3HCRA

Human ferrochelatase with deuteroporphyrin and ni bound
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
359
structure length
359
Chain Sequence
RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase, mitochondrial
publication title Product release rather than chelation determines metal specificity for ferrochelatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 128
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcrA02
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hcrA01
2XVXA 3GOQA 2HK6A 2HREA 2PO5A 2PNJA 3M4ZA 4KLCA 3HCNA 2C8JA 1TJNA 3HCRA 2QD1A 3W1WA 2QD5A 4MK4A 3AQIA 1C1HA 1HRKA 1AK1A 4KLAA 3HCPA 2H1WA 1LD3A 1C9EA 4CCSA 2XWQA 2DJ5A 2XWPA 2XVZA 2Q2OA 2Q2NA 2Q3JA 2JH3A 1L8XA 2XVYA 1QGOA 1DOZA 2XWSA 2QD4A 4KLRA 2H1VA 1N0IA 2PO7A 2QD3A 4KMMA 4F4DA 2AC4A 3LYHA 1LBQA 2AC2A 3HCOA 2HRCA 2QD2A
chains in the Genus database with same CATH superfamily
5COBA 4J76A 1CR1A 3DWEX 3EIUA 2VWQA 4F2HA 4FCVA 4CT5A 3T0IA 4CF7A 1I7SB 1MHTA 4NECA 4UTPA 2BFDA 3W5UA 5IZCC 1V8OA 1H2EA 2WAXA 1FS5A 3OOYA 4QGHA 2VK8A 1EM8A 221PA 1W1IA 2R8BA 4KRGA 1IM8A 1NVKA 4D02A 5ALVA 1RAGA 1RC1A 3TE7A 3LNCA 4M9ZA 3B1KA 4FYYA 3H2YA 1MG0A 1S2DA 1FMCA 1KQOA 2OR3A 1BMTA 5IH7A 1OKKA 4HI0E 3S81A 5CCDA 2NMVA 1AOXA 1PUJA 1RLJA 1QRUA 3P27A 1RVV1 3SZOA 121PA 1RWXA 4ZDJA 5HILA 4OXXA 4INPA 5U9CA 3R8CA 4PHHA 4GLOA 4X92A 3H2GA 5EP3A 2DWCA 2X7JA 4HNQA 1ICEA 4K46A 3BGSA 1YA4A 2XB9A 3X1ZA 5B2ZA 4F85A 5GVSA 3USCS 2BI7A 2HGZA 3BBLA 4BEWA 1H6AA 4KPFC 3GLHA 5HX7A 2JRCA 2AUTA 3GRUA 4R1UA 3ONDA 2ZYHA 1BNCA 3AQIA 4HLQB 2VZEA 2GVDC 2WJJA 3JQ7B 4IDQA 2J1LA 5FUVA 4PYLA 4RF2A 1TCAA 3REGA 3RU7A 5JEEA 2FGKA 5HQ3A 1X92A 3OC6A 2Q3LA 4FMCF 4O4IA 4BQQA 4R2MA 4X8MA 2E87A 2XEDA 3AY7A 1YJ8A 1HTBA 2GJSA 4GS5A 4JLWA 1OHHA 1PEKE 3WB1A 1YQ9A 5ALZA 4FQ7A 1IY2A 4XDGA 1FB5A 2W2LD 4B76A 5KVAA 5J1SB 3QVTA 2A14A 4TZ0A 5K8VA 1JDTA 1W8IA 1S89A 4MW2A 3WRYA 3NNNA 4KWIA 2ZREA 4TUYB 1I94B 2PUEA 5GV7A 3EXIB 2PQ6A 4Y2QA 2IU3A 2X0FA 2C3OA 4UNSA 3EQ7A 5NULA 2CKMA 2V1XA 3V4OA 1R6BX 5ESWA 4FOSA 1QHNA 3I5AA 1NLMA 1OYYA 4OTZA 3GP8A 2EFEB 1W8DA 1CJCA 1H23A 3N28A 2QYSA 1ZNXA 4OYLA 3MGAA 2C3YA 3ZWKA 1ISGA 1AJEA 5E7IA 1UKBA 4QSMA 4AJNA 3BN3A 1KU0A 4WZBB 1ORTA 1BMFD 1C3JA 3BBPA 1P81A 4LDQA 4DHWA 1R6UA 2PMWB 2OCPA 3LLMA 3AB8A 1ZBDA 4YTEA 1WUJS 2X9GA 2DPXA 2GB4A 2C4NA 4B17A 4H6VA 2OCAA 2R5FA 1ISFA 1EAYA 3FAZA 4MRSA 4E1AA 1XTTA 1Z5UA 3CR3C 1E79D 1K75A 1FFXB 1UBEA 1XROA 3RJTA 1M5TA 3LP5A 5D1NA 4RBNA 4C7VA 1P0IA 2ZRCA 3D2LA 4OJQA 4C0XA 2RHMA 9ABPA 2ZRLA 4LISA 4KDEA 3BA6A 2W6IA 4GG1A 4L4SA 4MZXA 5ALJA 2AZTA 2JBWA 2DR3A 4OMCA 1GXSA 1IVYA 3SSAA 3ZNOA 5CX1B 4ESVA 3B9PA 3HFRA 2GZMA 4U7HA 3UATA 4QXMA 1DRVA 5AVRA 3I12A 3HGQA 2GRUA 1VZ3A 2H7CA 3PNPA 2A0KA 2EKPA 2QPTA 4TLMB 4US0R 1L4UA 5GP1A 1P7WA 1N7IA 1YB6A 4MQEB 3DP9A 2ORYA 1SHJA 5TT1A 3A9SA 3FOCA 2YZ7A 1QIIA 4L78A 1GN8A 3BQNB 1ZLXA 4LDRA 2P3SA 1Y4ZA 4OLFA 4YMTA 1BYUA 1WCYA 1DI0A 5CHYA 5EP1A 4BNKA 1B0PA 3OZWA 5F2NA 4A0RA 1RTKA 3CT4A 2IBMA 1A4IA 4KL8S 3PDJA 4KQEA 2YWCA 4A0HA 4C7JA 3KVRA 1H2FA 4P98A 3LPNA 2CF5A 5FNZA 1QGYA 4I81A 3HB7A 3NIFB 1YASA 2Z2IA 4ZO7A 2QKYA 5ALOA 1YR7A 4JJ4A 4Y6GB 5IDVA 3QTBA 1P6QA 4M9CA 1IUKA 1N6OA 3PRKE 1NG9A 1NVVQ 1JHUA 3IUJA 4OQYA 1CDEA 3I2GA 2LP4Y 1D1SA 1GRCA 1TIKA 2GFHA 2QPLA 2WFLB 1RM0A 3K96A 4P4LA 2VJAA 4YJFA 3U48A 4D81A 1Y7HA 3LO5A 5AKJA 1E2GA 2CVPA 2QQFA 5KQPA 4YV0A 5JLJA 4M8LA 1G42A 1W2WB 2OQ2A 1DRUA 2ZBFA 1XD8A 3L6EA 4HDNA 1CS0A 1VHDA 2GAJA 3NHFA 1CZKA 4CN9A 1F2TB 4GKBA 2OPBA 2ILTA 1DRWA 3D4LA 3EIXA 1JHAA 3K0HA 1WZCA 3PL1A 5ITZA 2W83A 5JD4A 3W05A 4BWVA 1PRYA 4JNKA 2QM3A 1Z4LA 2VDOB 4J7XA 4N47A 3SC2B 5I45A 4M9UA 4G89A 1WIWA 4Z1MA 2Z2XA 3QX3A 3Q98A 2PLNA 1M2NA 1F5SA 2HZBA 1PQYA 1W6UA 2BHRA 2Q9AA 1CUFA 2OK7A 2V7VA 3G2LA 4B6OA 4EYSA 3AI2A 2XI4A 1HFJA 4OGWA 1U90A 2HK7A 4RETA 1P7VA 3DEFA 3LL7A 2J07A 3ZHBA 4PSDA 2JKVA 2O57A 1SCQA 2UZAA 1NWCA 3LPMA 4IWYA 4H1VA 3TCKA 4FIDA 1R6DA 5EIBC 2VNKA 1M0WA 5AJTA 3NRBA 2JH9A 2HC9A 5KU7A 1DUVG 1QRRA 3DVQX 3I9NA 4GI7A 1K4YA 3A25A 2QR5A 3LNTA 2RGXA 1RM3A 4F86A 3M33A 4Z3OA 4IF4A 3TKLA 1X0XA 3BH7A 1CUUA 4FKZA 2AG5A 4TN5A 1TVMA 3GYBA 1EK2A 1GQ2A 1VL6A 1MAVA 2VZ9A 1U9YA 5TPWB 3VMMA 1YFLA 2ZAOA 2B1GA 3ORSA 3GELA 1SQFA 1REQA 3MYRA 5KJCA 1I2CA 1ESZA 2Q5HA 1YZHA 3AHFA 1A27A 1Z45A 1NBAA 4U2DA 3O2SB 3ZQJA 2JG3A 3G2OA 2C0QA 2AFHA 2G88A 1D5CA 1JZSA 1MMFB 3Q7PA 4YXFA 4US2R 1XPUA 2VJPA 4Z1OA 3GPLA 1R0WA 2ASEA 3QLTA 5KPDA 3PIDA 4I4TA 1Y1SA 2PGXA 5JUWA 3FXAA 1YB1A 2OV8A 5IEBA 4AP6A 3KQTA 5BWLA 1HRKA 2B4YA 2FWPA 2Q3EA 3QEMB 4OXRA 5DX0A 4QOFA 3X1KA 2SHKA 4RJLA 2FRVA 4LVUA 4MV5A 3RBZA 2CJWA 2UYQA 5F5XA 3PGMA 1GU1A 3DEYX 1IM2A 1F8FA 1NPDA 5DM2A 1GADO 3TIXB 4CF3A 1ILEA 2PUCA 1DIAA 2OSBA 3LRXA 2Q07A 4LOHA 2YASA 1QDUA 3ROPA 5L6LB 1QGZA 2JPDA 3WWYA 4DRXB 4F60A 3DZBA 2MYPA 1X70A 5CB6A 2OFOA 1PWHA 4NXMB 2NVBA 3GU3A 4RZXA 4INAA 3ZGVA 5LM3A 3OQHA 1JFLA 1JFSA 1YAJA 5G0VA 5L3RA 2HBYA 3IR5A 3HDHA 1Y4SA 4O2BF 1X39A 1QTQA 4UUOA 1LTKA 3AY3A 3WWEA 4IMIB 5K6AA 1NBME 1J99A 4F3RA 5EFZA 3HDQA 3UM9A 1A9QA 3ZVKA 1JA0A 1SMKA 1QH0A 4DIOA 