3HCRA

Human ferrochelatase with deuteroporphyrin and ni bound
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
359
structure length
359
Chain Sequence
b'RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
molecule tags Lyase
source organism Homo sapiens
publication title Product release rather than chelation determines metal specificity for ferrochelatase.
pubmed doi rcsb
total genus 128
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcrA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcrA01
3GOQA 2QD5A 3HCNA 4F4DA 2XWSA 4CCSA 2C8JA 2XVZA 3W1WA 2PO5A 2QD3A 4MK4A 1C1HA 4KLCA 2QD4A 2HRCA 2XVYA 2Q3JA 2XVXA 2AC2A 4KLAA 2PNJA 2H1WA 3AQIA 3HCPA 2DJ5A 2JH3A 2Q2NA 4KLRA 2XWPA 1C9EA 1LD3A 2PO7A 2AC4A 2QD1A 4KMMA 2XWQA 2QD2A 1HRKA 3M4ZA 1DOZA 1AK1A 1N0IA 3HCRA 1L8XA 3LYHA 2HREA 3HCOA 2HK6A 1TJNA 1LBQA 2H1VA 1QGOA 2Q2OA
chains in the Genus database with same CATH superfamily
4DWOA 5BRAA 1RI5A 3B8HA 4Y2SA 1FUEA 5MFPA 1ZH6A 4W4TA 5JI3E 1LQTA 1ZQ9A 3S29A 3TRHA 4QDXA 3S99A 4IUCS 1NJSA 1N5DA 3K16A 1BJTA 3SJUA 4DCPA 4ETWA 4R8KA 2PS1A 4PF1A 4RIGA 4BV9A 1JZSA 1G55A 3F67A 2ZUWA 1N77A 3WWZA 1DQZA 3BKXA 5FPYA 1JHPA 3LDAA 1U9YA 2X42A 2BCEA 2EBHX 3AETA 1M1XB 1Y8QB 3ESAA 2ZT6A 4FHEA 1OI7A 4QGFA 3STUA 1Q0TA 4TTQA 2E1PA 2JFYA 1N1EA 3AQ4A 4K9OA 1CVRA 2ZIXA 4MI6A 1X70A 2R11A 3LY8A 3V4SA 4OHYA 1JR4A 1IZZA 2NN3C 1XMIA 1FU4A 4G0ZA 3X1YA 2PA0A 2R7NA 3HB0A 1M2VA 3HKEA 4OSPA 4ZU1X 2PPVA 3GPDG 4GMXA 5AJUA 1RS0A 1QO0D 1XLTA 5EKXA 2GN9A 1CB0A 2W5UA 3ODGA 4AKTA 3I62A 1JWAB 2ZWOA 1NN5A 3DBLB 4E1BA 5AM5A 4OUDA 1W73A 2B7LA 2Z1NA 3BUSA 4KNYA 1OW3B 2F3QA 1M2OA 1PZGA 2VSQA 4C03A 3OT1B 1NMZA 2FZ4A 2IE0A 3PNSA 5EZYA 4LYAA 1A1SA 2LXNA 3CKYA 1KI4A 2MOKA 3MELA 4FGWA 5C1OA 5KQPA 2BI7A 4L8GA 3UMVA 3NEJA 3RC1A 2OEPA 1XRSB 1L5MA 4YV7A 5ESWA 4MHSA 5KYWB 4D3FA 2VQFB 4FNAA 5FTNA 1FQJA 2HNAA 1PT6A 2E87A 3PTLA 5KOJB 2C2XA 2FDRA 4I9UA 4RVOA 2X3YA 1UPXA 1CJTC 1ZGCA 3K31A 3P9PA 5MF6A 5FADA 1ST2A 4GC5A 1ZH4A 3G8YA 3FVTA 3GFGA 3NW9A 1U11A 1XNHA 3M9XA 3UAOA 4CCAA 1Z6AA 2ZRKA 5LXTB 1M9NA 2F1OA 1Z34A 4Q12A 2MCFA 4D74A 3N9IA 5KKNB 3D7LA 3LQ2A 1EAMA 1O95D 4LXHA 4GPEA 1UXJA 4QTXA 3RABA 2UZ0A 4MS3B 4RGBA 3CU5A 2A5YB 3I5AA 2D1RA 3Q6IA 4QBIA 4QWWA 4ANFA 5D3QA 2DBQA 2O6HA 4DUYB 1NQXA 2J3HA 2ZSHA 3KAPA 4L4SA 1ISRA 4QGHA 2ZJAA 2WEKA 3L4JA 2XMZA 4AKHA 2QRVA 5C4IA 3R6WA 2A7QA 1ECGA 3HE3A 5FD8A 2AR9A 2HXGA 5EZYF 2Z3WA 1PN3A 1XGKA 2X4LA 4QXRA 3DYIA 4A8HA 2P2ZA 2Z43A 3T9BA 3A31A 3O9VA 4PO9A 5KMGA 1X86B 4FKBA 4HB0A 1BS9A 3TPCA 1OJLA 3PL1A 1S1CA 1XMVA 1RRVA 4JSYA 1VZ3A 4S1TA 4EY5A 4BC0A 4QPCA 2BBTA 2IXBA 4IIVA 4OO3A 3THOA 2QG6A 2QQFA 1PW7A 3WQBA 1SKQA 4RSHA 4MGHA 1K5PA 1VIYA 2I1WA 3IS3A 1CT9A 1QK3A 2VI5A 4TXJA 1JQDA 2NVWA 1GAEO 4BLUA 2HW8A 2FPIB 3HXQA 4LC0A 3P9IA 4W82A 3O9ZA 3SYKA 1NBME 1PJRA 2H0QA 1HE2A 1U4OA 1JHXA 3H11A 1P8JA 1NU8A 1S89A 3AI7A 3O3NB 3QLEA 5DBIA 2GILA 4IH4A 3DP7A 4TMWA 2B8EA 3NIFB 3PWZA 1W85B 3H1FA 1LDGA 3KQQA 2C4NA 1ZU4A 2D4AA 4OTZA 1QAMA 2RI6A 4PG5A 1RZVA 1B8NA 4IIJB 3RVMA 4PE5B 5F4BA 2QE7D 4HK4A 4KQ6A 1CFZA 4B7AA 3OAAD 1OFTA 1GZVA 2E9SA 2ZB4A 1E8NA 3PQ3A 5AVOA 3W1WA 5F1PA 1QUFA 4BCCA 2QL9A 3UATA 1YQUA 4JGIA 2XR1A 4AYXA 2V7EA 1KO7A 3P94A 3WGHA 1XA3A 3VPBA 4TV8A 4BB6A 1XTUA 4RJTA 1MX1A 1TCCA 5IVPA 1NNEA 2QGFA 2EJUA 3N0VA 2Q1WA 3O03A 4NDAA 4Q7JB 4Z9YA 3WMFA 4A0GA 2BKXA 4PZLA 1XF9A 4B45A 6ADHA 2YV1A 3FMOB 1AQNA 3COVA 4YDSA 3EC7A 1G5IA 1PBNA 3SSNA 4K46A 4L5AA 1NUHA 1QK5A 1RHQA 2PG3A 4R2JA 1L5OA 1CY6A 3TDKA 4KJZA 4KWCA 2Y68A 2H31A 3EDMA 1V9LA 2I99A 3V48A 5HUJA 1YNSA 1WM1A 2O0KA 3GEGA 1J70A 4Z86A 4A2QA 2PGJA 1R3UA 3KJNA 4ZPXA 1I3OA 5EIWA 4C2BA 5FYQA 1JA9A 2B1RA 4MJXA 1CE8B 3MJ4A 5C81A 1X7WB 5M7EA 1OQAA 4L2IA 4ZOCA 1SU8A 1JEJA 4GMGA 2COEA 1DRVA 3I8XA 3IBCA 4X64B 3OHPA 3IAEA 4XTRA 4HJXA 2QEQA 3KRTA 4W5OA 3EIQA 1F8XA 1E1CB 2PD6A 2X6RA 4MVXA 1B6RA 3VR4A 5KNCH 3BIXA 4CQLB 3H4VA 2YS7A 1BOOA 4JROA 3OCCA 4D98A 3LYLA 3W6ZA 4JC0A 4X3PA 1GY8A 2CVFA 2QE7A 3GJ6A 5EVJA 1A4UA 1B14A 3IVCA 4CNBA 3AHCA 2W0MA 4JJFA 2EKLA 2JGMA 2OHOA 4TMZA 1TF2A 4OP1A 1DC5A 2A0YA 4BKQA 1BCSA 1DKRA 3F49S 1SBQA 2YHIA 2JJ1A 4Q9NA 3EPKA 4MEAA 2PSEA 2X2FA 4QU0A 5J2UA 3A1NA 3HLKA 3QQPA 1YJBA 13PKA 3RLIA 1GNTA 1N2BA 1ZONA 2WPDA 3HFGA 4QBTA 1GZ5A 4UMEA 3TRKA 4F11A 821PA 4P5DA 5K8CA 2CGEA 3PQDA 4S35A 4EUKA 3IGFA 3OJFA 2Z4SA 3A7EA 3FJ1A 4EG0A 1I0ZA 4R68A 4GGPA 3CH5A 2C77A 4N0MA 1SQ0A 4GLLA 3FF4A 1V7QA 1XR3A 1C1XA 4NSNA 1C0LA 4OFBA 4UE3S 5LYJF 8MHTA 4DV4B 3MHTA 4KIWA 4HHEA 1XTPA 2VPXA 3BRQA 1CWUA 5DI3B 3D2LA 2P3LA 5EWMA 5JXWA 4YJDA 3HACA 4A7PA 5ALLA 2GM4A 1O8CA 3UH0A 4O5OA 2PNFA 3LE8A 2IE8A 1AK2A 1D2EA 3SI7A 1VKHA 1Z6QA 3P20A 3AVVA 1Z0SA 2R751 2MSWA 3ZWOA 4YHBA 5JCZA 3QSYA 1SG6A 1F12A 4YACA 4WLUA 4C78A 2ES4A 2M2IA 4Q9AA 4JR1A 4DV1B 4TV9F 1CIJA 2WUVA 1G0NA 3I9NA 1P75A 1V45E 3FDJA 3DFKA 2I67A 3DDZX 5BUCA 2VUHB 1G38A 3GFVA 1U3CA 1AA6A 3GNTA 5IC4A 5JQGB 2YIMA 2PRKA 6REQB 3UPDA 3M4XA 3R5XA 4BLOA 5FPTA 1ABBA 2DZDA 1JTFA 2GCNA 3KTAA 5FWAA 1XAGA 1L5QA 1P91A 2F1RA 3H1TA 1UMBA 3OO1A 4XJXA 4FOSA 5T67A 4KOEC 1U7PA 5AIBA 1TUGA 