3HD7A

Helical extension of the neuronal snare complex into the membrane, spacegroup c 1 2 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
GSHMRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 2
publication title Helical extension of the neuronal SNARE complex into the membrane
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 36
structure length 91
sequence length 91
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3hd7A00
1HVVA 1N7SD 3RK2C 3B5NB 3M0DC 4WY4B 1GL2A 1NHLA 2H8PD 1KILA 1URQC 1L4AC 3B5NA 4LGDE 5KJ7A 3RK2D 2N1TA 2NPSD 3RL0C 1JTHB 1SFCB 5CCGA 1N7SB 1SFCD 2HG5D 1URQD 1KILC 1T3JA 4OH8B 5CCHD 1XTGB 3HD7B 3PP5A 3RK3C 3HD7D 1JTHA 2YMYA 1N7SA 2N1TC 2XDJA 3RL0D 4WY4A 3RK2B 5CCGC 2NPSB 3TSIA 1GL2C 1URQB 3RK3D 1L4AD 3HTKB 3KYQA 2NPSA 3B5NC 4W7YA 5CCGD 4WY4C 5KJ7C 1SFCA 3RL0B 1URQA 1GL2D 5CCHA 1KILD 4W80A 3HD7A 4JF7A 3B5ND 3RK3B 4WY4D 2HFED 4N78E 2NPSC 3P8CE 1L4AB 5KJ7D 4W7ZA 3VOPA 2N1TB 2M8RA 2N1TD 1SFCC 1N7SC 2KOGA 5CCHC 2WZ7A 1L4AA 1GL2B 3HD7C 2PP6A 1KILB
chains in the Genus database with same CATH superfamily
3L70G 2H43A 2WPVB 4HB1A 2O01J 5KLVE 1KC8Q 3H1KG 4L74A 5AVYB 1P84D 1NOHA 3CI9A 3OJAB 4EOTA 3U59A 3CPWO 5KJ7A 2OYOA 4EYYQ 3VYIA 2D2CB 2BCCD 3KXDA 3D71A 5CCHD 3IR9A 3L70E 1VQ4P 1SQQD 1OVUA 2IZ0A 1Q82Q 5KKZC 1GW4A 1L0NK 2QJPB 3AE3C 5AVZB 1MKMA 3RK3D 3BRVB 4IFMA 3KYQA 2A45I 1M57D 3ZDMA 5KJ7C 1DIPA 1NTKD 2YKOA 2JJLA 1QLED 4PJ0H 2FFDC 3RGUA 1EDJA 3BVHA 3EFGA 4RKUJ 2HPCA 2AEJA 1MFZA 2E76C 3P8CE 1FOSE 1KQFB 1PPJE 3L71G 1ZLLA 1S72P 4YPCA 1SQPG 4C46A 1M8OB 3H1LJ 2FYZA 1BE3D 3HD7C 2AEMA 3OW2O 3BASA 1KB9D 4GODA 2FYUD 3Q5PA 1ZN5A 1N7SD 3L36A 1U7JA 3H1JG 3A0HH 1BGYJ 2OYIB 4LGDE 4L75A 3L71E 5H2FE 3GF7A 1U57A 2KS1B 4XE5B 4D6TJ 2HODA 5GTHE 5AVSB 3A5TA 5AW8B 5AW0B 2YMYA 5AVUB 3M0AA 4IFDK 1WT6A 3RK2B 1YIJP 1VQLP 1VL2A 2R32A 3TGUJ 3TDKA 2ZVNB 3WU2E 2XKMA 1L4AD 2G3AA 1T8ZA 2M5AB 3JSVC 5B5EH 1S1CX 5KLIC 3SSUA 4I7ZC 2OYHB 4I6MC 2YO3A 1L0NG 2WVRA 4H0LB 4A7PA 3AE1C 3TNUA 1M90Q 3M06A 4LC1A 1YQ3C 3FX0A 4GOFA 1RY3A 3L70J 1MUUA 5K5GB 1LTIC 1H8AA 1X22A 4JYBA 5APUA 1NAFA 3H1KJ 1J1DC 3GLMA 3M0DC 2CK3H 1UIIA 2ITAA 5L8RJ 3MP7B 1LTTC 5AVQB 2WITA 3LW5H 