3D5QA 2PGOA 1GRNA 1E2HA 4FHZA 2O8EA 3LBNA 1N0IA 2A0UA 1G0OA 1IVNA 5EYPA 3K0FB 5CB4B 3T9BA 4BTLA 3P9XA 1ZK4A 4Q1CA 5B6JA 4TLDA 2JGIA 5K0SA 4LZJA 2P1DA 1DEAA 1B6GA 3AUYA 3FMOB 4OKNA 4LC0A 1MQ9A 3WIOA 3CLUC 3OVMA 2EZ8A 1GQOA 1DADA 4BQOA 1Q83A 2ENWA 3AETA 2ZYDA 3N2GA 3QVLA 4WASA 4YCAA 4LJKA 3WKBA 4QASA 1B8VA 1RC0A 1TQ6A 2DBRA 1LSJA 2L69A 2VYVA 4JBGA 3S5UA 1UPFA 2QLTA 4EI8A 1RJEA 1YACA 3K9HA 1EP2B 3V7WA 1SZDA 4KKVA 3UMJA 3OCJA 4IHJB 4TV8F 5AXBA 1X7WB 2FEKA 5KTTA 4GIBA 5FNVB 4WXEA 4IVNA 2FTKE 2WJ6A 3GGJA 1V7PC 4O4HF 4ZVVA 3IUMA 4OA5A 4DV0B 1VKOA 2WWRA 5ANRB 2HV9A 2RKOA 2DSNA 3GIDA 1S1CA 3FI9A 4OD0A 5LBUA 1DXQA 1UKCA 3O8LA 2CYAA 4DJFC 1CHDA 4MA0A 1KJWA 2IHKA 3WGJA 1GLGA 2VT3A 5J2TF 5ALKA 4EHKA 4IHKA 5BUCA 5JSFA 4HAXA 2NYAA 2RH4A 1IUOA 4DLKA 3EWSA 2O3TA 1SEVA 2XNDA 3TTVA 2A67A 5CVUA 1YH3A 1QCYA 1WHSA 3EZ2A 3OKCA 5DN6A 4CMEC 3W2IA 1PO7A 3IV7A 4Z0TA 5F5NA 1OYVA 3AR5A 1SC1A 2ZBUA 2VPWA 1XEFA 1F1BA 2H1VA 2P0EA 2YIMA 4U5XA 3RB8A 3WZ2A 3BF8A 2I55A 3GLQA 1O57A 2NTJA 4AY3A 1RT9A 2X2EA 3GVXA 3NWJA 4P3XA 4POOA 4FLMA 2JDIA 3I2YX 1IU9A 1W36C 4DV4B 2Y76A 2ZXFA 3QE3A 3ZDAA 2VK1A 5I3ZA 4L6IA 2Z04A 2ZAGA 4RFLA 1Q0SA 3D6UA 1J20A 1N25A 2G1JA 3F0TA 1PSWA 1S8OA 3DVSX 4WE3A 3TZQA 5L4NA 5KYWA 3LUAA 2NV0A 5BV1A 5L3SB 3JYHA 1N2JA 4P3YA 2Y1EA 5E2BA 1X7XB 4D8WA 3KYIB 2OB1A 1Z6GA 3G89A 2D1SA 1FJGB 2AMJA 2AZXA 4RX1A 1ZN8A 4L51A 4WLOA 5FFFA 1TEVA 1QFSA 4R81A 1XFDA 3JASA 2Q2VA 4KO4S 5KVSA 4XB6B 3ND5A 1BQ3A 3K70D 3S1AA 2F4VB 3DFUA 1KEWA 2ZWMA 4QBFA 3AGPA 3CRVA 1N8KA 3W2EA 4BVKA 5EE3A 3IOCA 1L4FA 3TLZA 2CGEA 4QU8A 5K8UA 4Q82A 2R8RA 4DCNA 2A0FA 5FLKA 4BNUA 4QGFA 2LXNA 1XQ6A 2ZITA 3AXTA 4G5SA 1RKBA 2Z9CA 4GC9A 1HG0A 4KCGA 4S24A 5IKOA 4JXXA 2YWGA 5LJIA 1B4DA 1SFRA 3EEIA 1CUVA 1KK3A 1Z2NX 1T6YA 2BKXA 4B80A 4Z3KA 5IDQA 2UUBB 4PRKA 3HI4A 1WD7A 4FGLA 2HCJB 1NVGA 4MVJP 1XE3A 2XTMA 2UYCA 4TXNA 2W6CX 4PAGA 2RFLA 3BAFA 4MW1A 8GPBA 3GBVA 3DDZX 2P5UA 5BQ3A 1M67A 2PRZA 1RYHA 1DEKA 2DCMA 3WY9A 2JC3A 2JNWA 1L1EA 4CMJA 4D56A 3RYIB 3C41J 4ZRDA 3EJ6A 4HSGA 4H18A 4YA6A 2CB0A 3DOJA 5E7QA 1JHVA 3T3MB 1HQKA 1RAIA 1NXQA 2O2JA 2Z6AA 5AH0A 1ZINA 3N8IA 4LHZA 3Q85A 3V7UA 2RH5A 4QUJA 3OPMA 5JJIA 1L7AA 1GG5A 1W46A 3FJYA 3RSOA 2IYTA 3OPYA 2P68A 4P58A 4W7IA 4ASUA 3CRMA 1NR1A 2ZJFA 5CA0A 4QQFA 4X71A 3FPBA 4QBHA 1VSBA 1RXIA 3K92A 4OHMA 1WV0A 2FRDA 4OQLA 1A82A 5KKAA 2EBWA 2VLIA 4QULA 3ETNA 5G4LA 1F8YA 1WJGA 5JQGF 5EOVA 1C1HA 1RWQA 2QLLA 4GP7A 1Y8CA 5FUWA 2M6KA 3EVFA 3SKVA 4LFCB 2IBTA 3BMXA 1NV8A 1DWUA 1M2OA 1TUEA 2DUJA 2HJSA 1LJUA 2PQ2A 3EY4A 4QQRA 3USZA 4PZPA 4I55F 1HQCA 4KI7A 2G3YA 4BE9A 1L7DA 1PG0A 2Z58A 4TRJA 5ITSA 2GH1A 3QENA 1R4NA 2AOUB 1CVIA 1XRMA 2FUEA 1RADA 4BQPA 3AOEA 3C4QA 1T2VA 2R87A 4EFLA 1ZVMA 4FSXA 4OFXA 3MTQA 4G85A 1TKAA 1DZIA 5E1MA 1U3VA 2WYUA 4BN4A 4J2HA 1UK7A 2QPAA 1PSZA 1OH6A 2Z3ZA 3M4ZA 1IBSA 1IRXA 4G4GA 3BERA 4PANA 4RVGA 4WSOA 3SP1A 4LBZA 4XARA 5CYOA 3L0OA 1ISHA 3FSGA 5FPHA 4ETWA 2D06A 3ZU6A 4YP5A 5KMGB 4BXOA 1E32A 9LDBA 1WDLA 1Q15A 1QRDA 2A9FA 2R751 1M5UA 2RHLA 2V6MA 4ETMA 4N3AA 4YUZA 3R7LA 2HTEA 1QK4A 1I80A 2Q5LA 1E2QA 1HE2A 2JFGA 2QP4A 2QTNA 2XE8A 3IQWA 3WQRA 3HR7A 5JU6A 3WISA 3B6EA 1PGOA 2ZRKA 2Q1SA 4P33A 1GHTA 2VPXA 1OT5A 1AK9A 1CNFA 2SKDA 4PPNA 1USIA 5G0SA 1I13A 5A1JA 1BRMA 1E8NA 1MC8A 4V0ME 3GG2A 1KJIA 3S70A 2V6JA 3VOBA 5I7VA 4YHHB 2WQ6A 1VL2A 3PX7A 1V7QA 3R7DA 3HNRA 5D01A 3MGCA 3GGOA 2WBLC 3LP6A 4C1NA 3SDSA 1N9GA 4EABA 2QT9A 1AGYA 3R76A 4CKWA 1PL0A 1NJFA 3KKKA 5L3ZA 1W4LA 1DARA 1VSTA 4MYSA 4M8NE 4XEHA 1W4ZA 1UMKA 1HWYA 2KJQA 1AUPA 2PE5A 2CZCA 2I2XB 2C59A 1UC5B 3HCDA 4HZGA 1V37A 4F72A 3CPSA 1M74A 4U9UA 4IGAA 2VPPA 3IURA 1H1LA 4WN9B 1NF9A 5HUHA 4UTXA 4J0HA 4MGZR 4LXTA 2BE9A 4F3KA 1F51E 2ZUWA 1LVGA 3EF1A 1Y3AA 2GN6A 2QORA 3EGVA 4BAUA 3U44A 3BL6A 4PLZA 4DLYA 3FZNA 5E3HA 2MR5A 5F2OA 4DLLA 1RYBA 1NZFA 2HGSA 5J5AA 2ZSHA 4R83A 4EK9A 4JT4A 4MA5A 3ER9A 3GFBA 1AQLA 4AG5A 1RHMA 2O0MA 3ICWA 3IP9A 1BVUA 5BORA 5LP6F 1N5RA 1YDFA 1QORA 4NNPA 1OILA 4TGLA 4RCZA 3MS4A 2FEPA 5CXQA 2FZGA 3FFWA 5J4LA 3SIWA 5L3QA 4BTVA 4C2TA 1JS1X 3EHEA 5FBZA 3QYPA 1JDPA 2D2EA 2CHUA 1SK8A 2XDWA 4KWHA 1TM2A 2YVLA 4HAZA 4ZANA 2NPIA 5FULA 2XB4A 3I5XA 3HLYA 3VAZA 4J3FA 4M7RA 4EVRA 3DCIA 1KVSA 3K9LA 1KI2A 3I30X 3W9UA 5IJZA 1LLDA 2F6RA 4AJ1A 5AM3A 2QENA 3BEOA 1EHCA 4LXXA 2R6HA 4UVEA 3R3JA 4IILA 4BKUA 1FEZA 4FB5A 5IM5A 1NW7A 1P9LA 1A2BA 1XEWX 1XN1A 3C14C 4B34A 1IFXA 1CY7A 4KKXB 3IBTA 3N5KA 5AM0A 1U5AA 4DSUA 5AT1A 1DDGA 1HSOA 4X60A 5EWMA 1SHUX 3UJ6A 5IUJC 1QF7A 2QOEA 3NEAA 1GPUA 3FNGA 5ICCA 2WYIA 4O2AA 2W93A 2I29A 4KYTA 1XLTC 4GLFA 4XTCS 5DYYA 4TKLA 5K01A 2X4DA 1R0KA 4FKMA 2CWWA 5ELXA 1NMEA 1KY2A 1YVDA 2EBFX 2YHIA 3B2NA 3PE6A 4LS3A 1OTYA 1VTKA 3L02A 1RU3A 1Q3KA 1ZOIA 3N53A 1HDZA 4K6HA 4OJKA 2OHFA 2Y1KA 4BBAA 5IABA 3G2PA 1AQNA 3AL3A 5JALA 2CHVA 1A69A 5JXHA 2GCPA 3PG5A 5ALSA 2OVBA 2C4KA 2GXSA 3GUCA 3OMXA 5ICSA 3HKDA 1P5JA 2P2LA 4KXWA 3ZY5A 3MINA 1LLUA 4G25A 2VPQA 3RYTC 4XOUA 2P9EA 4I1YA 3TW8B 2BKUA 5GZ6A 4E1BA 1G2OA 2XXBA 3AF4A 4PGFA 1ZH8A 1L8XA 2PKWA 3HUTA 4MULA 3VZPA 3O8QA 3DF9A 3SZLA 4CM6A 3IMCA 2I22A 2AF3C 