3EEBA 1Z7GA 3V4VB 4BJ5A 4JX8A 3GNSA 3UXMA 4EMBA 4WBXC 1JBEA 4M88A 3FKSD 4F3TA 4WCVA 1JA0A 3ZX4A 3RODA 2QP9X 2FN3A 2Q1SA 2YTZA 4HWSA 2JD2A 3KQYA 5E2BA 1ORWA 1RLIA 3KWLA 4C4OA 3KOMA 4YB8A 4PPGA 3NH6A 3DUWA 3LD9A 1JQAA 1HSZA 4KIUA 5CDGA 1GXSA 5A62A 2EZ9A 2PT5A 2HADA 5AO9A 3NWEA 4BBJA 5HJ7A 2QX8A 3L5OA 3SDSA 3EB9A 1BVYF 2PTGA 4G5XA 4PG6A 3RYHA 4BMPB 4DIFA 4ZHSA 1T1EA 4RL4A 2DXIA 4IW3B 1PWYE 3H9EO 4LOLA 4FE4A 2GTHA 3GGPA 2ZWPA 5DTJA 5FL3A 3UB4A 5D7BA 1YVUA 4XB1A 3R0QA 4DEVA 2ATEA 3EIOA 2QTTA 4XW2A 5H3LA 3MLBA 3ZGYA 3AINA 2BLNA 4I5DA 1M3SA 1VE9A 4LF4B 2QE6A 1EBBA 1M5UA 4UEOA 3T0IA 3ADOA 1PV1A 2K87A 2AWOA 1UEJA 5BV7A 4WEQA 2JIPA 2O5RA 3CUUA 3L49A 1OZFA 2GO7A 2VS1A 3B60A 4TSFA 4W7HA 1JJVA 1Z15A 1SXIA 3OPYB 2Q2OA 4PPFA 1L7NA 4AZTA 1Y33E 3ZQUA 2HV9A 1RR6A 1L1EA 4FNOA 3G68A 3LZ6A 1J0AA 1VZ2A 1Q0HA 3NONA 5GONF 1FP4A 3U7IA 3WGVA 5ALRA 4BMSA 5B7NA 4FLFA 1YRWA 3GDFA 1URPA 3EIWA 5CT8A 3ZZUA 5C8YB 2XYVA 5JU6A 4BQSA 1GLVA 5KVAA 3EXEB 5LIPA 1BMQA 4B75A 3QYAA 2WSYB 5IJXA 3HJNA 4RS4A 4JYMA 2XDWA 4CT4B 2ZU0C 1SO8A 4N01A 4AG6A 1IM8A 2PLAA 4F5EA 2J46A 3TSOA 1M7BA 1UXOA 3ICPA 4ZVMA 4DLWA 2XKJE 3I9JA 4TS9A 4KXNA 4N65A 3R8XA 1EUQA 4NARA 1PFYA 1QFXA 4IHJB 1KJ8A 3A05A 4A8PA 1GTSA 1AKRA 3HFRA 2VH1A 4WKCA 1T6BY 4D2IA 3L8GA 3THRA 5HIIA 4KQKA 2RIRA 4R2LA 1O89A 1XMSA 4NH0A 1U0BB 3LA6A 1K5HA 3L8CA 2GHQA 3ZCQA 3OZXA 1IUPA 3E03A 4V0OA 3CURA 3A11A 5FFNA 3KC2A 3UG7A 4MRAA 1ZOPA 2FGJA 4FBMA 2OXRA 4RTLA 1KDYA 1KYTA 1SVWA 2RGUA 2DSTA 3B70A 2QIOA 1WHTB 3T52A 4N82A 2J45A 2ZREA 4WKBA 3ZVLA 4RWEA 3MWDB 4ENUA 5JCOC 3JATA 4ZYWA 3DYVA 1QC5B 3UC9A 1FVHA 2JI4A 4AZ3A 1RWOA 3QBJA 3T7SA 1QTNA 3PNQA 1TCBA 1MAUA 4Z1MD 1E0DA 4A8JA 2YW9A 1J8DA 1A0OA 3PPYA 1U0FA 1YKFA 4DLYA 1TVKB 1PCXA 1JDUA 2PL9A 3LPCA 4DA6A 2NO0A 2A9OA 4DM4A 4O2AA 1M2NA 3F5SA 3U56A 1YZVA 2FX5A 2RB5A 3OLQA 3TO5A 2A0XA 4PCAA 3UMBA 1IBMB 1JFFA 2BFDA 2I4RA 1FFWA 4JBYA 3AQIA 4F9EA 5HKKA 1DLJA 1G21E 3TEMA 2WWRA 3OQMA 2ET6A 5LQSA 1L1FA 3AKZA 3NBKA 4K9NA 1T8SA 1Y6JA 5AI4A 1ZVVA 4BNWA 2XWQA 3LBIA 3BBLA 3U7QB 4ICIA 4JGGA 3UOAB 1WU8A 2IV3A 3AY7A 1EUCA 5C8YF 1R0ZA 2I66A 1RXWA 4LV8B 4F5YA 2A5GA 3CH6A 3GRVA 2A0WA 1HDCA 3FYCA 4KE8A 1V35A 2XNJA 1JBKA 3MTBA 4FGUA 1W96A 1KIMA 5FI3A 1WP9A 1R16A 5JNVA 4ETMA 2BFFA 4ZCQA 2A78A 2WD9A 2CYAA 4S2UA 1Z37A 2CUKA 2I2AA 1YQWA 2H1IA 3DZHA 3N0RA 5LBIA 4DRYA 2GPNA 3KKQA 2DM6A 1VOTA 3NCHA 4XWAA 1XVUA 5HIMA 3D4BA 4R1OA 3BK2A 4J0EA 4F1WA 4X3OA 1RIIA 1IEWA 2Q2VA 4UE2A 3C6ZA 1GUZA 1US8B 1G0OA 1TGYA 1ZUHA 3JVUA 5K0SA 1X87A 2AK3A 2O05A 3TZ6A 10MHA 3QYFA 3WL5A 3CB4A 4KMOA 2DCMA 2PEYA 2J0UA 2PYZA 1FBNA 4K8OA 4PVCA 2XDQA 1G3MA 3GU3A 1PR6A 2R44A 5AW1A 3EEOA 1WMFA 3EDCA 1JHQA 4GC9A 1N6HA 1WPXA 3C4QA 1PJ8A 3KQWA 4BV8A 1Z4MA 1P5JA 2H06A 4J1SA 4FHGA 4IP0A 1FYXA 3RS8A 5F3DA 4G1FA 1SXQA 4FOOA 3Q7PA 4NV0A 4YJHA 2HV8A 1ULUA 2WIBA 1FMLA 4NNPA 4XFKA 4DLSA 5CITA 2D0IA 2JJ8A 5I4BA 3ZCRA 4EYSA 2II6A 2ZI4A 4YJ3B 1X2EA 2SCUA 4RZQA 1WJGA 3NG1A 5G0WA 4KXQA 2IUEA 2ORVA 5FO1A 1K97A 3CY6A 1C9JA 5C8ZA 2WF5A 3LGXA 1EHCA 1UF9A 2OBLA 4UM7A 1X80B 4IGKA 1M1YB 3OHMA 3B6EA 3W2GA 5EHGA 2W58A 1ZSVA 2EBFX 2CZCA 5BV2P 3JASB 3L4EA 3K0BA 3S28A 4OHKA 3KYCB 4CEJA 1QF7A 2OCKA 3NIDB 1ZHFA 1K7CA 2PMDA 5L6LB 4Q1EA 2X8LA 1C7QA 4G0OA 3UJAA 4G89A 1U2SA 2Z8XA 4ED9A 2DJ5A 2ZTHA 2CCJA 5EMLA 4IJ6A 1S3IA 3VH3A 5CM9C 2XKAA 1PLKA 2WFMA 1H3FA 5AI5A 5H83A 2QTHA 4FE7A 1E3IA 3IP5A 4A9AA 5LCXA 3ISTA 3L82B 4QD3A 1L3IA 1JLLA 1PL0A 4EENA 2DEUA 1QCCA 1DAPA 4JT2A 1B2RA 3WNCA 2ZJBA 5AUOB 2EW2A 1XL1A 2QAIA 5DTEA 4NMLA 3FPCA 3N2EA 2KB0A 1U8FO 3CH4B 3HS3A 3RVKA 2XADA 2FN4A 3SHVA 1QIKA 2HUPA 1C0KA 1GOTA 1W9HA 1ZVMA 2J08A 3TMKA 4RULA 1XDSA 4QVGA 4K1XA 1AUPA 3ZY3A 1BAPA 1UM8A 4GMHA 2FX2A 1I94B 1PYDA 2ZGVA 3BZBA 2BGIA 4Q3LA 5TQJA 1VKRA 3DKKA 2OSVA 5EKSA 3GJXC 2I3BA 3R1IA 1YFLA 5AW8A 1KI2A 4V24A 4Q4LA 3UA3A 3PGMA 1L7OA 5ENZA 1GCGA 1X3SA 1F0KA 1I7PA 2MT9A 4FD3A 3TE6A 4X6UA 4ENQA 5HQ3A 5C37A 2RHWA 2OV4A 4CEHA 1SHTX 1YVDA 3HY4A 2D5CA 5HZHA 3A4LA 4MYTA 2OOSA 4Z7OB 2EX0A 3GJ7A 4PC2A 3EBLA 4DYDA 4WY5A 4OKIA 3P9SA 3M4YA 2JLUA 1LTHR 3DM9B 1W76A 1S0UA 2B8WA 2I78A 2JARA 1Z6YA 4FR2A 3SNHA 4KU4A 2RGBA 3ZW9A 4BECA 2BEVA 5KI6A 2XZTA 2R85A 5IWCA 3LRTA 1KOLA 2AD1A 4MGYR 1LBSA 3TZBA 4C3ZA 3T4EA 2Q5CA 1VJRA 2NU6A 1Z82A 2C4VA 3X1WA 3L1JA 1XWIA 2JBHA 1TF7A 1ODLA 3G2LA 3A4NA 5EE1A 1UPBA 4BS9A 1KMHB 1QHEA 1TTQB 3P9QA 3FCOA 4IR7A 2FFAA 4HVCA 1NYTA 1HDXA 2J32A 2QGNA 4GKKB 5F33A 1YASA 4Z0PA 3U44B 3P0HA 1XDGA 2FDXA 1IY9A 3B2QA 5CIYA 5K1ZA 1R4NB 2I8LA 2JIOA 1QDEA 3OY2A 2X15A 2O0LA 3AILA 4M8LA 2Q1UA 2AJTA 2Z2XA 3OUTA 2PXXA 1FYFA 4PTLA 1HI9A 1ECLA 1C2YA 4DNOA 1M5TA 2H8GA 3QF4A 2PRIA 2ZG6A 4JNCA 3D9QX 2JKZA 3GFBA 2X5JO 3B78A 3O26A 5GONB 4LF5B 1NQWA 1KU0A 1P1BA 4W99A 4GOJA 4BNDB 1EUZA 1FFEA 4XVCA 1XNGA 3FNEA 2OSBA 1X1CA 1PWHA 1TK2A 1G41A 3UJCA 1IN4A 3WZMA 1TO6A 3CNOA 4UTVA 4DA0A 1TQ2A 1C41A 1I5RA 1PQPA 4XJSA 4PFJA 3VZBA 3PUZA 1E9AA 3T1OA 4XGKA 1RP7A 1Y89A 3H8WA 3OKAA 1S9HA 3MJCA 2ZJ6A 3QY0A 2FWIA 3CJQA 1U3VA 1Y82A 4U2EA 1FU8A 2C8KA 5IYZF 1E4OA 3I37X 4CI9A 4PSVA 5A4FS 3L0OA 3AHJA 3RV3A 1G8AA 2PWPA 1FDWA 