3HCRA

Human ferrochelatase with deuteroporphyrin and ni bound
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Product release rather than chelation determines metal specificity for ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Ferrochelatase, mitochondrial
total genus 128
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcrA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcrA01
2QD1A 4F4DA 2PO5A 2XVZA 3HCOA 3LYHA 4KLCA 2C8JA 3HCRA 1HRKA 4KLRA 2H1WA 2XVXA 1AK1A 3AQIA 2HK6A 2DJ5A 2QD2A 2QD5A 1LBQA 2Q2NA 2XWSA 3M4ZA 2JH3A 2H1VA 2XVYA 3HCPA 2PO7A 2XWQA 1DOZA 1LD3A 4KMMA 3W1WA 1N0IA 3GOQA 4MK4A 1QGOA 1L8XA 2AC2A 3HCNA 2AC4A 2XWPA 1C9EA 2HRCA 2Q2OA 2HREA 2QD3A 4KLAA 1TJNA 2Q3JA 4CCSA 2QD4A 2PNJA 1C1HA
chains in the Genus database with same CATH superfamily
3ZDRA 3RS4A 3SYLA 3T7SA 3ZK8A 4A10A 2JGFA 5KDLA 3N39C 5ANRB 4H3HB 3JR7A 4LXYA 2YN4A 4MGKR 3P20A 1X1BA 4GPD1 4RBNA 1MH1A 3D6HA 5DHFA 5GOZA 3VZRA 3ZYZA 1LPAB 5HJ5A 1GDDA 4TSRA 4DZRA 4EUKA 2UU9B 1XF1A 2HYDA 1OE0A 3UA4A 1XTSA 2XNDA 2BFMA 5DNWA 2GZHA 2JLRA 2WWYA 2PL3A 3OIYA 5J1TB 4WOJA 3FI0A 2QVGA 1L8AA 3HBMA 5JZVA 4U3JB 1R37A 3OEHD 4JHLA 3OPMA 1PSZA 3R5KA 5F9MA 1XMJA 1LX6A 3PRYA 3I4CA 3VGPA 4EOGA 1KRWA 5BQOA 1YK0A 3D7MA 3C0KA 3VVLA 1MEOA 2NU7A 3KCQA 3SBDA 1K92A 1IMOA 1QRRA 1X13A 3D3EA 3KKOA 1U1IA 2EBUA 2RCNA 3KFLA 3NZEA 3M9XA 3TIFA 2RBKA 4PLFA 1KQOA 2I7VA 4WECA 3OKFA 4JYCA 4PRKA 3KVRA 3OLCX 3QE2A 3I5MA 1CP3A 3KQHA 1CD5A 2GF0A 1T8TA 5EMLA 3ETCA 1N78A 5F1PA 5A04A 2J7PA 1ISIA 2DYKA 3F5SA 4GPEA 1FFYA 8MHTA 1JDSA 4Q1EA 3R3WA 5HKAA 3J7TA 4HYEA 4M36A 1QUEA 1ABEA 4ZAVA 3G0CA 3BRWA 1PNTA 2QM8A 4UHCA 4B74A 1OLUA 3WZLA 3DV9A 5EI5A 4AWBA 4JLKA 4TROA 4HEJA 4RMHA 5AVVA 4COKA 3DOJA 4IRUB 2ZRDA 4EJSC 5C3MA 3OZCA 4BYMA 2EKBA 4JXKA 2OYCA 3TRDA 1ULUA 3RVLA 1FTQA 4M53A 1CK4A 4V0OA 5ALMA 4LXQA 3UXMA 3NLLA 5KYYB 3PEFA 3SQOA 1BS9A 3BWCA 1Z83A 2BVNA 2OD2A 1VJRA 2OCLA 4FYJA 4YJFB 3OTQA 5CRIA 5EUMA 2J0QA 1TCAA 2PZBA 3RBVA 4M0CA 3V8NA 1IWPB 3OAAA 2I3AA 4XM2A 4DV6B 2OCBA 3D4BA 5ITZB 4QPPA 4LOHA 3D4NA 5CLGA 2M6LA 2PUGA 1PJ3A 2XXAB 4ZK6A 1UJ2A 4KX3A 3MTIA 4UULA 1B42A 1I3CA 1RQPA 3Q98A 1JE1A 2QBYB 1ENYA 4BV9A 4ZVNA 5LQRA 3VX4A 1RKBA 1P3Y1 1RWVA 2AN3A 5A3VA 1TQ8A 4E5PA 5DW0A 2R6AA 1Y82A 2AHRA 4GBMA 3PFKA 1D09A 3AR5A 4POOA 1HE5A 2PMWB 1CNEA 5EKXA 1OAAA 2RJNA 1KAEA 3FWKA 3LLMA 4G67A 1RCUA 2MJLA 1QHEA 3L7CA 1N8KA 4JK3A 4BY9E 2H1IA 2WT9A 1G21B 1QHFA 1T3GA 4KDFA 1Q74A 4XYEA 2JGLA 3TI9A 3W2EA 1DTWA 5JIBA 3KSZO 3IOBA 1OIWA 4RHEA 4D0RA 4DCMA 2RGNC 2JNWA 1OV4A 3KK0A 4DV5B 2PZAA 2JANA 3GLTA 4H0CA 3MIIA 4B3BA 5LQNA 2XMSA 2VDRB 5E6UA 1JYFA 1RAAA 3NEYA 1R64A 2A9FA 2G5GX 3NTQA 4H0NA 4TWBA 4W5WA 2F1KA 1P0QA 2UZ1A 4YWHA 2A94A 1VG8A 1E9VA 3HKCB 5GZ1A 2QG6A 5LXTB 4FGKA 5ESXA 1H1DA 4GAEA 4RDXA 2I1WA 3N53A 1EUCA 5E0OA 4QPZA 4RD3A 3WOHA 1JJAA 5L9AA 1W7AA 2CJWB 4TT3D 2W8BA 4E13A 1UOEA 3ADPA 4LNUB 2XSZA 1YRHA 5AQ1A 3CV3A 1L4UA 4CL8A 1N1GA 3V9AA 2YS6A 1SQSA 2P6NA 3NBAA 2EKQA 1JFFA 3EASA 4BB0A 3ABOB 1BGVA 2Q46A 1O6FA 2OBNA 1HE3A 2WZDA 4R2WA 5U4QA 5KU1A 2H3EA 3OWXA 2H4XA 1TA4A 3CLKA 2RFLA 1WUJS 1DJNA 1Z12A 2WUVA 1JX6A 1PBNA 2ACEA 2XWBF 3CRZA 3D6NB 3F7TA 1DARA 1N2XA 1AQIA 1JILA 4BMPB 4NVRA 2QUBA 4L9WA 4DLRA 3A05A 3G0BA 4OEHA 5LJIA 1KU6A 3GFOA 4Y1RB 4Z51A 1K5DA 2R7LA 3H1FA 3DEJA 4YJ2F 1Y7HA 2DKNA 4DLBA 3EB9A 1CS0A 3ZY5A 5EJFA 5J4LA 2UYYA 4FKZA 2A0XA 4JC0A 2V6MA 4YO8A 1EFLA 4OXRA 4GUAA 5CVUA 3VTFA 4UXJA 2P9YA 1J9EA 1PL8A 2NXEA 3IEPA 3NM4A 3O8QB 3H1GA 3O3OB 4OYRA 1B8PA 4JP5A 5KNDH 3I5YA 4JUBA 3SVTA 1CY1A 1N2EA 3IRUA 5IAKA 3PHIA 4IJVA 3D5EA 3A14A 3B1FA 1UBMS 3HRHA 4Q4JB 4R1MA 5EHNA 4EKDA 4WBSA 3WC4A 3ZYCA 3DVQX 4J1QA 4WAUA 3SIWA 4AMGA 2OBMA 3WGTA 2CE7A 1L5FA 3PFHA 3RHTA 4Q7QA 3ELWA 1MO4A 2QT9A 1G3RA 2WJAA 2C4NA 3EXG1 5FWDA 5A4FS 4WZBA 4AJIA 2C7QA 3PIRA 1OZGA 2IHUA 2LIVA 2PH7A 1WJGA 3HR7A 2RGXA 3BIJA 1QK3A 3DBOB 3QUBA 1X38A 4P83A 4XR9A 5AHRA 3VR3D 3ORRA 5C3UA 2CUKA 2PX4A 1NC1A 1T4CB 2BZSA 4CV3A 5GZ3A 3K09A 2Z04A 2W2LA 1OB5A 1I10A 2HA6A 5K8JB 3ESBA 5IULC 1FP6A 1DEAA 4X9XA 1RWBA 1JN0A 3EDRA 4I66A 2BHRA 3P9YA 1E8MA 2EF0A 3UGQA 1U5CA 1XYVA 4BAUA 4WA7A 5IT5A 3QUTA 2GPYA 2RH9B 1PN3A 4IIJA 4LTNA 4WL0A 3WIVA 1K5GA 4ARZA 5JDCA 1RBZA 1V3VA 4MVWA 4QEDA 5DGXA 2YWXA 2AFIA 3SI7A 4BO5A 5TPWB 4QDUA 1NLUA 5DJ5A 1J0XO 3GDHA 4F4IA 1P4AA 1B43A 1V7PC 3F90A 3C48A 4I6GA 3BMCA 3CN9A 3I0ZA 2B82A 2DVMA 3MEQA 2YC2C 2G82A 3BHIA 5EN4A 4MB0A 3WICA 3BHMA 3PV0A 1MU0A 4QDOA 4D9GA 2ABWA 4KL8S 2GLXA 4AXBA 4B46A 4DLVA 3FOZA 2F4NA 3W5UA 2A58A 3KX2A 5BRNA 3T38A 3V7FA 1Z7GA 3MCAA 1Y81A 2Z9CA 3WLOA 1GXSB 3FJOA 4DIKA 3RF7A 2VJNA 3D59A 4QLOA 1ID1A 4A73A 5BUSA 1U6KA 3CFYA 3FNQA 3OFKA 2AHOA 1L8OA 3MT8A 1ONBA 2E89A 3LM8A 4RH0A 1QX3A 4L07A 4RM2A 1LV8A 3QI7A 1AMUA 2DTEA 1P7ZA 2OG2A 2PX5A 1PEKE 3GFVA 4LY6A 2GZ2A 1QPBA 1Q0HA 3AIMA 2JFUA 4KUGA 3TLMA 5JJCA 3FSJX 3TNJA 4EKGA 3I39X 1I24A 3A4LA 2X2EA 4C4AA 4BS9A 3CVWA 4ABYA 3GUHA 3WO0A 4AXXA 2VHYA 1RC0A 1I36A 4U7PB 4YT8A 5DBHX 2FTKE 3HEBA 4TPKA 3TSWA 2HF2A 2AMYA 4KXQA 1MO5A 3GGJA 4KP7A 1NNUA 1E4OA 1DXOA 1TECE 