3HCGA

Structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (reduced form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
145
structure length
145
Chain Sequence
b'YKKPSDAELKRTLTEEQYQVTQNSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHDDFSYNMRRTEVRSHAADSHLGHVFPDGPRDKGGLRYCINGASLKFIPLEQMDAAGYGALKSKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptide methionine sulfoxide reductase msrA/msrB
publication title Methionine sulfoxide reductase B displays a high level of flexibility.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup a
molecule tags Oxidoreductase
total genus 39
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature ec 1.8.4.11: Peptide-methionine (S)-S-oxide reductase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01641 SelR SelR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.150.20 Mainly Beta Beta Complex Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A Peptide methionine sulfoxide reductase. 3hcgA00
1L1DA 3CEZA 3CXKA 2K8DA 2KZNA 3HCGA 4V31A 3E0MA 4V30A 4TZ4C 3E0OA 3HCHA 3WX1A 3HCIA 2KV1A 3WX2A 3MAOA 3HCJA 4V2ZA 4V2YA 4CI2B 4CI3B 4TZCA 4TZUA 4CI1B 5AMHA
chains in the Genus database with same CATH superfamily
1L1DA 3CEZA 3CXKA 3EQTA 1HXRA 1H6QA 2FU5A 2RQAA 3GA3A 1FWQA 2LOYA 2KZNA 2K8DA 2RMJA 2QFDA 3HCGA 4V31A 3ZD6A 2KWBA 3DJMA 3LRRA 3NCUA 1H7YA 3E0MA 4V30A 4TZ4C 2YKGA 5F9FA 3FACA 4A2VA 3LRNA 2LVLA 2W4RA 3E0OA 4BPBA 3HCHA 4AY2A 3P3KA 2RQBA 3WX1A 3OG8A 4A2XA 3HCIA 5E3HA 1TXJA 3EBMA 5F9HA 2KV1A 3WX2A 5F98A 3MAOA 1YZ1A 3HCJA 4V2ZA 4V2YA 2QFBA 4CI2B 4CI3B 2HR9A 4TZCA 4TZUA 3ZD7A 4CI1B 5AMHA
chains in the Genus database with same CATH topology
1L1DA 3CEZA 3CXKA 2K8DA 2KZNA 3HCGA 4V31A 3E0MA 4V30A 4TZ4C 3E0OA 3HCHA 3WX1A 3HCIA 2KV1A 3WX2A 3MAOA 3HCJA 4V2ZA 4V2YA 4CI2B 4CI3B 4TZCA 4TZUA 4CI1B 5AMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1D A;  3CEZ A;  3CXK A;  2K8D A;  2KZN A;  3HCG A;  4V31 A;  3E0M A;  4V30 A;  4TZ4 C;  3E0O A;  3HCH A;  3WX1 A;  3HCI A;  2KV1 A;  3WX2 A;  3MAO A;  3HCJ A;  4V2Z A;  4V2Y A;  4CI2 B;  4CI3 B;  4TZC A;  4TZU A;  4CI1 B;  5AMH A; 
#chains in the Genus database with same CATH topology
 1L1D A;  3CEZ A;  3CXK A;  3EQT A;  1HXR A;  1H6Q A;  2FU5 A;  2RQA A;  3GA3 A;  1FWQ A;  2LOY A;  2KZN A;  2K8D A;  2RMJ A;  2QFD A;  3HCG A;  4V31 A;  3ZD6 A;  2KWB A;  3DJM A;  3LRR A;  3NCU A;  1H7Y A;  3E0M A;  4V30 A;  4TZ4 C;  2YKG A;  5F9F A;  3FAC A;  4A2V A;  3LRN A;  2LVL A;  2W4R A;  3E0O A;  4BPB A;  3HCH A;  4AY2 A;  3P3K A;  2RQB A;  3WX1 A;  3OG8 A;  4A2X A;  3HCI A;  5E3H A;  1TXJ A;  3EBM A;  5F9H A;  2KV1 A;  3WX2 A;  5F98 A;  3MAO A;  1YZ1 A;  3HCJ A;  4V2Z A;  4V2Y A;  2QFB A;  4CI2 B;  4CI3 B;  2HR9 A;  4TZC A;  4TZU A;  3ZD7 A;  4CI1 B;  5AMH A; 
#chains in the Genus database with same CATH homology
 1L1D A;  3CEZ A;  3CXK A;  2K8D A;  2KZN A;  3HCG A;  4V31 A;  3E0M A;  4V30 A;  4TZ4 C;  3E0O A;  3HCH A;  3WX1 A;  3HCI A;  2KV1 A;  3WX2 A;  3MAO A;  3HCJ A;  4V2Z A;  4V2Y A;  4CI2 B;  4CI3 B;  4TZC A;  4TZU A;  4CI1 B;  5AMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...