4ENRA 4QSMA 3QKRA 1NF9A 3FB4A 4U7TB 2P5UA 3JQQA 3KQPA 5IAGA 3TRJA 4XYEA 4I2NA 1O6ZA 1Y34E 1WKBA 3HU3A 3OCZA 4DUPA 1JQ5A 2OHIA 4PFSA 5ALTA 3BTVA 1MC5A 4BKUA 4DE5A 2WSIA 3DMRA 2WE8A 3AB3A 3I1FA 2ZR9A 3AP3A 1NDQA 1QAQA 4MVJF 1CR0A 3BWXA 2W2KA 4RF3A 4WK0B 1AV6A 1XZMA 1QO0A 2R6R1 2ZJ8A 3UANA 4C6TA 5FWXA 4HYEA 2UZ4A 3D8UA 4IEIA 4TV9B 4RW0A 4E33A 1UBMS 2JIZA 2QXUA 1AS3A 4ZOQI 4ND1A 1IMOA 1K7SN 4W9NA 3LVFO 4HDAA 4V0LA 2XSZA 1UMCA 3C6QA 3OMLA 4RPCA 2AC7A 3V4ZA 2IZ1A 2WINI 4NY1A 1RPZA 1RC1A 4MWZA 1JLKA 1TCAA 1IZ0A 2X9QA 4UAGA 3RYCB 2OZEA 4RZ3A 4QUHA 5JWRA 1BTOA 1Y9JA 1A5BB 3UFXA 4CCYA 3PXXA 3U6KA 1CUYA 2VATA 2GBLC 2IYWA 2GETA 2J3MA 3MNFA 4GW3A 1USGA 4PX3A 3EGXA 3HEAA 4W63A 3B9BA 3UO8B 2AWNA 3BIOA 4RZ2A 3UWSA 3SZMA 4IOLA 3GLHE 1T6ZA 3IE1A 4D42A 4V0ME 2NQTA 2FE4A 1NKVA 3MUEA 4WFIA 1OFUX 4W5RA 1NW6A 1AB6A 2GX6A 1YRAA 2XECA 3VO8A 3E0XA 1SFRA 3IL2A 2WJ4A 2E5WA 2UVPA 5IDYA 1G3RA 2H5LA 3GLGA 1P62B 1B41A 1K66A 4EL5A 2AN5A 3LCCA 4JI8B 1QP8A 1ZY2A 3KVOA 4OAOA 1V37A 4OJMX 1XD8A 3LL4A 4EP1A 5KDOA 3SICE 3UK7A 1PG5A 1AQLA 2PZFA 2VDLB 3BA1A 4OBWA 4YT5A 5K6AA 3L6OO 3CZRA 3VHRA 1K86A 3E9QA 2BM0A 3EDOA 3ICCA 421PA 4M7WA 2BFCB 2H0RA 2PLNA 4X1IA 2DQZA 4JLWA 1L4FA 2QBYB 3BE4A 4Q05A 4FWBA 1TCUA 3NBQA 1FZTA 4M21A 5GM2A 4JDUA 4RESA 1XZQA 1HZZA 3AGQA 3G0CA 1F51E 3FUTA 5LNK6 2G1KA 3BIFA 1C9NA 4GKBA 3T12A 1T0BA 2Q3CA 1LKZA 1G9TA 3FKQA 4DQKA 3DD1A 1BS1A 2HJHA 1CEXA 1M1UA 2PLFA 3JTMA 1IJBA 1E9BA 1RXEA 2DPYA 2XF2A 4UHFA 5EQFA 2OM2A 1PD0A 1EEHA 3L7KA 1CNMA 2IEZA 3NIBA 2QZPA 3A3NA 4NI5A 1GRNA 1N1GA 2GLUA 3JY6A 4C7JA 2QR5A 2FN7A 3L7OA 3T9AA 3H5TA 2GYUA 1U0EA 1P44A 3K1TA 4ZVPA 2CNLA 1RACA 2BGRA 4CMIA 1SKMA 3NO4A 1CETA 1XDWA 4I81A 4W8OA 1EWKA 1SKAA 2CVHA 2VJYA 3F9IA 5T57A 1Z5PA 4B1FA 4MO2A 2H1WA 3GLHB 4BRWA 3GT7A 4H3SA 1C4XA 4M0FA 2PV0A 1C0PA 3E6AA 4N76A 4OHRA 4H3KB 4BO2A 4ZO6A 1W29A 1KBQA 3E3AA 2CN1A 2W2LD 1VL5A 3C3EA 3DL7A 3AESB 3INYA 1T8YA 4P83A 1Q0UA 1XU4A 2YYSA 4Q18A 1SZPA 2EZ4A 3AL3A 3WIVA 4DJEC 1EI9A 4ZWNA 2RGXA 1A2KC 1XPJA 3IR6A 2PNJA 1JR6A 1BYUA 2X2PA 2FKNA 2FE1A 4RLQA 4AURA 1ORIA 2NP6A 2AYZA 5JRJA 2ZB8A 5IRCD 1E63A 1A7JA 2VAVA 3P2KA 5CDHA 2JK0A 1RWKA 4BBPA 4YO7A 4IDAA 4L9SA 1CUFA 4P58A 5FBVB 1B8OA 1FA9A 1NQUA 3TVDA 5P21A 4BN4A 3NETA 2AXNA 1G66A 2FPMA 2V8BA 3MWKA 4L4XA 4JC8A 2CV1A 4CLRA 5HR5A 3UUEA 1M6NA 5KSWB 5K01A 2JZNA 3PHGA 3V7FA 5FUQA 1L5HB 2DOKA 3U3JA 1OBFO 3RU9A 4IDEA 4DLBA 1FFDA 1KZ6A 3HSSA 2D1YA 1ETUA 4IJKA 1SKYE 1O58A 2J3DA 2XQKA 5LFAA 1Z26A 1KR2A 1R9GA 4ZOLF 4MKZA 2V1UA 3O2JA 2Q4TA 2XGGA 3WMRA 5EERA 4XUDA 3TE7A 4CHTA 3QITA 2XE8A 4DG5A 1P33A 3MQFA 1JB9A 4YAJA 3U1TA 4FZ3A 3LDUA 4ENPA 2OG1A 2WUFA 4DMCA 3O8RA 4Z4FA 2O50A 4G85A 3TKAA 5I7FA 1N33B 1QFYA 3UN1A 1AN0A 2PJRA 2QNRA 4OUDB 3I9KA 1TJYA 4NZNA 5LBUA 3C6MA 4RQUA 4YGYA 2TMYA 4ZJPA 4ZZ1A 5JNWA 3ABIA 2O57A 1RHMA 2FLKA 4TL9A 3IJRA 3QFTA 1QM5A 4IYRA 5F1OA 1CLEA 1CZNA 3NOOA 2XE6A 4Y2YA 1ZN7A 3CRRA 4IYJA 4K87A 3FKJA 1I7SB 3ZI0A 1E5VA 1WVIA 3FPHA 4OVKA 3GFRA 1QGUA 1V8PA 1V48A 3AKYA 3QUQA 4EAQA 4MW0A 4G09A 1DRWA 1V8FA 1ZJZA 5I6DA 3KNZA 3PHLA 5JNTA 4E32A 3N8KA 4W5WA 2PX6A 4PRKA 1QV6A 3FCAA 3W0LB 2GF9A 2AJCA 1EJBA 2IPLA 2V7VA 4GUAA 1JYFA 5J1TB 3AUXA 4R9UC 2VNKA 1OX4A 3KOOA 3MWJA 3PL5A 4L28A 2O2ZA 3B7GA 3TTWA 1V7CA 2VK1A 3ZTWA 3T5AA 1XXHB 9GPBA 5NLLA 2IUTA 3QUTA 2CB9A 2X76A 2W37A 3PNPA 1DDOA 4KNVA 1VA4A 2RFLA 4MRMA 1KSJA 1VP9A 4M0EA 5JQGF 3ZJUA 2BISA 2QX7A 5LDDC 2C4WA 5DN6A 3RH0A 1WOYA 1G6Q1 1LNQA 4ALMA 5JSUA 2O8FA 3RWBA 4XAQA 4L0QA 1X3LA 3B85A 3D4LA 3QEKA 4V0MA 4CKWB 4N41A 4H9GA 4LBVA 1JUDA 3Q7EA 1F06A 1R15A 1WCV1 4XASA 1JKIA 1YJAA 2R97A 4FXPA 5K8TA 1PJQA 3AF3A 3P0IA 1W1UA 2EBUA 3QELB 3MN1A 4KQ9A 4ALKA 4P4UA 1TQ6A 5CHYA 5BR8B 2R79A 3JZFA 3NYRA 1M2JA 5FNVA 5BT8A 3WJ1A 2H9IA 3T9FA 4J9VA 4F4JA 2QU7A 4YWJA 3VSCA 2ZANA 3A8TA 2OGZA 1UOPA 1IJEA 1E9EA 1N75A 4NEHB 4MV1A 2IKSA 4CL8A 4EY3A 1FNMA 4C4RA 3VKFA 1W85A 2NSLA 3K4HA 3MQ2A 4PV7A 4L9RA 2GK7A 4RSRA 5IABA 4XVUA 3WICA 5KTYA 2E4ZA 2JCXA 4OJYA 4M7RA 2X77A 3K3PA 1VPLA 3IEUA 1TM1E 5JS2A 4RSMA 5JH7F 2H92A 1RXUA 2AZMA 4EG7A 2W6NA 4HFMA 1ZINA 3UGKA 1Q22A 1LEHA 4REQB 3T15A 5JASA 2JS7A 2OCYC 3HWWA 4S1OA 3WGLA 1V7ZA 3NBZC 4Q4DA 2X4GA 3I9LA 2ZUTA 4LDNA 1E1QD 6REQA 5JWOA 3GFSA 2NYVA 5IVKA 2D54A 2JLRA 3D2BA 4PYNA 2ZDHA 5JT1A 2WUWE 3AO0B 1PJ3A 3ACBA 4MB6A 2XKKA 1LRKA 2G9RA 1L4NA 2Q5EA 4AY4A 4F56A 3UMSA 4MMYB 2Y92A 5AW7A 4XGNA 4YTEA 3PXDA 4S2EA 3U31A 3B3QA 5G4KA 4Z49A 5SZHB 1T0IA 4DY4A 3IH5A 2SECE 5MN4A 1DPGA 2LP4Y 4J6EA 3G9XA 5FR2A 4L76A 3UJ3X 4PG8A 5EJ6A 4BCBA 2Q3MA 1C1DA 4C5CA 4PAOA 4RCZA 2UZ1B 1B1CA 4B6EA 1X7WA 1R88A 2BKUA 4NZYA 1TAGA 2C7RA 4J2TA 3D81A 2KJQA 5FL7A 4R98A 4L0DA 1YZQA 3OA0A 1XN1A 3I2IA 2RHTA 3EVAA 3I9OA 1GU1A 4GEGA 3RANA 5BR1A 2ZR0A 5ALWA 1PNTA 2FJPA 4AN0A 3KSDO 1JDSA 1H5UA 1VG9B 2GA9A 4WUVA 2B37A 3O93A 4HEA6 1Z4KA 5IVHA 5EE5B 2H1LA 3UJDA 2XLBA 3C3BA 3PNBA 1JN0A 3JX9A 2WP0A 4K6KA 5K0NA 4P84A 2AJLI 2YKGA 4JJEA 5KNDA 3KO8A 1I6WA 4XGRA 1CW2B 1ECFA 4D92A 4KBFA 2I6UA 3OH8A 4EGCB 1OB2A 2RDMA 1UKBA 4DLPA 2IC5A 1YKSA 2DQYA 4B4KA 1SQSA 3JQ7A 3VR3D 1IPHA 1CVLA 2OFXA 3OZ7A 