1XVTA 1W5EA 2HRCA 2WLTA 3C5EA 2KJQA 2DETA 4RLFA 3TINA 3UBMA 5JYBA 3H0KA 5DYYA 3TXAA 1C9NA 2VKTA 1QYWA 1GQFA 2XY4A 4QU5A 1JHQA 4LI3X 4DB2A 1UQRA 1TU3A 2GPBA 3EPPA 1U3GA 1QS0A 1ATZA 2OCGA 2OO7A 3OMXA 3STUA 4G9EA 1QKKA 2QQGA 2Y76A 4OQEA 3D6VA 4AN1A 1OW3B 3PFCA 2E48A 4CFZA 3BB4A 2FDRA 1TPZA 1PJSA 1OBOA 1ORVA 1X8KA 3ICWA 5ALIA 5LA6F 2ARKA 3KJHA 5JFGA 5CLLA 2F1OA 4KQ2A 1DCTA 2F8TA 3U26A 1FXSA 5AI4A 3LIPA 4I7EA 1JL3A 3CX4A 3HP7A 3SC4A 4BO4A 1U6IA 3ZV4A 4M7WA 2VQSA 4IDAA 2AC2A 1E4EB 5DI9A 4BN4A 4WK4B 3DEIA 2D0OB 3RJZA 1XLTC 2HJSA 4N5HX 2GN8A 4XQEA 1LFDB 1J5PA 2YZ7A 3FGPA 4NULA 5L6LB 3L8ZA 1ZITA 1O8BA 2L42A 2ZFUA 5DT2A 1TKAA 5T4EA 5EZYB 1NBIA 3R0ZA 1JF8A 2YJTD 5CM2Z 1ZXLA 2O8VA 3L0IB 5FAKA 1QRTA 5BN1A 3MQFA 1CUBA 3BHNA 1OH8A 4KHPB 4CMCA 3A9SA 1DKRA 1DQPA 5TQ2B 1T15A 4GC5A 4AY3A 5KYKA 3WJAA 5EXTA 5CB4A 2WZQA 2XMBA 4C4TA 2XUFA 1N0VC 3QHPA 3AR2A 4NQRA 3D9QX 4KODA 5FUBA 3RU9A 4TTQA 3BFKA 2H0AA 4FD2A 5KTRA 3ZDYB 5DOZA 3CT6A 1Q7CA 2Q3JA 4AZ0A 4BC1A 1VL2A 5F23A 1VKZA 2J32A 1GPMA 3D31A 1I13A 1JSZA 1RW4A 2JCVA 2JGAA 3OEEA 2ZVJA 4D0GA 4RY8A 1IWBB 1FX1A 1M1NA 1FVOA 2G36A 5FT9A 4QVIA 3WTBA 4AKEA 3K9BA 2CXNA 4YWJA 5IM4A 2CZGA 1ZHHA 1JLLA 1A9XB 4F9EA 2BR5A 1LI5A 4J07A 5L3SA 3U4AA 4AYTA 2BMDA 2CBXA 4ZVUA 3WIDA 3JQCA 4ID3A 2XBLA 2W58A 1QYVA 4OY3A 3RS8A 3JQGA 1YDWA 2HIGA 2IC5A 4J2HA 1MB0A 1P5JA 3OJEA 2WAAA 1DT3A 3I42A 1KR2A 3NNNA 3AR8A 3N75A 2ZJ8A 2BI4A 2A92A 1PTJC 4ID9A 4L5IA 4PG4A 4X8LA 5G53C 3UAWA 1VKRA 3OIUA 4DB4A 1DZIA 2WI8A 3OTHA 4CKBA 1PVDA 1H5UA 3RIEA 4Q18A 3O38A 3FUXA 4OJTA 4D46A 3H42B 4GF5A 2FMFA 5K0GA 3QP9A 2WWWA 3AGPA 2P9FA 3CE6A 3MWYW 3NFRA 5FWYA 4CCYB 2PJUA 1E0KA 2DM6A 4LE2A 2BCJQ 4P8RA 2ONJA 1EXMA 1SBZA 1HEUA 1YVUA 1W1WA 3A8TA 3GHHA 4AP6A 2Z5LA 4AVYA 2YVUA 3LUPA 2GJAA 4YALA 1KJNA 2QRPA 4MS3B 4W1QA 1Z62A 1K4YA 4WLUA 4PS1A 5C1IA 2DQKA 3WMGA 1G5RA 1YA6A 4DQXA 3MJEA 3KBOA 1KDZA 2Q1WA 3KQWA 1F2UB 4Z7NB 4ZYWA 4K9KA 3RKUA 4DUPA 4TWAA 1V26A 3CJRA 1QOQB 2C5AA 2J7KA 3ZH9B 1V16A 2WTAA 3EFEA 3OWHA 4B82A 2OV3A 1HQCA 4C5CA 3KOXA 4DIBA 3C6QA 3R6LA 2AX4A 4AUEA 3A10A 4BP9A 3W3AH 1SZPA 4IV5A 3EAQA 3JZIA 1NV8A 4LFBB 4R8MA 2BM0A 4WVLA 4JUAA 1N6PA 4D8WA 2DWPA 3R3YA 4BGEA 1E1NA 1TZKA 3DB1A 2PU5A 2Z98A 5A7HA 1ZH0A 1JHXA 3L46A 1H1TA 3A06A 4KVZA 5A0FA 3UJ6A 3HNPA 5FUQA 4BGIA 2R6FA 4ZI7F 2GJ8A 2Q9BA 5LQJA 3ESZA 2I1LA 3THYA 5EXSA 1O97D 2ZJ3A 3PWZA 4LNHA 1TZMA 4X6YA 3K6SB 2X3UA 3MPOA 4PF1A 2IIBA 2PGIA 4Q48A 4KREA 2ZT8A 1EP9A 1I6WA 3C5VA 5DTRA 3WP1B 2Z1NA 1XNQB 1DX4A 1IN8A 1LPNA 1P81A 3O9MA 3T4XA 2HL6A 5HIJA 1XQXA 1J0DA 1PLJA 5AKEA 3MILA 4JGIA 2V4ZA 1U9JA 3DZIA 2VPWA 1JMVA 5FR2A 3V97A 4UBKA 5DK4A 5GAJA 2VZ8A 4RVUA 3GEEA 2CLKB 4J3FA 3LQRA 3GN2A 2QSJA 3U39A 5MFPA 4G63A 1VL8A 3WQQA 2WD8A 4WIAA 4YT5A 1M76A 4MCJA 4JASB 4Y0VA 4A0HA 1KEEA 1RC1A 2P1ZA 4QARA 1TQHA 4DEVA 3Q88A 3WIUA 1C7EA 4X60A 2LP4Y 2VJPA 1FMFA 2H29A 5F1YA 1XCGB 3LH5A 2NZJA 3VU3A 3D64A 5BN4A 3G0DA 5EQTA 1Q1ZA 5DEOA 5KVSA 3B3FA 3DFMA 1BWPA 1UDRA 4OLFA 1X14A 4FPXA 4M6WA 4XYGA 1A7KA 2WV9A 2CCKA 2X76A 4LCBA 5ICSA 2QUKA 4TX1A 4CLXA 1F6WA 2OK8A 4ZYZA 3IODA 3VNSA 3QVUA 1ZMOA 3MBKA 1Y1PA 1DBPA 5K0CA 4IHQA 2V4UA 4H4DA 2V0CA 3DTYA 5BV7A 3KSAC 4D4HA 4UVEA 4S24A 3B1XA 1S1CA 3I9KA 3GQBB 5CYPA 3TJMA 4P7GA 1KAMA 2Q1SA 2DPYA 2RI1A 2WHPB 4UPDA 1SC6A 1T1IA 5DHRA 2ZSJA 3W4JA 4YMUA 4ZGGA 4ZZ0A 3O0DA 3W6ZA 1VI2A 5AVJA 1ISMA 2W2LD 1M10A 2PKQP 5J40A 3HJBA 1RLJA 2D1SA 3C98A 3LUCA 3BERA 4TQGA 3PFGA 4Y9DA 4NATA 1IEQA 5JDCC 1WSWA 4X61A 3X1ZA 4DKXA 1C50A 3PVCA 5CPBA 3AP1A 2QZPA 2ENUA 2DWUA 3KKKA 4H15A 5AI8A 3REFA 2WPDA 1RE0A 2ZKIA 4L73A 4FFRA 3IDFA 2W4IA 3TL2A 2HQRA 4CLRB 1V5IA 2GZRA 2TYSB 3LP8A 1XTKA 2C61A 2G8NA 2JASA 4FR2A 3IAM6 3ITEA 4YMSA 4YFVA 1BHJA 1KYWA 3AI7A 1K5HA 4ZI7A 4D44A 6YASA 4IVNA 1NQAO 4TXLA 1K8QA 2PLAA 4EMUA 1BYIA 2YXPX 4BMDA 3EQ8A 3BWXA 4UBJA 1FC0A 1TGVA 2TECE 3M89A 1TKBA 4M9QA 3TNFA 1L4BA 1FDRA 1ZJWA 3IP1A 4KN5A 2YDYA 3NS7A 3DDNA 1V25A 1MIOA 1WDMA 2VUHB 4RZSA 3OE1A 1N5IA 1RR6A 4BQOA 2X7JA 4YCNA 1GD1O 3R77A 2LPMA 2Q4RA 1D2CA 3GH3A 5C8YB 1MBZA 3CHYA 1SHTX 3GLQA 3AKDA 2OY0A 3MAAC 4L3WA 2Q6VA 4X6LA 4M76B 5LYYA 5I8PA 1H69A 2AK3A 3TVDA 3U3OA 1ZIOA 5PGMA 2QB5A 3ABIA 3CSSA 4P4GA 1X7DA 3JQ7B 3NWEA 3TB6A 4CTKA 3M4YA 1EESA 1TB4A 4P3KA 2CBGA 1L5HA 5GV7A 4Z99A 1GGVA 4EUNA 4R1QA 5FPPA 1YB7A 2NSDA 4HRYA 1OYYA 4G26A 3EUFA 4BFSA 4BL5A 3OA0A 1KERA 3MTGA 2O59A 1PL7A 3ZD9A 1Z6TA 3SJZA 1Q1BA 3QTLA 4IP0A 4Q9AA 4GS5A 5DBEX 3TDNA 4F5WA 1NX6A 1LRLA 2CXPA 1Q92A 2P2GA 4IZ6A 1GADO 1R6XA 5A06A 1AXGA 2P0AA 4NIMA 5G4KB 1KVQA 3UENA 3D7NA 5HWSA 4HG2A 3PC8C 3RSZA 3V80A 3G5MA 4ZIRA 1BTOA 4FONA 1U3UA 3SMQA 1C3JA 3COWA 4LBWA 3IVMA 1Y1TA 3NATA 5DHPA 3V7NA 5BVHA 4G0XA 1DKPA 1Y37A 1BXKA 3R09A 4M7RA 2ZUBA 3MYRA 4BAZA 1OJLA 4O4HA 4R9VA 2GVZC 2VZEA 1YFLA 2B69A 4LGYA 3TX6A 2G9QA 4I46A 3LHIA 3AFOA 4RXMA 4C0JA 4QDKA 1QV9A 3RYTC 1JG3A 2VQFB 5AW6A 3PUKA 1PTJA 5CDTA 1VMAA 1ZOOA 2IIVA 3OQ1A 3QLUA 5DX1A 5E6SB 5FADA 3B3QA 5BT9A 3RLIA 4EUHA 5EPUA 1O4WA 1NYRA 1JA0A 1UDXA 4GE3A 5COQA 4BLUA 3ORQA 1PBTA 4D4IA 1ZAKA 1YJCA 1J90A 1YC5A 4MYCA 4Z8XA 2X1MA 