3HCHA

Structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
145
structure length
145
Chain Sequence
b'YKKPSDAELKRTLTEEQYQVTQNSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGSGWPSFTRPIDAKSVTEHDDFSYNMRRTEVRSHAADSHLGHVFPDGPRDKGGLRYSINGASLKFIPLEQMDAAGYGALKSKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptide methionine sulfoxide reductase msrA/msrB
publication title Methionine sulfoxide reductase B displays a high level of flexibility.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup a
molecule tags Oxidoreductase
total genus 38
structure length 145
sequence length 145
chains with identical sequence B
ec nomenclature ec 1.8.4.11: Peptide-methionine (S)-S-oxide reductase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01641 SelR SelR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.150.20 Mainly Beta Beta Complex Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A Peptide methionine sulfoxide reductase. 3hchA00
3HCHA 4TZUA 3CXKA 3E0OA 4V2ZA 3HCIA 4CI3B 2KV1A 4V30A 3HCGA 3CEZA 4V31A 3WX2A 3WX1A 4TZ4C 2KZNA 4CI2B 1L1DA 3HCJA 3MAOA 5AMHA 4CI1B 3E0MA 4V2YA 4TZCA 2K8DA
chains in the Genus database with same CATH superfamily
2LOYA 3HCHA 4TZUA 2QFBA 3CXKA 3E0OA 3P3KA 4V2ZA 5E3HA 3GA3A 3HCIA 1FWQA 3NCUA 4AY2A 3DJMA 4CI3B 3ZD7A 2HR9A 3EQTA 3FACA 2W4RA 4A2XA 2RQBA 2QFDA 3LRNA 5F98A 2KV1A 4V30A 2KWBA 1H6QA 5F9FA 3HCGA 5F9HA 3OG8A 2RMJA 1HXRA 3CEZA 4V31A 3WX2A 2FU5A 1YZ1A 3WX1A 4BPBA 1TXJA 2LVLA 2RQAA 3EBMA 1H7YA 4TZ4C 2KZNA 4CI2B 1L1DA 3HCJA 3MAOA 5AMHA 4CI1B 3LRRA 3E0MA 2YKGA 3ZD6A 4A2VA 4V2YA 4TZCA 2K8DA
chains in the Genus database with same CATH topology
3HCHA 4TZUA 3CXKA 3E0OA 4V2ZA 3HCIA 4CI3B 2KV1A 4V30A 3HCGA 3CEZA 4V31A 3WX2A 3WX1A 4TZ4C 2KZNA 4CI2B 1L1DA 3HCJA 3MAOA 5AMHA 4CI1B 3E0MA 4V2YA 4TZCA 2K8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HCH A;  4TZU A;  3CXK A;  3E0O A;  4V2Z A;  3HCI A;  4CI3 B;  2KV1 A;  4V30 A;  3HCG A;  3CEZ A;  4V31 A;  3WX2 A;  3WX1 A;  4TZ4 C;  2KZN A;  4CI2 B;  1L1D A;  3HCJ A;  3MAO A;  5AMH A;  4CI1 B;  3E0M A;  4V2Y A;  4TZC A;  2K8D A; 
#chains in the Genus database with same CATH topology
 2LOY A;  3HCH A;  4TZU A;  2QFB A;  3CXK A;  3E0O A;  3P3K A;  4V2Z A;  5E3H A;  3GA3 A;  3HCI A;  1FWQ A;  3NCU A;  4AY2 A;  3DJM A;  4CI3 B;  3ZD7 A;  2HR9 A;  3EQT A;  3FAC A;  2W4R A;  4A2X A;  2RQB A;  2QFD A;  3LRN A;  5F98 A;  2KV1 A;  4V30 A;  2KWB A;  1H6Q A;  5F9F A;  3HCG A;  5F9H A;  3OG8 A;  2RMJ A;  1HXR A;  3CEZ A;  4V31 A;  3WX2 A;  2FU5 A;  1YZ1 A;  3WX1 A;  4BPB A;  1TXJ A;  2LVL A;  2RQA A;  3EBM A;  1H7Y A;  4TZ4 C;  2KZN A;  4CI2 B;  1L1D A;  3HCJ A;  3MAO A;  5AMH A;  4CI1 B;  3LRR A;  3E0M A;  2YKG A;  3ZD6 A;  4A2V A;  4V2Y A;  4TZC A;  2K8D A; 
#chains in the Genus database with same CATH homology
 3HCH A;  4TZU A;  3CXK A;  3E0O A;  4V2Z A;  3HCI A;  4CI3 B;  2KV1 A;  4V30 A;  3HCG A;  3CEZ A;  4V31 A;  3WX2 A;  3WX1 A;  4TZ4 C;  2KZN A;  4CI2 B;  1L1D A;  3HCJ A;  3MAO A;  5AMH A;  4CI1 B;  3E0M A;  4V2Y A;  4TZC A;  2K8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...