3WFIA 2WF6A 3I6IA 4PZYA 4TMFA 2FU5C 1KGSA 1X7ZB 3O4IA 5HYVA 4AJOA 1QRTA 1MORA 1NE7A 3PDWA 1Z18A 3UB3A 2G06A 1UJ4A 4G86A 2AFHB 4YCNA 1TIPA 2XQFA 3Q0IA 2CFIA 4X6LA 5F9MA 1P7PA 3UENA 1YA8A 4TL6A 4CLEA 1J42A 2ID8A 4Y6LA 3T4XA 4IDDA 1BN6A 1I4EB 4ZIRA 3G6KA 3QUBA 3EVBA 3VHXA 2GD0A 1PEAA 2FPRA 4X1YB 3SE0A 3SXUA 5KYUB 5FWNA 4MJLA 1YAHA 2NZWA 2F67A 4JKYA 3AVYA 3ZQJA 4O2AF 2VHCA 4CV1A 4RY8A 5B30A 1BMTA 3AZPA 1SWVA 1PR1A 2OB1A 3ABRB 3UEOA 1QQ7A 4AU1A 3INRA 5LQRA 5IKXA 3SNKA 5FTKA 5EZSA 4BXOA 2WA2A 1P61B 3ZY6A 2QUKA 1M5RA 3L7YA 4FR5A 2ZUDA 3AFGA 3K9HA 1DTSA 5I9MA 1QIIA 4R16A 1HL7A 4KLRA 2E37A 4P0TA 4D3XA 1CY2A 1QQBA 2ZRCA 4Q9IA 1E79D 2N3ZA 5I7RA 2Z6UA 3D0KA 4A92A 3HVRA 1D2HA 1RYNA 1CP3A 3CKMA 3QHAA 3QK7A 5ALPA 4GI2A 3E7PA 3PKIA 1VG1A 2HREA 3HDGA 1O6BA 2AYXA 4EJMA 5HRCA 3RU3A 4HDKA 1GWNA 1JECA 3PZBA 4FMDB 5BQ3A 2GH1A 3I12A 3VKHA 1QFSA 3V8PA 3IUPA 1TZKA 2M6SA 2ZP1A 1E2LA 1PTJC 2L82A 1I80A 3CX8A 3DZDA 4C4AA 2QD4A 4MGIR 5L51A 3GPLA 3EVDA 1PLJA 1YUBA 3O83A 3L8YA 2MYPA 2EDAA 4MARA 1GQRA 2YWDA 5B36A 1F9AA 1SBNE 2XEXA 1QHFA 1MAVA 1S9DA 3P9ZA 4GOKA 1GR0A 1X7HA 1Z4OA 3V2GA 4BMOB 3TLCA 4RIHA 2VDUE 2X22A 3GC6A 1XTIA 3O47A 4M89A 4DA7A 1I9CA 4U7HA 3H3JA 3Q72A 3OQIA 3ICVA 2X5OA 3RYHB 5I8WA 4Z2AA 1ZKDA 4HQRA 5CA0F 3FYDA 1VMEA 2PZGA 3AV0B 3WDKA 2PXCA 1RPNA 4YQEA 3AF1A 4CDNA 1VE1A 1GUBA 1A4RA 1HLDA 5I9NA 1GNRA 1MH1A 4YR9A 3NHPA 2ZBPA 2ZKLA 3OEHD 5FOSA 1YULA 2QUJA 4IH9A 1I10A 1FNDA 2C99A 4MWDA 1CF4A 4IOJA 1NF3A 1YS4A 1IN6A 3NRJA 3ILHA 4HEJA 1BS2A 4M86A 2CT8A 2E4YA 4E6PA 2J87A 3EQ6A 3LK6A 3JTEA 3RS4A 2ZI3A 3BH7A 5FI1B 5IJ9A 2H65A 1ZVJA 3WKBA 4DZRA 1HQDA 4ND5A 2O8VA 4UCWA 3PX7A 2OESA 2PAAA 1BJRE 2QMEA 2PH7A 2ZXEA 3E84A 3VYSB 5CA1B 5L4LA 3MC1A 3F5FA 1DJOA 2NW6A 3BVPA 4MZDA 2DT5A 4QSHA 4F5ZA 3MWEB 2OQVA 4D26A 5C8YA 3VDXA 4AD8A 5IK2A 1OWOA 2A3NA 1T4BA 5JJCA 2XEDA 1SELA 1W93A 2W2XA 5KB3A 1VKJA 1GTJ1 3VPHA 2EARA 1XTVA 1YZNA 4R81A 7AT1A 5LP6A 3OQ6A 4XJTA 2PFKA 3VDQA 4CFZA 3EC1A 3IYLW 1HKUA 5AK5A 2I71A 2ZSBA 3L7CA 4BZWA 1NOKA 2J48A 1KE1A 4ZJYA 1TQDA 4OFWA 3ZHOA 2B69A 4XDYA 5FF9A 2I33A 1E6UA 4H15A 4H59A 2K7FA 3CS3A 2ZYRA 2FK8A 4XTCS 3VU9B 5ABPA 3K1YA 1N25A 3OCJA 1YDWA 2F64A 1ZN8A 5EEHA 2ARKA 3OF3A 5TARA 3CNHA 2BFWA 2F3UA 1GGHA 2CVQA 3IVRA 3L7DA 4NYIR 4R0VA 4Y2QA 3P2MA 2RAFA 4KB5A 5DGHA 4JUFA 5J5CA 3ZHCA 4AROA 4CM3A 5BXYA 4QPDA 3MGAA 1ORDA 2HJ9A 5HS4A 2QOEA 5ESRA 2Z5VA 5CEEA 5LL6P 4UHHA 1DZ3A 1M2EA 1TZBA 3U81A 2BFAA 3AFNA 3WIBA 1XKTA 3KBBA 3OJOA 4S0XA 4QRDA 4M0KA 4BP8A 4TKVB 3ZHTA 4D4MA 4MWBA 3N86A 1X8XA 3THXA 2FZVA 4BVHA 5IG2A 4AZ3B 1RRGA 1WCWA 5FV4A 4I50F 3THYA 1KZ7B 4Z1OA 2RK6A 1C7JA 3NIGB 1Q95A 1SVOA 4MV9A 5KJEA 2NUBA 3KVVA 5EPUA 4AO6A 4QQKA 2OO3A 5LJLA 4QOGA 4B7XA 1HURA 1Y37A 2VFAA 3KK0A 3SR0A 4M0MA 1YT5A 1KJ9A 4Q1VA 2Y2UA 3H2BA 2ODTX 4MINA 1G20A 4KSBA 3FWPA 3TL6A 3VR6D 1JXMA 4BO7A 4KGXA 3K9FC 3CR7A 1Z0KA 5DIFA 2JG3A 5DTIA 5BW4A 4RS3A 3JRNA 3OE7D 1RYEA 2BD0A 2P79A 1JIUA 5BYJA 1HE3A 4EH1A 5C46F 1IEVA 1Y81A 5EXDA 5C8DA 1JKMA 5IUNC 3G2QA 5A0VA 4IEFB 3TDNA 4C4SA 4DG9A 2X13A 1C4WA 1XT6A 4BQEA 3H5WA 1CJSA 2MWMA 4WGFA 4OJKA 4XSVA 3MMZA 1G5QA 1HFKA 3NKLA 4D4IA 1P80A 4X8MA 3VDNB 1OGYA 1UKYA 4A8JC 1KBOA 1A97A 4DARA 2PR2A 4F3YA 5JV5A 2PVPA 4AL4A 3SK0A 1X7XB 1OIXA 1SXPA 2IHTA 2N47A 1GKIA 1PYOA 3CE6A 1K5GA 3WGMA 1NF8A 1A4XA 3F3SA 2VBIA 4U2FA 5JLJA 4PZAA 4ZOLB 1ZIXA 1CS0A 1UOOA 3H2GA 3E9NA 2P3QA 3HUUA 1QKIA 1ESNA 1Y98A 3N58A 1E58A 5TE9A 2HMUA 3T61A 2YOFA 1FNNA 1T0JB 1KEUA 2P6NA 5A3JA 1LX6A 2JLBA 3ZDDA 4ARBA 4TKZA 7REQA 1L8OA 3HUEA 3GVIA 3FPKA 3NAQA 5REQB 4R01A 4QFBA 3TD2A 1WV1A 1M8PA 2DKNA 3A1WA 4Q9KA 4E12A 3HJHA 3HR8A 3KHTA 3Q3HA 4FB4A 1Y3BE 1DKLA 2XTNA 4X7RA 1DAMA 4Z5XA 3HWX1 3OPYI 3LP5A 2OBBA 4ZT3A 5BORA 1F7UA 4LWPA 2VZ9A 4FWIB 1K5DA 3ER6A 3GIWA 2EP5A 4F4CA 1LS6A 3CUYA 3X1XA 2Q7DA 1JR2A 3RIEA 2FEWB 3D0QA 4B6JA 1ETHA 4HYTA 1ACJA 4G5YA 4JB3A 2AEFA 2PL1A 2GPAA 1E8MA 2Q3LA 4CR7A 3W77A 3LH5A 3EFOB 1QF6A 2O8DA 3AX6A 1WVGA 5JROA 2IIPA 2P2YA 1VB3A 1V96A 4YJ3A 4RD0A 1PR4A 3K2EA 2XCOA 5CGQB 5JC1A 4TN1A 3BK1A 3C4JA 5FOTA 3NBUA 1GR1A 5JJBA 1KTIA 4EHHA 1JALA 2JAWA 2RHDA 4YP5A 5B2FA 2J7KA 1NVVQ 1AY0A 3NV7A 4HH1A 1G2OA 4MA5A 5JY1A 1P74A 2QNIA 3BC1A 4AWXA 4DUGD 4NR0A 4RFSB 1K6IA 2IXTA 1Z4JA 3SBEA 4KITB 2D13A 2DR2A 4A6DA 3RGGA 4C05A 3QYJA 4MVYA 5BYAA 1RTKA 3TF5A 1JPVA 2QMQA 3K94A 5JLAA 3A6FA 2DF8A 3NH9A 4V39A 4AJKA 1C3OA 3JD2A 4HZGA 1AZTA 4QLOA 2AS0A 2BLLA 2WNSA 3GJ8A 3I72A 4R2IA 5K8IA 4TWBA 1APBA 3HTXA 1C7FA 1J8FA 4C0KA 2RKBA 1NHWA 1R0BA 3F6YA 1BX3A 1ZMTA 3O2QB 3F2IA 3OLZA 4OH7A 2FW6A 2ZBFA 4JB2A 3NBFA 3KT8A 4MA4A 4MYDA 3D2AA 4OXXA 1L8QA 3P9YA 4CKZA 3U49A 4HOYA 1TMYA 3O38A 3GPIA 1O5IA 2AVDA 1QH1A 2WYHA 4HZUA 4ZKEA 4B71A 2XXAA 5TQ0A 1CY7A 4RJJA 2JIQA 3UF0A 4EMUA 4LA4A 4LX0A 3ELUA 3W2EA 5ADUS 5IAKA 1KU6A 4JXJA 4DR4B 4ZYVA 2IHUA 3A1DA 5C51B 2NU8A 1QHYA 2GFHA 3KKNA 2JF0A 2G40A 2LDBA 5MN6A 3ICEA 3H9UA 3IHTA 2PE5A 3W5BA 4OHVA 4PCVA 4DM7A 5JXIA 1XN4A 1PP4A 5T64A 5JHGB 5AYVA 2I65A 3AM3A 3OUUA 3TJZA 4AJJA 4CEHB 5F3WB 5I4KA 2G08A 3WHKA 5JZSA 1CC1S 1NRWA 1Z2OX 3TG2A 3AONB 2HPVA 3ROQA 2Y1WA 