3RS9A 4BMYA 1CF9A 3AU9A 4OBWA 5CXQA 5FHRA 2IZOA 4YRLA 2EFHB 5KAPA 4EA6A 1PNOA 5HE8A 1T5TA 2C5EA 1PWZA 4JMLA 3JQFA 2IEAA 4XLTA 1B41A 5EWJA 1T5IA 4WZAB 4EZEA 4G8BA 1OXBB 4NG4A 2IPAB 1A7JA 5K6RA 1G16A 2X22A 3IXMA 1JH9A 4ZK2A 2P9BA 3CZRA 1N2HA 1X74A 1U8TA 1ZN8A 2YBDA 4TV9B 4TWRA 3DBVO 5H4HA 2SICE 1T34A 4FD3A 2FFJA 1JQJC 2CK3D 3HP1A 3OZFA 4HNHA 1TM5E 4GI1A 1DX6A 3TM5A 2BEWA 1Y6FA 1O08A 3LS2A 3ENWA 5SV2A 2GM4A 4BGDA 2JEYA 3DXXA 1DIHA 4KTVE 1SG6A 1PYGA 3PT9A 3GLIA 5FEMA 3RFFA 4LJ4A 3ZLTA 3EIFA 3GRUA 2CVQA 2V7TA 4NYMR 3TFWA 1GL9B 3CNLA 5A5FA 2PRZA 4DR7B 3IIJA 4I50A 4BO7A 1GCIA 1GZ6A 2YXLA 3L0DA 4DCTA 1P74A 4LYJA 5I48A 1HGXA 5BNIA 2DLDA 3LP6A 1AKUA 2EBFX 3VGJA 4XE5A 2XW6A 2I1QA 1U2EA 1Z22A 3GNQA 4PSDA 4F93B 1LBIA 2FUG1 4Q00A 2KSQA 4R1PA 1CNMA 2OOSA 3E4DA 4RPGA 2HJGA 5HSGA 4OGKA 5B7PA 3HWX1 4HQNA 3KC2A 4P9NA 4C7OA 3KEOA 3UUGA 3DBRB 4B4WA 1JHPA 5GONB 1I4OA 1RHKA 3HN7A 1T2UA 2Y66A 1XN1A 3F6BX 3ICPA 4LY3A 1U8ZA 1VQ1A 3JZMA 4N01A 3PHGA 2I8LA 2WNSA 3A04A 3CLVA 1PHRA 4O4HB 1D03A 4PLTA 4OQQA 3SPXA 3ZW8A 2V6BA 2JCSA 2OFPA 5HKOA 1JIJA 4RK0A 1B14A 2R6DA 3S2IA 3BZUA 5C4MA 2ZITA 2A3RA 4IDBA 2RJOA 2ZR0A 1BROA 4BECA 1YHYA 2AN5A 3T9BA 4P22A 5FLXA 2PFSA 3UJDA 3CWQA 4DM3A 4HYQA 1ZGBA 4M9SA 1XD9A 2A1UA 2RBEA 3OJ0A 1FQOA 1KEUA 2WJIA 3ASZA 4H3SA 2IH5A 2BEUB 4EO4A 3GZTB 3PLRA 1DKMA 4AAYA 3DD1A 3FB1A 3PC4A 5L95A 1WKBA 1UJ4A 2CZCA 2EIHA 1EI9A 1UP7A 2IYSA 3D3JA 3DE0X 1TMOA 5L3RA 3MCVA 1E5VA 1JG7A 4EQ6A 5GOTA 5JISA 3BE5A 4QJBA 3OSZA 1VKOA 5T4FA 4LMAA 3WLNA 3A32A 3EDMA 2IZ7A 1L5HB 1WEKA 2W70A 4TKVB 4ZREA 1WTCA 4IAOA 2UYHA 4DJFC 1II8A 1NJ8A 2FP4A 1PT8A 1T1EA 2ZE8A 5FBWB 1EG7A 4E5MA 4FJ1A 3K3PA 4PZ0A 4KR9A 3G5AA 4B6JA 2O0HA 1ZUD1 3M9WA 3KOYA 4RZ2A 4TLDA 1I2CA 2PT9A 3BK7A 3PPYA 2GJ4A 1ZG3A 1G8SA 1S8AA 1VIYA 3DXFA 4YONB 1ZCZA 4G0OA 4XRGA 1Z5PA 4HN2A 1NQTA 1NE7A 3AB7A 3TQQA 1LCIA 1JAYA 3AEXA 2J41A 2JLQA 3KZKA 2BGIA 4ROTA 3TTVA 3W6NA 1R4MA 1TYAE 4EHNA 1J2UA 1Q0UA 3GZJA 5THKA 3HUDA 4MOWA 1T8WA 3AERB 2GCOA 1EIZA 4DUGD 5EYPA 1Z56C 5LLDA 3ICVA 5DNCA 3QFTA 4HATA 3FCCA 3H2SA 4W9NC 1U7OA 1N1MA 1ORIA 1I9CA 5A5DA 1E2HA 5AVOA 4KVFA 1AB5A 4DR1B 3NOXA 1XTVA 1U3WA 2XXBA 1XFDA 4FU0A 4MWBA 1G3QA 3BRWD 2K2WA 1P1JA 1W85A 1GY8A 2NYUA 4OBBA 1UKZA 4J0QA 1WQ3A 3A25A 3JAKA 1REQA 1L7DA 2VEDA 2WUWE 3AWIA 3BSWA 4ND2A 4ZYLA 2XB9A 4EGQA 5LYJB 1U2DC 4XUDA 1QP0A 2ZS7A 4U2KA 1JXAA 1RZ3A 1YRWA 2DQ4A 1B93A 5G40A 2W9XA 4YRNA 2ZWIA 3B5JA 5EIOA 1ZM9A 3T4UA 1SUEA 1CVLA 3BZWA 4RTQA 4FT2A 2JVJA 1O1YA 4LQCA 4C0KA 1B2RA 1V37A 5AMXA 2PH5A 3L8HA 4TV8B 3C3CA 5KAMA 3K0SA 4ZGBA 1X86B 4K6HA 3TNDA 1Z37A 2KBEA 5AICA 2ZUUA 4ND3A 5F4ZA 5J43A 1ISFA 2J07A 3FOWA 1IDOA 1K6XA 1VL1A 2PSEA 4LVNA 4R6WA 1W29A 3ILVA 1IVNA 3DZHA 2W0SA 5BSEA 3TIGA 3UPTA 3H7IA 1KAOA 5BV0A 1BDBA 2OK7A 2V7GA 4TUYF 4MDEA 4OQFA 4DRXA 1R9MA 2EJWA 2YJ5A 2J0SA 3B9RA 2A33A 2CLMB 3AJ8A 3UK2A 5L4NA 3SQNA 2X7HA 5K3FA 4BTLA 5MGNA 4RABA 5JSKA 2ZSUA 3LC0A 3ADBA 1M0SA 3OICA 3GFPA 1JQEA 5BR8B 3LXMA 5AM3A 4U2DA 4FDMA 2KI5A 1AS0A 3KR0A 3RLFA 1GARA 2IELA 5B1DA 1GFSA 2B2NA 1BE1A 2XPCA 3VR6D 4N0QA 4Y67A 2HSDA 1E20A 3NQ41 3RTCA 1XP5A 4E5UA 1VPDA 4Y2YA 5HF9A 1AA6A 3CEJA 4Q4AB 4D4KA 5B4VA 1JUDA 4KSYA 5LZ4A 1ISJA 3U49A 2D8AA 3CZ9A 4IDHA 3TO5A 5I7SA 2G67A 3PNSA 3STWA 4BNDB 2QQ0A 2J3LA 3T1TA 2VP3A 4LZWA 1GTG1 2O20A 4EMSA 4G5RA 3ZNOA 2FSSA 1TEXA 1EKXA 2VNJA 4XDGA 3A0UA 1E7RA 3QU2A 3LUKA 3QITA 4G4SP 1XMVA 3PI7A 3E22B 1CJTC 2YIJA 5J4HA 4RA6A 1GQOA 4GO1A 2IFTA 5KIAA 1Q0ZA 4KN9S 5EJ5A 1ML3A 4I1UA 2Q8PA 1N2CB 4JBWA 4K7JA 4Y30A 3KYBA 4ALIA 2QMQA 4KQJA 1GAQA 2BHNA 1Y6GA 1YF3A 4HWTA 5AK0A 2ZZKA 2WTMA 3EMBA 3BCHA 3LF2A 4JT4A 3PWKA 1NTRA 1U1CA 2PXHA 2WF6A 1JH8A 5EP1A 4U7WA 2YC4C 3A4VA 3AMVA 3FRJA 3K15A 5DTJA 4WMLA 4ZYYA 3A26A 3E9EA 4ENRA 3SVLA 4DABA 1KZHA 1Q16A 1Z2PX 2GZDA 2RI6A 4Y6QA 1IFXA 4RF4A 3DZJA 2YJ6A 1R5OA 4NFSA 3VPBA 3HWWA 3G13A 2EX0A 1FSSA 2FQQA 1FE8A 2F3PA 1QVWA 3PSAA 2FWMX 4FYXA 5JH7B 3VR4H 4UXIA 4MYTA 4L72A 4QYIA 2I2FA 2PGLA 1OYVA 2QL7A 3AM4A 2FPOA 1KWKA 4JI1B 4IUDS 1WP9A 1FXUA 4R71A 5L7TA 2R0QC 4QLBA 5J23A 3IBTA 3IKMB 3GEGA 3GJSA 3BUSA 2JAQA 1H2HA 4BNYA 3PNMA 3PUHA 4Q93A 1F2DA 4AKTA 1R9JA 4H17A 4TKUB 3GXBA 4KG7A 2QRVB 4O2LA 1DUIA 3EWAA 2X6TA 3PUYA 1MNAA 3NHLA 2KM1A 2VJQA 5E9QA 2GZSA 2AW3A 4K9RA 2ZRNA 4CETA 5JSZB 3AH8A 4UTVA 1U8AA 1Z4LA 5EC8A 1A8SA 3MK31 4J7CA 4U4AA 1OWPA 1RU3A 2E5FA 1SBHA 3M6WA 2PV7A 2FEKA 5E3IA 4WHMA 1GGEA 3SE0A 3INTA 3THXA 4JI8B 5ELXA 2ZB4A 2Z0MA 3PF9A 4HEQA 1BDIA 3QMMA 2QZJA 3VSDA 4WI1A 3S81A 2V6GA 5IAOA 2P35A 5F1OA 5KDDA 1NN5A 4UTZA 1Z7WA 3BL6A 3PU6A 4XJTA 3C3WA 3MTAA 2GETA 2DECA 2FW6A 2P27A 1J56A 3LK6A 4PO9A 2QTZA 3F3MA 1QZTA 2P9EA 3BXXA 3TZEA 4JMPA 5IDVA 4C7JA 3USZA 1M2FA 3RK4A 2Y1XA 2CXQA 1ZN7A 4EA8A 2WKPA 1RYDA 3TR6A 1N57A 5TIIA 2D4HA 4K6OA 3MHPA 5DYWA 4RY9A 4N0EA 1RJDA 3I9OA 5HG0A 4X0EA 1IXZA 1X3SA 1GKLA 2NTJA 3P4UA 2VJOA 3JALB 3MNFA 4G8CA 3E81A 3SKXA 4NJEB 2BTEA 4DCVA 2DY1A 4WADA 4P53A 3TL3A 2IH2A 4KAJA 1CF4A 1BE6A 3C5CA 4BE4A 3CZAA 4KK4A 1YVPA 3I32A 4H4EA 4BO3A 2P2LA 4DDHA 5BYAA 1PAUA 1P31A 3H8VA 3ZG6A 1UDWA 1ZGAA 1E0SA 2OXIA 