2NUTB 2P91A 4EENA 3EGEA 3RWBA 3AJAA 1B74A 5SY6A 1E9AA 2VATA 3SZRA 4TZ0A 4UHBA 1TTTA 4AN4A 1SBQA 4DQXA 2ZIGA 3EOBI 1NATA 4OP1A 2VAVA 4LDNA 2OL4A 1N36B 4N9WA 2AUTA 4AZ0B 4P4LA 1J8MF 1ESNA 1S9DA 5FTKA 4EI2A 4YRKA 4PIMA 1W9HA 3DO6A 4M37A 1C0KA 2P9YA 3H5OA 4A2QA 4GVLA 1IM2A 1JX6A 1K98A 4X66B 2AJCA 2ZPTX 1XXHA 2PSEA 1V8PA 3G0CA 3ICVA 4QUHA 4ZOAA 1UBGA 4B71A 1IN7A 1TOAA 1HDIA 1V16B 4A27A 4CUZA 2OCDA 1LGYA 1XALA 3QKWA 1Y3BE 3OQPA 5F5LA 1M2EA 3OMXA 1JQAA 1RRFA 4D0GA 4NV0A 2NSDA 3FYUB 4MDEA 3EUEA 4C7VA 3IBGA 3IKMB 2ZWAA 4NFLA 1Z4PX 2IPXA 1CF4A 1X13A 4UUBA 5TXGA 2FSUA 4A6DA 1Q95A 1V71A 3DOIA 4ZI5A 3OLXA 1XDZA 4LC9A 4Y6LA 1RCFA 3AEXA 2IZZA 1PNQA 4BBPA 4D46A 4PRKA 1TK9A 5IJ9A 5FBWB 2EHJA 3ELYA 5KTOA 1ZD8A 4RKQA 3I3SR 3E5NA 1KSHA 1ONSA 1X8LA 2VT6A 3W6NA 1QPBA 3RT7A 4BV8A 5LJLA 2NZWA 2LRHA 1B8UA 3CH5A 2NU8A 1Z7EA 2GM3A 2O7NA 5LYJB 2JFFA 5EPUA 1SKYB 1XMSA 3ZWWA 3FI0A 3E81A 1EFRA 2BHNA 3DWGA 1T2EA 3N3BC 3LHDA 4HN9A 1BGVA 3D1VA 4X00A 3F9CA 3ELUA 5LA6A 5AVUA 5BNZA 1OLUA 4J8PA 2IYXA 1I13A 2PEZA 2V03A 5B7NA 5JXJA 2EZUA 3PUVA 1SXJE 2ODTX 3NXSA 4JJ8A 4L8GA 1AF7A 4PYRA 4BO1A 1R6VA 4BP8A 1CYEA 4H7EA 4HUQA 2GWRA 2JAPA 4RFLA 3DVAA 4J2TA 4ZCPA 4AMYA 3OPVA 1JR3A 1JIKA 3Q6NA 4O0MA 1QV9A 2CHFA 4JZKA 1QMPA 2EG9A 2ORWA 4KDFA 1XF1A 2ACKA 1E6KA 4OUDB 2DWOA 4IFTA 3CLKA 2GCGA 3FPBA 4ZRDA 2WTNA 4I46A 5DWDA 3ZKWB 4N48A 1CEYA 3U6BA 2FMTA 1DO0A 3V1TC 4ZA2A 3NC1C 2HJ9A 4GVXA 3K8ZA 5AKGA 2A94A 2PZMA 3PT5A 5EIFA 1SXJA 3CLSC 2X41A 5EG5A 3COVA 1E5VA 2C9CA 2V8BA 3GJ7A 4KH1A 2IU4A 3NV9A 4YTEA 3H5IA 5JNWA 3GJ0A 1ZOLA 4P81A 1SZCA 5C5EA 2V0CA 4Q02A 3TVDA 5ENDA 3P27A 4IJVA 4U63A 4N54A 1LPSA 4XRGA 3I8SA 4P84A 2VQEB 2YVAA 5FQOA 1ZA2A 1LF0A 1EAYA 3IP6A 3HDGA 1M8KA 3H5VA 4H3VA 2EFCB 5ESXA 3OQ6A 3ZDDA 1UMCB 1W4LA 4L3OA 4V39A 4MROA 3NHAA 4EY6A 2Y1FA 3RSSA 4A0HA 1BDHA 3A1TA 5DTRA 4ARAA 4XPIA 4L7QA 2CGEA 2A0XA 3B3FA 4I50B 4C7JA 1TF5A 1J06A 1RLUA 1KEEB 1XD9A 4IEEA 5H3LA 3U7QA 2FUG6 4FLFA 1VA5A 4WXYB 4NLLA 1G63A 3T4UA 3FPAA 1Z8FA 3KQSA 2IKQA 4O4IA 4Q6BA 1XVTA 1ITZA 4XW2A 4QFDA 4AZ0A 3ZJ4A 1HFWA 3L8MA 2H7CA 2YASA 4RDIA 4B45A 2PUCA 3GRZA 4J7AA 3W8EA 3OSZA 1GZ4A 4JROA 1XHLA 3FIJA 5GINE 4MQEA 1ULZA 1ZD4A 2ODWA 3EQ2A 5CIQA 4YN3A 3SE0A 4J1SA 4HAZA 4Q3OA 5BV1A 1I2ZA 2P0AA 1SHZA 2I4IA 3EXG2 2DERA 1NV9A 3FOCA 3MS4A 1L9XA 2VDRB 1GG9A 2IL1A 2ZI7A 2O8FB 1IC6A 2VA9A 4RELA 1I1HA 3TBKA 2IXFA 5KREA 1QVWA 5CCBA 3R7DA 4LV6A 2DB3A 2IF2A 2VBIA 3MOIA 4I3GA 4S3MA 3RRXA 4CT0A 4DLRA 1E7WA 5AJTA 1WJGA 3V9PA 1B8PA 4OHVA 4Q4AA 4DIKA 4FFRA 5TPZD 2Y6VA 1NVGA 3FOFC 3FTFA 1V6SA 1S8FA 1YRQA 3KQTA 4PU0A 2JBWA 3HDHA 3X3HA 3BQ9A 1E60A 3RM3A 1T35A 3MJCA 2J9ZB 1Z0KA 5LN1A 3QU7A 2BV3A 1JHVA 1L5MA 4FZRA 4RTJA 4LJKA 3IHLA 5IBPA 3ZDBA 2GK3A 2REBA 4RW0A 1PX2A 3CRVA 4JJZA 1UUFA 3I53A 1XTIA 4WVLA 3LPLA 1J0XO 4XM0A 5KDOA 2NO1A 3ZY6A 1LZKA 1U6IA 4AJ1A 4OK6A 2IHJA 3V34A 2UUBB 1FSSA 2HU7A 2QIPA 1FTGA 3H2KA 4P98A 4R83A 3GLFB 1S3GA 4QDXA 2OBNA 1BQ4A 4J9UE 3EZNA 4UTZA 5E9JA 4EB0A 3K4HA 5ALHA 2NXNA 1ADFA 4RVCA 1KK1A 4I4LA 3ZKWA 2VJNA 3P0IA 2ATCA 2HQSA 2R96A 3KL2A 4RMHA 1HOTA 2GYWA 2R7AA 5BPHA 1T5OA 2QTVA 3WVNA 5KUTA 3DCIA 5JU6A 5J2UA 4IDOA 3H83A 1G6OA 2QL7A 3AILA 3KSBC 3EVEA 4PXAA 3ZWDA 3PJEA 4Z53A 1WSDA 2BFFA 4AO6A 3VYSB 1TGVA 3MF4A 1VE3A 3FGZA 1CE8B 4E2FA 2PQ6A 4OI4A 4ZV7A 2ATXA 1APBA 1K7EB 3LT4A 2Z4TA 3PE6A 3L7DA 1T9CA 5U4QA 1GR0A 5FYQA 4R3NA 1Y89A 4EA9A 1C8BA 4L6AA 2XMDA 4DNOA 5K05A 4BP1A 2QDXA 2AXEA 2Y76A 4BIIA 1O89A 3N28A 3IO5A 3KXLA 3QV1A 2YDYA 1PWEA 2JI4A 3GVIA 1UM9A 3U4QB 2VQSA 5DGDA 3H6GA 3PNLA 1KIMA 1LPPA 3SIPA 1K8RA 3AFHA 3GUZA 5I4CA 1C7IA 4PFKA 3RSHA 4YH1A 5CVVA 5GOZA 4ADSG 1ILWA 1E2HA 1SZPA 3JPYA 4XWAA 3RU7A 1CY6A 3ESRA 5J4HA 1DBVO 5KNDH 2BCEA 3CVJA 4RV5A 3TR6A 1N7HA 3DAHA 1PR3A 2B8EA 3KZVA 1E4OA 4ONEA 3E7WA 5KPJA 1HTBA 