1NLUA 1S0UA 2FZEA 4M0UA 1A7AA 4U63A 4XJVA 1PW5A 3TZ6A 4H7PA 4BECA 2ACVA 2NT3A 3HPQA 2P69A 3GRVA 1DDIA 2EWVA 2XMDA 1UC4B 1M6VA 3Q9NA 5ENVA 1MR3F 1PTJC 1G8KA 3PFGA 4DBLE 1HTTA 2ACKA 3ZGOA 1GV0A 1MO3A 2VVTA 2WJHA 5AVWA 4GXTA 1OX5A 4DDHA 4JT8A 1DIRA 2IYUA 3HBLA 4OHWA 2QTTA 3DNFA 2Q6VA 2YV1A 2VHCA 3NHJA 2MOKA 2N42A 4MKXA 1GG8A 1DC6A 1M34E 1RXEA 5CDTA 5B3JA 3L4BA 3R09A 2BGGA 2X1MA 5LUBA 1P0FA 1PT7A 2GZ2A 4MUAA 1J07A 1TLLA 2Z95A 3D54D 4I9GA 3P9QA 2FW7A 3DE0X 3Q7EA 4QUBA 5FORA 3UHOA 3UMMA 2E6KA 1ZR2A 2ODQA 1W44A 3M2TA 3LDHA 5BRJA 1VP9A 2ISCA 4RMHA 2QVCA 2BONA 3NBAA 5HCIA 3Q0EA 2WWVD 3RH0A 4D45A 2E1PA 5BMVA 3G6WA 4MV6A 1JT2A 1TMGE 2VOEA 3W6ZA 1PS8A 1SBHA 2OXIA 1ECBA 2KWIA 2C8JA 4I2VA 2F55A 1M8FA 5U1PA 1R74A 1QGED 4MEAA 1RYNA 4WINA 5A3QA 3KCNA 3Q6IA 1FXWF 5FCDA 3PNLA 4Z9FA 5C8YA 1B76A 3D1JA 4R2IA 5FLYA 3G1TA 4AL4A 4IJWA 3VYWA 3N2NA 1LQUA 2YY6A 5AUPB 3EEYA 4GWGA 2VDQB 3NMUF 2G83A 2ZRIA 2P67A 1OAAA 4MRMA 4HY3A 1EFPB 3I92A 5HZKA 4AJEA 3DAPA 4CCYA 1W35A 1SRQA 2VNSA 3WL6A 1GTL1 3FW1A 2B83A 3PI7A 1GPJA 4HEHA 4RK4A 4B4WA 2YOGA 1N6PA 5DTEA 3L6OO 2AQ8A 3ROXA 1BXGB 4KE9A 1FUKA 2J7PD 3CH6A 3ZUPA 3KTOA 2CV1A 4X84A 2IOHA 3F1LA 5D6OA 1UEJA 4FS3A 1Q77A 2REQA 3LGAA 1DXHA 1QVRA 2ZIEA 3OU7A 2BFPA 1NF3A 1DHRA 1RZUA 3PQEA 2AYXA 4QYWA 2JA2A 4Y1GA 2BM0A 5F78A 1BHSA 2ZSEA 3C87A 3VVLA 4H60A 1O9HA 2R1UA 2G5CA 3AZQA 1K7FB 1T36A 2CD7A 1XEAA 3I39X 1M9NA 5A4JA 3QBTA 4TV9B 3FZEA 2H1CA 4PC1A 2PLFA 5FI0B 4C20A 2A9OA 3I9LA 5KBYA 1QZTA 3I9FA 1TF2A 1U9CA 3W5DA 4WEQA 1FDSA 3LL4A 3EISA 6LDHA 1YR1A 1J0EA 3C48A 1HV8A 2KYRA 4PG7A 4YECA 3OMLA 1YR8A 2EIHA 4HLCA 2JHAA 3FUTA 4I1IA 3TNDA 3IEVA 1RQRA 4LBYA 5DHPA 4FMBB 1C3OB 2HMVA 3BWEA 3DTVB 1FRZA 2BL4A 4G8JA 4JQZA 3EMKA 5KOJA 4K6GA 3CG4A 3U56A 4NOJA 1US8B 3N5CA 5FP0A 3SC4A 4EFMA 4KN5A 5IS2A 3PQDA 3BTVA 1L4EA 1NRJB 3UK2A 2QBYB 2PSSA 3I1IA 1JPJA 2C2WA 1NY5A 4KVAA 4LSZA 1N7HA 1T4BA 5CA1A 3K6JA 4GAEA 3PITA 1EEHA 2X6QA 3IELA 3G8YA 1UMDB 1M34B 1ZO8A 4Q21A 5JEDA 5EGSA 4WECA 5LNK6 5CFNA 3K2EA 1BDJA 3N70A 4UUMA 1PR0A 3FZQA 2XODA 1PWYE 3H9UA 2C4TA 5ER9A 2ZI7A 1DUSA 2QAGA 2IZ0A 2PX6A 3EZNA 4E7OA 2NVOA 4BL5A 3PLRA 3GARA 4R7ZA 1NXOA 2QN9A 2O0KA 1K8RA 3D2CA 1N3IA 3BFKA 1G4UR 2R96A 1CY0A 1XD2B 5FI1B 4RD0A 5CH5A 4JLDA 3TPFA 2D7CA 3KJFA 3QLEA 3QKWA 4BU1A 1N9ZA 1P1KA 1GG9A 2ZI9A 4Q3NA 2C1ZA 3GJTA 1KYZA 5ESDA 3L9WA 5SY6A 4WCFC 4K2HA 4ZQBA 3IKLA 2DR0A 1YGYA 1K6JA 2AN9A 3ZNQA 1DC8A 1E0KA 2NQ2C 3KWFA 4XWWA 4GP9A 1G6OA 2A58A 3P4YA 4Q3AA 1DB3A 1YK1A 3N6XA 2PR7A 4MRNA 2PR2A 3D4NA 2D5BA 1ZJZA 2O14A 3GFGA 3OZXA 3WHKA 1M1YE 3IGFA 5A5EA 4E33A 1H5NA 2A7XA 2ODAA 4ROTA 2JCXA 4E51A 5ENZA 1X13A 2NWQA 3TB4A 4YK7A 4Y3UA 2X3YA 3KHTA 3KZOA 4L4UA 4RWZA 5HIIA 1KZGB 4IDFA 3TQTA 3VNRA 4DUZB 1FRNA 5B12A 3U40A 1BCSA 5IBPA 4PGGA 1P7YA 4Z9YA 1VOTA 3SXUA 3EEBA 1PJTA 3NBMA 3R9WA 4DLPA 1N8TA 1PR9A 3HI6A 4MWBA 3OJFA 2OA0A 5K8CA 1NW5A 5KX5B 2VTBB 2DKNA 3BDAA 4E5NA 4PS0A 3CH7A 2PJRA 2BUCA 3IXQA 4AWBA 5KVVA 3THXB 2W2TA 1QGDA 1UANA 5KC8A 1DJLA 4UHBA 1EDZA 4FYXA 5H02A 3WBKA 1DQPA 2XTNA 2RARA 2ZUEA 3SJCA 4ZOLF 2HWWA 1EE9A 3COPA 1UJBA 3KOMA 2C3UA 2EFYA 2H1LA 1D2MA 4QLBA 4XQ9A 2ZB3A 2DU8A 2Y9PB 3O4VA 4P86A 1W2GA 4JLAA 4RADA 4TKUA 5FTKA 2W70A 2D13A 4QHSA 3NM4A 4QU5A 3LW7A 1Z6ZA 3SS8A 1A2OA 3MWGA 4FFNA 1ULBA 2WDPA 2BJHA 4JI0B 1AF4A 1V5WA 3ZK7A 1H8ED 2PSFA 2E4VA 1U1CA 1F4LA 2QN1A 3ICVA 2PGJA 3QI7A 3WL5A 1F7VA 2IX3A 1LNZA 1TB4A 2I4NA 2BMFA 2G07A 4BP9A 1VGQA 3NASA 5HKLA 5KYXB 3ZXXA 1HR0B 4LCJA 4U7DA 1KORA 1UM9A 3FOZA 3OSZA 4O4JA 4UXHA 4NMXB 2I2WA 4PZZA 3PS9A 2O7RA 1HE8B 1WKBA 3EDOA 3O94A 4RIIA 5CIWA 5D5QA 2UU9B 1XSEA 4U7FA 4V03A 1WE2A 4ZXPA 4C4XA 3OZBA 2DECA 4YUVA 5I51A 2R6JA 2UZ0A 1B3BA 4OJNA 5CNJA 1IJKA 4S1OA 3WMEA 3WR5A 3FHJA 2B6NA 4RCVA 4EF6A 2Z08A 4G5GA 4Z53A 3I2FA 4F46A 5I7AA 3FUVA 2V65A 5BVGB 4KXMA 2X5XA 1IAQA 2YC4C 4BB9A 2X42A 2VZLA 4NHOA 2EF0A 3BCRA 4RLQA 5DSZA 3BORA 5JO0A 2F8TA 5CVJA 1BMQA 3WK9A 3ZZMA 1JFFA 4NMHA 3VR5A 3OUZA 3J81k 2B8EA 4E3WA 2GEVA 2JJYA 1VYTA 1M1YB 2Z9BA 3QLUA 1W85A 5FPYA 3FE2A 4RM3A 5JWHA 5HJ2A 1X80A 4EX7A 4I5IA 1RKUA 2IHNA 2A92A 1XYVA 4FFOA 3UNXA 2JVJA 4HEA1 4FJ2A 1IHPA 1Q91A 5JNWA 1GGKA 2JA1A 2GF0A 2QTVA 3PYMA 4F6RA 4MQFB 4ADSG 4BFTA 2FJPA 1Q22A 1RM5A 4ISCA 3LCUA 2HF7A 3CJTA 1X1BA 6AT1A 5J4YA 4RA6B 4I0WB 2G80A 2GNOA 3NJ8A 4GBGA 4MW0A 3CLKA 1E0JA 1Q0QA 1M33A 2YNMA 2YQ4A 3NFYA 3W2GA 1QQAA 1B73A 3PGKA 1GSHA 3MUEA 4LFBB 1E1RD 3PQ3A 3D3EA 3DOFA 4F4CA 4LGMA 4UUBA 5J40A 1WVIA 4PCAA 4RPCA 1JG6A 1U04A 2YV3A 1E1CA 3T7DA 2I9PA 3HTXA 3DZDA 3P9SA 2R97A 1E62A 1OBFO 3QEJA 1MABA 4PNEA 3EWAA 3ZE9A 3FZYA 2R00C 4FILA 2GILA 9MHTA 2HCRA 4XVQA 1ZC4A 3IHTA 1F3LA 3DC7A 3U49A 2F1JA 4AG3A 1ZUNA 2WT4A 3EIQA 4WZZA 2FF7A 5C8ZA 4KG7A 5AMXA 4NICA 2CLMB 4OKIA 5IC6A 5BW4A 4TLLB 1BROA 4RV9A 5DDIP 2H07A 1JSZA 2EL9A 2IXEA 2VP2A 4JIMA 2W4IA 2AOVA 1QS0A 2OC9A 1SCJA 2C9DA 4ED9A 1U7HA 3P1JA 2YMPA 3AIOA 2A4KA 1TF7A 1VCOA 2VYCA 3DMTC 3G8CA 3MT8A 4RM2A 1GCOA 2PSJA 3WJ7A 4F2WA 3GX1A 1AXEA 2OP0A 3BMNA 3R77A 3CPJB 3Q8LA 3OKPA 2YINC 3AWIA 3K8ZA 3PFBA 5HKKD 3PFCA 2XUGA 2QROA 3OEHA 4MB0A 5BV7A 1B3RA 4OPMA 