2YOHA 4RNCA 1X0XA 1ZEJA 3GN2A 4AP9A 2TMKA 3Q1KA 3JWGA 4DIBA 3H2KA 4N18A 4RHYA 2BMAA 3AIMA 3GJZA 4A0FA 3VQTA 3PFBA 2P6UA 1HOTA 3K5IA 1J0BA 4OHXA 1E4EA 3PNYA 1NKSA 2I3GA 1YR9A 2ZYSA 2FFHA 2GEKA 3CHYA 3E05A 3L6BA 3ZPXA 1YFZA 2PAFA 2WJYA 4C6RA 2OAEA 3CIFA 5EXEA 5CEFA 3TXXA 2HFKA 2CV0A 3QV1A 1CCWA 2XOKD 4HXEB 1T4GA 2UUPA 3SZOA 4YRIA 4ZK2A 5JI2E 4CNQA 4ZOAA 2FRVA 4INZA 5EUMA 2QSUA 3PUIA 2WTMA 5AUNB 5K4GA 4RM2A 3T6KA 3ESXA 1DP4A 1DX9A 1KMCA 2IZ0A 4XGQA 3RSGA 1OWMA 3DQQA 2J3JA 2IX9A 1EP9A 2BBOA 4YUWA 4HDNA 3U19A 2PCLA 3PE4A 3DOOA 3FX2A 3QFRA 4WH0A 3U37A 4F96A 1FRVA 1JF8A 3AIIA 2AUTA 3BMNB 4O4JF 1KO1A 2NACA 2ANCA 4QOHA 2GCPA 4MV4A 4TTJA 3CC8A 2YJ3A 2DETA 3O31A 3CO5A 2BCGY 3PD0A 1L7PA 2GBIA 1F1JA 4M1KA 4KR2A 5E9JA 1NSYA 2IIBA 4ARAA 3OO0A 1RPJA 4CF4A 1TFRA 1F1BA 2HQSA 2ZBDA 4NZZA 5DH9A 1BWSA 3M4ZA 3JZDA 1KMMA 2YYZA 2NM0A 4FGLA 3T7CA 1YC2A 2QY6A 1H22A 2O2CA 4AMVA 1U04A 3K0KA 3C48A 4ZAXA 4Z3OA 1E2QA 2R00C 3PX3A 3ZDZB 2HO4A 2IUFA 4RETA 5D86A 2J7PA 1JG6A 2P4UA 1OXTA 2QTMA 4KVAA 4PN3A 4IJMA 4YONB 5JS7A 2H2WA 2VP6A 3NHRA 4BVAA 4A73A 1SUIA 1JJIA 2CJWA 4HVAA 2MMCA 1LV8A 2DVMA 4MMZB 2JLQA 3IBTA 3R75A 1F5SA 4DSZA 4B81A 3V2UA 4RTNA 4IIJF 2WQZA 4J7CA 1XRRA 1X42A 2CLSA 4EJSC 5LDGA 1A69A 3G79A 3KKZA 1LTQA 3GARA 4HLDA 2WF9A 4GU5A 5EYPA 4KW7A 4DB2A 3C0KA 1V1RB 4KACA 4MIOA 1XZPA 2QQ5A 4EFNA 5LDHA 5KX5F 2ZIEA 4JJIA 4E1VA 1YMQA 1H6BA 3K9CA 1W4RA 5CLLA 3I2FA 1GADO 2VHXA 1BRMA 3A2KA 1XLTC 3NR2A 4IDOA 1YHNA 4M2LA 2AKEA 3M2TA 1ANKA 1OYOA 3A9UA 3ENNA 4XX0A 4DQDA 4MI1A 2JFPA 5H0IA 4C01A 3UFXB 5BVGA 4RKRA 3TTTA 1XRQA 3AIOA 2GESA 4HWGA 1M7GA 2WR8A 4PGMA 3NPMA 5L53A 4QOSA 1GGJA 1IRIA 3FGPA 1BWPA 1UUFA 1CUIA 3TIGA 4UEJA 5KVSA 1B3RA 2QK4A 3GVCA 2XIJA 3CX6A 3HL0A 3RTDA 4BO1A 2ZTVA 3CEMA 3PIRA 4S04A 5EJ7A 3G0IA 3H8JA 5ALNA 1HSOA 3KWJA 4TXLA 4DMRA 1Y8CA 3A70A 4MLZA 1WXGA 1DTWA 4UQLA 2AQHA 5AT1A 5HVNA 2OTCA 1NBWB 3KDPA 1RP1A 1C30A 2PKQO 2QAGB 5B5SA 4KN9S 4UHCA 4IRMA 4BNHA 1WZUA 4NENB 3V9PA 1Q1ZA 3PJEA 2C3MA 4KQGA 4YGXB 1C7ZA 4J1TC 3WK6A 3WLTA 1MH9A 2YN2A 5LKRA 3IA2A 3MW8A 3VM6A 4HXFB 1Y5MA 2BONA 2WU8A 5H3CA 5T5QA 3DONA 3MIIA 2HSGA 2EF0A 4E4RA 1HL3A 4PSCA 2ZYWX 5KKAA 1BX1A 1NXPA 4RLSA 4FLEA 2J31A 3VTFA 3WK9A 4XKJA 1VCIA 5IANA 1V3VA 4MW5A 1FQKA 4OD0A 4HR7A 4PRLA 5ICFA 1GU0A 4YQZA 3R9KA 5CFRA 4YI3A 4C7BA 5DYNA 3OTGA 3B89A 1ES9A 4M49A 1TDJA 4L8WB 4C7MA 3FHCB 4HB3A 3N6XA 1RWNA 1IDN1 4ENVA 1K88A 4JL5A 2IWRA 3I3OA 3DMTC 2XODA 1Z6PA 3PI7A 4DREA 3E3LA 3EA5A 3B6ZA 2FOLA 1VPDA 5ALDA 4BO3A 2WVAA 3WB0A 1WCIB 3FPAA 1EXVA 4XD2A 1XQ1A 3MJDA 3U4HA 2AOTB 4Q1DA 3DBOB 3ZH9B 3NNSA 2Z3VA 5DHFA 3ZVRA 1JP7A 1JEYA 5FPSA 1JVBA 1KARA 3DOUA 5HCIA 2BMFA 2R87A 2WHXA 2EW1A 4OB8A 3K0CC 4OMDA 5T4BA 1L7BA 4GPIB 3CJRA 3OPMA 4HPJB 4AZVA 3DNMA 5IAEA 3ULKA 3KT6A 2ZPUA 3QG1A 4LIPD 4RVDA 5BW6B 3T54A 1L7XA 1W8IA 2VF4X 4HX5A 3TZEA 5B1EA 2PUGA 1JW9B 4EGFA 1X1EA 4EJFA 5BNZA 4JEIA 3TRIA 4MR9B 2IH5A 1H94A 1IJKA 1YSCA 2J9GA 3MUFA 3PHIA 4G0XA 4ZQFA 4HNQA 1OPRA 2NO5A 1GSOA 1NP3A 1VTKA 3ANTA 1XEWX 2VNHA 3ICWA 4FHDA 4O4LF 3ROKA 4P4SA 2K2WA 2D5BA 1T43A 4WLEA 3N2NA 3PFFA 5FO0A 4JFRA 1L5HA 2OAQ1 4BFSA 3VNUA 2WHPA 1EFKA 3NYIA 2P1RA 4INOA 4TWAA 1J6UA 4MR8B 1GQ2A 3F3KA 5IYZA 3BXOA 4K9QA 4KTVE 2XGOA 1AQJA 1G8SA 1H4TA 4I50B 2ENWA 1CZLA 3VC2A 3IIKA 1KXZA 1U9IA 3OJCA 3F5DA 2P9BA 4FN4A 3JAMA 4PZPA 1Q3HA 3KQMA 1SUFA 1YUNA 4E09A 1G63A 1OHHD 3QFCA 4BWFB 2HC9A 5JPDA 1T5HX 3NEAA 4IM7A 4YEDA 4DN6A 3JQPA 3AJEA 2ZBRA 3O73A 4MS1A 3GNLA 3QE0A 3H9QA 3E48A 3E9RA 3CF0A 3PQ6A 1T3GA 1KXJA 1OTHA 1UDAA 3DE1X 1WXDA 1F0YA 3PP8A 4O4LA 1A9ZA 5TC4A 4DABA 4B2PA 1DBVO 1QNFA 3JALA 1MW9X 1QVZA 4OMFG 5DXAA 2BTOA 5H59A 3UK0A 3BULA 1FVOA 1VKOA 4TXNA 5I48A 3PB3A 4N3AA 1N5OX 4XIIA 1KKLA 4YUYA 1OV4A 1T35A 3BXZA 2AYYA 3SM9A 5TR9A 1Q19A 2BHRA 3C2QA 4MGZR 1VC2A 4UEQA 1ZC3A 4CMEC 5JISA 2H16A 3L0IB 1Q1GA 4RJKA 1ZM9A 5TGTA 3OCWA 3GAFA 5AJVB 2X41A 3S1AA 4YXWD 5E4JA 1ZS9A 4ZRMA 3O90A 4QO7A 4K2AA 1QIJA 3RRYA 4I6GA 4OFZA 3N2GB 4G25A 3AUKA 2PD3A 3THWB 3NT4A 1E8DA 1OX4B 1TJ3A 1XD2B 1YRHA 4M4SA 2XT9A 3MOGA 3T7EA 3WC4A 2NX2A 2AX3A 2VJMA 3LNTA 1QIHA 1F3OA 1UBLS 4M0PA 3UMMA 2W98A 3LRXA 1KI7A 2XUJA 3OPVA 4GZ6A 3MT8A 4JT8A 3R77A 3VOAA 3VOBA 4ZRDA 1GVHA 4JJ7A 1V2HE 3EQ2A 4HO1X 2GJKA 4TTTS 1QLHA 2Q4BA 1J5XA 2FHPA 2XYPA 4JAVC 3RUEA 4BKRA 4EKIA 2W2VA 4MQBA 3ITDA 3VU0A 2ASEA 1K3FA 1MKYA 3OZWA 4Q93A 5TY0A 3V3KA 2Y4NA 3U4QA 2WFLA 3FHTA 2XE4A 3Q2IA 1FSZA 1NLZA 1PVDA 2V45A 4OHMA 3GBSA 2DSNA 4GR5A 2C5FA 3ELWA 2WG1A 2EQ5A 3GLSA 1NXWA 1IN1A 2AGVA 4MV6A 3KSZO 3K4PA 4RTQA 2XCSB 3FCCA 1M34E 5BOSA 5AVTA 1SCUA 1L7AA 1Z39A 2JLWA 3SMVA 3DV9A 1GUAA 1V25A 3UY4A 1XBTA 3IIMA 3E8MA 1B8PA 5L7YA 1VHWA 3OEHA 1EP1B 3TM5A 1J07A 1IH8A 2DJIA 1JU4A 1ZK4A 2WMYA 4QOIA 1EX7A 3UGQA 1ZA2A 3IP9A 4DDHA 2P27A 3AVWA 1UFVA 1K89A 5AOBA 1O5OA 2PZEA 4FEEA 2TSYB 4IMRA 3MB5A 1JHUA 3W5UA 3ZQ6A 1NVKA 2NUPA 3NVKI 1BC5A 3WAGA 1EHIA 4YRTA 3QLTA 4RK0A 2PZMA 4REQA 4YBRA 2HU7A 5DIZA 1W0JD 3B3FA 1Q0QA 2HCRA 3DMNA 4JSRA 2LBPA 4XUGB 4RMNA 5HMMA 2GS9A 2DB3A 3P9RA 2NPIA 1XVTA 1IZ7A 1HT2E 1KAGA 2BFPA 3DTVB 1NIPA 5B4UA 2D5AA 3SAJA 4MVJE 