3HJRA 3U3DA 4OSPA 1NLMA 2G4LA 1TC1A 4X6LA 4C78A 1BVRA 2YIVX 3AI1A 1Z7BA 3EEFA 4HN2A 5E38A 1MFPA 4D4HA 4LRUA 2EFGA 3HN6A 3B8EA 2YUTA 1D2CA 4KN5A 1L4FA 4RK0A 2JANA 3KLMX 4PGMA 5I6DA 4OHYA 1X3LA 1U02A 2WPNA 2QU8A 3AZQA 3T0GA 2OD7A 4GT1A 4RDCA 2DHQA 4PHCA 3GOQA 4JYCA 1BCSB 1E0SA 1ZWLA 3GHYA 1P6QA 1W34A 3CF4A 4G5OA 1J0EA 1RHKA 4P3NA 2DWPA 3W2EA 3E0XA 3DDOA 3WAJA 4C7OB 2ONKA 1U1CA 2D3TA 1Y6QA 2CY0A 3TDMA 4BZPA 1RE0A 3LW7A 3QFHA 5KYTA 1U81A 3TLMA 2YOHA 3GWZA 2Q6TA 3ZDQA 2W6ID 3THWA 4AKGA 3COJA 3T5GA 1NG1A 2YFKA 3FAKA 3A7EA 1INLA 2IIQA 2Q3BA 3ODPA 5IM5A 2P1DA 4LRQA 3TI9A 3WKBA 4R2WA 3TX2A 4DS3A 1DFGA 4A0FA 2JEZA 4DZTA 1QHNA 1QG2A 1MZVA 1VG0B 4R7TA 3S99A 5LFAA 1XTJA 2C03A 2RARA 2RFLA 4KFRA 4JLPA 5KNDD 4XAQA 1YS9A 1RR6A 4ZT3A 5D3MA 2BFOA 3FYDA 1KJWA 5L3ZA 5A4JA 1U3GA 2OCXA 1USWA 3GLFA 4UZFA 1NAIA 3GLTA 5AOAA 1Q2UA 4MPPA 2HU5A 1QAQA 3MBOA 3G0HA 2IYOA 4KSCA 2VG8A 1JU4A 4DMHA 4DQ0A 3PLAE 1S2LA 3D7RA 1WOYA 2WI8A 4KLAA 3X1XA 5AVXA 2DGDA 2YW9A 5H4GA 4GMXA 1ML3A 4ZV9A 3V8VA 1JALA 3LYAA 5KCMA 3JZMA 5M34A 3VZDA 3W5SA 3QX7A 3VOBA 4D98A 1NQ5A 1E2LA 8ABPA 4B34A 2V4ZA 1G8YA 4BNMA 3IYLW 1PR2A 1LBIA 5FLXA 3HKCA 3RT1A 4TYMA 1RWQA 4HZIA 3DGFC 2PZFA 1WULS 5D85A 3DDSA 3G7SA 5ALFA 1G20A 1FS5A 4C3VA 2VDQB 3B8HA 3AGQA 3BHIA 4XLLA 3L77A 3U26A 5LQDA 1DXOA 4AULA 4BRSA 3KTFA 1W85B 3AH8A 1YE5A 3NC4A 1EQAA 1QKIA 1DRKA 2C8JA 2XGGA 3CZ5A 3E8SA 2C7RA 3WHLA 1Y80A 4IMIB 4O63O 2QRKA 1C3OB 3CBQA 3F1LA 4MZXA 4XCVA 3I9NA 3K0KA 3GEDA 1Z37A 3C74A 2NT4A 3RANA 3K0AB 3OOEA 1R10A 1CNEA 2AZDA 1TGYA 3LBIA 5F2EA 4Y0VA 3VM6A 1EP9A 3GMSA 4HO1X 4RESA 3EPLA 1DAMA 3TLZA 4AIRA 5J4VA 3DZCA 1PFGA 1L8AA 5K8CA 1W2HA 3KM0A 3A3PA 4NJEB 2ZR8A 4YV7A 1AGXA 1JLRA 2FQYA 3GT3A 2LD4A 4LZNA 2VK2A 1CIVA 4G5GA 5DF1A 1KKUA 5A3SA 4GBJA 4M8NE 2J6BA 3OFNA 1GU7A 1T8PA 1OC4A 1QRDA 2VJMA 2OBXA 3LXXA 3JQ8A 3F3YA 4BIMA 1Z16A 4K9QA 4DWJA 2WAOA 1KNQA 1SCBA 5TQVA 3HM2A 1I9GA 1JDPA 1UJMA 2C82A 3HN2A 4U2EA 3OPYB 1SHLA 3QLTA 5HZHA 5JNSA 2OESA 4R1PA 2G04A 2V7QA 4GBED 2FUG1 4RY8A 5EUCA 1OLOA 4DEVA 5LP6B 3VO8A 4D92A 3FZQA 1S2NA 1LUAA 5G3ZA 3RS9A 4BO0A 5KOHA 4L5IA 4BO8A 3N2GA 1M1YA 1UKZA 2HO5A 1EA7A 5TQ2B 3IB3A 3WZMA 1U3UA 3K0HA 3VKVA 1GPUA 4TMYA 4F6CA 2WA1A 3AEQA 4Q1VA 1RWBA 2PM8A 1N5MA 1V7QA 2BF7A 1IHUA 2JIPA 2IH2A 3NR2A 2WU8A 1J5XA 1M6NA 2I3DA 2XUOA 1R8YA 4PC2A 5B30A 4NZYA 1AKWA 1UP4A 4GKBA 4JC0A 3ILVA 2X8JB 1Z08A 2PS0A 3G88A 4ME6A 4ZU3A 1Y8RB 4RH3A 2Z0MA 3DDHA 4XD2A 4B32A 5KNCH 1ZVKA 1CBUA 1M1YE 2FOLA 2G7ZA 1J2TA 4WLNA 2FSVA 1OD6A 1D2NA 1ZM4A 1AF4A 1NUAA 2CFSA 2AT1A 2BZ1A 3H5RA 5DYNA 3GPIA 3UA4A 3FWNA 5GJBA 1D6MA 2ADFA 1FPQA 2VZLA 4NBUA 1HEUA 1F14A 5B1SA 4B6OA 3OIYA 4QUAA 1UXIA 1M73E 1CRZA 2HPZA 2ZJ5A 1CKEA 2F1HA 3C6ZA 2CEAA 4HYTA 4X7RA 3GGCA 3U7RA 5AQ1A 1U9IC 3LIPA 3CB2A 3KV1A 4NF2A 4TMKA 1D0SA 1TQDA 1R0YA 4TLMB 4Z3OA 3OBIA 1S02A 1NZJA 1U94A 2Y1EA 1OXBB 3EZ2A 2QVGA 3PQEA 1P44A 3Q40A 2I7DA 2CMFA 4KQKA 4Q7LA 5T57A 3F96A 1K6JA 3VXKA 5I8ZA 2ID7A 1US8A 2OO5A 4LHZA 4HQRA 1QU3A 1A98A 1A8UA 4OD0A 3O83A 1M1NA 1RWMA 1U7HA 2QX4A 3AR8A 1DG1G 1N3IA 4TKUB 4NU8X 2QRMA 4PANA 4Q9HA 3EPPA 2ZQZA 3O8CA 4UBOA 1M2OA 3D7LA 3TCXB 5LMNB 1JMKC 4AF7A 1C3OA 2EX4A 3EQ8A 3RIXA 3SVZA 3V1MA 1E3QA 1PNTA 2NO0A 3RS0A 1BFUA 1GRCA 1QH1A 1U7PA 3I6ZA 3FSGD 4JT2A 5EINA 1UK8A 4L7VA 4ZC1A 3TX6A 4PYKA 1UK9A 1WXWA 1QO0D 2WK1A 3DPIA 4IX1A 1KOLA 1NSTA 4I4IA 2EDAA 4ZTZB 4Z0NA 3H11B 5FTNA 5BN4B 3QU4A 2LKDA 4BQIA 2W2VA 5K0ZA 9MHTA 4L4UA 1US8B 2F4VB 1NBME 2E89A 3CLRD 2XODA 5F23A 3O4IA 2OFWA 3PIDA 1WP9A 2DP4E 3QOFA 1CJCA 4I5EA 4MR8B 3SJAA 5JV5A 4M7OA 4LWOA 2OLKA 3NWBA 1JUDA 1O6CA 3T41A 2KLBA 3BBPA 3BE6A 2A5DA 3AUYA 4KBFA 3DBHA 1JR3E 1J8FA 3KQOA 4HDAA 4NE7A 3DC2A 3KJHA 3GVXA 4P0PB 1A9YA 2ASEA 4YXFA 3FF1A 4KUGA 1BG6A 1GPWB 1VJ5A 5THKA 4TT3D 4N0DA 1WV1A 3CNOA 4OMFG 