3UQZA 1SUBA 4F11A 1AO3A 1S2GA 4KWCA 5K0LA 1PR5A 5FTWA 4DLZA 2WA2A 5EIWA 3U5TA 2B3TA 2RGGA 4RV4A 5T64A 3SN6A 4PNZA 3O8OA 4QU0A 1ZBQA 3O8DA 3ZZ0A 2XT6A 2VTEA 3KZMA 5DTIA 2E5LB 2ZK7A 3ROPA 2JZNA 5IMSA 3O8BA 4M86A 4XQCA 1YAJA 1VM6A 1ZPDA 1O0BA 3GJRA 3LX5A 4MPRA 1RWKA 2ZP1A 4HN4B 4OHPA 2VH2A 1E79A 4BMOB 1OIXA 1V8OA 1ZWLA 3LGXA 1WB9A 1VLHA 2H4FA 4KE9A 4WGFA 2I65A 3IXLA 4I36A 5B6PA 4HQ0A 5H16A 1ECGA 1EWKA 1HUQA 1PNQA 3K7EA 3IMKA 3OTWA 3KYDB 3SQLA 3E2PA 3DMRA 3ESAA 4QEKA 1JT2A 5THQA 4A0FA 4EHJA 2HV8A 1L7XA 1AM4D 1I2ZA 1Q6ZA 3STXA 4D82A 2RKOA 4N0DA 3TPZA 1ULZA 3ZY6A 3H1TA 5JECA 3K8OE 4F6CA 2IS4A 2X8JA 2Q45A 3QNUA 4F2DA 4NAVA 3Q8KA 4LSWA 4WOCA 1ZICA 3W06A 5A2QA 1BYUA 4TVSA 4OQPA 3BXOA 1FP1D 1ZD2P 1G64A 2MCFA 5HJ7A 4M9ZA 2J5BA 1L5ZA 4FCTA 5AIAA 3SE7A 4EYSA 5EWMA 5AW7A 4GMXA 1LLQA 2JCBA 3K0CA 5JD5A 4YRPA 3G1TA 4QPDA 4CUJA 3HB1A 1D2GA 3MFYA 2CUTA 1EWTA 3M4ZA 4OLJA 1KDRA 3T9CA 1HY3A 2QVZX 4KFCA 4BV3A 3UHAA 2XTNA 4N5IX 2N46A 2UUAB 3ZZNA 4QKQA 4K6MA 2G9NA 4YCDA 3QW4B 1TGYA 1MGPA 2P9CA 2CF6A 1W5AA 3BMQB 4M1TA 1JLMA 3FTDA 3TBHA 3W3ZB 3PUVA 4HEHA 2QM0A 3WYAA 1RI5A 3AFNA 2PUAA 4MB2A 1U80A 2AKAB 3HL4A 1SC1A 2DFTA 3LDFA 4MGIR 3PT5A 3NBQA 4EATA 3FWHA 3LKDA 3PJGA 1YCFA 3A1CA 4MP8A 4CKCB 4JHXA 1GUBA 3P9RA 2NXWA 4MHTA 2HBYA 3L0OA 4A2WA 1DS6A 2ZJ1A 3B6ZA 4DGSA 5KYWB 3LQ4A 4QDXA 2XMPA 3R2JA 3HCAA 2XODA 3OEED 5TR9A 5KKNB 2BC9A 1GWNA 2BKXA 2GMWA 1EHYA 3CPSA 5IKPA 3LUBA 3Q85A 2DLNA 3U44A 2HIMA 4R5MA 4TVOA 5CW1A 1GA4A 1ZSNA 1E94E 1NM5A 3IIMA 2QTMA 1AQYA 5LN1A 4S05A 1UBNA 4UASA 3DEKA 3LVQE 2IZZA 2J5RA 4TXNA 1E69A 3Q3VA 4QTZA 1IU9A 1I33A 2ZYHA 4YMVA 3VPGA 4KQFA 1HH4A 1U2ZA 1UK9A 4G85A 4KJXA 4RX1A 4BUJA 5LLTA 3ZLJA 2O8EA 2C4HA 4JLUA 4YR9A 4DQKA 1Y4SA 4TN1A 2D3TA 5DBOA 4XDZA 3B1KA 5JCJA 1PD1A 1OASA 4J4HA 3Q3JB 1PSWA 4PCVA 4ZVVA 4I50F 2VAWA 3BQ9A 4ZO9A 2GTIA 4MUJA 4PBSA 3CXRA 8ATCA 4B3DA 2DPHA 1XN4A 2COKA 1UKCA 1XJ0A 4PZ9A 4Z1MA 4A15A 3HXTA 1EJ0A 3TZCA 4Y7CA 1NM5C 3ZHZA 3M82A 4EITA 3TRKA 1A8PA 2ZJAA 4OPMA 2QIPA 3G88A 3FY4A 2NO1A 4DY4A 5FDFA 4WJZA 1JR3A 1CPYA 1U7XA 3O4RA 1JGTA 2WWIA 5CIWA 2JJ1A 1PZXA 4QPJC 3UV6A 4Y2SA 2FR0A 3ESCA 4ENWA 4MGYR 3LQFA 1EDEA 1X7WA 4JBNA 3GEBA 1P1RA 1Q12A 3B3AA 4Y18A 5HKKA 3SXUA 4F8YA 1BG6A 2IEBA 3HVUA 3CWCA 3QVGA 2A9QA 4QO8A 1NNI1 2IEDA 3TSCA 2DBZA 2DWOA 5CB6A 2KPOA 3WLFA 5KQRA 4XEHA 4C2BA 3DW1X 1AKQA 1Y1QA 1YZGA 3C3YA 1JDNA 1ESZA 3H13A 3WQRA 4AG5A 4L28A 3U81A 1U94A 2CE2X 2IEYA 4WT7A 4RHXA 2IWRA 1KC1A 2WAYA 5ENDA 3GDFA 4XUEA 3ZXSA 1FDTA 1PR3A 4C29A 4L4RA 1HSZA 5LQDA 1P91A 1POXA 1ZK3A 2AQHA 3I04A 4FW8A 4E7PA 3MZ0A 4ECEA 4MW6A 1PK8A 2QRQA 1V1MB 1U0GA 1NT4A 3W5VA 2Q0SA 1QDLB 2VF4X 3LZDA 1Z5GA 3ZX4A 5K3AA 2JLCA 4UAUA 1MCZA 4JY7A 3C6BA 3G23A 4AJ2A 4RIHA 1EVJA 5BRJA 3DW3X 1MO2A 3UK0A 4ZEVA 1RXUA 2XWPA 5LP6A 4TV9A 3TAUA 1KBZA 3Q5DA 1T9GR 1V41E 1FZTA 1ADYA 4MR9A 1AUVA 4RGBA 2PX0A 4HPXB 4M83A 2HBZA 2W83A 2YHIA 5HTKA 2JLAA 1Z0UA 2WIKA 5KNCA 2OGTA 1HYEA 4K6FA 3LXRA 1CVRA 2QXYA 3R3VA 2UZIR 3K9QO 3UXYA 3CH7A 1GAJA 4RL4A 3OO0A 2YJ4A 5FPSA 3ZU4A 1RYNA 3CO0S 1MB4A 3AIOA 2ZATA 3UGJA 1NGSA 2P8JA 3I04M 4MNTA 2VSFA 1X1TA 2HFJA 3Q9LA 3MD9A 1SY7A 2OCDA 3CU5A 4UARA 4MYHA 4RIFA 4CEHA 1XTUA 3H8JA 3RO7A 1SBTA 4ONEA 3OHPA 4HY3A 4E2ZA 4P4SB 4ILEA 2XYGA 3H3FA 5JMPA 4EYKA 4LY9A 2O48X 3ZC3A 4UVGA 1EP2B 3BJIC 3O83A 3BXHA 4W6ZA 1O7JA 1UOPA 3MOIA 2RGCA 3DQPA 1N2GA 1X7ZA 3IAM1 4L75A 4LYHA 2ZLBA 5KTNA 3LV8A 2V7QA 2GKGA 1MRNA 2HMAA 4FB5A 4JYZA 3I1YA 3DE4X 3RSGA 4MVYA 4LK3A 4BNZA 3NETA 1AZWA 4FGSA 4B3FX 1R7RA 4R40A 4R54A 1V3TA 3BWVA 3OIWA 1U2RA 4QUDA 1G6Q1 1WMDA 3DDZX 4ZOAA 4PZLA 2D0PB 1PJ4A 3GVCA 4B45A 1J23A 1FNNA 3KAQA 1E6KA 1DCFA 1AZLA 1B7GO 4YRJA 4H1TA 2ZIZA 1GKYA 1LDNA 2JIBA 2QN1A 3WNDA 1E8DA 3T9AA 2CJFA 5FI3A 5EJ8A 2HBRA 4O08A 4ARCA 2WM2A 3TLEA 2FG7C 5TF0A 4LJLA 4F1JA 5K7SA 4ZOCA 4K6CA 1K7EB 4OQYA 1CUAA 2BMFA 3KQPA 4ZODA 5DDIP 2VWPA 5I4CA 1JFRA 2HWXA 2WQ6A 3GJ6A 4H60A 1CRWG 3A2KA 2X5XA 2X58A 1WZNA 1DWPA 4ZFNA 1UL1X 2TMYA 1KK1A 4BTEA 3QKSA 4TTRA 3DEHA 2I22A 3LLVA 4AZWA 1GRRA 1DKUA 2Y0DA 4GQBA 4YJFA 1OREA 4TV8A 5I7WA 1LVGA 3V33A 4RJTA 4G1CA 4GPAA 3N5KA 3JYNA 3T94A 1G2QA 3E48A 1E7WA 5IS2A 2FA9A 1UR5A 3RVQA 1N2CA 2L2QA 2FEMA 2IXDA 3L0SA 4ICIA 1JHUA 1DRVA 1RKVA 3COYA 2QRLA 5F78A 4CVNA 4IWYA 2OXFA 5ALVA 1GEEA 2V45A 4NCAA 2X5KO 1Q11A 1II9A 4Q34A 1SUAA 1PP4A 2VZ9A 4P4SA 4CN8A 3K0EA 4O4JB 2R8EA 4B2IA 5ERXA 4TMFA 2BIFA 3QPAA 1UXKA 1N7JA 4ZYVA 3C2QA 1D2MA 1Q1AA 5K5EA 1YDMA 3TX2A 2UXDB 1JEQB 4N49A 1KPIA 5HJEA 4FFBA 2Z95A 4XOIA 4EHIA 1A3CA 1M83A 4Q1VA 3ZDCA 2JFBA 4FSHA 3UJPA 1HLDA 5L3VA 3RFTA 1U63A 1WVMA 1XRPA 4O8ZA 1OXVA 1QZUA 1E2KA 1U7TA 2W2VA 3OX2A 1M1UA 1G8GA 3IULA 4EY5A 4ZICA 1IRIA 4J9VA 5IXJA 1GZ7A 3GJ7A 5F2EA 2ERCA 3QWBA 4HDRB 4DMCA 3TFQA 4E51A 5CXXA 3PC2A 2J6HA 2CZQA 1JG1A 2W48A 3G5TA 1L5NA 4F72A 5HCIA 3HY4A 4QT0A 1YJ5A 4LS3A 1DOZA 3D6AA 5G41A 1SKYB 2ECQA 4HNGA 2EJTA 5JBIA 2ZBDA 4Y1FA 3NHFA 3WMXA 2QRVA 1D1TA 4QTYA 4CL2A 5B57C 3P0JA 3L18A 1IJEA 1YRAA 5I7VA 1NU8A 1EA5A 4MVJM 1LQTA 3AI2A 1G3IA 3IAS1 3CVOA 2O06A 2MHCA 2X13A 1C0EA 1JHRA 1KJ9A 2X19A 3I92A 