5F9HA 1LGYA 2VDJA 2ZIGA 5D1HA 2I7CA 1V3UA 4EZEA 1T36A 1K2WA 3M5WA 4L3VA 5HKOA 3NVDA 4E5DA 1W47A 2YBDA 1ISPA 1RRMA 3HNPA 3JXEA 4KQCA 1SD2A 4GUDA 4WOJA 2FCRA 4JQYA 3QLVA 1C1DB 1TMGE 2C54A 1BDIA 3LHFA 5ECWA 4EECA 5B6PA 2V6FA 2IT1A 4J2HA 1F17A 4R7TA 4U5QA 3FPSA 2BV3A 3L05A 1V5IA 1XYVA 3ORFA 4MYHA 4OF4A 4RA9B 1Y80A 4E1AA 4EW6A 3HCWA 3I5XA 3DE4X 1KEEA 3BGSA 3BSYA 5LLDA 3HO1A 3FPGA 3D59A 4ZMSA 1OLSA 3PQEA 4MTLA 4P35A 5TMBA 2CBZA 4OGGA 1KMQA 1IB6A 3ABQB 5JNRA 4MLCA 2UUAB 3DOIA 3E5RA 1JQJC 2QR3A 3QFHA 2O2XA 3PC6A 3USCS 3V4OA 3WP1B 2P0EA 4O25A 4AN4A 1XZKA 3FWHA 4TMKA 4UUQA 1WABA 1XD9A 2BTQA 3GUHA 4LVNA 2EP8A 3JQ7B 5LPNA 3CZ5A 2YYYA 3KAJA 2X6QA 2I2WA 4GOXA 4HQ0A 3U3MA 1VL0A 5CT4A 1PO7A 5F76A 2PFGA 1A8PA 4D6YA 1DFHA 3PQ8A 4B3HA 4UDOA 2GHIA 3E2PA 4N54A 2F62A 3JAKB 3QEOA 1VPWA 3IJEB 4JVOA 4BMNA 1PGPA 1F2DA 2I0FA 2Q1YA 3EEYA 1YIAA 4UARA 5EPOA 4ITVA 3OX3A 3O4VA 2RI1A 4ZQBA 3BF8A 3MSXA 4H7JA 4HNAA 4IOKA 5AVWA 1GNSA 3DO5A 1XEXA 3VJMA 5HK8A 3LX8A 5EP4A 3S1LA 1ZVQA 3A4IA 1II9A 3B6MA 3WK4A 3FKSA 4G41A 3QXSA 3UT0A 3ADDA 1K8QA 4LHWA 3V8BA 2VBGA 2QN6A 4FOLA 3D4OA 4U7JA 3SX0A 2QSYA 4A8TA 4ZHQA 1FJXA 2W93A 5ALGA 1OC2A 1FSSA 1KI3A 1LRLA 2F3TA 5FLXA 3L92A 1WVMA 2ENUA 4OEHA 1AF7A 1HM5A 1ZGZA 1BDJA 2JEYA 2ZLBA 3JW8A 4MRRA 4BNUA 5GINE 2YC4C 3KFLA 3OSZA 5DXFA 5FUBA 3W3ZB 1NC3A 3VR6A 1M10A 2XNDD 3QXCA 2OR3A 2Q8PA 2UYGA 2EDCA 3M9LA 4Y9DA 3K8YA 3ZUGA 5C53B 5ICCA 2HRBA 1OKKA 2PVSA 1TUEA 5IJWA 2IP1A 1HEUA 4QUGA 1KAEA 4DBZA 2VWQA 4JEHA 5BRJA 3BCUA 5JAQA 3ENQA 1T8TA 4P38A 4G2TA 4DDVA 2QTZA 4Z54A 5A02A 3FXAA 4RCYA 4TKMA 4YS6A 3TIXB 1AU9A 2HLPA 1M0WA 2ZYVX 1A27A 4OMUA 4YDQA 2AT1A 1Y5LA 3OIFA 4LOJA 1GCAA 1H69A 1ICEA 3MILA 4GHWA 5D84A 4WESA 5CW1A 3AUJB 3SCZA 1QO7A 1GYPA 4BIIA 3LOQA 4WKPA 2GJSA 1NVBA 1EDDA 1H2AS 2Z6AA 1YR8A 4E5KA 5LC1A 2NXEA 1E3WA 3HMKA 1DWOA 2B4AA 3V5NA 4B33A 2QAJA 3ROZA 2YV5A 3U3RA 1GAWA 1B4DA 4E7OA 3RC8A 1PZFA 2XHZA 4JB8A 3VVCA 2O1SA 4AKSA 5ARBA 4EX7A 3KVYA 3GH1A 3CCCA 4JLOA 5AVXA 1IUNA 4HYYA 1ESDA 5IPFA 4UMFA 4R83A 1MOZA 5DGCA 4QLAA 3EGWA 5IJAA 4YH1A 5I7UA 1I7DA 1U0JA 4HKTA 4FX5A 2H2HA 1EBFA 5I9BA 4MV5A 4GYJA 1H66A 1HLPA 3GW8A 2XUDA 4HGNA 1GM5A 1M2KA 1SOWA 4JLNA 1SXJD 5A6SA 3AVXA 1AS0A 1DQSA 2YNMD 3HV0A 1GN9A 1OCEA 3OFSA 4OQNA 1FIUA 4RH0A 1VYVA 2CFTA 5GGXA 3DR5A 3I2JA 3RSQA 2OFWA 4PX5A 5K5EA 1KI6B 2GZ1A 4YAWA 5AXBA 2VDVE 2WUDA 2Z95A 4DPLA 3PCTA 2Q5IA 1A8UA 1HOXA 1XQYA 1K6JA 4TT8A 4EG6A 1DE0A 2YDXA 3WSVA 1JFTA 1CZHA 2ZZMA 3UYLA 1ITZA 2P2NA 1HTTA 3MGKA 2A9QA 4E70A 4UBKA 4H7HA 2QENA 2WQ6A 3F73A 5K45A 4URUR 2XMCA 1J7JA 1J9ZA 3U1VA 4QDTA 4D8TA 2GK4A 4YI5A 4W9RA 1GEEA 1S3FA 1U0HC 4GOND 4B8WA 1MRSA 2D5LA 1GP2A 3GEDA 4A15A 1QJ4A 5IDQA 4RVUA 4NZPA 1YBAA 4UBMA 4LF6B 5DE3A 2Z5GA 5B4TA 1SEPA 2P9HA 1EFUA 2VJPA 4C7OB 3PPVA 2E4WA 3UXYA 3O7WA 1ABEA 1U2QA 1SC1A 4MUGA 1ZDMA 4Z1MA 5DTMA 4JLAA 1SCIA 3GJRA 1SU7A 2IEGA 2Y4OA 3HYSA 3X1ZA 4KEAA 4WRRA 2E6KA 1NXOA 5FTMA 3TZCA 2VJQA 2HU2A 2OBNA 1JT2A 4DQVA 2ZM6B 4OAQA 2ZSFA 4M1EA 2H4WA 4WLFA 4FUTA 4JV5B 3BAZA 4OMCA 3PRHA 1TA9A 2ZK7A 1KKUA 3R9XB 2IJGX 1STOA 1MJGA 4KMRA 4O1MA 5IARA 2NU9B 1MZVA 4QPPA 1I4TD 4QRHA 2ZTMA 3V55A 3H5RA 4E3ZA 4NAHA 2NGRA 3DE0X 1AF4A 4YR7A 2LVBA 4YBZA 5D2CA 2VDOB 3QU7A 3BHNA 1POXA 4R7ZA 2J3IA 2C88A 3L7MA 4JA2A 2Q6OA 1W36D 1I30A 2HEGA 3MBIA 1N9GA 4NECA 5LSAA 1CUBA 1XVLA 1Y7IA 2GKSA 3C5CA 2GWHA 3LUCA 3NQ41 1L1QA 2I4IA 3FDZB 1IZ8A 3QEMA 1YVEI 5F64A 3WDLA 4FFNA 1E2EA 3ZYZA 3MS2A 2W6ZA 3I2HA 4IJVA 5GOZA 5KNCD 1Z5VA 2PT9A 1VIDA 3FSGD 3ZDEA 4LY6A 4HMPA 4C4PA 3FJYA 4NX2A 4CTJA 1BXGA 1NR5A 1ZNXA 1H1LA 1IZ9A 4ZAWA 4DCUA 1U7UA 3GX1A 5CNIA 3A9VA 1G20B 4IAOA 4YX9A 3EASA 2RKWA 2I6GA 2J4DA 4W8HA 3T7KA 4I4TF 4C29A 3HLYA 3VUEA 3DXZA 3WL3A 4ZVLA 1VSTA 4UUBA 1QWOA 1RFGE 2PRYA 2NUTB 2XAAA 1U02A 3HZZA 4OG2A 2HCTA 3IJPA 3SX2A 2GZSA 1P4JA 3VO9A 1UJNA 5TS3A 4I1RA 2PTHA 4YJFB 5BYBA 1ZIPA 1AD2A 1CJVC 2Z2ZA 1MQAA 1Y7PA 3DVSX 4XA8A 4EVQA 2HB6A 5DWQA 1WNTA 3P96A 4N5NA 5GP1A 1Z45A 2IYSA 4P5PA 4PIMA 5G0UA 1JYSA 3DAOA 5KIAA 3WYEA 2CHUA 4RVFA 3WGOA 2MINA 1ZCFA 2VCYA 3FGOA 1ZR4A 2NSYA 1KMIY 1ND5A 1HEYA 2FWRA 1ZD3A 2MSLA 3BERA 1DIRA 1GFZA 4EKNB 4J1NA 2IS2A 4BKPA 3KQSA 4KAJA 1WF6A 1QZTA 2WILA 1U1GA 4E88A 3CUTA 3U16A 1E6KA 1TOAA 5IFLA 1FXSA 2OLJA 1C14A 1R4ZA 1DQPA 3B6IA 4TQGA 4ZMBA 4EKGA 1EK2A 3EEQA 2JFZA 1JSXA 5L7TA 4OXYA 1OGJA 2HK7A 1GPLA 2GPJA 2OYRA 1AMNA 1HNXB 3BXXA 4JOQA 2I6SA 2H8KA 2N1MA 2IF2A 3NRCA 5F12A 5EJMA 3KLNA 4YREA 4WZAB 3HI6A 1M6HA 3TEJA 3TQCA 4FFLA 1CSEE 4HTFA 4FLMA 1VPTA 2EYUA 4NV1A 2VNJA 1CFJA 1XV5A 2NTNA 3NAGA 5CVCA 3EOAI 3CFYA 1N3BA 4YMWA 1T1GA 4ZVOA 3FG9A 5ECDA 3MQ4A 1MA0A 1PQ4A 3WFZA 5HEKA 2F7SA 1HRDA 1SA0A 4ND7A 1E2DA 1ARZA 5K3DA 3KG2A 2CBXA 4LJ5A 2UYHA 4IF4A 3KBOA 3CB2A 3OTHA 2BHLA 4P3KA 5KSPA 3HFSA 2GBPA 4UM5A 4DCVA 2A5LA 1A82A 1PFWA 1PSDA 4XRGA 1CUJA 1P0IA 2HDOA 2W2MA 2XCLA 3P52A 2PBRA 3A1CA 4LE0A 4NYMR 5E0OA 1Q1BA 1D0SA 4ZVTA 4BLPA 4OLFA 3S81A 1NAIA 2IHKA 2ZI6A 1W34A 3EMDA 2D7JA 1YDFA 2D0OB 1H4QA 4YPOA 2Q5QA 5K0LA 5KNDD 2F1KA 1S5PA 2OXFA 5ALOA 1NVEA 3TOCA 1BEEA 1YL6A 1Q6ZA 1EGAA 1Q7RA 3ESQA 1M6VA 1X7GA 4K8RB 