1IDN1 1OBHA 1FNMA 2QN2A 4YRDA 3MYRA 3S2FA 2HXGA 2AI2A 3QF4A 4GC9A 4ZCSA 1EHCA 4BU1A 3OE4A 5M7EA 3BZBA 3EODA 3U9LA 3WK9A 4EG5A 4M1MA 1A72A 3KLPX 2RB5A 4A16A 3H1GA 4D9EA 1VA4A 2F8MA 3ZVNA 4NSNA 5DNWA 5AM4A 5C8VA 1VL1A 1KY3A 1AG9A 4OLJA 4WD3A 3WK6A 3IKJA 3ASVA 4WW0A 2B6HA 3EMVA 4FGLA 4GOMD 4IH9A 5KNLA 3K2BA 4E21A 1FSFA 1NNLA 2EBWA 4HMQA 1FRNA 3SLKA 3HXPA 4BNUA 2BKLA 2REQA 1EYZA 2NN3C 4W5RA 5ECWA 3IAFA 2AOUA 3TPZA 1KK0A 5K6AC 4BO5A 3OA2A 2IYAA 1ZYUA 3D3QA 4IMRA 4B6JA 3NNDA 2ONCA 5I7WA 4H7DA 2FXIA 4ZO8A 4URWR 4Y6OA 2HUNA 2GN9A 2WYOA 4ZARA 2BKVA 3AUTA 3FTNA 4K88A 5D7NA 3ULKA 1HDZA 2PKWA 1EZ4A 3IQDB 3QHPA 5E7QA 3S28A 1P2VA 5DIFA 3BB4A 3CZPA 1FRZA 1V8DA 2Q3EA 5CTJA 2O9JA 3QMMA 1WAMA 1KQOA 3ONFA 4P86A 1F6DA 1NYTA 1TADA 4IXWA 4EDHA 3I1FA 2XOXA 1FDVA 4MULA 2QD5A 5AI9A 2KQUA 2P6RA 1OU0A 4WV3A 3B1WA 3EHDA 3P2JA 1CUSA 4F56A 1R6XA 2J30A 5KHOC 4P3OA 1KP9A 3CEHA 5CDSA 2YCLA 3PPXA 4B2LA 2FH5B 1CTQA 1VCMA 3CGWA 3GCGA 4I9GA 4XE5A 1Z62A 5I9TA 3JZIA 3V46A 1UFOA 4B2IA 4AS1A 3SBXA 4N8EA 3NBXX 4X45A 3AKZA 3TLGB 5IVHA 4S05A 4DBLC 3BJMA 4DILA 1UJ2A 1Y4ZA 1JZQA 3BD7A 3ORFA 3PL1A 4HSEA 3AIMA 1KKLA 1F0NA 4FBLA 1FP4B 3GLSA 4G5HA 1CUCA 1SUEA 2JZNA 4MVJH 1MAHA 4OM7A 3W1VA 2DHEA 4EBBA 3T1QA 5TV2A 3NATA 1Z88A 2JIRA 1QUEA 5KYWB 1UAGA 5CH8A 2C58A 5BUCA 1JKFA 3M6MD 4YCLA 3C85A 5JWHA 3GAFA 2D00A 3EXFA 4KR7A 2XUDA 4P4SA 3VR4A 1GA1A 1GGKA 1G64A 3ACDA 4UPDA 4WVFA 3WKDA 1XN1A 1LX7A 1NQVA 3ZWVA 2UDPA 4M4SA 3U60B 1PG5A 1AS0A 2ZITA 1QO7A 1M6HA 3HBFA 3K9BA 3C6BA 5HGXA 2QYSA 1GOTA 4H4CA 1OZ0A 1DV2A 1SUBA 4M8KA 4O2AB 1G8HA 3ZI7A 2JFZA 3VDMA 1N25A 4QODA 4CLHA 2XGOA 4EMBA 5LP6F 3COSA 4CKEA 2I2CA 3CN7A 4UATA 2WUDA 3TTYA 5LWHA 2PBRA 2BZGA 1A4UA 2J3IA 4KQCA 5JJLA 3CIOA 1QH8A 1SXQA 3C6KA 2IYTA 4J2OA 5KTMA 3F7NA 1ZJ4A 1NJGA 4CIVA 5DHRA 3EXHC 3D8HA 4D3XA 1T3HA 1RVV1 3GD5A 5CLQA 3BSSA 3WISA 1DPGA 1LU9A 1TQ8A 3JARB 5K01A 2W4IA 1ECPA 1ZJYA 4UUOA 3V33A 3HYSA 5JMWA 2P9GA 1TCCA 1RHQA 1OLSA 1VSUA 2YXEA 4UNQA 3RG8A 4YUYA 1JAZA 2R7NA 2QRHA 3FSEA 2ZDHA 2OCKA 2CJWA 1VL2A 2JIQA 4ZOLF 4DJTA 3OAAA 4M88A 2XJ9A 4EVIA 2GCNA 3WLSA 3WMWA 4L73A 5GY7A 3RE1A 1ZN8A 2WHRA 3FB4A 1NKVA 2WP0A 3LBNA 2COEA 4CT4B 2D8MA 4CCYA 4CZ2A 4HKTA 1F0PA 4EHFA 2A5GA 2FJUA 4MW5A 1P60A 1ZMXA 3WHPA 4CM3A 4Y2PA 5JPIA 3NFRA 1JFSA 1XDUA 1RHMA 1OI7A 4FONA 4UM9D 1WETA 5DNDA 3F74A 4I6GA 2O8DA 3G9ZA 4W5WA 5CNIA 2HK6A 3WP0A 1I8TA 1F60A 1W49A 5HSGA 5HFAA 4DDVA 2VTBB 3JALA 4QG7A 2GDJA 4MQUA 6CHYA 3ANNA 2KBEA 2OG2A 2ZXUA 3JXEA 2DHDA 1E3LA 2ONZA 3F98A 4FN4A 3LWNA 4FS3A 4OA5A 1ULUA 4CEHA 1DIGA 3ZWBA 1U0TA 1L3BA 5FBLB 3R5JA 4TZKA 3TJMA 5T8KA 2N75A 6YASA 1HE5A 4JLOA 1E3WA 3SAJA 3BDIA 4DWWA 2KBFA 2OAEA 4EBFA 1O0SA 4I6JA 5JECA 4KXXA 2QYOA 2F9MA 2A7XA 2WT9A 5JARA 1WCIB 4JLSA 4YUVA 4MCIA 3PCXA 1NN5A 1RHRA 3QE0A 1DAFA 1I2MA 3MRSA 3NBQA 4WXMA 1JHAA 1II9A 2Q4RA 2LIVA 2AF3C 2L18A 4R9UC 1NVUQ 3J7TA 4ASUD 4NYMR 5I8WA 2VWHA 1N4AA 1IQPA 3M6WA 2BFFB 5EA2A 2VL7A 2CL0X 4FOSA 2R1TA 1YQTA 3OIUA 1Y9DA 4JLAA 3NTXA 1JZTA 4QUBA 3VH4A 3PJRA 5E4YA 4HWSA 2Q4EA 3ZH2A 5SYMA 1KJ9A 1NE2A 2WMYA 1KO5A 2E1PA 1CUZA 3BM5A 3MMZA 3O74A 1RZUA 4GP7A 2HJWA 2ZT7A 2B82A 3B20A 3P1JA 4MGHA 1NBEA 1DBPA 1O6BA 3L18A 4I1YA 2MSCB 1EVZA 1QLWA 2FMXA 5BSWA 4WKGA 3CTPA 2RJ3A 4E5VA 3CM0A 3D6JA 4OGGA 1U2TA 1QYRA 4B80A 4MVXA 3FHTA 3ND5A 4D3FA 2H8KA 1U9JA 3GNLA 2FFQA 4NARA 4YBZA 2VJLA 4O1MA 4DQDA 2PXHA 3PI6A 5E9AA 3U48A 1R5JA 3KU4A 3NYRA 3HHPA 4QARA 3MGKA 1PGJA 1LLFA 1C14A 1XYGA 5C0OE 4BNIA 1N5LA 3AK4A 4ZQIA 4BHTA 5EXSA 3ZDAA 3NHWA 3WRYA 2A58A 2HH9A 2AYYA 4I81A 3ZY2A 2CLOB 2A92A 3KYJB 4Q19A 1C80A 1N1DA 3LDAA 2W6JA 5HJEA 4LWPA 3GRKA 3N6XA 4TX1A 4X85A 2O8EB 4LOHA 5DDIP 2CDNA 4ZI7F 2EW2A 4BX9A 5FFNA 4H6WA 4PTYA 1R50A 3LRTA 4JK3A 4J4HA 4L2IA 4RKYA 5JD3A 3HYLA 2ZIAA 3JASB 4MRVA 3M6XA 3PENA 4TXJA 