3Q5GA 5AI9A 5B12A 3QEBZ 5J3JA 3IL2A 4YQFA 3TD2A 4ARSA 2JLVA 3F3KA 4FGUA 4A2QA 1HZZA 3ZVLA 4FE3A 1WCXA 5JEDA 1RWOA 3QUCA 3TTUA 4EYEA 3WA6A 1YO6A 3ROFA 4J0KA 4K28A 3FW1A 1EFKA 3O91A 4TL8A 5JALA 4IR7A 3P97A 4J03A 3LXUX 4KQKA 2IPNA 4XM0A 2VJAA 5BWMA 2JFZA 3EXG2 4IDDA 5DTMA 3AO0B 1Z35A 2CXOA 3CUWA 5KQMA 1DIRA 5CYOA 4DA8A 3KPWA 4J3JA 4UBMA 2QZ9A 5T4BA 5IM5A 2IXEA 5TXGA 4P7FA 5LB4A 4JP2A 1NUPA 1U0HC 1AX9A 3GRAA 4MVCA 4X3PA 3ZWOA 1BOOA 1XJQA 3M33A 4MINA 3EXIA 4LQ4A 1QNLA 1I0LA 1RXEA 4MRMA 4LYEA 5DIFA 5HIAA 2EZTA 2VF2A 1DEXA 2FPSA 1YTLA 2W2NA 4JAVC 1GUAA 1G5IA 1GXSA 1Q3KA 2HMUA 3KLPX 4IJKA 3EDQA 1WR8A 5JMWA 4ENTA 2JLWA 3OZDA 1SN7A 3PC3A 2NUAA 1W36B 4TKZA 1Y7TA 1QH8B 3B6KA 2HGZA 4JI4B 4DLNA 1E2GA 3A3OA 3GLHE 4YLYA 1HI9A 3T15A 3ASYA 5BPFA 4FMPA 4RJJA 4WSOA 3IIIA 3B52X 3ZKWA 2ONZA 3RKSA 4L4XA 4I9UA 5HFAA 2IV2X 5IDXA 3GLIB 2NV2B 2BJVA 1CR6A 2IYTA 2VA9A 3C3XA 3VAAA 4I5EA 2BEWB 4QJ5A 4QU9A 4AICA 3QUSA 4FZVA 8ABPA 5JANA 4HDMB 1PL0A 4JJ8A 1ZX1A 3QEOA 1E1DA 2O7NA 3JWHA 3NUGA 3WK8A 1ZMXA 4TYWA 4NK4A 1VP3A 1Z4IA 1EM8B 3M1YA 1KO5A 1T13A 5CJPA 3SMVA 4KWTA 3WGKA 1BH6A 1Z2OX 1E96A 1MMFB 1RYBA 1UFOA 3BEDA 4MGEA 1YZUA 4W8GA 3V6LA 1YR1A 1MH9A 3CB2A 3R0QA 1H8HD 2V3CC 4ATNA 3EE6A 1G63A 2D3WA 3HWSA 3SICE 2J3KA 3AYXB 1V9SA 3IPYA 4LC9A 3TKYA 4CLOA 3BTSA 3RVPA 4RNDB 5CFNA 4BZQA 2Y67A 3ZCPA 3M6MD 4FQ7A 5BVGB 4M0DA 1ZONA 1G291 1XTPA 4DSOA 4WFIA 4MV4A 3B3JA 3STTA 3Q72A 4B1FA 2BYTA 2IH4A 5FUVA 1MV8A 1IQPA 1PNVA 2N1BA 2W2MA 2P9QA 3R75A 1KPGA 1B0PA 1WMBA 2XT0A 5FWNA 3A1VA 3CNEA 3EVAA 3P2IA 2B1RA 5A3JA 4K9MA 4KR3A 1Y8QA 1Q5PA 4MR8A 4EEZA 1QBKC 2D5IA 3QE4A 4I8DA 4IHJF 4XB1A 3U4HA 5JS1A 1V5GA 3RJ9A 2GTPA 3EODA 1FVFA 3OX1A 4XJXA 5K6AA 4ZAXA 1OX5A 1Y1SA 4TTPA 1JDZA 5EMJA 4TL9A 4J76A 2CXXA 4RHCA 4LEIA 4OSPA 3MWEA 4JA2A 2IYYA 1CF2O 1V9LA 3DFIA 1MOPA 4ZAYA 5DMHA 1DKOA 1W47A 2FGKA 5AT1A 2YWEA 5AWFC 3MXOA 4H6WA 4MQEA 1KTVA 1Y7IA 2H4ZA 4ZDIA 2WSYB 2ZRLA 1G20A 4ZO4A 4JLPA 1LW7A 1XWIA 1FRVA 1TC1A 4ESOA 4MK4A 3A6ZA 4Y6RA 1WHTA 1I3OA 1V45E 1YA4A 2GAAA 3IBCA 3WRWA 4MVJG 1XC7A 2ZE5A 3FBGA 1CQZA 1N2CE 2RAFA 3QPBA 1KE1A 3UHPA 2ATXA 1ZUWA 4YNBA 2ID7A 2A5JA 3EWSA 4N1AA 1Q0LA 4DR2B 3MXTA 1V11A 4RC9A 3OSUA 1NURA 1PVVA 1WUYA 4DV1B 3OZGA 4IGKA 4RESA 4AF8A 1C7ZA 3CEHA 3LCJA 4MQFB 5AVWA 3NDBB 1WWKA 3X0DA 1OXSC 1BC5A 1C7QA 1MX1A 2P7HA 3BTVA 3DYBA 4IQGA 4PZDA 5DSZA 4MWGA 4JJ4A 1JHZA 1H6AA 2GQ0A 3HKBA 3WMWA 4OL9A 3VSCA 621PA 2ZI4A 1L4NA 1I3MA 4KGVA 1T10A 2JIZD 4BNMA 1CZKA 5GJCA 1UPFA 4B31A 1GZHB 1URPA 5KSWB 1NXQA 1P5ZB 1PEYA 3LUDA 4ACBA 2R8RA 4FILA 4C21A 4ENSA 1OKKA 1Z4KA 2V7XA 2G1AA 3KU1A 3LQQA 1G0OA 1N2ZA 3MJ4A 2UZ0A 2AK2A 3OZTA 3EPRA 4IXDA 1VMIA 2B4TO 1UAAA 4O2BB 1XE3A 2ECFA 3QVVA 1ES9A 2APJA 1JRLA 2QG9A 3A0RB 1USWA 1B6RA 2IXTA 4V0SA 5DYGA 1Q50A 2VP0A 4DMFA 1E89A 1SG0A 5ESWA 1RBMA 2OHGA 1IOWA 5K0SA 3KZCA 3GLFE 2H1OA 1I7LA 1QFJA 5ALJA 4AZTA 3NIWA 2FOXA 3JAWA 3IQFA 1TYZA 2G17A 4S1NA 2I2CA 2WE8A 1L5RA 4A1FA 5LFAA 1F9EA 3FGOA 2K7ZA 1QIDA 2DUWA 5D8DA 4NFLA 3ZQ6A 2QZ4A 1M2HA 3O5AA 4LDAA 1QO9A 4GH5A 3HUTA 3L1JA 1W46A 1MFPA 1LZKA 4J1TA 4AWAA 5A0TA 2C0CA 4N3GA 3H2HA 1UOQA 3BE4A 1GPBA 1DJMA 2P9ZA 2AMFA 4OVKA 2WILA 3U1VA 3ESXA 4BQIA 3KKNA 4FE4A 4NNOA 1W6RA 3SX2A 1QKIA 2GM9A 3AZOA 3WB2A 3DM5A 3HKCA 2F43A 3QI2A 5D7NA 3KKEA 1TJPB 2FRVA 4Y2RA 4DCSA 4GR9A 4WZZA 5CDUA 3OVMA 5H68A 4X94A 4BO6A 4MPTA 1MB2A 2B5VA 5BN4B 3EG5A 3I61A 5H3LA 1ZZEA 2H4JA 3CB4A 3IKVA 3IA2A 4L6AA 3WLRA 1S5PA 3B1JA 4XB6B 5L6MB 3HUUA 2QLMA 1UMBB 2XWQA 3QKTA 4EK9A 2ZJBA 4BNDA 5JAPA 5I7HA 4PR0A 4RZQA 3HPRA 4U2GA 3A9RA 1SVSA 2GYWA 3NX4A 4M60A 3ZHVA 4PHFA 3UAZA 5EKUA 2VSNA 4A27A 4RORA 4RLHA 2UVDA 4XLZA 4CEIB 5C8ZA 4YDSA 1ACJA 4PG8A 2HHAA 1EH5A 3DCNA 1U4OA 4HEA1 3K9HA 5I7AA 3DPSA 4N6NA 4ZC1A 2HPZA 1GPH1 3OA2A 4MJXA 1FFCA 2Z8ZA 4N5NA 4O25A 4B17A 2J8ZA 1EWVA 1W19A 5ALWA 4D3ZA 5F2NA 3EG9A 2N75A 1XPUA 3SXUB 3J81A 5FA8A 2C88A 5P21A 2QTVA 2CSXA 1ZVVA 1NX9A 4ROSA 1QQ5A 1YQXA 2WSSA 3SWWA 3JX9A 4L6IA 2VRWA 4RGQA 4XH9B 4UU1A 3UTCA 3ZDEA 1ML4A 1ZGHA 2WHPA 3OKCA 3HLKA 2NLOA 2EP7A 4OHXA 1K97A 1C41A 4FCWA 2PO5A 4C7KA 3EGOA 3SF0A 1CKEA 3DOEA 4CMBA 1YHNA 4GMKA 1CY2A 2W7TA 2QSUA 3B9QA 1MJGA 1M5TA 1CG6A 1JNYA 2ZOSA 3IVRA 4RXTA 2H92A 2ZROA 4DWJA 2PZ8A 5BPHA 2G83A 5B36A 1OXKB 3RREA 1TT5A 3PPWA 3PIIA 3VO8A 5JATA 3G2KA 1JBEA 5A71A 2AFHE 2D5AA 3LPCA 1ODJA 5CLQA 4DRZA 2VWGA 4DC0A 3C4VA 4YCBA 1BEZA 4FDLA 3VPDA 1FW8A 2IBTA 2Q4TA 2HJHA 4MV0A 1DKLA 1PIWA 4HAXA 2TSYB 2RK3A 4U8HA 2AWNA 2GLTA 3QFFA 1CJKC 2WF8A 1W59A 3HY3A 1QZZA 1QIIA 4NOMA 5BO5A 2R48A 2VVTA 4GP9A 3NHWA 3QY9A 3H5NA 2FOLA 1C29B 3N0TA 5B1HA 3UN1A 4CJXA 1F7UA 3CMMA 1QJ4A 2PT6A 2HWWA 3GJZA 3IVCA 2VP5A 3LY8A 4M22A 5EAIA 3HA7A 4CHGA 5A4JA 3CS3A 4LFCB 1DBIA 3GEDA 4FFMA 2NUTB 1JG6A 2LDBA 3MJHA 1BS1A 1XCLA 2EX4A 3TSAA 2CLIB 5GM2A 3UB4A 3HZHA 1QONA 1NVWQ 2SKEA 3E27A 5JC1A 5EZ6B 1YBVA 4ZC8A 1K9VF 1JZQA 5KUTA 1CZLA 3RPEA 3I2FA 2HHCA 3NAQA 4YJKA 3CLTD 2JGJA 5K3DA 3T3HA 1TIPA 2AFIE 4AX4A 4TKUA 4PYJA 2NSHA 3AY6A 1SMKA 1R3DA 4A5OA 1WU7A 3CF0A 4HNTA 4NKRA 5JWRA 1E3LA 3E9MA 4Y9UA 1ATIA 4QHSA 2ZAGA 3VR2D 