5FPHA 4JLSA 1M8FA 3E58A 1ID8A 1ORTA 1P5ZB 1AIPA 1AQIA 2C07A 3OIWA 2JGEA 2YWGA 4PWZA 1P7ZA 5DNDA 3I34X 1H5QA 2AQIA 4BLTA 4YMSA 4ZI7A 3Q9UA 4KR3A 3O8NA 1C9DB 1KI8A 3NC4A 1XDUA 5C4GB 3SZRA 2ZB2A 4KWTA 1RLMA 4ILKA 4TTPA 1D0VA 4N5LA 1E61A 1FRZA 1YE5A 1UC5B 3DE7X 3OZIA 3BD9A 2JHCA 4ZAYA 1W0KA 2AW5A 3RJMA 2AI3A 4JJGA 4HD8A 2ZPTX 4W9NC 1MJNA 1JH9A 4NBNA 4G1CA 3LCVB 4QVIA 5BSMA 2VP5A 1RMQA 2EQBA 4L16A 1X94A 5TQVA 1JPNA 3D7RA 5AVKA 5JNLA 1TC1A 3IVAA 2ZE6A 1ONBA 2YMMA 3IIEA 2NZXA 2NSDA 4KO4S 2JFXA 3FPLA 2IXEA 4ECEA 3C3PA 2WTUA 3HMQA 1DVRA 2O48X 3AP2A 3TECE 1DDIA 3C3XA 1MV5A 4BE7B 3DE5X 2OO5A 5B1DA 4DM3A 5AW4A 4AJ1A 3R40A 2A35A 3QMMA 1R5OA 4RORA 3COPA 3W3AD 3EVCA 2B98A 1R4MA 5KCMA 3TK1A 1NG1A 3GA0A 1MG0A 2R7KA 4DBVO 3TTYA 2B7BA 1IULA 4AT1A 2IHNA 1V16A 5CCEA 3WJ7A 2CUTA 2EEPA 4KUEA 4MI9A 3W3AH 4JYZA 1V4BA 2C98A 1E2UA 4LS3A 2RARA 3EXG1 4Y9SA 4K9RA 2JCGA 2QLNA 2GJ9A 3I39X 1XCLA 3PPIA 2O59A 3M1IA 3TR0A 3ZS8A 4NXNB 4FMCF 2IYVA 1KSHA 2FPUA 4XIYA 5AESA 3QWIA 3WYAA 2R0QC 1CHNA 3KOWA 1MVNA 4AC9A 2RK3A 2YDYA 4GNRA 5EWLA 3WGTA 3CRNA 1DIOB 2BCJQ 2BFBB 1QANA 2D74A 2GWRA 3AZQA 1N5KA 2OBXA 3ORRA 4PSAA 4YP9A 1RLUA 3V1LA 1FUUA 4Y2HA 4BASA 4ZV9A 1S7GA 4FC7A 1L4KA 4PLTA 2HA2A 2QZSA 4YWHA 5CBPA 2NPOA 1J1IA 3LY7A 2UAGA 3PXCX 3UJ6A 3U7HB 3KU4A 1DELA 4Y2RA 3TTVA 1Q14A 5L3VA 5GIOE 3ZD6A 3W5IA 2QL6A 5K6TA 3U48A 3C16C 1WDTA 1V43A 1RRCA 4HDNB 1K0UA 5BNWA 1CLUA 4FK8A 1LW7A 1GG8A 1M1YE 5JG7A 4X62B 2R68A 5E4TA 4U7FA 3MFQA 3HSYA 3FZGA 4HRYA 2JHPA 3R5JA 4BGEA 5IHXA 1K6MA 5DYTA 3WSTA 3JWEA 1G7CA 3PGVA 5ARCA 5DLDA 4RXTA 1MDFA 1T6NA 2GKOA 5BSVA 4X95A 3W8EA 4G2NA 3KX2A 5AI0A 1Q1AA 1TTHA 1U1DA 2A9JA 1NBOA 4RPLA 5BO5A 3EXAA 1IM2A 1D5WA 3T1HB 3QBVA 1CULC 1Q5PA 1NVWQ 4AP5A 5KNBA 4ARZB 1KYWA 2CUNA 1PW5A 5F51A 5FP0A 2YINC 5HFAA 4TM8A 4ABTA 1TB4A 1NRIA 1VQ1A 4JCCA 3T35A 1ISSA 4REMA 2RH4A 4AY3A 4N4AA 3WWOA 3DUFB 1LBQA 2JAHA 2DWUA 2QG9A 4NBTA 5GVRA 4OUKX 1PJZA 3L43A 4DT1A 1KDVA 1R2QA 4DANA 2F4NA 4G5OA 3CG0A 1B73A 4O2BF 3UCEA 4D6XA 4ZDIA 5HCNA 3CUSA 4UUAA 4A6EA 1R0LA 1Y5IA 2IOQA 4K3VA 2CEAA 1M75A 2XF8A 4YRGA 3K4QA 4H2DA 4OQQA 2D5IA 3DT9A 1Y6GA 1N0HA 3ROEA 1WBBA 5KEIA 5CCDA 1O77A 3BIJA 3TD9A 3T5CA 3EA0A 1WQ1R 2CKDA 5JPIA 5B55A 4F1KA 4PWYA 2XQIA 5ALMA 4FKZA 3RVNA 1PGJA 1Y3AA 1CRLA 1J9GA 1OF1A 2OWDA 4YXFA 2CVOA 2YV3A 3JSXA 4RK1A 2J41A 4RK4A 2IS4A 5E7JA 4P8RA 1UKAA 2A1TR 3TZHA 2G4CA 1MB4A 4Q01A 1J06A 2A94A 2VDQB 4GEKA 2ZUBA 1WW8A 5TPWB 1N8NA 3QPVA 3OIYA 4GPAA 1R74A 2HDHA 5G1PA 1LY1A 4RD1A 1EUDA 4OQYA 3U40A 2HHLA 2PZLA 4C5BA 3VR4H 2BMVA 1N5MA 1Q6YA 4Q37A 5HFJA 3ZWXA 4U3JA 5T8KC 4F21A 5DISB 5B1HA 3VYWA 3GCWA 4OGFA 4Q4JB 1W46A 2QI9C 3IR7A 4ESHA 2CJPA 4NCXA 3R9IA 3FOEC 1I2BA 1I2CA 4PYRA 2ZSIA 1GQSA 3NC0C 1C30B 4JC5A 1CRZA 2CXXA 1PSZA 1IZYA 3ETLA 5BW8A 2YVAA 1KGDA 1U7XA 1WA5A 3EUEA 2C8JA 1QXSA 3K05A 1VXRA 4GSLA 4YUZA 3II6X 4DAOA 1HH4A 2AZDA 3H6HA 4LXYA 5EIOA 3CVWA 4YLGA 5C7IO 1W581 4KPEC 5B58T 4JVNA 3SSOA 4YMLA 2ACEA 2XHEA 3VR2D 4A16A 2J0QA 4YA6A 3PC4A 3WBKA 2RGWA 3C5EA 1WXIA 1AKNA 1QYWA 1DQRA 2CDCA 1NVGA 3HG7A 4O2BB 1GL6A 3AKDA 4E5MA 5IKEA 1EFDN 3ROFA 3TQQA 2PWBA 2IXFA 2JGJA 4BVKA 3IO5A 2C2OA 1SZCA 4OY3A 1Z38A 2Q3BA 2ZAIA 3DEZA 4MZXA 4GE3A 2HA5A 3NRBA 1J00A 1GQOA 2BFEB 2V55B 3NUZA 2I6QA 4MKHA 3RS2A 2WJAA 3OIUA 3RSZA 3UW3A 4IIUA 1PK7A 4WXRA 1R12A 2PT6A 3T5MA 4DLRA 4FGKA 3FWZA 3NHYA 2H2FA 1U5CA 4YAKA 1HPLA 1T4CB 1KFEB 1ZEMA 4M9SA 4DSNA 4ZCSA 1GZSA 3AI1A 4GT1A 4JITA 3GUUA 3M3PA 5E6RB 1VKNA 3B9RA 1SUDA 1Z3CA 2OP1A 4KLAA 3RF6A 5CJ2A 3D6JA 4R9NA 5BQXA 4UOEA 4PHCA 1JH8A 4PYOA 3CN7A 4KPUB 1K63A 2EOAA 3NM4A 3ORSA 4G1BA 4LJAA 1G5PA 1FFBA 2ZI5A 3GP5A 3PIIA 1ZD1A 2FPSA 1FMFA 4I6JA 1U2EA 1ICIA 2J3QA 3IAM1 5T3YA 2IU0A 3AYXB 3TMYA 2KLBA 1L7DA 1RQLA 2Y05A 4IO1A 5GZ1A 3OHSX 1QWSA 2X9LA 2JFFA 4U00A 2PH1A 3BIWA 4QQNA 2ERCA 3SJBA 1ZH8A 2I6TA 3ZU5A 1UOEA 2C7PA 2CE7A 3VHQA 1BMFD 3NWPA 2C1EA 3DHVA 1CX9B 1Z6XA 1NJ6A 2HBYA 3IOCA 1A88A 2AFIB 3TLMA 1X74A 1RAAA 1OAOC 3OWHA 1GAXA 2ROQA 4GNKA 2Z4RA 3BHMA 3GN1A 3D3EA 3H2JA 1FMCA 3KTOA 4BYGA 4US0R 4FSXA 1E0KA 3RBVA 4I6EA 2H29A 3D3JA 4R2XA 4ZFNA 4OXQA 3RFVA 4W9MC 5B3JA 4DC9A 4DJAA 4QTUB 2O3QA 2ISQA 4WKGA 4BDTA 1E3SA 2GD2A 4UW9A 3CR3C 4PBRA 2RJOA 3LQ1A 2JI9A 3R3JA 2EF1A 2HMYB 3DFUA 4NBKA 5T3UA 1JDZA 3N6RA 3QU4A 1MP0A 1T2VA 3R5TA 4KQ2A 4Q48A 5FPKA 5JD6A 4KREA 2VN8A 4CM5A 5IZ4A 1Z2CA 1RZRA 2AOXA 4P32A 2V54A 1S2LA 3DZKA 2Y0BA 4XVRA 1OFHA 4JVMA 1CK4A 1CVIA 1U8AA 2PKRA 2BDTA 2TYSB 1WR8A 4G0NA 2XBMA 5A9SA 5DEOA 5E9WA 4EQ6A 2QMHA 2ZT7A 4NCBA 3QX9A 2VF2A 3F7NA 3QUAA 1ZRMA 4GIBA 4HEA1 3T94A 4AY5A 1K4MA 2Q2WA 1S1MA 2D1TA 4ZI2A 3WIOA 1X9HA 1BH2A 2CMDA 1MAAA 4KR6A 4OXIA 1L7RA 3NNNA 4K28A 4ZP1A 4ESVA 1DNPA 1HGXA 4QPZA 2OO5C 3VR5H 3UQYS 3W7VA 4J4TA 4ER7A 3WNDA 3NASA 2WTEA 1QZUA 1TA0A 2C9MA 2QVBA 3HC7A 3C8DA 4GECA 4V0RA 1UK8A 2X0DA 3S1AB 5KX5A 1ZITA 3HKBA 1XAJA 4HS9A 1QGAA 1RWMA 2E7ZA 2GCOB 2A5DA 2IOFA 4BLRA 3HKEB 2OXCA 2HT6A 4W5TA 1SUAA 5IM4F 5TQ2B 2N0SA 4TWRA 1XD2A 1RABA 2WABA 2X8WA 3DBLA 2VJMB 3IKJA 4QJ5A 1DCMA 3JRWA 4CDGA 5FTWA 4B3JA 2ZYGA 1Q3TA 4ZOBA 4ND8B 3X0DA 1BSVA 5KYXB 