4ND7A 2WTEA 4EUFA 3PR3A 3DMFA 1LWOA 4JXJA 1K89A 1V8DA 4Q12A 3D43A 2ZE8A 1S2GA 3VR5H 1DEXA 3IJRA 3WNBA 3ZHQA 2A86A 4XR4A 3MUNA 4ZOQI 1KWKA 4NR0A 1J8FA 8ABPA 1ZKMA 4Q3BA 5COQA 3OJXA 3JQFC 4H2DA 4K9NA 2QSJA 3CUKA 3MTAA 3ZHTA 1XZMA 1QX3A 3FHCB 4EBFA 4JL8A 3EPKA 5KYTA 5K0CA 2NW6A 2W6PA 3PZBA 4FT2A 4XUEA 4HN4B 5HDQA 4BP3A 5HQJA 5SZIA 1U3CA 1NYRA 3BOSA 4KFCA 3HCOA 3O26A 2C04A 4KU4A 4MVJH 3IO3A 1T5OA 1O5IA 3LUKA 1T9HA 4P93A 2JIQA 3CPHA 4RS4A 1B93A 1K8QA 3QXGA 4M8KA 5DHRA 4JYZA 4MS1B 2WD7A 4NZZA 5FD8A 3QF4A 1R3DA 1JR4A 3CNHA 4LNUA 2A94A 1K92A 3C39A 3D64A 1NNSA 4TQAA 1MAWA 3Q8KA 2GBCA 4YJ2F 1NFRA 4DA6A 4EJ2A 2RBGA 1X86B 2NAFA 3A9WA 3QMWA 3I01M 4UDXX 3RSQA 1EFTA 5FUBA 3JALA 3OPVA 2CLLB 2OXEA 3USES 1VJ0A 4DHEA 3FKJA 1GTVA 2RAUA 2WFAA 3GJSA 5CEJA 4LJRA 1XRLA 3FWNA 4M55A 3BWBA 2WHRA 2WHYA 1N8SA 4YVFA 4JI7B 4NFLA 3GP5A 2PMKA 1XF1A 5IASA 4BYMA 1V0JA 3VR2D 3EDYA 1Z22A 3Q7IA 3W5SA 3CSUA 2XVXA 2ZROA 5EXTA 3UB2A 4D9KA 2VK2A 2X3UA 5JATA 2QXTA 1ST2A 3ICEA 3LC1O 3QUAA 3B52X 3H18A 4FINA 2R47A 2RHDA 4M9SA 1YZFA 1K1EA 2H18A 4K9LA 2QQ0A 4P53A 3ZE0B 3CVVA 3UYLA 3VR3D 3VOAA 2ECOA 4YJ3A 1I7LA 2ID4A 5CFOA 3SMVA 1ZJJA 2GFQA 4OB6A 1NRXA 1NZJA 1MOZA 2XKAA 5ESRA 2FXIA 2GARA 4FGZA 4LVCA 5EQJB 5U4XA 3SHVA 3BE5A 4NBTA 5C0OE 5TGZA 1SXHA 4QVIA 2WM8A 1YB4A 2G1UA 3W3AA 2IF2A 3F6EX 4MUXA 5EC8A 3PXAA 1OLXB 1XQYA 1HNXB 1STOA 1QG0A 3R4VA 4RS3A 1EK6A 1BX3A 4Y9TA 3TFQA 2A0YA 4ROSA 1BOFA 1DX6A 1FYWA 3QELB 3FCSB 4MWGA 5J5CA 4BMOB 2NO9A 4F9EA 4HLUA 1CYEA 2YJTD 3F5DA 3CW8X 1AGRA 3PNMA 3H3XA 4LZLA 5BWBA 1Z08A 1Z6XA 4OQFA 4GR5A 4ZVNA 5DT2A 2JIBA 3OTIA 1PFUA 3AOGA 3V6LA 4ZDWA 1U2ZA 2A1TR 2VXBA 5KU1A 1PE0A 1BRTA 4OFZA 4IJVA 1ETHA 4GRDA 2XCSB 3WO0A 4PRYA 1C9YA 4X6YA 3WNQA 1H2BA 1HDRA 3B53X 4F71A 4QTXA 1ORRA 3VAAA 4ITRC 3FLAA 3U37A 4BKPA 5AYVA 4PAWA 4CUZA 4CKXA 3L43A 4DA9A 3L1JA 1V4BA 2Q5QA 1YB2A 2OZEA 1G19A 4FXOA 2BMWA 4X3OA 3S99A 1ZEJA 2G08A 5CJ2A 3WLNA 2XUPA 1UMBA 1DRKA 5EZSA 4UFPA 1A3CA 2JIZA 5K3BA 1ZICA 4DY6A 1E7RA 2GPJA 3PUVA 4IAOA 3HJNA 3KXIA 3QTTA 1BKDR 1UEXC 4J4TA 2HCTA 3EC1A 3HKEA 3M4JA 3X1WA 3DS8A 3GZ4A 3KZ1E 1ZISA 5IWAB 2D1YA 2WSLA 2WZBA 4GHWA 2FHSA 4D9NA 4K0KB 1BU8A 3FSJX 4KB5A 3BJIC 4NX2A 1SEPA 1ACLA 1QPBA 1XTIA 1OVMA 4TTPA 4XA8A 1R5NA 3AIIA 5DYGA 1VJDA 2AC4A 3DEHA 5IAGA 1K27A 3DC2A 3S68A 3QJGA 5T6BA 5H5JA 5A7FA 1WBBA 3T3EA 2ADOA 1EFVA 5DNUA 1P4HA 5ED0A 5B58T 2XTJA 4V0OA 3AUUA 3W3AH 5FO0A 3WBJA 4EX6A 4WKNA 2FPUA 3HKBA 3RSZA 1RLMA 1J2EA 3T5BA 3EXFB 1HY3A 4IDBA 4WJZA 4V02A 3D6MA 1LZLA 3W6OA 2CXOA 3UWMA 4RGBA 4IIFA 1E96A 3KJIA 4V0NA 5JS7A 3HZRA 4KX5A 4L1KA 2WTUA 3R6TA 1XJQA 3VU3A 1IBKB 1NVVR 3ULKA 3VR4A 2X23A 4L5BA 1OXMA 1LPSA 3NV9A 3N8GA 1QONA 4XIJA 3E7WA 4KBYA 2GK4A 2FQ1A 2X2OA 2FZCA 3NIGB 1J06A 5TPWA 4DQDA 2KHZA 2IZ5A 4HX5A 2H4ZA 2DTEA 1DKQA 4R8MA 1CE8B 3A3OA 1K6MA 1ONOA 1WDMA 1YQEA 2GM3A 2XDYA 3IKMB 3ZZUA 4I8IA 4DCJA 4OP1A 1GKKA 2G77B 4D46A 3E4CA 2XNKA 3URKA 3VZCA 3FKSD 2ZJ2A 4LXHA 5FL7A 3GAMA 4GSLA 1U7OA 3BJZA 4DCTA 3MXOA 1AQYA 2QR2A 3E3LA 1HA3A 2JEZA 2BLNA 2Y2VA 3KUDA 3R7SA 4CT4B 1XV5A 3G88A 4LPKA 1MEJA 1J6UA 1JDVA 4GDFA 4X93A 4A4DA 2JEYA 3KZXA 4WKOA 3RTBA 3K0CC 1JLMA 3W0LB 1WQ1R 1E5VA 2HF2A 1JIUA 1EA5A 2PV0A 3R0VA 4MDEA 2RHWA 4PPGA 4OHVA 4GO1A 2XKBA 4E22A 5D3QA 1H6BA 1WW2A 1YB5A 4HGNA 4Q3DA 3QUSA 4WI1A 4HADA 1XTRA 3G1UA 3LUFA 4QFMA 2P91A 2PX8A 3I04M 4JT9A 5BSFA 1AKEA 1G7RA 1L3BA 1GCUA 3O5AA 1G6HA 3SJZA 3BH6A 4ARIA 1E9CA 4NYJQ 1RZVA 2E48A 2XB8A 1KOGA 1KY3A 4DRXA 4Q9JA 1E9AA 1Z2EA 2FEWB 3INGA 5B3KA 2H2AA 4RY2A 2YX1A 1I8TA 1OBVA 1W88B 2Q3DA 2AI2A 4D8UA 4DLTA 4E2ZA 1IWBB 3G82C 4MQ5A 5E6SB 5FPSA 1UPBA 3INRA 5LA6F 5E2AA 2CLKB 3A6JA 3WLMA 4EI2A 4Y6SA 3MCZA 4Z4FA 4XGQA 2VTVA 3EFEA 1N9KA 2VSYA 4N3CA 4QNMA 3I64A 1U4OA 1RWBA 3F8TA 4YAJA 2DWQA 3U4QB 5LUAA 4OHOA 4A6DA 4V24A 2ID9A 2VDMB 1TEHA 3NVMB 5CBPB 1C80A 1FX1A 2XDQA 2ZXEA 3VU1A 1XZFA 3Q1LA 5L6MB 2X8JB 4U2GA 1L3CA 1VXOA 2WLSA 4A6EA 3K0FA 4OAQA 2ZTUA 1FTSA 1QVVA 1QH8A 4LTNA 4LZNA 3TOZA 1FW8A 4AF8A 1AE1A 3UXMA 3NV7A 3KOUA 2ATXA 1NAHA 1V35A 4I9FA 3SXPA 3CH5A 4HVLA 1S2IA 3TRKA 3U09A 2SECE 2DZDA 2P6PA 2PS1A 3QM1A 4HQFA 4NCAA 1RAAA 2J6HA 1X1SA 4BIMA 2PUWA 3PNYA 4Q9HA 1EM6A 2QIOA 4HKTA 2WJAA 3O1IC 2H7VA 2PL9A 3TZHA 2PJUA 3ZZ0A 1S2MA 3V33A 1TZMA 5IKEA 3Q87B 1JIKA 1FVFA 1RHKA 2IZOA 3A05A 4IHJA 1JR3D 4A2PA 3WRWA 3GBPA 3D5EA 3C6MA 3KR2A 4L76A 4WNYA 2LCQA 1II0A 2XUAA 3HBFA 3NBKA 5JIBA 1VZ2A 4XW2A 4YB8A 3RUAA 2MSKA 4DEVA 3W6UA 4MHTA 5E3JA 1RHQA 4JR1A 4N49A 2HRBA 4LDNA 4D0LB 4ERNA 1FJXA 1UKAA 1LEHA 3C6XA 3WWCA 5G1PA 4R3NA 4CLXA 4WNAB 3RAJA 5EE1A 4QO8A 2O8FB 3P26A 3SIXA 4ZICA 5M2QA 1ONPA 1XDGA 1DP4A 1G3RA 5LQUA 1ZW1A 2WJWA 2ZRDA 3F5QA 4TYMA 1EXWA 2R8EA 1JJAA 3DE2X 4FHFA 1R4MB 2RHBA 1L9KA 3ROEA 1EVKA 1LW7A 5K03A 1ZZEA 4NZPA 2QVGA 3WBBA 2WAAA 1RE1A 3FN4A 2OGUA 4E3ZA 1CZUA 1Z0AA 3EVGA 4TKVB 3A04A 2PYZA 1L7EA 3E27A 4WADA 2PU7A 2YY5A 1PUXA 1UFRA 1Z82A 2XUZA 3KAKA 4JQYA 1QR6A 4L9SA 3FCCA 1Z25A 3B5IA 2GX6A 2ONKA 4IKEA 5CRIA 5J2UB 1OYOA 1XLWA 3KVNA 3FKQA 4QICA 2NZ8A 4UPDA 3TZKA 2PJDA 1C30A 1U0OC 4LJ4A 1UDXA 2YRXA 5D3KA 4BFWA 4RSMA 4E13A 