2XQVA 4GWKA 2WYHA 3MRXA 1MB3A 1MABA 1U3VA 4L8VA 2K7FA 3HDVA 2E48A 1TU4A 3W5JA 3RVOA 5BVHB 1W36B 2XXBA 1YDMA 3AM1A 4INJA 1ATIA 4ND6A 2AMLA 2WHYA 1PD1A 1ZD9A 4TWJA 1RI4A 2WU4A 1MB2A 4Q4DA 4WLOA 5FUYA 1RKVA 1JA0A 2VXCA 1J8QA 1KXZA 4TQAA 3WJ7A 1KXJA 1NW8A 2NYUA 4B3HA 4AQ7A 4N7MA 2C5LA 4Q3BA 4ZK6A 3HXLA 3BK7A 1NXOA 4ASUA 3F78A 3UVEA 3OURA 1YZTA 3NIGB 4PG5A 4WXEA 2BGTA 3E3NA 1LCIA 1X86B 1SU6A 3NCHA 2JRCA 1WP4A 5K8LA 4TTTS 1RJGA 2W2LA 3KZXA 5DBFA 2XE6A 1N5RA 3OH8A 5E95A 4DJFC 2PX6A 3HPRA 3E48A 3GAZA 2PRIA 1W581 4A4DA 4H6VA 4EG1A 1E1LA 2ZUVA 4KP7A 1N92A 3GROA 3J80A 1ZO8A 3LPNA 2NUAA 5B1HA 3RVJA 3Q9SA 1A8PA 4GW3A 5U9CA 1FP2A 3OTQA 2QMOA 1VZ2A 5DRYA 5AW4A 4GLJA 4XTCS 3WTCA 2JB9A 1CDOA 1F06A 1NRIA 2YJ4A 2VP9A 2PX0A 3PGA1 2TMDA 4TS4A 1P62B 2X1VA 3ZU4A 4CF7A 4KLNA 1N4DA 3OWXA 3B6MA 4R8MA 4PAMA 4MUEA 2RG7A 3PDUA 4ZJPA 1ZM7A 3F6CA 1NMZA 3L79A 2XQGA 4N5MA 1NUPA 5HQTA 3OKCA 1UFRA 4HQKA 5DKFA 4HS9A 1JHOA 2H92A 3F46A 2BM0A 1AJEA 1YI0A 5GADl 1Z6QA 2CV0A 2V58A 3EBLA 2I1VB 3BGOS 2NO4A 3VUFA 2P9ZA 3OCVA 4CDNA 2RGAA 1TA9A 1SA0B 1YKFA 4RVOA 1HYBA 4PPNA 3AUXA 4I1SA 3RLIA 4EYOA 1QX4A 4FX2A 2PUBA 5AK4A 1AZTA 3TZLA 4W7SA 2BAGA 1I2AA 2VYFA 1YL6A 5IJAA 3VNRA 1ODIA 3GUHA 3HKDA 4DV4B 1UF9A 5K0TA 1E2GA 1CUIA 1FZQA 3O9MA 2FX3A 3RABA 4W99A 2CVQA 5ALOA 3VAYA 3ZI4A 1Q11A 4FZJA 2JL1A 3N39C 3HC7A 3LT0A 5AI6A 3FKJA 4COKA 2WMNB 4N41A 5BWBA 5KU1A 1DRUA 3GLGE 3Q8KA 3U16A 1EP1B 5ANRB 4V24A 3N87A 1N6RA 3GEBA 3V48A 5I7RA 1EUCA 2XITA 4B3IA 1NOIA 4KQIA 5FOSA 1XZJA 4MRAA 2DOKA 2PUFA 3FYUC 4RD0A 1XLTA 2OZKA 3KQMA 1YJQA 4WCFC 1AA6A 1G6HA 1JJBA 2YFYA 3DCNA 3RGWS 5AVRA 3FF4A 1QIEA 3CJRA 4KZKA 4FYWA 5C7LO 3ZD7A 4N03A 3BMNA 3O3MB 3D4IA 5C4GB 2R6DA 3NM5A 4GF5A 1ST2A 3K5IA 4AJ2A 1N77A 2QT9A 4K3VA 5LLTA 4URYR 2J6HA 3FCYA 5CDFA 4CCAA 4NNOA 1NLYA 3IPAA 4IRXA 1OY1A 4MRPA 2IPNA 1L5HB 2JGDB 3I64A 3U49A 4EHDA 2NO9A 4DMRA 4FMBB 4MVJD 5DMHA 3MTAA 2GBIA 2DLDA 5DYTA 5T41A 1ZNZA 2B0CA 2E1RA 2EATA 5HK8A 1IBRA 3E35A 3DW3X 3O95A 5DLPA 2QP4A 2E4AA 3VR6A 1QRUA 2RBGA 1JPNA 3EVFA 2J48A 3IOMA 3AINA 4YWHA 5LZ4A 1DB3A 2GK4A 4KWHA 2NTEA 2PRYA 4URXR 4JSRA 1P2SA 3FVVA 4LHWA 1FYFA 5J2UB 1CS0A 3RVNA 3WMXA 3ZCTA 5DWQA 4V1CB 5DW0A 2C42A 4FSHA 3W9YA 1N2IA 2NUAB 1E7MA 1W88A 2IYNA 3GT4A 2ORIA 4HXFB 3C3KA 1TAHA 3U0VA 2EEPA 1Y4AE 1EX6A 4G67A 1J0DA 4NOKA 4PC3A 4PW0A 2UUAB 1ISGA 2R6R1 4JR2A 2CN1A 4YFYA 2Z08A 4O2LA 1TUEA 1O3YA 2IPAB 1QIJA 1P2TA 1T5IA 2XY4A 3GCZA 3JWJA 4GD3Q 4HRXA 4MEJA 4OQEA 3D9QX 2SHKA 3AVQA 3FWKA 5FBVB 2O6LA 5K3AA 4Z4HA 3K6RA 4L5YA 2W71A 1MEEA 3LDFA 3PPYA 1L5ZA 3S2IA 3MINA 3Q8MA 5ES4B 5FWXA 4KBYA 4R84A 1AKTA 3JVUA 4NWIA 3TM4A 4DREA 2XVMA 2YRFA 3RLFA 2JIMA 3CCCA 3IP9A 1MA3A 2JVJA 1PW5A 4H7JA 4LHXA 3UOGA 1TAQA 2V4MA 5EIWA 1PSDA 1TUIA 2V45A 3K5WA 1B0ZA 4LQLA 2WJVA 3OX1A 4RD4A 1QK5A 5B3JA 1WW8A 1Q77A 2C29D 4LSWA 3U4DA 5HJ7A 1ZQ1A 2A78A 4FN5A 1MU0A 3QVLA 2TYSB 3O3CA 5GOTA 3IR7A 5CDYA 4QECA 1J1ZA 3SQMA 4P83A 3P9RA 1V11A 5DT2A 2XDWA 2J3LA 3UHOA 2CXUA 3DEFA 5L3SB 1TTHA 2IOHA 5CH5A 1FRVA 1IULA 2A6PA 3WSVA 5A1TA 1ZONA 3QLVC 4KXVA 2WJHA 1W35A 4L02A 1OSNA 1HETA 1OFTA 1ORRA 2FG7C 1W0JD 4RK5A 4ZAFA 5JD4A 1EQUA 2NXJA 4G3XA 4K6CA 1XEXB 3OO0A 4Q4HA 3FCSB 3GDWA 3UAZA 5IFKA 1NT4A 4HB0A 4YNBA 1JYEA 4L3VA 1T15A 5L95A 2VNJA 1W5BA 1P5RA 3WIDA 6REQA 1DSSG 3NHBA 5AMXA 1FU4A 3QZUA 2CVFA 4D96A 4DT1A 5HF8A 1YK1A 4JL6A 4NP6A 4U02A 4HDMA 3ZV6A 4E51A 1U7XA 3Q3IA 4G4JA 1LA2A 3THWB 4H1TA 4BRUA 3BN3A 4XIGS 5IARA 3RSZA 4KLRA 3IMGA 4XGNA 3TM5A 5IYZA 1NGSA 1PN3A 3URMA 3GPDG 3GHHA 4CF5A 1IWBB 1OH7A 1KMMA 4CV2A 3NMUF 2IHBA 2JLXA 3VSEA 3SKVA 4DLAA 4WOCA 3N86A 4KJZA 4UEJA 1HR0B 1AKYA 2B2CA 4JUFA 1P5JA 4MQ4A 5JPDA 3QYAA 4QPPA 3G5MA 1PIWA 3A06A 4R1TA 5HQ3A 5CCEA 3L40A 5F98A 1XYVA 1HMYA 2I5PO 2M98A 1GGMA 3GYGA 4FB4A 2R86A 2B8JA 3CZMA 1ISMA 