1O3YA 5EWLA 1E4YA 1Q83A 1T3ZA 2RGYA 2P2ZA 2PX3A 3O21A 4MGZR 1E63A 4E4RA 3MF4A 1KSGA 1HFKA 5K03A 1SCQA 3BG5A 2JARA 2XUGA 4NCHA 3FDJA 3VU9B 1P0IA 3I8OA 1EBUA 2R3SA 3IIKA 4F9GA 1L7QA 3HE3A 4PZCA 3T7IA 4QO7A 3THWB 1AB6A 2C9DA 1XCOA 3L02A 1TQ6A 1Z9BA 4LC1A 3T6KA 2IOFA 1R0YA 4R2JA 1G19A 4R1OA 1Y7PA 3DUFB 2O3RA 1QAMA 2YS7A 2H5IA 2FX3A 4KUEA 3HSSA 1J0EA 3LBYA 3M5PA 3SJAA 3Q41A 3H2KA 1IBSA 3AEKA 4ENUA 4HLDA 2Q3FA 4AK9A 1R9GA 4L4SA 3U56A 3U3JA 3EBPA 2ZWAA 3F6SA 4DANA 2VYFA 2RB4A 4MW7A 4HMQA 4OXIA 1ZN2A 1W52X 3MS7A 2CNBA 1ZD3A 3QYPA 5JJLA 2GWHA 1OX4B 2C31A 3CSDA 4DQUA 5AESA 1CUXA 1JALA 2P3QA 2PQ2A 4L4UA 1SA0A 2O07A 4L8GA 4RO0A 1PR4A 1DPGA 2V1XA 3DVRX 3GLHA 4CF7A 1V47A 5IABA 2I4RA 3KZXA 5CBPA 2XCSB 3GAAA 3TE7A 3CR8A 3QIVA 1KP2A 2BWJA 3R6TA 2I6QA 1QLJA 3LRPA 1T5BA 2BF4A 1MQAA 3AF4A 3HGTA 4Y6OA 5DP1A 5FJJA 4ZWNA 1O95A 1CLUA 3GBVA 3F5QA 3HU1A 3KO8A 4HEA6 4MPDA 5GONF 4BKOA 1MG0A 3OPNA 4FMBB 5D3MB 3KETA 1CC1S 2R5NA 4DNFA 1FYVA 3X2FA 5KBYA 3AF1A 4D97A 2QP3A 1YQWA 2Z1DA 1N1DA 3WDKA 1XAIA 4BNLA 2I71A 3HO1A 2I4MA 3RNOA 3ZY2A 1A4RA 3RRXA 5DM0A 3DZBA 3KPVA 2BRUA 4P0QB 4C06A 1M33A 3HR8A 5H81A 3TJZA 2G72A 5B2EA 1OXMA 1LPMA 2GEUA 4OSEA 2NU6B 1B26A 3H5OA 2V8OA 3W9YA 4UPEA 4F7WA 3F73A 3CZ5A 1SBNE 2EL9A 2H59A 1SUPA 3NHKA 2Z2KA 4NENB 5FUMA 1ONOA 3CG4A 4S2EA 2X1HA 3WMFA 4KR6A 1JQ3A 4ZIRB 4YAWA 2QRNA 2Z8XA 4Q4CA 3AG6A 1NUQA 1TF2A 1VIDA 2B6NA 3T8YA 4BB5A 4GX5A 4RFSB 4LV8B 4QNNA 5LP6C 4Q3LA 2WKQA 2XZOA 4CMEC 2O23A 4UM5A 1XB2A 2ZW9A 3ADDA 3IXQA 4YEDA 1M1YA 1XDUA 3PGKA 2OP1A 4HLUA 5H1YA 3OZXA 3F46A 3UJ3X 3T99A 3RAJA 4Q24A 4WCFA 3EVDA 4H31A 2XOXA 4BRUA 2WB4A 4ADSG 1A82A 1XWFA 4YV7A 1TMGE 2W5UA 2Q62A 4U2EA 4D41A 3EC2A 3HN6A 2EKZA 4H16A 1VXOA 2X0IA 4DOMA 3DMTC 3WK7A 2C7GA 5B64A 3EYWA 2HLHA 2TMDA 3GYBA 3L1IA 2OM6A 2IV7A 4PQYA 4OSOA 2HY7A 2VDKB 2ZJOA 4BMVA 1FU4A 1UDBA 1RADA 1TJ5A 1U8FO 2J31A 4OUKX 4X44A 1CU1A 3M1LA 5TDHA 3DHYA 5K8CA 5E6UB 3UKOA 4ZZIA 2FMTA 3A70A 4DR6B 4JL6A 5KVCA 1GL3A 4CHTA 3B89A 3FPEA 4GHWA 3DB2A 5IHXA 4O5OA 4GZLA 1JVNA 5HGXA 1YRQA 3DMPA 4RY0A 4RQUA 4HADA 4JC5A 1Z6AA 4YIKA 3A1WA 1UANA 3GROA 2HF8A 4QDZA 3AERA 5DWQA 5B7NA 1TFUA 1SURA 3MGAA 4RW0A 4WUTA 1N3BA 4DNQA 5EXPA 1UK7A 2F17A 2HJVA 3ITNA 1QTIA 1YFJA 4G89A 2OHVA 3VUEA 4D6PA 2E9SA 5CJ2A 2G63A 2A35A 1WABA 2D7JA 2GRUA 3OZRA 2OHOA 3PRJA 3RUPA 4QFBA 4BJHB 4EI7A 3U19A 3RUCA 3U4CA 3SIXA 4GOXA 3RIGA 3N8IA 4F12A 1E1CB 1Z2AA 1JB1A 3NFYA 4JI3B 1FLDA 3W7AA 4HNVA 3BMXA 4YMGA 4Q1FA 5FEUA 3AEUB 2B78A 1Y89A 3U48A 4C87A 3OCWA 3QBEA 3G89A 4DARA 3E18A 3D0RA 1UT5A 1DLJA 2P75A 1ZNQO 5CT8A 4MV5A 4YXWA 4I4TA 4Z4FA 3EY4A 1ZSVA 1HSOA 1W8IA 1O6ZA 3ANMA 4IS3A 2QQ5A 1H2EA 3EDCA 2EBHX 4Q4HA 4QGGA 4M0EA 5B37A 4H4CA 5LLSA 1NXVA 1OI4A 3IJ5A 3MINB 4X5OA 1A76A 1E6EA 1A96A 1OXUA 3ED1A 1EQUA 1MABB 1N3LA 2IOFK 3M9LA 4G4IA 1E6CA 2JCXA 4RPCA 5BYBA 1ZJ6A 2JKYA 1O8CA 1YACA 2CVPA 3QG1A 1KYTA 3R6WA 3T12A 5I7UA 1YV9A 5KC9A 3GLGB 2A1UB 1NWHA 3P9SA 4MQMA 2NVOA 1QG4A 4BWVA 4JB0A 2JIDA 4QAJA 3I05A 2QJWA 1JFLA 3FKJA 2BGNA 4YTEA 2FUKA 2F3UA 3JWPA 1J0AA 1QE3A 5BQ5A 2EYUA 4TKLA 1G2OA 4PZUA 2PAFA 1MN6A 1VA4A 1K8XB 2B5OA 1IWOA 3KJEA 3WO1A 2GVNA 4ZVPA 5CLJA 5CDFE 2ORWA 3EF1A 4HLNA 5JPCA 2BE9A 3K0AA 1J70A 3TLKA 3UZUA 1Q19A 3QLEA 1GTMA 1KY4A 5GINE 3VMFA 1EWRA 5IASA 1W0KA 2Q2OA 3B70A 4OKSA 1I1HA 1JYEA 5AKZA 3PKJA 3LZCA 1GLGA 1I30A 1WP4A 4LRQA 4Q03A 2EQBA 2C94A 2OV6A 1TM2A 1UUFA 5HF8A 4CIAA 1FNSA 3GJ4A 3NBUA 3RAEC 3N8KA 2XZTA 3JQFC 1VPEA 3JQ7A 5EVCA 4BMCA 3MLEA 1ISRA 1KP9A 4MQBA 1V11B 3N0VA 4OV6B 1L7EA 2K87A 1Q0SA 3K2IA 2DQYA 4GLLA 3QE0A 1YB1A 3F6YA 3GN1A 1XKLA 3DULA 3PL5A 3D3NA 1ZOIA 4O6VA 3LUGA 1FFAA 5C35A 4OYLA 4WXMA 1T0PA 1SUWA 1UFRA 1YI8A 4M89A 2MWMA 2CLDX 4B47A 3RYHB 2FRDA 3QOWA 4RV9A 4YUZA 1H2WA 3ZV6A 2LTAA 4WQMA 1RRPA 1ZK1A 2R6R1 2DTXA 3IE2A 1UXOA 3L06A 3OTIA 4FFOA 4O2AB 3CNNA 4Q21A 5F5NA 5AUPB 1QE5A 1IQ0A 1FU8A 3VC2A 4BZZA 4C3OB 4D43A 5BW5A 4WZ6A 2IEZA 1IB0A 2XCLA 1BN6A 1DGQA 4J0FA 4RDIA 2FI1A 3GFQA 2XVXA 3UOGA 4RWEA 2UUCB 4MWEA 2O8BA 5HUHA 2O2ZA 1G20B 3QF7A 3TLAA 3UMFA 3ZY4A 5GJVC 3KM0A 5E9AA 4QYXA 1TU0A 2Q8NA 2QE7D 1TM3E 1TT7A 1BXZA 2X8BA 4ZKEA 1W44A 4P2BA 2OMKA 3GJQA 1DC4A 2C9MA 3RTEA 1KH3A 3LVFO 4Y0NA 1KMHB 1JTVA 2YW9A 4Q3KA 4BLQA 2OENG 5KNDA 3DMYA 2RGEA 4EPYA 1R0WA 2DEUA 2HPHA 2J9GA 2C03A 2EFEB 3CR3C 4PC1A 5JARA 4UU7A 3T1NA 1A77A 3HXOA 1KJJA 2HDOA 1GO2A 4OHRA 1M1YB 2PNFA 1ZISA 1P3JA 5F9FA 3X1YA 4ZN6A 2ZBUA 4UHKA 3WQBA 1GYQA 2BMEA 4BFYA 4B0OA 2ZBVA 3DZ8A 4KXMA 3TW8B 3E7FA 1BXRB 5K6TA 1YMVA 4OLHA 1VGVA 1CCWA 2DWCA 3ZIAA 2V0NA 4DCUA 4MIEA 2OECA 3A9VA 3MJSA 5JCJD 2CNOA 2LW7A 4V0RA 2JL1A 4HFNA 1QIHA 1XNHA 4ZTZB 3BWMA 1IIBA 3F4KA 1H4SA 1NPYA 2KE5A 3Q7SA 1SH7A 4INJA 2I99A 2P3SA 4RZXA 1ZZGA 3TOSA 3FDZB 3GRFA 5IEBA 3V00A 1ESCA 1N2OA 2HIHA 1JFSA 1HYHA 2PXCA 1SKAA 2C8JA 4DUYB 4RLQA 4F1WA 3L4EA 2VWHA 4XPIB 2FFQA 2CFOA 1X7YB 1FDOA 4XDYA 3WHKA 4JLJA 2FDCA 4MDYA 1GITA 1RKXA 4ND1A 3ZEIA 1XI2A 2ZYUX 4HUJA 5H7XA 2IQIA 3SSOA 4LN1A 4HL6A 3V3TA 3VO1A 1QGAA 4YS6A 2GXQA 3ICOA 4ZRDA 3PXAA 3TR0A 3TWOA 4E22A 1I5EA 1PV2A 1PD0A 4S0ZA 3CCCA 4B09A 