1TTPB 2FN8A 5FXMA 1JHQA 1S9HA 2WYOA 3C3PA 3LY5A 4HATA 1P2BA 2GN4A 5AKKA 2FH5B 4FMCB 1T6BY 5JDIA 1KK0A 1DG1G 2WIAA 4J7CA 4R1SA 1RJDA 3AJ8A 1DWOA 2MDTA 5AUQA 2HK8A 3QU9A 5CJJA 4B7UA 1WMFA 4GKAA 1Y8ZA 2AEFA 3TG8A 3LVFO 5C80A 1I51A 2HA7A 1PDOA 4HRVA 5HE8A 4BRWA 2JASA 4HDCA 1YIAA 1IHDA 4DNOA 3UG7A 1ZH6A 3AR2A 1WS6A 3QITA 4EBBA 3FLEA 1N33B 2IEZA 4EJSB 3T3GA 3GW8A 3ETEA 4L7VA 5HP4A 3FHOA 2VATA 1KIAA 1I32A 3GDWA 3WYAA 5FTNA 2ZSIA 1MQ8B 1JMKC 2ZJYA 3DV2A 4CDMA 4IP0A 2C2XA 3VH3A 2HIAA 4I8XA 2XCIA 3EDRA 4TL7A 1JKIA 3T9CA 3OZDA 1NVTA 3UQYS 3THYB 3KKQA 3KFXA 3SKYA 4R71A 1F9AA 5GM2A 3T41A 2VYQA 1M2VA 4B6FA 2KQUA 3IAAA 1NLZA 4U0JA 3ORQA 4FDVA 4ZC1A 3LWBA 4P83A 3KZNA 3T5DA 4B6JA 4YXWD 4M0FA 3RU3A 3E53A 1T9AA 3I05A 4TXHA 1ODCA 3RVRA 3EDQA 4ZZ0A 3CX3A 4B4KA 3DKIA 4Q0MA 4RSHA 2CNBA 4JGGA 3TOVA 5G02A 4CIAA 1RXYA 1U94A 1QP7A 1C9DB 3PDIA 1W0CA 4MIEA 3VO1A 4F11A 3R5TA 3IVXA 3I6QA 1LDNA 1KH1A 1MD9A 1SCKA 5ELLA 1QAMA 1U2EA 3DAFA 2GGSA 5JPIA 1W49A 1TXGA 3VUFA 2Y93A 4CV3A 2WTBA 4KOAA 4XE5A 5A4DA 2QM8A 3V1KA 4M1SA 3RK0A 3ONWA 1BGWA 2HMSA 5HM6A 2OOKA 2HNBA 4QPCA 3F3KA 4WZAE 3GAZA 1I1OA 4BO7A 3EFOB 4MQ4A 3UAGA 1NLFA 1JAXA 2ZDGA 3AM4A 2OESA 5TRTA 2R6R1 3SYTA 4C7XA 4ZHQA 3ELUA 3I45A 4GI3A 1JBKA 2GNPA 2J5BA 4HGZA 4Q1FA 2B8JA 3PFKA 5E9JA 5HXAA 3BGWA 1II8B 2XXAB 4XSGA 4YMHA 3N7AA 2J41A 2J48A 1M76A 4ZIRB 4BU0A 1NQAO 1U80A 2IUEA 4JCCA 1P72A 3A7DA 5CLGA 1FDUA 1XYGA 2IYFA 5CM2Z 1A4XA 2Q5JA 4NDZA 1TNDA 4OMUA 3TW0A 5KYYA 1RYYA 3TRDA 3ZHYA 1NR7A 1BXRA 2Q3CA 2P9CA 2UYYA 1AMUA 1GJRA 2G7ZA 1E8MA 4UEQA 1F4VA 3JQEA 1N0WA 2HD4A 3LKZA 4JJGA 3ADBA 1HDGO 1SHLA 1P9NA 3T7RA 4RYLA 1IZ9A 4BX3A 4TKZA 5AUNB 3ECAA 1WD5A 1DCMA 2R85A 1P2FA 1N78A 3N8DA 5AI0A 6REQB 5LQNA 1DC3A 3OZ7A 4LF6B 3BIWA 1Q1GA 2ZSDA 1C7RA 1MDBA 5FYDA 4BB5A 1S8AA 1RYMA 3EGOA 1DAIA 2C3MA 3IP8A 3OCVA 2R65A 3PNSA 1XKTA 4I50A 4M38A 1DBPA 1T2DA 1PNOA 2DX7A 2YN2A 2ZATA 3OF3A 3EW9A 3ASYA 1JHZA 1K3UB 2R6GA 1JXAA 3ILSA 3B7WA 5IAEA 5LQSA 1KXZA 3JWGA 3K7EA 5BN4A 5JS6A 3C3CA 1R9NA 2HHCA 4QOEA 3D3JA 5A4FS 3LXXA 4M0EA 4LDJA 4QUEA 3A1TA 4TWJA 4GUAA 1ZHOA 4PWZA 4F97A 4PSUA 3T4EA 4AMBA 2W2VA 2A9VA 4OHCA 5B37A 4QWMA 4AJ4A 2RAFA 3BFXA 4TLBA 4LX8A 4PYMA 4K6FA 4JBYA 2AXNA 1EHIA 2J0QA 1T6XA 1AKWA 5KWIA 2JCVA 4CI9A 1JUDA 4QOGA 5COAA 3H1EA 4X90A 5BNIA 3IXLA 4A27A 1BHO1 2GEJA 5AUOB 4D8TA 2POQX 1CRZA 2WJGA 1IXYA 2C7QA 4E30A 3OOWA 2HW8A 3E23A 1O0CA 3I58A 4G0XA 2ZPAA 3W6PA 4AZ3A 2F3PA 3QYFA 4EIWA 1LCIA 3C3XA 2ORED 3ZHOA 4ALJA 1GL9B 2GZAA 3V34A 1GARA 1SC3A 4H7DA 2R60A 1JQAA 1OFUX 1ZIXA 3ODGA 4X85A 5EHQA 1BVHA 3TLBA 3QSGA 1BGXT 3DEIA 4NWIA 1RR6A 4J8PA 3RC2A 3PQ4A 4JVNA 5ULLA 4L9WA 4AUNA 4JLOA 4W5WA 2YJ6A 5B64A 4CQMA 1KDTA 2LWIA 1SD5A 2YRWA 3IH5A 2CXHA 5KTNA 2EW2A 2QTBA 1V1RA 2W48A 1C5KA 3UJNA 3C1OA 4G0MA 4WGFA 5BSHA 1TTTA 2WUEA 3FYCA 3CV3A 1QO0D 3WRYC 2C78A 1VXRA 1PBTA 1POXA 1UBHS 3D8BA 5CXSA 2I66A 1G6Q1 2PS9A 2YVQA 2PAAA 5B1DA 2QTFA 3OY7A 2OHHA 2JGLA 2WT9A 2GBLA 2XYRA 3WFIA 2FSUA 1IE3A 4IYJA 1E1NA 3KG2A 3DCJA 3FFXA 1ZK1A 3M7IA 3WAGA 5HIJA 4Z51A 2XUIA 4RZIA 2Z1NA 1TCCA 2NO7A 2OUKA 1F3OA 2P9JA 3B1JA 3GQVA 2O3RA 3N87A 4G41A 3UJ9A 2YYZA 4MVWA 3PXGA 5I9BA 3T3HA 4EYEA 4OLJA 1X7ZB 5JLAA 3VTFA 4A23A 4DCPA 4GE3A 2GRJA 3IVGA 4NNOA 2D5AA 1G9SA 3A2MA 5E1BA 3RYFB 4ZMSA 3HXMA 4I08A 4CTKA 3TOXA 3INYA 1L5VA 2GZDA 3OZTA 3E1GA 4OM7A 1ZWLA 2XNCA 4FBLA 1AB6A 1O94A 3FGZA 1MX1A 4BNZA 3V4LA 3QVGB 4MIYA 4Y6OA 3PC6A 4XCQA 3SDBA 1P4RA 3HJRA 4BB0A 5DM70 1LTQA 1QB7A 2CVFA 4BY9E 5H70A 3PE4A 5T3YA 1OAOA 1XVAA 3G2NA 3KZCA 4DWVA 1Z4PX 2JBHA 1PS9A 1ZXLA 2CL7X 3RC1A 4AYTA 2ECFA 4J0GA 4R8VA 3KBBA 5CCBA 2ZULA 1BD4A 3C6YA 3V8VA 4AZVA 5SV2A 4CMHA 4S35A 4B8YA 2X7HA 2QRVA 1NN5A 2NU6B 3QGMA 5LL6P 4H3VA 4V0MA 4EYQA 2HY7A 3F5SA 4F2DA 4TVSA 2HYIC 1XZIA 1H5UA 1S2OA 3ITEA 4ZC8A 2P0AA 2WAMA 3BXZA 3RS9A 2Y1FA 1UZUA 4MYHA 4S1PA 1FX0A 2E2WA 2K7ZA 2E4AA 2WU0A 3DQPA 3SYNA 2YL2A 2ZM6B 3V9AA 2FUG6 3NWPA 1WZEA 2WF8A 2I8AA 4UM7A 5EJ7A 4FQ5A 2FP4A 4XB2A 3HSSA 1VLVA 5H81A 2JI9A 4KDRA 4QRIA 2IP4A 3AIMA 5IVDA 2GRAA 4BMCA 1WKCA 4BRUA 2VXOA 3FYDA 3I3OA 1ADJA 2ZUBA 3GVIA 1R8XA 2V7XA 3RSFA 1R7RA 3C7KA 4DMFA 1CY6A 1FSSA 5EZ6B 4BNXA 3ZEAA 2WRZA 1ESEA 3UMSA 1JIVA 1TCBA 2JFNA 3PWKA 4IDNA 4MCJA 3L6DA 1F48A 5TARA 3R6GA 3UBMA 2PSHA 2V8OA 3ZDFA 3RHTA 2VF4X 3P9YA 4DXAA 1G20E 2H1OA 3OJ0A 1OWLA 3Q7SA 1U0TA 4B1FA 3BA1A 4GPEA 1SBTA 3LYLA 3H8SA 4EG6A 4ZKDA 4G0NA 1Y1QA 2OFFA 3KO8A 2J0SA 4GVXA 4H1TA 1XTQA 3O1JC 4EGQA 3L06A 2CDCA 3WFZA 1OTXA 2C7BA 4AIIA 2WSBA 2NU8B 3HZHA 1ESNA 2GYVA 1PJ8A 2BEJA 2JGMA 2OXRA 4RVNA 2J6CA 3BDVA 5C1BA 2PGDA 2XYHA 3DCYA 2CHQA 3FDJA 4P7KA 1YNSA 3TR0A 4Q05A 3M9XA 2O8BA 1Z28A 4CUKA 3LOQA 4FZ5A 4RKQA 5REQA 1BGVA 2HA5A 4W5HA 3WNCA 4JI2B 1V2GA 1K7EB 2NQ8A 1T4CB 4OSEA 2Z5VA 4UZFA 1PZMA 2FPIB 4K7JA 1C8BA 4E08A 4ZODA 5FBWB 4N5LA 4YT2A 2RHGB 3WWDA 3WGIA 2OG2A 4R40A 1E4EA 1GQFA 3KUXA 1OPXA 2Q5FA 3C74A 1OJ7A 4MJLA 5EIAA 2AFIA 1K9VF 2YZMA 3GH1A 2J9ZB 3B1WA 4RD4A 1KERA 5C31A 4H4DA 4BLSA 4BO0A 3KHKA 4UXIA 1KYIA 4QJ5A 5I9MA 1C1YA 5AW1A 2PHZA 4XM1A 1T8RA 4Z4QA 4CM3A 2V7GA 3GLKA 3IMFA 5ICGA 1ZVVA 2H4WA 