3KKEA 1R8XA 4OX9Y 1G55A 3B60A 5JMOA 4RGVA 1QDEA 4QPZA 1T2AA 2CUKA 3FD8A 3N2KB 4IIVA 3SJUA 3KOUA 1EFVB 1U3TA 2JGNA 4GPIB 1VBKA 3VR2A 3PD7A 4J29A 1J9EA 3TQIA 3ZWKA 3LUFA 1M34E 3NHSA 1ZR4A 4DCPA 2CDBA 2WV9A 3BWMA 4YCNA 4YI5A 2O8EA 3RADC 2W58A 2WD8A 4OKIA 3ZYCA 3NP7A 4QJBA 4TMTA 5CGQB 3RHSA 3ZWPA 3C7TA 2CD9A 4W9NA 5BUZA 3GRFA 1V8BA 5AOVA 3CVXA 5CVUA 1W52X 3OJEA 1SD5A 1XBTA 4MW2A 1QQBA 1XQWA 3NTUA 1YBVA 4QG3A 3A6DA 3DEYX 2PSSA 2PUTA 4YLYA 1M10A 4NMMA 2DETA 2GARA 1RRKA 5HDQA 3A6LA 5BWNA 5AVQA 4WZBE 3G2HA 4RWEA 2X4IA 1CZUA 2F9FA 2MOKA 2WUGA 3JQ6A 4H4EA 5E1BA 3SD7A 3ML1A 3IODA 3ZHRA 1KU0A 4BVLA 3WA7A 3DLCA 1FFAA 2W90A 2XSZA 3EJ6A 5E6SA 1TO2E 4B6GA 2O8BA 1MJFA 1WW3A 4YT2A 2DXIA 2AEFA 2CLSA 2W2QA 4FFMA 1O6ZA 5ALIA 4B4DA 4HTAA 3PF9A 5D5PA 5CITA 1N5IA 4WCVA 2A9VA 4Y2SA 5COQA 4KN9S 3JZAA 4V0QA 5EGSA 2BGLA 1AQNA 1F5SA 1ICEA 1Q17A 4IHQA 5HJ5A 1YSCA 3BXEA 4ZZ3A 5L45A 2XCTB 2IHNA 3L0YA 3DBRA 2ET6A 4WZBA 2VJPA 4UVHA 2IXDA 1MC1A 3WGUA 1CUAA 4MDYA 3MEQA 5JCZA 4EJ2A 1Z6PA 3AERB 2POCA 2IBTA 3A9WA 1XG5A 1Y81A 4PRYA 4OSEA 5BSRA 4YUAA 1IY8A 5LIRA 1P8AA 3LQKA 3A7DA 1LDYA 2BD0A 4RVFA 2X0JA 4DAOA 2R2AA 1YUNA 4QQFA 3AO0B 3WMEA 1CUDA 3AUSA 2ILTA 3ND6A 2BVNA 4K9OA 3G2OA 2PUVA 4Z4EA 1F3LA 1K27A 1LD3A 3CF2A 4WZAE 1ZCZA 1U28A 1DEHA 2GHQA 4X20B 4CCSA 4DC0A 2OHXA 2W4MA 2NV6A 5JXIA 3RW9A 4M9UA 2I3GA 1KZ9A 2MINA 2Z9CA 4J07A 4WBNB 2XUHA 2HSJA 4M9ZA 4MYDA 2D0IA 4TV8A 2YMLA 1SD2A 2BGIA 4TVOA 4WZBB 3N8HA 4HD8A 4P80A 4QPNA 5EWMA 1D2EA 4CGYA 1OBOA 1RLOA 1BFDA 1BDBA 3P4UA 3X2EA 5E1MA 5G40A 3VJLA 5BNTA 4ZXFA 3AF2A 3AIIA 3K0CA 1Z26A 4EEZA 4ARIA 2RHLA 1IU9A 4RETA 1EWKA 1SOVA 3GJ6A 3TW0A 4HB2A 3O8NA 1CFZA 1JEEA 1I24A 2PGAA 2AR9A 3NDJA 3BPSA 4M8SA 2NIPA 4P31A 5A05A 4BNKA 3IIEA 5EXXA 1H0RA 4HJRA 4OJKA 1WL8A 1QO9A 1P1CA 1IYZA 4QNMA 4E7PA 1SPXA 3LFHA 3E1KA 3LT1A 3IE2A 1Y3CE 2IXGA 4NCNA 3D0OA 1ZXLA 3ENNA 4LJYA 3R7NA 2C5BA 4CJXA 1H8ED 5IUJC 1JHQA 2YZKA 4DUPA 3MJDA 2PMBA 5A3JA 2RSLA 1FP7A 4GZ5A 1JXMA 3ZVKA 1JDJA 1HL7A 3O84A 3DKKA 2PL9A 4EUEA 2D54A 2PTHA 5CAEA 4H27A 4LF7B 3K0SA 1GAEO 1XUOA 4OHUA 2EWWA 1RYHA 2FEXA 2ODPA 2G82A 2ZK7A 4MQFA 4LFAB 2EG5A 5EKTA 2PJZA 2H4WA 2GEBA 3L7OA 3OEEA 4D99A 5J4KA 3BH7A 1Y6FA 5HIJA 2GF9A 4Q3KA 2L42A 3LFTA 4XIIA 3BD6A 5ELMA 3WKEA 3ZXSA 4C4TA 1NASA 5ICMA 1EJ6A 1QGOA 1S89A 1AS3A 2VPZA 4M2LA 3ONWA 3IMEA 1TRHA 5KQLA 1DC4A 4Z86A 5JSHA 2GD6A 2ZI5A 1K06A 1WO8A 3AESB 3NTVA 3W5DA 4BQFA 3DZJA 3BGSA 2DVMA 3E4CA 5HS6A 1XGKA 1MT3A 4WERA 1D0VA 5ADWA 4NI5A 3BFVA 1ZMTA 3M1LA 2FDRA 1N6LA 3ROPA 4MO2A 4JR0A 1WRBA 1YI8A 2RKBA 4M9RA 4DB4A 3BFXA 3CG4A 4LJSA 2FWPA 3H2JA 4K9SA 3SFVA 4E5SA 1U11A 4IV8A 2P11A 4RVDA 2OV3A 1SHKA 2KW5A 2ZIZA 1WVMA 4ZOEA 1TRKA 1R37A 2AJBA 5BMVB 3ZJTA 2GJ8A 2V6FA 2ZYWX 3F6RA 5JSKA 4QYSA 1NIPA 2GM9A 4YMHA 4R3UC 4BPBA 4I4TA 4FMDF 3ZQJA 4YA6A 1C1DA 1L7PA 4EA6A 5EWLB 1D07A 1WA5A 2ZYUX 2SCUA 3A0RB 3O8BA 4HAYA 1RYFA 4MUFA 4ZT5A 4XASA 4D81A 4M9XA 2BBWA 1LSUA 2PT7A 3C8HA 4R9VA 1SB8A 3X1DA 1X8XA 2YXNA 3AUJB 3LA6A 4MUYA 3TXYA 4HPXB 3WGYA 3EE6A 3O91A 5SYAA 4C89A 4D02A 1F0YA 3JALB 3VHXB 2FWJA 1JKXA 3Q0EA 2MU1A 3M6UA 2PGDA 4CL0A 1KI4A 3DAGA 1PVOA 2B30A 1E2EA 2VZ8A 2WM9B 3AB8A 4NICA 4DDTA 4MGZR 1IPFA 2BELA 2D5CA 5F51A 3GBSA 4XYBA 3R5XA 5EXTA 4CG3A 2X3UA 4Z7NB 4HJXA 4N3AA 3UJAA 4B3DA 1X80B 3DHYA 4U7PB 4XR4A 3D5EA 4N4AA 4DLZA 3KTOA 4J1NA 4AZTA 1R18A 3HKEA 3GGOA 2B1QA 2VF5X 3A26A 4R1SA 1E2IA 5TT1A 1D2HA 2CLCX 3GLGA 3H0KA 1T6BY 3R3WA 5IWAB 1TI7A 5BW8A 1C1YA 4WJKB 4UMDA 4BCCA 4E3WA 4N8SA 3HFGA 3QTBA 1Z6AA 2ZVJA 4XYMA 4QUGA 2BFMA 1RQNA 2V6BA 1MB9A 3OQVA 1CY0A 4RKFA 1LDGA 3T7CA 1C7RA 4TXMA 1E4EB 2GBCA 2OB2A 2OK8A 3FUCA 4FI3C 2CLDX 4FIDA 2RMKA 1Y5NA 3CNEA 2JAWA 4LZPA 4J75A 4KKXB 3ZGXA 4AROA 1A2QA 1PDVA 1JFVA 3KQWA 1T4DA 2MSLA 2XMSA 3EQ9A 3RU3A 2AYXA 1IZ8A 1W59A 1JKJB 3WLHA 