3B2EA 4KPUA 2JFGA 3ZU5A 1H6BA 4INOA 4LMBA 5LZ7A 1S89A 1SC9A 2PGJA 3VOBA 3H3XA 1MW8X 4XSVA 4ZGWA 1ZKMA 5DHUA 5JLJA 2WP0A 4B43A 4D26A 1XZAA 3BORA 2H52A 1VYTA 1QC5B 2BKAA 2XSZD 3P0RA 2VJCA 3TEMA 1T3SA 4IKOA 3RSOA 2ISCA 4R4JA 3FMGA 3IB6A 4M1YA 3ETDA 3GI1A 1IZ0A 2GBGA 4GQAA 4PQEA 1JQAA 2AQ8A 3GY0A 3VVBA 3ZI4A 1KYVA 2G9VA 1DP4A 4D9JA 1NXSA 1ENOA 2OB1A 3HNRA 4D81A 2B37A 2HA2A 2O4CA 2DULA 1TO2E 3WR5A 2PGDA 2VHCA 5DCWA 1GPKA 4PTLA 3FAKA 3VZBA 2K4MA 2NPOA 2OD9A 3HDVA 5LQAA 2R1ZA 1OBFO 3QKRA 2EG5A 3ZGLA 4PAOA 1Q91A 4ESEA 2Q8QA 3PEUA 5DNAA 1KZ4A 1INLA 2QLBA 5ESRA 4ZYUA 2B7BA 3L8MA 3I1FA 4OP3A 1APBA 1RRKA 3HI4A 2AG5A 4URFA 3IV6A 4ZVTA 2JCYA 3DGEC 4KVGA 4MYSA 9ATCA 1C8KA 1JHYA 4JOSA 3RVJA 5EZ5A 4DA4A 1SIBE 1G7TA 1VFPA 4WBNF 3KXDA 4KRXA 5JSZA 1XDSA 2DP4E 1WUHS 1BWSA 2PRKA 4WZAA 1Z28A 5CCDA 4A36A 4ND8A 4BEVA 1Q0TA 4U2BA 3N7AA 3WNVA 1LX7A 1MB3A 1SUCA 4TQ9A 1JI3A 2ALJA 2OPBA 3E61A 3BGWA 5BNZA 3RC8A 1IIRA 4AJPA 4HNAB 2G9UA 1CUIA 5CFOA 5CAEA 3ZHUA 4YP7A 2IRWA 4FYPA 4V03A 4I08A 4E6PA 4C9BA 3TSOA 2DY0A 2ZPAA 3GGOA 5LNK1 3UVEA 3A6DA 3D8BA 4MEBA 4FDVA 1DC3A 4D3XA 2O0LA 3NH9A 1JLKA 2NTVA 3CRW1 2AR9A 4ARVA 5C8DA 1HNXB 1A9ZA 2O0MA 1U2TA 1XZLA 1GCUA 5TVKA 4Y2GA 1XAGA 3SZLA 2ZM5A 1MHTA 5AXCA 1BRMA 1T6NA 2OAGA 4YRRA 1EFVB 1MJNA 1VLMA 3CZ4A 3WA7A 3GDGA 3IQEA 4DT1A 1G8KA 1DG1G 5DULA 4KIJA 3WLJA 3RADC 2PBZA 4Z5XA 2O8NA 3IHWA 3CY6A 5BRAA 3REOA 2OBYA 4NTZA 2A0KA 5FI5A 1ST3A 2O8BB 2RBGA 2PXAA 5TF4A 5K0NA 3P94A 3CRNA 1C3EA 2MSEB 2ODPA 3K31A 4JR1A 5BNWA 2ZJ5A 1KYZA 5IDWA 5BQXA 3EIQA 1WRBA 3CBGA 3L4KA 3JYOA 3K71B 1DRWA 5HQ3A 1NQ5A 3GWZA 4LCJA 3ZJVA 5B1EA 3AETA 2LWIA 5BUQA 2OHHA 3LOQA 3IUMA 2B2CA 4GBJA 1ZOSA 4P2GA 1GRNA 1DOHA 2HOQA 5LPNA 3IE1A 1ZVJA 3NALA 4ND6A 5IZCA 3WGZA 2E4XA 3U7QB 5I7EA 5KTYA 2EG9A 1L3IA 1QQTA 2QDXA 3I3OA 2A2ZA 1KMNA 3RUHA 5DPMA 5BUZA 3CVVA 4F8JA 1ILEA 5DNUA 5K9ZA 4GSLA 4H3VA 4I8IA 3I9LA 1TQDA 1I3LA 1Y0BA 4KSBA 5JD4A 3VNBA 3X3HA 2EZ4A 2MR5A 2OORA 4U6SA 3IEXA 1J2RA 1V1JA 3LTNC 4ZU6X 1EFAA 3I23A 3LP5A 4EI8A 1FS6A 4PFQA 5C80A 1EQ2A 3PQ8A 1Y34E 3WJ1A 2IYLD 2W2PA 3VR2A 4MW5A 4RANA 1YH3A 5JT1A 4AP9A 5JCOA 3FBTA 4WKGA 4FEGA 5ECGC 4ALKA 4KN6A 5CDYA 5REQB 4PVDA 4FQ5A 4TUYB 3OBBA 4ARBA 4YCLA 4BO9A 2BSQA 2XUQA 1RRCA 1SKMA 2QRMA 1PVOA 2C5GA 5AM1A 3QF4A 2YWDA 3G2MA 2VDJA 1CQIB 1LDMA 3MWDA 3RSHA 5C52B 1RMTA 4RZIA 2H2FA 5CCEA 5KNBH 1A7AA 3QPDA 2CUZA 5D85A 1DG9A 5C1PA 1P19A 1JWLA 3QVWA 4AZVA 1M6EX 5UKDA 3MS2A 1XV5A 4PC3A 5CM9C 2QTHA 2XV1A 4OFWA 1EFVA 1K08A 3EC7A 2F6RA 3BILA 1EJ2A 4OMDA 1X8LA 1H9BA 2VF8A 1Z6ZA 1Z75A 1K3TA 1A8HA 1VIMA 2XNSA 2YWBA 3EZGA 2HZ7A 1OKKD 2O05A 2G04A 2FEXA 1UM9B 1H2BA 2V96A 4IICA 3IAFA 2W2QA 3HYRA 4YBRA 4HN9A 4O4IB 4X8HA 4JYAB 1B1AA 2FEWB 3K1AB 4K03A 1XRMA 2P6MA 4BRZA 2XD4A 4NYJR 1KO1A 5HYVA 4ZTUB 4G0NA 1CNFA 1NV9A 1MVNA 1UXJA 2H1LA 4L7QA 4DA7A 1Z7EA 1C7IA 2JVIA 2EV9A 2C7RA 1CDZA 2PCJA 4BTVA 1EX1A 2C00A 2A9VA 2V7EA 3CR7A 4DVJA 3HXKA 1ULTA 3PFFA 4KO8A 1DO8A 1E2MA 3E05A 3LIIA 4N6GA 1HF3A 4P08A 1J0BA 2C8LA 1NVUQ 1JDTA 4B73A 5KYXB 2HK7A 1Q7GA 3HRIA 3HU5A 3JY6A 1XA4A 1PGNA 1KDVA 3ROXA 4ZCRA 5TMPA 1W9MA 3U44B 3JD0A 3K1ZA 5FRDA 3BFJA 1RZVA 2ATCA 1P4RA 1N9KA 1QWOA 1XELA 5GGYA 1XZBA 1GUFA 4TYMA 1KEEB 4OTZA 1SUIA 5TQVA 4DAOA 5JAIA 3D6MA 4PPGA 3UYKA 5JCZA 2FZLA 5M04A 2HFKA 5B58T 1Y9DA 1OPRA 1YQEA 2I54A 4GOKA 3L04A 5KTMA 2NG1A 4IOMA 5DISB 3V3KA 5LXTA 2Q1UA 3O9ZA 1V1MA 2ZTMA 4MI1A 1L1FA 5FLYA 5MDHA 3GVXA 3K2EA 3Q7PA 4O4HF 3BB1A 4UUAA 4HT3B 1YD7A 2IHYA 4A0RA 5KVVA 1QIEA 4P80A 5AJYA 4MVJD 5ITSA 3KQNA 3CKYA 1P33A 4R2IA 1KGDA 1FP4B 3SYMA 3QNMA 3OOWA 4FN5A 3CN7A 4N39A 1XEXA 3N58A 4PYRA 4AJJA 4B6EA 4OREX 1NI4B 3NW9A 1OFUX 1T9BA 2Z09A 3M6LA 3LJKA 1YGPA 3B48A 2PQMA 1RXCA 3RYIB 3FVQA 1HDXA 3DHEA 3DTTA 3EEBA 3C3KA 1VHLA 3AKCA 3LMKA 3LQ1A 5F3DA 5HS6A 4KR7A 5FF9A 1QKJA 4ZVOA 1HT2E 3ILSA 3S5UA 3QRWA 2Z2XA 1MO6A 3JQRA 5A2GA 3T7KA 5HVNA 2Y99A 1RYZA 4KO4S 3C6KA 3RHZA 4E7OA 2FPPB 5I45A 2B7LA 4FIZA 3VVCA 5KX5B 4G07A 2QW8A 3PKIA 1D2AA 3TNYA 4NLLA 2DPGA 2W6CX 4NSNA 4RFSA 2ZRGA 1FU7A 3U31A 3DFZA 3ODGA 4GYYA 3FFAA 1XWWA 5SICE 2ZUFA 1TI7A 1IBMB 1JEQA 3AQ4A 2BONA 4KBFA 3GNLA 3KG2A 3LQYA 3AKYA 3NO4A 4C30A 3WB0A 2NP6A 3C1UA 1J97A 2VHUA 3B7WA 2II6A 1QOPB 4MTCA 5F73A 3E9YA 3D8RA 1EAMA 3B1VA 3DDOA 5J9FA 3V32A 3DXYA 4OHKA 4DC1A 3NRJA 3LD9A 5FFMA 1NBEA 3K09C 1JHDA 3GUVA 1VGQA 1WULS 2HMVA 2C5BA 2D7DA 4TMKA 4UEQA 4FOOA 4XWKA 2WAOA 5D51S 4CIWA 4GRDA 4QASA 4XR4A 1O9HA 3VM6A 1QPZA 1FTYA 3JASA 5HCUA 4NBSA 2FPKA 1E4EA 1NZDA 3DNFA 3MTBA 4X45A 4D79A 5C7LO 9LDTA 4XYBA 1B16A 4BQQA 3EXEB 2WWHA 1W36C 1T9KA 5DYTA 4KW7A 2J6BA 2EQ5A 3FJYA 3C6ZA 3PCRB 2Y71A 2ZSKA 5C8YA 2UYCA 2YYAA 1QO0A 3K32A 1ZNWA 2HA0A 2Y2VA 1TD9A 1VKNA 2G88A 1LBTA 2XYQA 4MUFA 5FTNA 2DBYA 5E1BA 2AL7A 3GELA 4U0JA 2HSWA 1X0XA 1OWNA 2RGWA 3K4HA 3FUTA 4PGGA 3JWJA 3EEOA 2HJRA 4CE6A 3VDRA 4ED9A 1OH6A 5DX8A 4WLVA 1G17A 3IUEA 4O63O 2R5WA 2NU9B 1J8YF 1DI0A 1KY3A 3W1VA 3WRVA 1VJ5A 3GPDG 3VZCA 3B20A 3OLZA 1BE0A 3DMHA 4B40A 4HGRA 5ILGA 1TYDE 1YFKA 3PJDA 4JZYA 3RSLA 4MRNA 2AOXA 1WB5A 3RUDA 3CISA 2BBWA 4IGAA 4WOBA 2D5BA 2ZIEA 