4X45A 3VR1A 2DJ5A 2IODA 2PBLA 1TAUA 1G9XA 4IEFB 3F8WA 4CM4B 2FW8A 1W5FA 5BV2P 4TKMA 1U2SA 3OQ1A 1TEZA 2XYQA 2VUSA 4RJIA 2QU7A 2W2LA 3C5HA 3NATA 4NMWA 4TV9A 1WLYA 3ADPA 3QVVA 4JS0A 1BFKA 3P19A 1T1EA 2O1EA 3KHUA 1ZD9A 3NC0C 3SC3A 3CE9A 3FTEA 3QY0A 2WB2A 2QUBA 4UREA 3IIIA 1GYRA 1QFYA 3FMFA 3I6ZA 4IZIA 5LLSA 2CJYA 3LSYA 4W8OA 1R9MA 3ESDA 4DF3A 2ZJ4A 3R7WA 2O2HA 1LA2A 3OC0A 4II2A 1FK8A 3O31A 3SE0A 3JYOA 3VNQA 4CM5A 4HDKB 4YJGB 2W71A 2F00A 3JZDA 5JZSA 4OVKA 4EMUA 2AXEA 4FGUA 3RQSA 5JC1A 3ITNA 1L6IA 2FMXA 4JSTA 2FETA 4E2FA 1U8CB 3JQBA 4O4LB 3GFVA 2CE7A 3FIUA 2PJZA 5KYVA 2WY2D 3WLOA 2GZ1A 4BX2A 3LXMA 3WLHA 2AEMA 1G20B 2AR7A 4JI5B 1OH5A 1BMFA 2QRLA 2OLKA 4QL3A 1U9IA 1NX9A 1U0RA 4CXMA 1SD2A 2E89A 2JIOA 1G8AA 3H2KA 4V38A 2VN8A 4YRKA 2HEIA 4UHDA 4AZ0A 1AKTA 3FI0A 5AKHA 4ZJPA 4KQHA 1E79A 2O1SA 1L5OA 1P7ZA 1PTKA 2X4GA 4JEMA 4JYCA 5A71A 2FWIA 2FZVA 5K6AC 5BSEA 5JQGB 3KB1A 5JDIC 2FDRA 1SPBS 2NZXA 3ESRA 3U62A 4OGGA 2Y4NA 2CHFA 2NN3C 2I8CA 5EJAA 1L4NA 3R41A 3O8BA 3NETA 3R7FA 4BLUA 4I55B 1ONBA 3KYCA 3JSXA 3U7RA 2YXEA 3JARA 4Z9XA 4PXAA 3QG5A 4LGVA 4S0ZA 3JD3A 5K3AA 2ZKLA 4G07A 1D6NA 3RVNA 3CN7A 1ZMTA 3KZVA 3UB4A 2I4TA 2HIMA 2NSLA 1T3ZA 3BCUA 4CF5A 1E6WA 3E58A 1VHTA 2Q0SA 5AJWA 3AHCA 2ZYIA 4G0QA 2GN1A 4R2XA 4AMYA 5BPFA 3AR8A 5BXQC 3U4MA 3RT1A 3L1HA 4B3FX 4R2KA 1BSVA 3ZLBA 2BTQA 4UHCA 1Q1QA 2HRDA 4G1MB 4JGIA 3SYMA 4PN3A 2HWXA 5J5VA 4IMRA 1ISJA 3PC4A 5B57C 3EVZA 3TRIA 5IVPA 2SCUA 3TXAA 2HO5A 2IJGX 4MR7A 2IUYA 3WLSA 3GR6A 4D0GA 2WWHA 4D26A 5AOAA 2BBTA 3WLTA 2JATA 1E2BA 3E03A 3WDKA 3DMDA 4AP9A 4CKYA 3EPJA 5JJCA 1W5AA 4BPRA 5KX5A 1ZCZA 2OM2A 4FR5A 5TVGA 5JC8A 1VMEA 2CEKA 3B3FA 1WCIA 4BDSA 3ZDZB 1A4UA 1MPXA 4R1PA 3ZJ5A 3THXA 3IDSA 1X9HA 3D3WB 3C3KA 2NU7B 5M3BA 1Q1AA 4II7A 3DEKA 4MRPA 2I1LA 3TVYA 1A77A 3W5AA 4N39A 3SI7A 3PQ7A 4PF1A 3RGWS 1SCUB 4GYYA 4N4AA 3A3YA 5JCOA 2V6FA 1W87A 4OGKA 4XPIB 2Q1YA 3AX6A 4LZAA 2OFPA 2QEQA 4LXIA 4RKRA 5JO9A 1DAMA 4PZLA 2Y0DA 5KVQA 4YROA 4QREA 5ECDA 1J8DA 2BZGA 1GO2A 3I4FA 1DEOA 3Q9UA 3FRIA 5CK4A 4BDTA 4C0SA 4JGBA 4WZ6A 1TADA 5F7XA 3TYXA 2G0NA 5HTKA 4Z6KA 4L0MA 5AW5A 4OQNA 5T6MA 3IR7A 5IANA 2C84A 2R2AA 2Y0BA 3PCTA 5BRNA 4ZZ1A 4G01B 1A71A 1OZFA 3F3MA 3QKRA 1PHPA 4XRRA 3EXHB 2IQIA 1DQNA 4LDAA 4D3FA 1P5FA 3V80A 1MH9A 2VKQA 4LYJA 4XWTA 4DJ5X 1BO6A 2IDKA 4A3SA 1UJ6A 4URXR 3VHXA 4MUGA 2DQKA 1JR3E 2NZJA 4ND3A 4YBRA 4EM6A 3QEKA 1ZGAA 3AVXA 1LKZA 1JIXA 5LIPA 5CDHA 4IZHA 5ILQA 1ZCFA 3HU1A 1GA1A 3QVMA 2A1UB 2V7QD 3FPSA 2C03A 3CGWA 3ANYB 3DZHA 3OBIA 4ESEA 2V3CC 3ZVNA 2AT1A 2WA2A 2ACEA 3GT4A 4BO2A 2JFZA 3RROA 3ZE6A 4BIIA 3FTFA 3FIJA 4K28A 4XFKA 4OK3A 5KCMA 4FE4A 4PINA 4YC7A 4E07A 5I8WA 4ZOAA 2C3PA 1SELA 1RBYA 2A33A 4UD2A 2QIPA 4MUHA 5AW8A 3WGYA 2BFBB 4NZMA 2BHTA 5LB2A 5JFOA 2C88A 2GEDA 521PA 2EC5A 2P7HA 2WNSA 3KQSA 2UZIR 3LLCA 1QTNA 4R05A 3NONA 3SHFA 2EEZA 4O1MA 4DDWA 1VI5A 2FSIA 3H8JA 2QZSA 4NZ9A 1MN6A 1XJ5A 4LV6A 5JH7F 5DI9A 5JZ9A 1DXYA 4RV5A 3T12A 3W78A 4ZU3A 4BVEA 5ADHA 4DEXA 4EQ6B 4BX0A 2BVNA 3QEOA 4ITVA 3C45A 1LU9A 2C0PA 4RIHA 4UBOA 2X58A 2GD2A 3CN9A 3LY9A 4DCSA 4EKIA 2ICAA 4UCXA 1EMDA 1FVHA 3GAFA 1Z2AA 1DSSG 4OQ4A 2NSJA 1MB0A 3R24A 5AK6A 2I2DA 3ZD9A 1FDOA 1EVYA 1UBCA 4NFYA 1XX6A 4N0QA 4LHEA 4RJKA 1QGUB 2ZPTX 2I9KA 1ND5A 5DZSA 3TEMA 3CZAA 2DR2A 5EEHA 4EG1A 1ZM2A 2P2GA 2FFQA 1W76A 4YP0A 2FRDC 2JGEA 3ILVA 1OVGA 1D09A 1I6MA 5K99A 5BN1A 1DINA 1GZ3A 1QG6A 3MERA 5F3DA 2QJTA 4RKEA 2NVUB 1NOJA 2AEJA 4FGKA 2PT6A 2JRLA 1KTIA 1GGVA 3JQPA 3E9CA 2EJBA 5GADl 3LAWA 2IU6A 3B36A 3S2IA 2GLTA 3MJFA 3N3BC 3DVAB 5A3SA 3H65A 4WFIA 4ZK6A 1Y3BE 2PLAA 3IQZA 1NNLA 4OFBA 1T0BA 1TJ3A 2XA9A 2CXUA 2XF2A 3ZI0A 3AOEC 3HY3A 1J97A 4FWBA 4MDHA 3SYKA 1XDWA 5EZYB 2V5VA 3EGXA 4EMTA 2CXTA 1E5QA 3C0KA 1N0HA 2BR3A 2XAUA 3CT6A 4GGPA 4DQVA 2CMFA 2FG7C 4JLPA 1T25A 2V54A 3V3TA 2X8AA 5DBGA 1KH3A 4ER5A 1NPYA 1YJ5A 1DMRA 1GNTA 3GEDA 3WLFA 5BUSA 4UTRA 1E5DA 1GLNA 2IUFA 3G0OA 1AMNA 4R2LA 2IK8A 5TJ9A 3E5NA 4JR0A 3DZCA 4GKVA 5D1HA 2QTCA 1SXJD 3VC2A 4K9KA 1CY1A 5DYIA 3HCPA 5AVUA 3KQOA 2ENUA 4BV3A 3KALA 2DQYA 3HUEA 1OF1A 4D9EA 3L8FA 5KSOA 2LCFA 4IJ5A 1NSTA 4TTJA 1F12A 2W6ID 3WDMA 3P2YA 3HADA 3FPKA 4M22A 4WGGA 5LMUB 2V97A 5BNZA 5GIPE 3LXRA 1A5TA 3IHKA 3GJRA 1QZZA 4S0XA 1IM5A 3UAYA 4EARA 3H6GA 1PD0A 2OORA 2XGGA 1E9BA 2PO7A 5LD2B 2PUDA 1V4NA 1EUZA 2CMDA 1JILA 1YK0A 2CXPA 4LJ6A 4QQ8A 5F1YA 4KVFA 1DTEA 1LFDB 4HDRB 4X7BA 2GN8A 1I4TD 1NMYA 1UDRA 4HYYA 4NC9A 1WQ3A 1R0RE 4LMRA 3PHGA 1LV7A 5FBRB 4DLZA 1QJCA 3BFPA 3VH4A 5KTMA 2GWHA 2ZUDA 5KVCA 2PH5A 4ZPXA 1RABA 4PGHA 1YE3A 2Z6QA 2FPXA 4ZGGA 4W1PA 2F1KA 3O4GA 2PK3A 5DHSA 4CL0A 5A2GA 3FPAA 5EPOA 1E2KA 4IH9A 4HGPA 1FVXA 1PGQA 4P32A 4LYDA 3SBXA 4RQTA 1MQSA 2VYFA 3QBVA 4NG4A 3WGGA 3PA6A 1LDYA 3GJ0A 1VC2A 1ZD4A 4P7GA 4PIPA 4YFVA 3LT4A 3TAXA 1OZGA 1IUPA 1XMOB 1PF7E 1XXHA 3CQ9A 3NKFA 4UVGA 1FXUA 1ZGCA 2AX4A 3R5HA 3F6BX 4P92A 1FFSA 1VYHA 3QOFA 1DCKA 3O82A 5DH9A 1CZNA 1W0JD 3H9JA 3JWHA 2FUCA 4I9HA 5E8RA 4J6FA 5JSYA 5MF6A 1ZDMA 1AKRA 3BCSA 2VBCA 4BNVA 4KPUB 1ZI6A 4CIYA 4HQ6A 1ND6A 4W99A 4JLUA 3BF7A 3VJRA 1HEUA 4C7OA 3VKHA 1KY5A 1FSFA 3HCWA 2EJVA 4C4YA 