3NKLA 1KAOA 1RRVA 1NY6A 4P3KA 2AN3A 2NVWA 3L93A 2IUUA 1N2BA 1PQYA 2ISQA 2ZBGA 4BTEA 4QA9A 3WG9A 1K7XB 4HGQA 2P5SA 1X9HA 4BS9A 3M9XA 3EEYA 4U9UA 2Z8XA 2D2VA 5DK4A 1N6KA 1XL0A 3BSWA 3GIDA 2WUFA 1SC4A 2PSHA 1W8IA 3TLCA 4BMZA 2YS7A 2OMKA 3L6RA 5BQOA 3BK1A 2XA2A 4D4JA 5E9WA 3NAGA 3SJCA 4UNRA 3E53A 1NR7A 2GERA 5EQTA 3KOWA 4U6SA 2A8YA 3EQ6A 3TPCA 1PQUA 3DTNA 1PSWA 1UT6A 1YTLA 5F4BA 5AVWA 2R48A 4RX1A 1JIXA 5HE8A 4LGMA 1WKCA 2ACVA 1JEJA 3HR4A 2EKBA 1FDWA 4LG1A 4M8LA 1NF2A 1BRTA 3B78A 1F3OA 4BAUA 4EWLA 1PR6A 3DNFA 1HLFA 3SF0A 3MSCA 4ALKA 2HBQA 4PYLA 4W9RA 1RKBA 4BLPA 1EE2A 1EVKA 1ORVA 1R0ZA 1RYYA 2Q0QA 5DHPA 3WMRA 2IZ0A 4UE3S 1CV2A 1N9GB 3WAKA 4TQUS 4DRZA 4N40A 1GEGA 4JDUA 4UHDA 2H4YA 4LS3A 2A9PA 2G07A 3DDWA 2NVUA 3KJQA 1H3FA 2OCIA 3NKFA 3JAWB 3R2JA 4JFAA 4A2CA 4CI9A 2ZREA 1G7CA 3OKPA 1N8TA 3U61B 3GMTA 4WDQA 1FQKA 1M72A 2W6MA 5TEVA 1MEOA 1E0JA 1HG0A 1Z4JA 2EVWX 3GJXC 5JNLA 3CW2A 3NPMA 4XARA 4Y2GA 4RMIA 5SICE 3KOXA 2FPKA 2MR5A 5DHQA 5DXJA 4MVCA 3TRKA 5FQNA 3FWPA 3NOOA 2JJ8A 4K6FA 4PHTA 3RUFA 1ZISA 2WLTA 2Y1CA 3FOWA 1PT8A 3ZZNA 4FHFA 2XF2A 3OT4A 3PXBA 2PEYA 4ROTA 1B2LA 3H8VA 1GGNA 5IUKC 3WHKA 3DMFA 4BLRA 3AU9A 4PNPA 1M2JA 1PNVA 2G0AA 3W8DA 4PS1A 3PNOA 3K70D 1JHUA 4QO8A 1CYDA 5BYAA 5JBIA 1JHDA 4W8HA 3UGJA 1I7PA 1PBNA 2B4YA 2WIGA 4ZV4A 4F2WA 2HD4A 1T34A 2Q7XA 1MJNA 3E5HA 1CQPA 3PC2A 3COZA 1R16A 2JC3A 4EYQA 4IHJB 1JT2A 1WDLA 3A2LA 3BX1A 3C39A 4RAOA 3SZMA 3ONDA 1L7XA 1N5OX 1NOJA 1ST3A 1YNOA 2JEYA 3ORQA 2HX1A 3Q1LA 1X9IA 5AI4A 1KBZA 2BUCA 5KVSA 4L8LA 5A3RA 3LX5A 1MLDA 3SM3A 3O2QB 4TKLA 3G2MA 3EWSA 4P3PA 4BV2A 5JCJD 2R7MA 3INNA 4D9HA 1L1EA 2BFDB 2I0FA 5TGZA 3W8FA 1JKJA 4MI9A 3L1HA 4OXQA 4OXNA 3QNUA 4LTDA 1C9DB 2I6UA 3M3HA 4IIGA 3IALA 1UPXA 3PDIA 3WWOA 2FWIA 2B98A 1PO7A 2Z58A 4PLCA 4RLQA 2ZATA 3DE7X 2I76A 3U1VA 5K3EA 1D1QA 2G8NA 1PFWA 2GEDA 4DA0A 2O0HA 1DU4A 4DMLA 5H3HA 4BZWA 4IWNA 4DJJA 4G81A 3U31A 2BEVB 5HOQA 2JIOA 3OO1A 4ZVSA 5T4EA 5BSFA 1MB0A 4FFSA 1V0JA 2IWRA 3TLXA 1NXPA 2QU7A 4HGPA 1G18A 1K3UB 1ZNQO 4O08A 4D4LA 2DKFA 3BREA 3LA8A 3GJZA 2D1FA 1E8MA 4CV1A 5DN6D 3PD1A 2PT6A 1PX0A 4AAYA 4LCJA 2ORYA 2J67A 4QASA 3Q98A 3ZXXA 1QK4A 2EKPA 5JRZA 2BP7B 3IIJA 2C96A 5EJ2A 4JI6B 2HCJB 1FMTA 3ZX4A 5GTDA 5FEUA 3O6VA 1PVDA 1Y1LA 1B42A 4TMWA 5K3CA 2Z9BA 2FY8A 1SXJB 2WTAA 2H9YA 3AY6A 1NC1A 4BWGA 5JJBA 1P5HA 1KJYA 2CVHA 2IUSA 2WD7B 1CD5A 4GMFA 3TZEA 4EL5A 1CULC 2HHLA 4BP9A 2HA3A 4HSGA 3S8MA 3M1IA 1OYOA 5IVDA 5A06A 2BYTA 1MO6A 1VCNA 3ZE9A 1QM5A 1B73A 2CNNA 3FZEA 3O7MA 5JCPA 3R1IA 3FPHA 1KAEA 3NWJA 1N2JA 1G7TA 1V43A 2D13A 1OIVA 1DC6A 3G2IA 5EQJB 5CLGA 3QVGA 3DTVA 4RTNA 4DZRA 4EMSA 4JJ4A 4DADA 3RJ9A 3EIFA 2HWXA 4UU1A 2WHEA 3W7AA 1WUKS 3N74A 2QI9C 2ZRJA 2OECA 4F60A 4YRIA 4CEJA 4ZTUB 4MKXA 1QHEA 3GCWA 1ND6A 2VDVE 5H83A 1E9EA 1MABB 2HLHA 2OFFA 3L6OO 4HI0E 5DW3A 5ISMA 1EIWA 2WWXA 2Q3DA 4Y2JA 5P21A 2QTCA 2JARA 2P9JA 2ZBEA 4BEVA 5IXJA 5TMPA 2Z6VA 2VSOA 3W4KA 1TFUA 5HFJA 1DWOA 4LXHA 2HC9A 4MQLA 3UJDA 1BXRA 5FBHA 2JCVA 3OZ7A 3FGNA 1G4UR 5CEJA 4UFNA 3MW8A 1SOUA 4OL0A 3QPBA 1JP7A 5DB4A 3MC1A 4M0CA 4UD2A 1YL5A 1LI7A 3AW8A 2IK8A 4BCDA 5CDHA 3I0ZA 4PSCA 2RAPA 2Q0HA 2QMQA 3FW1A 2Q5HA 3HFSA 4JX8A 4Q3DA 1XPJA 2V4UA 4II2A 4YONB 3W6PA 3IUBA 4BNDA 2O8CB 1H23A 1PJAA 1C7EA 4W63A 2W6OA 1VLVA 2WSIA 4N5NA 1BQ3A 3ZHBA 4BMSA 3PXXA 4ZOLA 3FWHA 2E9SA 1Y98A 2VP3A 1UXJA 3R4CA 5WRFA 4MAFA 2ZE5A 1EEHA 1HLDA 4QM7A 3NIWA 5HCUA 2G1PA 3DEZA 4CMIA 1U8TA 4G37A 2ZUCA 5TS2A 4EGQA 2AZXA 2ZANA 4DMFA 3JQ8B 3FAZA 2FPIA 5L9AA 2XE4A 1GAQA 5KVCA 3QV2A 4ZYLA 1SVSA 5KPDA 1VIYA 4GRDA 2HBZA 2RCYA 2ZBVA 4Q1FA 5JDCA 3MN1A 3QVXA 1MR3F 1YQXA 4D42A 4YRGA 4NV3A 2OORC 2V7EA 3M34A 1R1DA 3PQ4A 3NJ4A 4NIMA 2HL6A 4DUZB 4RPLA 2UKDA 1NN0A 4B82A 2Y27A 1NR5A 4Q1EA 5EXPA 1Q12A 4KAFA 4F3KA 5JDIA 2Y0BA 3G2QA 5CXQA 1TEXA 2AOWA 