4F2PA 5K0ZA 4HXYA 4CL0A 1RXVA 1H85A 4CZ2A 3OTOB 2ZJOA 3VC1A 4FTWA 4JELA 1O1YA 3MMSA 1P31A 3CISA 5KOYA 1G64A 1VFPA 4CMEA 2C2GA 1FFAA 1BDMA 1O94C 4S0ZA 2OHVA 2IP4A 1Z0IA 4W7SA 1H2FA 1GZ4A 2VQ3A 1RMTA 3PPXA 1WU7A 4DKJA 1XXHE 4PZUA 5CTJA 2O9JA 4IIXA 3F4KA 3IMEA 2Q5OA 1SZJG 2IPNA 3FFWA 2X0JA 1ODTC 4CDMA 2AMFA 3JQFC 5DM70 1FDTA 3V7WA 3VX4A 3RRFA 2IDZA 1RJWA 1AKVA 2J0VA 4ER5A 1KDPA 1ZCBA 2QYTA 1NN1A 3OZBA 4GR4A 4PPYA 3BXEA 5A05A 3RT7A 9MHTA 2YUIA 2GCIA 1DBRA 2JGAA 4HX9A 4BE9A 4V0QA 3GHHA 1XZDA 1QB7A 1T2NA 1E4VA 4KAXA 5E1MA 3WXBA 4E2WA 4D8VA 3DOCA 1F48A 2YNMA 1W30A 2DBYA 4B6PA 2FZKA 1E2NA 2QR2A 2BL4A 3HVKA 1JEDA 4NL4H 4EFDA 3QU9A 1D4OA 1GITA 1EBUA 4S12A 5EOVA 5BN3B 5KMGB 2PYIA 5GJCA 2VSFA 3CTMA 5L3QB 3A9RA 3A9SA 2AR0A 5J4KA 2H85A 2JCBA 3GLGE 1G7RA 4RF2A 2NQ8A 3GCXA 1GPWB 3SF0A 4X20B 5E3JA 3G59A 1EM6A 2WJWA 4PYKA 2B1JA 4JB0A 1ZR2A 1I7QB 5JEEA 1MC4A 3Q9LA 5A6VA 4FI3C 1HDYA 1Y9EA 2OO7A 1IBSA 1X1AA 1X39A 1E1NA 3WG9A 3K0FB 1G9XA 1GDTA 3GGDA 5G0VA 2BKLA 5DOZA 3EWAA 1EAYA 1G4HA 3FNIA 3QWFA 3BMXA 1MABA 2OXTA 4ZARA 5E2IA 1D6SA 1DOHA 1FLNA 3EQ8A 1Z73A 5ALQA 3VR3A 1JGTA 1WWKA 2ZYIA 2ZZKA 3GK3A 3WKCA 5BPHA 5HQTA 3DDHA 1CY1A 3O84A 2WTNA 2NXWA 3DBVO 4MV8A 3DZBA 4OK6A 1QQ5A 3H18A 5FR1A 4KX3A 3X1DA 4LECA 3ECAA 2H7XA 2VZEA 3OZSA 5CXXA 1M73E 2EGHA 4F46A 3A1EA 1AXEA 3KLBA 2WMDA 3CT6A 1CQPA 2JHGA 2Q6VA 4HAWA 2EKDA 1B2LA 4FFVA 4Q1BA 4TKUB 2JJ2A 1U3TA 5FKJA 1QV9A 2AUMA 2XWBF 1P9LA 4RA9A 4UKDA 4UD2A 1VGVA 1M2OB 1UT8A 1EU1A 1KEEB 1MRNA 2BZSA 4PXYA 1K75A 3VZPA 4WLOA 4EIWA 1Z68A 4ZDJA 1YU6A 2YJTD 4AMZA 2VZ0A 4BFCA 2DWQA 4DJJA 3OUZA 3FTPA 5JHHB 3UJBA 1JSLA 2PHZA 4DJDC 5C4MA 5CIWA 1R0YA 3RT9A 3MYYA 3JQ8A 1KPGA 2REQA 5E6UB 4RGQA 2XMQA 4KLCA 3O1LA 4BTEA 2IGBA 1TJPB 4J91A 3DBRB 3A1SA 1FDIA 3HJBA 1S6YA 3R3YA 5JFOA 4F5WA 3T38A 2ZUVA 1CHDA 2W2NA 3F1LA 4CFYA 4HPXB 1NUAA 2IW1A 4MS3A 5CFZA 1F14A 3ISVA 2PKXA 3WLLA 1R8QA 1THTA 3CKKA 3OEYA 1RAGA 1FC0A 1Z35A 4PHTA 2I1LA 1Z8NA 3OJWA 2QRVB 1FK8A 5J2TF 1YHZA 3QVKA 2J7PD 5EJ8A 4PINA 3W2HA 5H8WA 1E92A 2XDAA 1DXHA 2Y1EA 3HPQA 5T6BA 4Q1CA 4QGGA 1NA5A 3TW8A 1B8UA 1CERA 3HN2A 3LZDA 1PZHA 3WNQA 1K7FB 1TM5E 4RK7A 3PEYA 1TL7C 2MDTA 2GVDC 3T7TA 3F3YA 3RIXA 1ENOA 3TEFA 3RVSA 2LKDA 4GMDA 1XRPA 4J6FA 2WNIA 1GYQA 3AUYA 4EUFA 3MS7A 1LSUA 2N1BA 3WV4A 3ADCA 3TH5A 2W43A 3B9QA 4V3CA 4R8RA 1FYWA 1MJ5A 4NNJA 1K4YA 2GAJA 4N0PA 3I1YA 3VISA 4DJ5X 1QLJA 3HJFA 2P40A 1MO4A 5CX1A 2H2IA 3RBXA 2V0GA 2IOFK 5AW2A 3CVJA 1OASA 2VHUA 5CA1F 3QKWA 2Q21A 3HP7A 3LOUA 3OURA 4YP7A 2EVWX 1WMEA 3A6GA 3V4LA 3VO1A 3BL5A 3ZJ4A 3JSAA 1IDOA 2H4FA 4MW7A 4URFA 3CPEA 3IV6A 3V33A 3FA2A 2FUNB 3PVZA 4WESB 3DEKA 1VCHA 2Y77A 4QG7A 3JZAA 1OX5A 1V11B 2PGNA 4L75A 5K4AA 3IP3A 3QX8A 4BO5A 4E5UA 1JIQA 2PGIA 3AXTA 4QOJA 1G2PA 1SK8A 2WWHA 2Z08A 2Q1TA 1V7PC 2HMTA 2JBAA 3GZTB 3GXBA 3HNOA 3M89A 5EQTA 1OC4A 3VR4D 3HBMA 5EXTA 2BGJA 1CR1A 1EM8B 4EITA 5HG0A 1FSGA 3CLHA 1PLLA 1BWRA 2FN8A 4MUYA 2V3CC 1EB8A 2JCVA 2M9MA 2MMGA 2XITA 1SWWA 3DCNA 4QOEA 2BM9A 5DBEX 5HCUA 4G0VA 5GTDA 2QVZX 3N07A 2QLLA 3ANXA 5A5GA 2VAXA 4CGZA 1GZUA 1SKUA 1F2UA 1VHQA 3OG9A 1QJCA 4LHXA 2NVUA 3WWPA 2NWQA 1UAYA 2R60A 4GPTA 3W5HA 3TNYA 1R50A 4HH4A 3K9QO 3A6ZA 3PJFA 3IKMB 3PXBA 4L2IB 1U4SA 5KS2A 4RDHA 4JLJA 3RAPR 1JDJA 1MO2A 3UA4A 1I2DA 1W0JA 4K26A 5DT9A 3HCCA 3MCZA 3EN0A 1PEYA 4G8DA 1J90A 3GUCA 1D07A 4JJ6A 4GPZA 4GZ3A 3AL0C 1EK0A 2VHVA 5C1IA 1CZOA 1Z7BA 1N36B 1A9TA 2X9NA 3I6YA 1FTSA 1R8SA 1M33A 1DAGA 4CQLA 3K6SB 5JCXA 3LT1A 3V7UA 3FNBA 1PV2A 1VSBA 1GXSB 3QVLA 5I45A 4XIJA 3EG5A 4I3HA 1DJLA 2DR0A 2LV8A 2R7LA 6PFKA 1PV4A 2Z56A 3C3KA 4JWTA 2JI8A 3Q4GA 2RBGA 1FYDA 4FGSA 4QIHA 2IS1A 3B51X 4BB5A 4U63A 3ZVNA 3I1JA 4AJHA 2XWPA 4LISA 1KY5A 1QRAA 2PA3A 1VE5A 1V8OA 2DPGA 3GDHA 3ESZA 4Q3DA 3K1AA 5L3SA 4KH0A 2BPOA 3R6GA 1ZD2P 2ADFA 5LLTA 1PVOA 2G5CA 3T3OA 1NF2A 5D3MB 3RYFB 2XTJA 3Q9SA 5CNMA 5B7PA 5H9WA 1ENYA 3H5NA 3K0SA 2PWAA 2B6HA 4LF9B 1R9MA 2NT4A 1E1MA 1FB5A 2YQ5A 4KXXA 1JHOA 1QRSA 2M6KA 5KYNA 3IAFA 1OXMA 4YROA 2J8ZA 2RKOA 1ZRNA 3EVNA 1XJWA 2FLVA 3DCIA 2I2XB 2NU9A 3SIPA 4IHAA 1IY8A 3M1AA 3SEZA 1K06A 1Z5ZA 1VMIA 5JSFA 2PGXA 4KX5A 4TWJA 4WKOA 3L2OB 4L5BA 3TLXA 4HAZA 1YS9A 5IC6A 4EG3A 3AH8A 4BJ3A 5AFSA 4GLBA 4Z0HO 5B3AA 2BP7A 4HN4B 2D59A 3L46A 3RTEA 3SSMA 1TO2E 5IN5A 1N9GB 5JSQA 1XMPA 3NP7A 2QJOA 1A95A 2RMKA 1WO8A 2XUHA 2WSBA 3H5AA 2IOYA 2BOVA 1NJ2A 3GRAA 1WUHS 4HDSA 4L4UA 3EEIA 2BGUA 4KQFA 1P1IA 5I9LA 1QRUA 4XQEA 4LXUA 3CZAA 4P34A 4RVNA 2ATIA 2FSVA 4U02A 1KYQA 3GRKA 3NUGA 1UBTS 3OT4A 2I62A 3KOZA 1HY3A 2VUSA 3RGWS 1YZHA 4O4IA 1J2TA 1EYZA 3MIZA 4Q4CA 4X92A 3LKBA 2E3JA 2YXEA 5AXAA 2BE9A 1LTKA 4PZ9A 3RKSA 2ZUEA 3EVFA 1H2BA 3QSGA 4KH1A 1BXRA 3DB1A 3N8DA 4MIEA 1VSQA 3LBHA 5IT4A 2ZSDA 3HXTA 5CDFE 2V5UA 1L7EA 3ESDA 4HWTA 2WIFA 3EWNA 3FVQA 2EERA 1ADCA 5EI5A 2GDZA 1OXBB 2XY4A 4O8ZA 4AUEA 4EG5A 2O7SA 4HDRB 2Y9PB 2GD6A 4EI7A 4R84A 1UKZA 4KC0A 3L0SA 1J0CA 3DKIA 4TYQA 2XT6A 3LO8A 4ZVSA 3ZV7A 3DTYA 2C78A 2ZRAA 3JATB 1M54A 1NUTA 1XTRA 3PC8C 4RM3A 3KEOA 1R66A 3SHWA 4V3BA 1PRYA 1EVIA 5LR6A 3C6KA 3UNXA 2MINB 4PCLA 4B3CA 3BCHA 1MR3F 1KP3A 1TIKA 2VJBA 4GOOD