5LOVF 3T4XA 1JVSA 2O1XA 1VMAA 3E2MA 1O96B 4JP8A 3NHRA 4PRLA 5L7TA 2DBVO 4JBLA 1MJNA 3JQAB 2F43A 2JJMA 4H9GA 5KWEA 2FPLA 1V26A 3RAPR 3L6BA 1JHMA 4Y1RB 3DOOA 1M1UA 4V0QA 5DFAA 3M5DA 1XZEA 1H0KA 3GGSA 2HA4A 4U7GA 4LC1A 3WIVA 3KNZA 4LJ7A 2DH5A 4L0DA 3VSDA 1WMSA 3NBYC 1UPAA 2D5CA 2Z98A 3C5VA 3TXXA 1IWPB 2J8ZA 5EY5B 1Z16A 2C31A 4JJEA 2I7VA 3LYHA 3TFOA 3QXXA 1RWWA 5H16A 1ADGA 5IT9A 2FNAA 4OREX 1CJKC 4Y1EA 1TFRA 2P9HA 2VDRB 2Z5LA 1OWNA 3PF8A 4KR3A 1BU5A 1Q84A 3OBBA 1DAKA 1J24A 4IQ0A 4R7TA 5FDFA 5LQJA 4LGYA 2PDAA 4QPZA 2VEDA 4L2IA 4QDTA 4DYVA 5IULC 1N2HA 1TT5A 3HYRA 4F1KA 2H5LA 3FOAA 2Q2OA 1KSGA 2NZUG 3SFTA 3W79A 1TVKA 3QNUA 2FX3A 1TU4A 2O20A 2RDMA 1T34A 2I4LA 4QATA 5HMMA 3INTA 2O2SA 2HXGA 2ZYUX 3O03A 3HVKA 2HLDA 2NUAA 4REOA 4W4TA 1U0BB 1UFQA 2F62A 3MLAA 4EW3A 2O2GA 1QWOA 3DLAA 3HV0A 4HEJA 4WXRA 1GGEA 2BKEA 2BKLA 1C41A 2D2XA 2LPMA 3DBLA 3NM5A 2VPIA 4IHAA 4MQMA 3TXYA 5JROA 2R79A 4RK1A 4B87A 2QR3A 3V8NA 2ZK7A 5BQPA 5KSYA 4YGXB 2CC2A 1XMVA 2HF9A 5A06A 1XCMA 3KR0A 4RQUA 4BUJA 4RV4A 3AERB 1V95A 4JP2A 1LF5A 5AW3A 4CKEA 1FMFA 4LKRA 4W8GA 3NHLA 5H8WA 1BJKA 2HKIA 2CFOA 1X8KA 2VJDA 5K3SA 1NPTO 2GR9A 3S7TA 1G5RA 4IH1A 1VBKA 3BAZA 5F2EA 4EY6A 5K0TA 4YT4A 5DMHA 3RLFA 4KYVA 3A14A 2CDRA 3RUHA 3HGMA 4J4BA 4LE1A 5AW2A 1C4XA 2ZB2A 3DNMA 1CBUA 3EDCA 3M1AA 2IPXA 4CLRA 5JFTA 5IM4F 2NV6A 2GVZC 4FVTA 2X22A 4IDEA 3GAAA 1BH6A 1EFUA 2PL3A 2O9JA 4ZOLB 5FWDA 1L5LA 4CODB 3Q7TA 1G2IA 1HT0A 4MS4B 3UT5A 4D98A 5BQXA 2JLXA 4OXNA 5B3JC 2DP4E 3L4BC 3RS5A 3FVVA 3QVWA 1N2SA 4IIXA 4JZKA 4WOPA 3EOZA 3ZY2A 4BFSA 3ZGLA 4QIHA 3PT9A 1PT5A 1IEQA 1PL7A 1ZONA 2BGLA 4QXPA 4Z2YA 5SZKB 1G8FA 3AMVA 3ZGXA 4D9CA 4WBNA 4WLEA 3RWMB 1EIZA 5JISA 4KZPA 1SD1A 4B3IA 1SQ0A 3DZIA 4ZTZB 4OH7A 1SR8A 1OA1A 4KGDA 1DS6A 4ONEA 4MGHA 4ACBA 4UAUA 4HVTA 1VA4A 1Z6TA 3CFYA 1DG9A 3ZV3A 1X87A 3RIGA 5LN1A 1SQ5A 1TO2E 4Q4AA 2EJCA 2Q3FA 2VFAA 2NP6A 1GSAA 3B1FA 2QJFA 5CYPA 3KCQA 3KRTA 1DAHA 1FTYA 1GRVA 3CX4A 1WCWA 4TTIA 1N2GA 1Z0DA 2HXYA 3DA8A 4RVUA 1NC3A 1XF9A 2ETXA 3D6VA 2XCRB 5L51A 4CI0B 1Y81A 2XITA 4GMGA 2M32A 5GV8A 5GAJA 1DT5A 3OLYA 1TU3A 2OC4A 1S4QA 2PX2A 4WDRA 1FPQA 1VCIA 3BXGA 4P4UA 2AN4A 3AR4A 2JEOA 1W88A 5CB0A 4U02A 2PN1A 3A27A 4MPRA 2JLCA 2RGGA 3KOXA 2YMLA 3KL2A 5G2OA 1P19A 2E49A 1I01A 2M6SA 2VDWB 4WV3A 4Q18A 2WV9A 2B21A 4Y2PA 4F6LA 1K8ZB 2WJ3A 1T15A 3GA0A 4RVOA 1MJGA 1D4OA 5HYVA 3S7ZA 4QPDA 2CKDA 5H0IA 3H5NA 5KYUA 1KETA 1A7UA 1J1UA 1RAFA 2O50A 3SVLA 2BZSA 4I5FA 3JV7A 3RKRA 3ANNA 2WP0A 1KFEB 2X8JA 2AE2A 3A1DA 4NHEA 3V5NA 1XDSA 3VKVA 1QJ4A 4BLTA 4BE4A 1JFVA 5EE9A 5INTA 4P0QB 2E3JA 1ABBA 4GRIA 2ETVA 4O02B 3QTLA 1CETA 1EUDA 1GTZA 2FG6C 3ONVA 1THZA 5BOSA 1FLVA 5JI2E 1XYYA 2ZIXB 3JRNA 1VJ1A 4QXOA 3V4PB 3WGHA 1Z7EA 1EFHA 2OUIA 2GD6A 1ES9A 4LXYA 5FJJA 3UY4A 2G72A 4MJ7A 4LF5B 4JQOA 4NYMR 1AS0A 5ARDA 3WA7A 2YW9A 3OO0A 2LZ0A 1D7AA 1NP6A 1UAGA 4ND8B 1FUUA 1YRQA 1W75A 1QTIA 3B70A 1EE1A 9LDTA 4FR2A 1KFBB 3SQOA 3ADCA 4B45A 1MFZA 3T61A 1PZXA 2JW5A 1HTWA 3JWIA 5KEIA 1QV9A 4JAVC 3CWZA 2AKEA 2JFOA 2J3JA 1THTA 1GAWA 3ENZA 4QDXA 2QL6A 3CLTD 1PJBA 2QTMA 1R00A 3ORFA 1OMOA 2QAGC 3GFQA 3MGKA 3OU6A 5EJGA 5A6VA 5GPBA 5CIYA 4BWYA 2RK3A 3BZWA 2IH5A 1TTQB 2RHJA 1E1YA 2RGUA 1SOVA 1V5EA 1KI6A 3ESYA 3HUDA 1PFQA 3RF6A 4RJ2A 2C7VA 1VG9B 1RRKA 2OCIA 2PQ0A 4DCMA 1OLUB 1BAPA 2GZHA 2IUSA 2XEXA 2XMZA 1HNZB 2VSXA 2AOTB 3HN6A 1I1HA 1IDOA 3K4PA 3KZMA 3BGOS 4NAUA 2YXPX 4CM8B 1Y3IA 3EZLA 4DDVA 4QGGA 1JZTA 2QAIA 4F5YA 1NVFA 1IZ7A 1HE4A 3GA7A 3LG2A 3P4XA 2HZ7A 1B8NA 4QYSA 4W5JA 1V7ZA 1OU4A 4Q66C 4FFBB 3FCEA 3BC1A 3WRXA 4X0EA 2QP9X 3NRCA 4L8FA 3W6NA 1J1ZA 2E82A 3AGQA 2FHPA 2C7GA 4M1KA 5HS6A 3GLIB 1BWPA 4B82A 1V48A 1X7YA 3NHYA 2R6FA 1EG7A 3CLRD 3LJKA 5KO2A 1FYDA 4YRLA 4NCIA 4D9BA 5AKIA 1H6DA 2J5XA 4QNRA 2BUAA 1A8PA 3BMOA 4OXKA 1AT1A 2L82A 5HVNA 3EWIA 3W8NA 3M6UA 4EG7A 1KMHA 1KVUA 3QWHA 4HBZA 3J7TA 3EIHA 1G66A 3CNEA 4DTIA 4OUDB 1GGNA 1I36A 4WY5A 5KUTA 2E5FA 3FDZA 2Z4TA 1OFUA 4ZWNA 3GFSA 3ZWQA 1P3Y1 2C5GA 2VHYA 1EX1A 4WL0A 3W4JA 4O63O 5B7QA 2XRFA 3T3NA 3H5IA 3G9UA 4P3OA 1U7UA 2NPFA 1J70A 1YI0A 3W8EA 3MIIA 3I1YA 3RG8A 5F21A 1TPZA 4B6SA 1TZBA 2QN7A 4U7WA 3MCVA 4RF5A 1JLHA 3PWZA 1ZL0A 2XA1A 2FPOA 4DSAA 1GNVA 4D3YA 1KE2A 5AW4A 1BA2A 3GEBA 3P32A 2VNJA 1ACJA 3ORRA 2A8YA 3RRNA 2DHCA 3UT6A 4EJFA 3THYA 1U0HC 2NYRA 5C18A 2BRUA 4P5PA 1GG2A 2BYTA 5H3CA 3ZU2A 3EX7C 5D7BA 1Y0BA 5HF6A 3AVVA 1RI2A 2QSUA 4XD7D 3CXUA 2JHFA 3T7JA 1ZBQA 1GUAA 2K5UA 2KSQA 4ZVSA 1L7VC 3RWBA 1BOOA 1UZNA 3RJ5A 1N7GA 1UBJS 3AIKA 3M6MD 4UNQA 3RADC 3M3DA 4P84A 1AHPA 1Z36A 2P0YA 1Z2OX 1XXLA 2PMEA 2IKSA 1LRLA 1GZVA 2B5OA 4CU5A 3QMMA 3DBRA 2I3GA 4X44A 4EUNA 3LPAA 1Z13A 3CR8A 2J7PA 1R8JA 4G5XA 3Q15C 1I0IA 5BV0A 2X2PA 3D6HA 2UUOA 4Y9SA 5I9TA 1FSGA 3WYGA 4EMBA 4FFDA 4RJTA 4YAUA 3K0KA 1V8ZA 3IO5A 3UGTA 3GJXC 3ISTA 4DLWA 5FEUA 4EQZA 3D8HA 2ZBQA 3A26A 3UV3A 3G0GA 4JB2A 3DO6A 2AJCA 2XVZA 4Z2AA 1LI5A 3K6KA 4IGFA 4BGUA 4CQLB 3EOAI 1T5HX 4GR9A 3LRTA 4UCWA 4WFJA 5K4AA 2I87A 2YOHA 1AKMA 2VRCA 1IQUA 1PJSA 3R7BA 3QLUC 4Q3EA 4UU7A 4IDPA 4CG1A 4DN6A 1PFWA 5IMBA 3PEFA 3GQBA 3U39A 5A6SA 5I4IA 1RYDA 1EP9A 