3W3AD 4ARZA 3B1ZA 2O06A 1PWYE 3OZIA 3PX7A 1KMCA 1VHWA 1CF2O 1DXQA 1G8JA 1TZMA 3ADPA 3MAJA 5J5AA 3JQBA 4KO1S 3ZIUA 4UBLA 2HIAA 3PUYA 4DM3A 4YR7A 4MV5A 3HUUA 1I4DD 1NLUA 5I48A 1TXGA 1A7JA 1OXXK 3R9XA 2ID8A 2VSXA 5FBQB 4D5EA 2K2QB 2UUOA 2NMVA 4NCKA 2YWHA 1GILA 3JD2A 3LQ2A 4G0PA 5C3UA 2XGMA 1R0RE 3JVDA 3T5PA 2JJQA 1I3KA 4HOYA 4UULA 5DHUA 2M6LA 3JQPA 1YZFA 2EJVA 3B9PA 2HA4A 2J3QA 3HMKA 1K66A 1LV8A 4QBIA 5EZYB 1UBSB 2XUFA 5EJAA 4ZVMA 2EZ9A 1IAQA 2JFHA 1TVCA 1Y33E 2RH9B 2VBCA 3A10A 1O95A 4OJYA 4QREA 3RF6A 4RTPA 4P2GA 1ZZEA 3VR5D 2QP3A 3O92A 3R77A 1VHJA 1ZGJA 4IL5A 3LIIA 4QLOA 1NF3A 1G98A 4FMCF 2C94A 2AFHA 2HU8A 3JVEA 3P2OA 1GGEA 3PKZA 1D2AA 4OP2A 2YKGA 1ODLA 4O2BB 2XJ4A 5FWDA 1QC5B 3HA5A 1QYCA 2H57A 1L8LA 1TTPB 2JDID 2BCGY 1XZBA 5F5XA 4CKCA 3D43A 2DUWA 3DEHA 3LUGA 4FFDA 3I52A 4UD6A 1G4AE 3DZBA 3WICA 4TV8B 4YX9A 2EBFX 1CEXA 1JAYA 3DW1X 3NKVA 2BZSA 3JW8A 4V38A 3UF0A 4ZQFA 4WQMA 5DV9A 4D3ZA 5ALVA 2JGDA 1L5HA 5EIBD 4XIJA 4C7MA 1WB4A 2WM8A 5EZYA 3LBFA 2CMGA 3D4NA 1E3EA 2C4NA 2N47A 3F71A 5H4HA 3W7VA 4ZVNA 4FD2A 4BNZA 3CBGA 3VU1A 1U2QA 3ZBQA 4ODIA 5F7XA 4ZHSA 5AVZA 3L8CA 5J2TB 4DV1B 3I5MA 1FFBA 2FSHA 2WNHA 4D3DA 2OFXA 2H07A 2Q5JA 1T4MA 2ZULA 1GARA 3NWEA 1DXHA 3NS7A 3PPVA 2PSFA 3EISA 4HLUA 4UEOA 4EAAA 2IJGX 2QTMA 3LH5A 1CY4A 4KV7A 5FULA 2I4OA 1N0HA 1FF9A 4FIZA 1YS2X 2A9FA 3BIOA 1DWQA 4Y9UA 4QRIA 2MSNA 2PV0A 1GY8A 5BWCA 2QZSA 3EZ6A 4DCVA 3EH2A 1CZKA 1SM4A 3IURA 3P97A 4GM0A 2YN2A 3G8YA 3UAOA 3ZV4A 4DC1A 3LQFA 5BN3A 2Q3HA 3AM3A 1C0PA 1CERA 2ESRA 3EEBA 1KY4A 2ZU0C 3ENVA 1UK7A 4FPXA 3MILA 1ZNWA 3B5JA 2REOA 4KXYA 5AK6A 1EESA 4XCXA 4IIFA 4AJPA 2FZGA 1BW9A 3AVPA 2ZFUA 3PXAA 4ZK2A 5A7FA 3EXEA 1X1AA 2WM3A 3Q8XB 5BW5A 4M98A 4Q4CA 3I58A 4Q4JB 4DUYB 2DUMA 3DFUA 4IO0A 1TYAE 2HJRA 4JCCA 2Q5OA 3PFHA 4RADA 5AVYA 3DHVA 3T9BA 4KMMA 3S44A 2HAEA 2WA2A 3KL4A 1VKRA 2JASA 1I1QB 1SHUX 1PNRA 2X5JO 3PQDA 2C5EA 4A36A 2F8SA 3H97A 3RYCB 1QJ4A 3L43A 2C9ZA 4YMIA 2FRDC 5HUJA 4RULA 4JBLA 3K2EA 1KWKA 4MW4A 3LRPA 2BTOA 2MSEB 4WZZA 2XUZA 3M1AA 3DV0A 3ZQ6A 2FZWA 1XTTA 5TC4A 2DPHA 2WZQA 1QU2A 3DTYA 4RF2A 1TLFA 1VJCA 3K92A 4WESA 5GM1A 4HEQA 3PBKA 5JWOA 2RD2A 2A9KA 3FJOA 3FUTA 1GNLA 2I33A 2HQRA 4RGQA 5F2KA 5LMCA 2C9OA 4HLNA 3KLOA 5D5QA 1PS0A 2C97A 1Z29A 2DPGA 2Q4DA 3KELA 2BEJA 2PZKA 4UCFA 3STVA 3IBSA 2GPNA 2WKWA 3QXCA 4JB0A 4BGEA 2AE2A 2BKAA 4FR2A 4CG2A 1URPA 2IY9A 4K2HA 3GNQA 1C0EA 1FMCA 3M5CA 3PUKA 1KJ8A 3BDAA 4R5MA 3A2MA 4XSGA 3FNEA 3UFBA 1XZCA 3ZWQA 1JVBA 2IYRA 1O1YA 2XMZA 5DN6A 2PUGA 1VXRA 4URFA 2AFIB 4F9GA 1IPHA 2QORA 3KQKA 2AG0A 4G09A 1CCWA 2E6UX 4LE1A 1RNLA 3E1SA 3K35A 4YQYA 1S6YA 3DAYA 1G291 5DOVA 3O8LA 2FW0A 3M33A 4BEJA 3U56A 2ZOSA 3PTLA 3OIGA 2XGJA 1ATZA 2JKYA 4AFNA 1ZICA 1RQ2A 2WFAA 1ENOA 3WGMA 4C88A 4D3YA 5K5EA 4JR1A 1B41A 1PG0A 5LZ2A 2NVUB 3SI7A 2W11A 4JVNA 4OA8A 1BCRB 5JRDS 4RH1A 2RGGA 4WK0B 3LVBA 3R40A 2OHJA 4LDJA 4KR9A 2FB9A 4PCAA 2DC1A 4CEHB 3A6HA 4E03A 3CSUA 1CUEA 2YZGA 2JLBA 3IA7A 3OHPA 1DJNA 5FL7A 3JVIA 3L7YA 1NMQA 4Q16A 3T1OA 2ZTUA 3BYZA 3DKIA 3RYFA 4B76A 4YV0A 2O3JA 2IYVA 1PYGA 2XUPA 1M0SA 1Z0DA 2ZAGA 3THXB 2R4UA 4YJ2F 1OIWA 1JXAA 2NT3A 5DI3B 2PY6A 4KXQA 2BEWA 4BZZA 3MWJA 5C8ZA 1E1QD 4GH5A 3EDQA 5E3IA 1UOPA 3DAOA 2F4NA 4TTVA 3SZUA 1T24A 1BOOA 1ZUNB 2GMWA 2MT9A 2XRFA 4P4SB 5CH3A 3QKRB 4DSUA 3D8SA 3SBDA 1YIOA 1Z5ZA 4JXKA 5TDHA 2RAFA 3OM1A 4KIGA 2HTFA 3SXUB 2D5LA 3JATA 4G0XA 1Z06A 2H0RA 1Z0IA 4J0HA 4Z7QB 1EEXB 1Z3IX 1OGYA 2BGNA 4OY3A 2WVGA 4PYOA 5AHKA 3CA8A 4I1OA 5IKOA 2YDXA 3SKXA 5I4IA 5K0FA 3AF4A 4BMCA 2Y9MB 4O4LB 1TAUA 4RENA 2O8BB 1OPRA 3GGJA 1ADBA 3UBTA 1CC1S 4CF6A 2J09A 5BVGB 4KMOA 1NVVR 1G3MA 1K7FB 2A0WA 1H1DA 3UGKA 1UJBA 1ZNXA 4HC4A 4C5BA 4D82A 1HE8B 3QYJA 1NBHA 4FDLA 2XMRA 3R5FA 2O2YA 5G02A 1GG8A 1OU4A 3MTQA 1U4NA 3P4YA 2AZMA 1T3SA 5K45A 1HZZA 2E55A 