2WDPA 1IJFA 1ODIA 3JAWB 3Q1LA 3ASUA 2CF5A 1QQBA 3HBAA 1UBRS 3WYDA 4WWHA 4BKQA 4E4TA 3JVDA 3LSYA 2ZT7A 3H8WA 4PX9A 3S8EA 1FFEA 2HIAA 3ONFA 1YZQA 1JHOA 1RI1A 5GPBA 1DBVO 1DTEA 3RJTA 1PFGA 4EVRA 2XBMA 3GBPA 1UP4A 1P2VA 5FI0B 1N7IA 2UZ4A 3FNIA 1EUDB 2O7RA 1RPTA 2ZS8A 3S4YA 3KB6A 4D0LB 3PL1A 2WJHA 4N82A 1ZU4A 1M7HA 1PJLA 1KIFA 4D96A 1GGMA 4OFZA 4OJMX 2AOTA 2G6BA 2XMZA 1Y6RA 3C15C 4C0BA 3LAWA 3GEMA 4OF4A 4URYR 4TGLA 2WK1A 2Y0BA 2UUPA 1Y8AA 4MVJF 2SNIE 4L2IB 2D74A 6NULA 4TYYA 4FZ5A 2JAUA 1CRQA 3DF9A 1TW2A 3JRWA 4WK6A 3GGDA 1WD5A 2QP9X 3HVRA 1K7FB 3GB9A 3TNLA 2RHJA 1CE8B 2P6UA 3SP1A 1UMKA 2O8DB 1QGYA 4BZXA 1W4AA 4MA4A 4UTNA 3K70C 2ZTSA 1NQWA 1PJRA 5FL7A 4V3CA 3UMMA 4B5LA 3CKLA 1S2IA 1TK2A 2BGJA 1Y9ZA 1JHMA 1NVXQ 1PT9A 1Q7RA 2C3UA 2QMHA 4UBIA 3O1JC 2CHGA 3UMSA 3LF1A 1CQJA 4HGYA 1PG5A 1A04A 2ZIWB 2ID9A 3FR8A 1MJGM 4F96A 1IG3A 2JD1A 4F9TA 3U2QA 1XNJA 3SXPA 4PU0A 4B3GA 2Q3LA 2XXJA 4CR8A 1O4VA 3FYTA 4J8PA 4RTOA 1YR8A 2B8TA 5BNTA 3DBLB 5JH7F 4OGFA 3HJGA 4LMPA 3Q12A 6ADHA 4G0VA 4BVHA 4EIWA 1C4KA 1CR0A 2HCTA 3H0EA 2XJ9A 5IK2A 1E2JA 5H9WA 1TF7A 3F71A 3BFXA 4E4YA 4QQRA 3ZDXB 4O4IA 2BELA 4DA9A 4RPHA 1Y9JA 1EK6A 3C45A 1UQTA 1GGJA 1XA3A 1PUXA 1YZKA 1U1EA 2HEGA 1E1KA 1XDDA 2QEQA 2CFCA 2X0JA 1SVLA 3I8XA 3N2ZB 1AF4A 1FDSA 2PYIA 3ORFA 4NCKA 3MW8A 4R81A 3DFKA 3RUFA 1UMCA 3F1LA 3I12A 3IP6A 4RH1A 5K8TA 3GGPA 4GYWA 1CULC 1Z2NX 2YQ5A 3IQWA 3OQHA 3AESA 1RVV1 3NWJA 1TNDA 2PQ6A 5BQ3A 1XTIA 5I9NA 2BBTA 2XLCA 3ZDAA 4MS3A 4AROA 3AB3A 4X7BA 1NDUA 3W8NA 4PN3A 3DOFA 5KX5A 4R41A 3R9XB 5A4AA 3ZGYA 2J08A 3TEJA 2FNAA 5COBA 2YVAA 5JRJA 4U7DA 2P2YA 3N74A 2CXUA 2WWRA 3T61A 6REQB 1XEWY 2R2GA 2BUCA 1VLZA 3JQ9C 1B2LA 2JHCA 3M6XA 1XMXA 4WXHA 5L4LA 3A4NA 2CWDA 1FL9A 4KXYA 3QMWA 1KIAA 1UBUS 5ALYA 3IO5A 4CKBB 3HJFA 2BP7A 2PUCA 3II6X 2CEAA 4WLEA 5FNZA 3T1HB 2F3QA 3FX2A 3ZWXA 4CQJA 1OI3A 2JS7A 4MUBA 2FMUA 1NY5A 2WSSD 3LY7A 4JBIA 3RABA 1H3NA 4EY3A 3L2OB 1Y33E 4XI9A 5KU7A 3E9QA 1Y8ZA 2IIPA 4C4OA 1DWQA 5M34A 1H85A 1ZNXA 3K9NA 4DQDA 1N2JA 5KOIA 4JELA 1FJXA 3F3YA 5D01A 4IILA 1EX7A 3WBBA 1DMSA 4BWYA 3UO8B 3FLEA 5DVZA 3BK1A 1CYDA 2VFAA 3GJXC 2XX3A 4JJGA 2N0SA 3FYUB 3PE3A 1UBOS 3G7SA 3GRRA 4O59O 2XOKD 1K4KA 4OAPA 4IJMA 4J29A 2BM8A 3I01A 4C7BA 4QUGA 3QJ5A 1TKCA 3IDAA 3RS5A 4IIBA 4C14A 1HDGO 3A11A 5D00A 3VYSB 1UIRA 3LY9A 3ONNA 2GD6A 3FOFC 5IT0A 1DEOA 4R8VA 4AIIA 4A5SA 2HO5A 2ZWVA 2R00A 3UMBA 4GPTA 5HP4A 4CDGA 1OZ0A 4W1PA 4Z4QA 1UPBA 4L8LA 5KYTA 3GVHA 1VE1A 3THWA 3F6PA 2ZAMA 1NATA 4U8GA 1V8BA 4EKYA 4UQOA 2IYQA 3NIGB 1U7HA 4OQLA 1N5LA 2F1RA 5D3ZA 4LJYA 5DSXA 3VI3B 4RKWA 5JFOA 5BYJA 1Z4OA 4ZU3A 1XEAA 5A4MS 3BQNB 3NVMB 3PCXA 4B34A 4TTIA 1ZHFA 1UBFA 2PIAA 1I32A 5CT9A 1SBQA 4OGWA 4EW3A 1AV6A 1YJBA 1LDEA 3KS9A 3P9IA 2GM5A 1EGAA 1O58A 3HH8A 3B85A 4IVPA 3VNAA 1HT0A 2XNKA 2Y0EA 3UBTA 4DUGA 1TIBA 2X0NA 3IUQA 4Q7MB 1YQQA 3T52A 2HF9A 1LQ2A 2WT8A 3FPBA 121PA 1WAMA 4WKOA 1IYZA 3DHNA 4ZV7A 4EG8A 1O94D 2EC5A 1FDIA 2C4WA 1J49A 1U3TA 2DC1A 3DXZA 3G2IA 1I1OA 1XFAA 4PPYA 3NHZA 3ZEAA 3S8YA 4DMRA 2FK8A 1F8FA 4E31A 5EEGA 4D8UA 2IE8A 4ALNA 1YXMA 5CH8A 3BAZA 4HV4A 5FBLB 1FNBA 1N6NA 1T9HA 1CVIA 3EJWA 3UV3A 1T4CA 4E1AA 1GQ2A 5JI3E 2EJCA 3WVNA 4D45A 3IS3A 3NYWA 1VLLA 4NDZA 4YPVA 2A5GA 2N1MA 4HQ6A 2PQ0A 3JARB 2Y0PA 1ODLA 2F1JA 5F21A 5FYDA 2J0UA 1YBHA 3NEPX 2V59A 4B75A 4QZVA 5KTSA 5ES3A 4M99A 5IYZF 1Z47A 3IUYA 1XQVA 2H1HA 1CB0A 2O3QA 3GIWA 1X6VA 1RPNA 4I2NA 4NEHB 4BIMA 4EX7A 3OZWA 4MEAA 1HZZC 4ZDJA 3CIOA 4ME6A 4ON9A 2QZZA 1NMZA 4I5DA 1BVUA 2PBRA 2X9NA 3GLSA 3H6HA 3OLVA 4UMFA 4QFDA 4NBRA 2GJ9A 2PVCA 1OWMA 2RAPA 1Y9EA 1AN0A 1HFEL 2QQFA 3EQ2A 3HMKA 2ZJ4A 3KJGA 3KKPA 1EFUA 4JT9A 3ZIAD 1A9RA 2Q5LA 3NEAA 1SPBS 4HH3C 1SUSA 2ISQA 2VQ3A 4KXXA 4Z0PA 3VVMA 3BMOA 1ULSA 1E9EA 2DUMA 4RVNA 3HJHA 2OHXA 2YWHA 1VE5A 1LA2A 1TAUA 4Q12A 4MVJE 1L5SA 5T6BA 1GL6A 1Z0SA 1PR6A 3U7RA 3HS3A 1YJQA 4C4YA 1K88A 1LFAA 4RS3A 2A5YB 1B8OA 2X9GA 2O8CA 4AJ1A 1E6UA 1JBKA 1PJQA 1Z6YA 3MERA 4EFKA 3RODA 6AT1A 5JY1A 2AXQA 3DV0B 4W5OA 5KSZA 1G2PA 1NR5A 2FSGA 4OJNA 1BA3A 1KTIA 1QIFA 1Z17A 3WK9A 4CV1A 4YC7A 1UOOA 4IV0A 2PS0A 3D6FA 4BKRA 2XOKA 3D6UA 3O4GA 4FCCA 1LWOA 3UCFA 1FDWA 1E77A 1VKJA 5MHTA 4YVFA 4L4ZA 3JYLA 3PFNA 4XTCS 3SOPA 4AJKA 1HWYA 5JUWA 4YMTA 2ZRIA 3RV4A 1BU5A 2VOJA 3FYCA 3U3ZA 2VAMA 1EE1A 1MC1A 5CU7A 2E18A 3UW3A 4Q66C 3TZQA 1U6JA 1BN7A 1GYRA 2AE1A 1IONA 2VATA 3KOMA 3BSFA 2Q1YA 4KRYA 4L5YA 1FP4A 2WJZB 3NGXA 3OQBA 4ARUA 2O2SA 4F2GA 1WXQA 2XCIA 1VIAA 5JBQA 1D07A 1A95A 4OK5A 1UFVA 5GGXA 4HLCA 1JEDA 4RKFA 2HA5A 1KBOA 2NNLD 1W75A 2LKDA 4J2TA 2XWSA 4AY4A 3NBZC 3HC7A 4EW2A 4Z4EA 3DSRA 3ETLA 3CM0A 1QLWA 3K16A 3G7NA 1OGJA 3IJRA 4II2A 3VR6A 4TS3A 3A2LA 1W5TA 1ZM2A 2QXUA 4TMXA 3FPFA 1IOZA 4RVCA 1COWD 4WUVA 5AW5A 3H16A 5AKYA 4Y2QA 4F3TA 2FZ5A 2JHGA 3V4FA 1VRCA 3RRNA 5BVHB 5JSHA 1DIAA 4PX5A 5F35A 5BOSA 3H9UA 1ZCJA 3HWRA 3PA8A 3DUWA 5TEWA 3FLMA 4IFIA 1YVEI 4JX8A 3OOEA 4LNAA 4DCPA 1V71A 2VA8A 3AR7A 4EHHA 5AJWA 4EHAA 1YZTA 5K05A 4MKXA 2DPLA 3C16C 4B48A 1OVMA 1AOXA 3BBPA 1EFHA 3BGVA 2R66A 4EBBA 5ES4B 5L40A 2O8FA 3NGMA 3Q9NA 4HUTA 2GEFA 2H8KA 1RPJA