1GPNA 2M6LA 5CLLA 3ZVRA 4HYEA 3H7IA 4CIVA 1HLGA 3ZD8A 6ADHA 1OW3B 3N9IA 5TQ0B 1QYIA 3KXPA 2ODBA 3IQFA 4BNTA 3U13A 1UKEA 1OWOA 1RRVA 5FBKA 2PM8A 1YNOA 4N5NA 3G9QA 1EWYA 3DEAA 5TMPA 3Q5EA 4R01A 4BO3A 1ZS9A 4LVNA 5EIHA 5BVHA 2WICA 3OZGA 3GNTA 4BV8A 1M0EA 3RSSA 4KJXA 5FWXB 3BL8A 4JEIA 1XWWA 3CLSC 4KXUA 3LOUA 3KP1A 4FLEA 4Z7QB 3VQTA 4BUZA 4MJXA 3WMRA 1D7OA 2ZVDA 2FDCA 1G21A 1T5IA 4BKMA 1ZGZA 1M2FA 2Y0CA 5A7GA 4JMPA 4BASA 4PNHA 2GTHA 1HKHA 1IZZA 4ZREA 5KNCH 2PUHA 2H31A 1YC2A 3VM6A 4EITA 4KSBA 3LKVA 1ID1A 5FAXA 1U0NA 1UMCA 5I7FA 4FN5A 4G4SP 3BL5A 3VNSA 1AUXA 3KEQA 1SHTX 1XTUA 1QF9A 1VHLA 1U8XX 2OXCA 3R3XA 5LQKA 3Q3GE 1O0BA 1U8TA 2L19A 3DBHB 5DI3B 4OQQA 3FFAA 1X6VA 1Y8RB 1MRSA 1TD9A 4HNHA 2W4MA 1T0PA 3KTAB 2JFXA 5KC9A 2JH3A 2OHGA 1B43A 1ECLA 2Q45A 3OCCA 1DQSA 1RZ3A 4TTVA 1L2TA 4WHMA 4LWPA 2COUA 3DZ8A 4I6GA 5EHZA 5KYNA 4JU8A 3OAAA 2VDVE 4FNMA 5K3OA 4H77A 2AD1A 4I1RA 5AXAA 3KJNA 2Z8XA 3QMPA 4M1ZA 1S1MA 4JFRA 3VI3B 1YOBA 2GESA 4J6EA 1CQXA 4MK4A 3SGLA 4OL9A 4IS2A 4HAUA 3LPCA 2B9EA 5FL3A 4WZAA 2SKCA 3MWDA 4Q9LA 4XYEA 4EI7A 5FA6A 4EG8A 4FYJA 1SXPA 3N8KA 2YWXA 1ZR4A 4B6QA 4ESHA 4C05A 2C07A 2GJ4A 3ANTA 1YMVA 3UHPA 1H93A 4FDMA 1Y6RA 4QHTA 4BPBA 3IAS6 1KYYA 4NEGA 1Z4MA 1GAJA 3WC4A 3MRXA 4BO8A 3BXEA 4NCHA 1H4SA 3GMIA 1V45E 4HNUA 5IW8A 2FQYA 1BVYF 2XQGA 3X3HA 4J0EA 4EY8A 3R9XA 4G24A 4YJKA 5LIRA 1ZJ6A 1HQYE 4IR7A 1KA9H 5DWDA 5EUMA 5F77A 4B6EA 3WQSB 4O3FA 3CRQA 1EQ2A 3QKIA 3HHEA 4MUKA 1W48A 3KSDO 3J7AC 4MPDA 1M54A 1TX4B 2XT6A 5ETJA 1UDCA 2L2QA 4ZGWA 1MGOA 2VF5X 4G8DA 5F35A 3H5VA 2H51A 1QV6A 1H8EA 2IQ5A 2ZTLA 3CLVA 1YOVB 3QKUA 4GGOA 4KYIB 4PTLA 3TI9A 5HS4A 5LA6B 3QK7A 1OZAA 4B32A 3IKJA 2PH7A 2YFKA 1HOTA 2YV5A 1CUYA 5CB4F 3ZD6A 1DO8A 3FNEA 2JVKA 2O2EA 3BXHA 4O2BA 5EHIA 3ZHCA 1GZUA 3TL3A 4WTOA 1FJ2A 1TDJA 1W1UA 1XIVA 2VDNB 2Y77A 4I36A 5TSDA 3FTNA 3LMKA 5ALMA 2QG9A 4PR0A 4B3DA 4BFYA 3K5HA 1TW3A 3EH2A 2V7BA 4HB2A 3IOBA 4DC1A 3L7KA 1AKQA 2WTNA 1NOKA 4DABA 4TVKA 4LRWA 1I6LA 1M6HA 3SY8A 4E5KA 3WHLA 3PQ6A 5KINB 4DAOA 3U3JA 1CR6A 1DKOA 1SBCA 1XO1A 1ZFNA 5TQVA 3HDGA 4IVQA 2UVQA 2DBYA 3VC3A 1M5RA 2XY4A 1EZZA 4TZ6A 2AXQA 3PU6A 5DTMA 2NU6A 3NHSA 4PLVA 1M75A 4ZI3A 4HUQB 1SXJE 3P71T 1Y7PA 3KETA 4MUMA 1X74A 5E9WA 1OC2A 1ZXXA 2H63A 3MLBA 4PR3A 3U4HA 3SYRA 3GDHA 1IMJA 4HLUC 4JX9A 5G41A 4IPTA 2D2FA 2I78A 4TV8A 4YMVA 2JI7A 2WWFA 1UK6A 4QYTA 2C8VA 1S9DA 3N2EA 1PFVA 5CG2A 2C4UA 3G79A 2DG2A 3OHMA 4O4HA 1YUBA 3ZXSA 5JHGB 4URYR 5HKAA 1EBFA 1GPDG 3ASUA 4QUIA 3IE2A 3S2SA 1G6KA 1CG6A 2V0CA 3FPEA 2ZSFA 3WLKX 3EXEA 4TQUS 4DCCA 1M6YA 1P2TA 4LRQA 3I52A 3UAZA 1SHKA 4I9UA 3PCXA 1NI4B 2R48A 3DH0A 3O4JA 4I7EA 3RRMA 1M0TA 3CZ4A 1E3LA 5E1OA 3ZWMA 4GLLA 1ID8A 2ZWPA 2VNHA 4RVDA 4TLEA 1R0YA 3CVXA 3AG5A 5BSTA 1NSFA 1RIFA 3IQEA 2R2GA 3BRWD 3LHFA 3PVSA 3I42A 1XHLA 2HQBA 3CNLA 3R0XA 4S1NA 3UMFA 4N12A 4C4PA 1U8UA 3EOBI 3PEUA 4IXNA 5KB3A 3HJFA 2HPAA 4Y2UA 5JCXA 4PCVA 1PQ4A 1NQVA 4MI1A 1MIOB 4OUKX 4GNKA 1SVMA 1YFJA 1JX6A 1BZYA 3QU7A 4Q3CA 4BO9A 2WTAA 4M0PA 1J8MF 1FFCA 2GASA 1CNMA 1ZGJA 5KQGA 4WUTA 2AG1A 2O05A 2OHJA 2WSMA 3BSYA 4F2GA 4GOKA 1V1MB 2IP1A 2QDXA 2AMVA 3OP1A 1DELA 4RF4A 1AO0A 3TIIA 4BQNA 4FYHA 4CLEA 3QKSA 3QFTA 4GYKA 3NBXX 1BN7A 5H4HA 3V3KA 3MCUA 4D44A 5KKNB 3W1EA 2VJMB 4RZ3A 3STWA 1CZHA 4BS9A 4DFDA 2C7RA 4HJXA 4KXLA 3EIEA 3TPCA 5HKKA 3K09A 2H6EA 4LYGA 1AU9A 2IYSA 3EK2A 3OLWA 1G5QA 2FPIA 1IUNA 3RFTA 3IAM1 4MSUA 4CYMA 2XXJA 3JYQA 3UPUA 4IFIA 4G5QA 3V8MA 3BXPA 1MHPA 3NOQA 2UKDA 1Y3HA 2XA2A 1EXNA 2Z57A 4BAGA 5CNKA 3O9ZA 2CY0A 1W94A 4JI6B 3VYSB 1RHJA 2OCLA 3STXA 4P7JA 2YVKA 3RJMA 3DLBA 3JZMA 4RXUA 1X15A 2Q2NA 3RRJA 2PXXA 3CZPA 5M34A 3VHQA 1S3FA 1P2UA 1XAGA 3C70A 3N2KB 4J0IA 4FD3A 3EHDA 4NOKA 2YWJA 4DR3B 5DP2A 1DT3A 1NNEA 3IRUA 3PIRA 3QIAA 2Y99A 4DLVA 5IJ9A 5ICFA 4CM4A 2IXFA 2W2MA 2O2ZA 3AILA 3PI6A 4UEOA 2HF8A 2ZBDA 4V1CI 4KACA 2PT9A 4HQNA 2D7DA 1V5FA 3E22B 5IWCA 3H86A 1FNSA 1DKMA 2FN3A 4N5MA 4OMDA 4IG4A 4JY7A 1USWA 5EHNA 1SRRA 3M5CA 1LX7A 5AI8A 4G5RA 4EGSA 4IM7A 1I3CA 3HJAA 3NYIA 3BJEA 1JDUA 4E5MA 1RLTA 4KITB 4UNNA 2XECA 5JBNA 1FFYA 3CUUA 5EZQA 3V4VB 3C3DA 1T5SA 1QGAA 4C06A 3HP4A 4R2HA 1U8YA 2ON6A 3FAKA 4FFWA 2HR1A 3AP1A 2ZZMA 3OCYA 4PX3A 2C5EA 4U2KA 2O8DA 3I5UA 3NPAA 4DANA 1PP4A 1BWSA 5LZ2A 3FTQA 3VR2A 1TMOA 3I9V6 4ZCSA 1R18A 2LIPA 3H8VA 4C1BA 3B78A 3GLFE 1VLJA 2JJ8A 4AMVA 2AQKA 4RVHA 3NXSA 1R6XA 2J5RA 4C7KA 4A6PA 3Q72A 2FEAA 4OBWA 2QGNA 4NLLA 4UOZA 5ES4B 1RPNA 3W1WA 4AJPA 3EGDB 3TSCA 2J9FB 4KQWA 3VR3A 3H05A 1S4MA 3EW7A 1TCUA 4XVRA 3L9XA 2MINB 3H0CA 4AZWA 1CD5A 2PVCA 3SCZA 1T1RA 1JTVA 2B7CA 4BZXA 2FDXA 3B2QA 3DO8A 4MEJA 5A3VA 5CFMA 6YASA 1JNYA 5JAIA 3VNBA 4KFRA 3EVNA 1TI7A 1PEAA 5C32A 5J4HA 1A8IA 4DR6B 4C0JA 3ZKWA 4KBFA 1LK5A 1XPJA 4MW5A 4NU6A 4E6PA 2ZSBA 2IUUA 3LX4A 3HXTA 2I2AA 2VUIB 4NMLA 5T57A 5T5QA 1OIWA 2A9RA 4I55A 3AEUB 4E4YA 3TWOA 2PT5A 4RELA 1TM1E 4DA7A 4E5PA 1CQJB 5LQDA 1PU2A 3WGZA 3ZNNA 5LWHA 4FN4A 3KZKA 4CVNA 2OL4A 1F0PA 1SG9A 4N8DA 1QOZA 1PV1A 1V8BA 2P5YA 4FFVA 3T7EA 4G1EB 1G1MA 4C0QC 5A4AA 4XQEA 1GTSA 4G9GA 2JFQA 1BX0A 5HG0A 1OFVA 3AJRA 1IEXA 1XLVA 2P9YA 3FUCA 3RRZA 3HJGA