2VUTA 5KWSA 4DARA 2IVFA 1GXSB 3SICE 1Q7BA 4XQCA 1BX1A 2D1SA 5DCLA 2OXIA 3WIEA 3PLNA 1RIIA 1SC1A 2IDMA 3GDFA 4XTRA 4OYHA 4CF4A 5FT9A 1MPTA 4ER6A 4N8DA 2YN0A 4GI7A 3JQGB 1IHOA 2A3NA 2ZTSA 5AOBA 2AIRA 4Q6WA 3VZRA 4WKBA 1L7MA 4CQLB 4E09A 1YK0A 1RTTA 4FNAA 4J4TA 1PEKE 4PX5A 4R8VA 1SY7A 3RKRA 2OUKA 3JWGA 5KJEA 1G1MA 4WN3A 4LGYA 4R4JA 1UP7A 5K3SA 4P5DA 1FFHA 3OCYA 3BXXA 2MHCA 1LJ8A 3A2NA 5ADHA 1TDJA 3R3UA 1YMQA 2B36A 1AOXA 2WE8A 2WF7A 3DV2A 4QOIA 4WWHA 2HMVA 5BMVF 1T29A 2G83A 3I1YA 3GL9A 1U1EA 1W75A 1CY7A 4AF6A 4MS4B 3VKFA 1T1RA 5CEEA 1L5NA 3HJUA 2EX1A 4UM5A 1IB0A 3E9QA 2DR3A 4R2XA 3ES9A 2VHQA 1E69A 2VDKB 4TTJA 2GDZA 3AVYA 3U9TA 5EE5B 3SY8A 2NSYA 1PUIA 2A9RA 2ZYAA 4FGZA 1QRTA 4BBZA 2PX4A 1GR1A 1DTWA 1NN1A 3DZKA 4TXLA 3TTVA 2HY7A 1FNSA 3DDUA 1U1DA 4UVIA 3WTBA 4E2WA 2YFQA 2C5HA 3QXGA 1QYXA 1G59A 1JAIA 1S2OA 1ZIDA 4W4TA 1MP0A 3KJIA 3OMWA 5FI3A 4BMNA 2YY5A 5C52B 4FFBB 1FLVA 1XEFA 3RTBA 3ZGZA 3VAAA 2I1QA 4COOA 4OJMX 4PSAA 3BMCB 3QIVA 1D2RA 2Z2JA 1VBFA 3C8MA 4B3XA 3CVUA 3A4LA 2R1TB 3GEMA 4R9SA 4OI2A 2X86A 2H0QA 2Y77A 4Q7QA 1VCOA 4PQGA 2BHSA 4KKVA 4AKSA 4MQFB 1A9ZA 1YC5A 1YASA 2IHZA 1ISFA 3REQB 3KPVA 4ZHQB 3WAGA 5CAEB 2JVKA 1Q44A 1Z68A 1EXWA 3DTVD 3FE2A 4KV9A 4LF4B 4AJNA 2RHGB 4L74A 4G01B 4D9KA 3LWBA 4O4IB 2LGJA 3SCZA 1YQGA 3LKDA 5FA8A 2H3EA 3R23A 4IXNA 1SC3A 1GV0A 1W73A 3I42A 1LTQA 4L9SA 1B6TA 4P7JA 3BWVA 1OGJA 3VPGA 5L6MB 2VJAA 2YRWA 2EF0A 3BGVA 3E58A 3NHJA 3RRYA 3C3WA 3K53A 2YQ4A 2FMHA 2NG1A 4MI6A 4CQMA 4B3RB 3P9QA 2F1KA 5EHIA 3X1JA 2AW5A 3O47A 4BLSA 3ZYZA 1B4DA 1UPAA 3MPOA 4LTMA 2A1IA 1KEUA 2O2GA 5CA1F 2V7PA 1G8SA 1FVFA 1U8UA 5K6RA 2VJQA 1M2VB 1WNFA 3I76A 4KB5A 5AT1A 3BICA 4DKXA 1NBWB 3P2MA 5JZOA 2XUKA 1VZ3A 4LI0A 1QIKA 2O1WA 3NVMB 4QPCA 4F8EA 2H2GA 2BJVA 1UQRA 1L5SA 3LC2O 1CUFA 4EKNB 1T4CA 5CYOA 2J3EA 2C4UA 5LDGA 5C5IA 3IJPA 3X2FA 5AHOA 3Q5DA 5IAJA 2PMCA 2VBFA 2JCGA 4XGKA 1GZDA 4FI3F 1A04A 4OJNA 5KOJA 1G21B 1GTG1 1W5SA 1LNZA 1QVVA 1VYVA 2H4ZA 2HQBA 2WKRA 3FPJA 4GNKA 1E1NA 5CIWA 4LTNA 4Y2TA 3L5OA 2FKAA 2W2NA 1KS2A 3GLHB 4QDKA 1KDVA 1MW9X 2OXTA 2GPYA 3W5HA 4AUEA 1OBVA 1OVMA 4RPCA 4XDGA 3UFXA 2TMYA 3IJRA 4PRZA 3WBFA 2HGZA 3C3XA 2Y1DA 3RNLA 5IJXA 3LKBA 5F7OA 1FS4A 2QRPA 2H4FA 1PR4A 2UZ3A 2H06A 5EMNA 5IP5A 3S2GA 1ZJZA 4DV2B 2NNLD 1XVAA 1IL0A 1IWOA 1Y4UA 4GPBA 5FORA 1P0MA 5J23A 3EPKA 2DJ5A 3SKYA 1RRCA 4KXMA 2WKPA 1UBUS 1O0CA 5K8VA 2H4JA 2F3TA 4IRMA 1JHXA 1P0CA 2I3AA 4FILA 3VYRB 2JLRA 1DPFA 1UKBA 3FOBA 4OJTA 3JVVA 3SSNA 4IDHA 1LI5A 2ZZKA 1ZK2A 1PK8A 2NO6A 3WNZA 4Z9XA 3V42A 5B5SA 2RKOA 2ZUBA 5CR9A 5T64A 5JCXA 2H17A 2HPVA 2I55A 2GD2A 2AG1A 3LHSA 4ARUA 5LYJF 1UZAA 2GETA 5ER9A 4EIWA 3PQ2A 4ALNA 2DFNA 1NU6A 3AV3A 1BX0A 2P8JA 5AHWA 2YMQA 5G4KB 4JI7B 4C2AA 4TSFA 2HQOA 1S01A 2QTHA 4XXHA 3BB3A 2I9PA 3IUEA 3QTTA 5IHPA 3VAZA 5K8UA 3JWEA 1DT3A 2FEMA 3SLGA 4DPMA 3DMRA 4UXIA 2QL5A 3FZYA 3QNWA 4KQ9A 2LCFA 1OI2A 6NULA 4UQOA 2FPGA 3C1AA 2ZJ7A 3VISA 3TQOA 4KITB 3L8HA 3BSFA 3AHJA 1Q84A 3LVFO 1FUYB 4A2PA 2J8ZA 1MJ5A 1CT9A 3FJYA 4BJ5A 3NTLA 3WE7A 3AWIA 4UAGA 4OF4A 3EEOA 5G53C 1FXWF 3W8RA 2GNAA 2H52A 2PQMA 4LQ4A 4K05A 3L0CA 4A0QA 3PC6A 4KQXA 3W5IA 1EJ0A 2HFKA 2XKBA 3ASYA 1JEQB 1NQTA 4AWBA 1P0QA 2IU3A 2A9OA 3DMNA 4AMVA 4ZRNA 3MCVA 4X9XA 1DZ3A 4FGWA 1O96B 1B15A 5K0EA 4ZEMA 3DF7A 1DIHA 3O1HB 1LNSA 3FYUA 2AC4A 1B93A 2IIVA 3DUFB 4PSUA 1K75A 1O0BA 3NAMA 1RU3A 4X6UA 3STTA 2B37A 3HKDB 5DM4A 4MJLA 2WNIA 1VM6A 2CYAA 3QWAA 2FF5A 4OBXA 2PRJA 2P9TA 1E1DA 3RC9A 4DLBA 5CEFA 3U7IA 5AVOA 1AGNA 4N49A 3AHCA 5FJIA 1G66A 421PA 4ZI2A 3TW4A 5IU6A 3KPWA 4MAAA 3QI2A 1GNQA 5P8WA 4JEIA 3NALA 3O8OB 4KE7A 3ZGYA 1FQJA 3F5FA 3IUYA 1X77A 4H1WA 2YYAA 2AD5A 3IQZA 3B38A 4E7OA 3U62A 3GQVA 3O5AA 2DKOA 4ISCA 5DOZA 4CN8A 2PBLA 4C4XA 3ILXA 4BVFA 2QJFA 1N3YA 1O94A 2QYTA 4FOOA 4YAUA 4YJHB 5DM2A 1SCNE