1RE4A 1FC2C 3EFFK 5AW6B 1OMIA 3AE2C 1XTGB 1YQ4C 1QL2A 3RL0D 2KUBA 1OW6A 1G1JA 3GHGA 3PJSK 2NPSB 2Z4EA 1DH3A 2E75D 1PL5A 4RESB 2WSEJ 1URQB 3II6A 4OWFA 3RL0g 2KI7B 1NTME 1KMIZ 1EDIA 2C9NY 1MV8A 1ZOYC 4R4LA 1RE4C 4H44D 1KORA 1JMMA 3V2PA 1WRGA 3L71J 1M7LA 1MFTA 2Q1KA 3SWKA 3CX5E 1N8RQ 1SQPJ 3Q3DA 2WQYC 3AEDC 2D2CC 3RBZA 2KOGA 1ZXGA 1NGMB 4UB8H 5CCHC 1S2EA 2Z5IA 1ZP0C 1DD4A 3VN0A 2QJKC 4TT3H 1OX3A 1W2EA 1VPCA 4U3FG 1IJDB 4K3AA 3L74D 1NTZK 1S9KD 2Y9ZA 3VTPC 2W27A 1L0LE 2IBZG 5AVTB 2OYIA 1K04A 2AXTE 2N9YB 4MN4C 4JYCA 3C9IA 1HGVA 1JY3N 2KS1A 3L73D 1USEA 5CCGC 4ZMDA 1LJ2A 2E76B 1DD3A 1R8EA 2V4HA 3ITKA 1EZVE 3V5BA 1S5LH 2W6JH 3L75D 3AE5C 3CCVP 2J58A 2O01N 3P7KA 4R4MA 3G4SP 5KLVK 2JWDA 1KB9I 2Q5UA 3BCCG 3VMAA 1GDTA 2KLUA 2OYHA 2OQQA 5APXA 1SQXE 1KQGB 2LKMA 1EXIA 4GDOA 2H7HA 3M9BA 1GL2B 3HE4A 1VQ8P 1KTMA 1VQ9P 3RK2C 2LXCB 2IFMA 1EC5A 2E42A 1T2KD 3B71A 3CMEP 1L4AC 1T3UA 2OGUA 3BCCE 3PRJA 1NTMJ 3OA7A 4Y28J 1LTSC 5AW9B 2FBWC 3PTZA 4HJGH 1R5SA 3AE6C 2OYHC 3H1LG 4NPEA 1QEXA 1W5CE 1IFMA 3E7KA 4H0LC 2H89C 3CCLP 2A06D 1KD1Q 1NTZG 3CCSP 1KFMA 5B66E 5CBOA 2B87B 1BGYG 1N7LA 1P84E 1PGQA 2JO1A 5KAFE 2I8DA 1SQBD 3CWBD 2ZVOB 5TISH 3MUDC 1PGPA 3HE5A 3HTKB 4OGQD 5CBNA 5M1BA 2NPSA 2HR3A 4KT0J 1URQA 2KYVA 2W6AA 4BRYB 4UB6H 3S1KA 2N9BA 1J1DB 3B4SA 5CJ0A 3L35A 2W83C 1KILD 1JCCA 1CZQA 1FDOA 1SP4A 1DX7A 1L0LJ 2E5YA 4LLHA 3SWYA 3MGNA 1IFIA 2BASA 1OXZA 2QEXP 1IC2A 2H88C 1KN7A 4O9BA 5GTIH 3M91A 4U3FJ 2JR8A 3O6QA 4DT0A 5KLVG 1NTKE 4WY4B 2E75C 1HTLC 2H8PD 1URQC 1EDKA 2O1JA 4HH2A 1FAVA 1ZMEC 1LTAC 2L5GB 5BU5A 1VDFA 1IFJA 1RQUA 4N6JA 4ZKPA 1BE3E 1Y8AA 2FYUE 1JB0J 3CLQA 2XNDH 4C7NB 1SQXJ 2IPPA 3CCRP 4GIFA 2FFDA 3WUVA 3D6YA 1ZR2A 1LGHB 3A0BH 2E74D 3AEEC 2M3EA 3I5CA 2WSSH 3L4FA 3BCCJ 2FYNC 2QJKB 1FZEA 1RQVA 2J59M 1NAYA 3HD7A 1KQSO 2VRSA 1NKNA 4DCKA 1PPJG 4JF7A 3RK3B 3V6IA 1X8YA 1LWUC 3VOPA 1NU1G 4DOJA 2WT7B 2MJZA 3LIDA 1KYOH 2P67A 1FZBA 3E1RA 1VQ5P 1HVVA 1K73Q 1LNQA 1GW3A 2KXPB 1GL2A 1NHLA 3L72D 1YJWP 4HYTB 4D6TD 1M1JB 2YO2A 1EQ7A 3PLNA 2Y0EA 1NU1E 2R44A 3H1HD 1Q90D 4CPGA 1NTMK 1KYOI 2JWAA 1JTHB 3U1AA 1N7SB 1JUNA 1A02J 1DEBA 3TGUD 3Q5SA 1NTZJ 2ZT9D 1RF0C 2QIWA 3KZIE 2E43A 2QRXA 3MHVA 1LTGC 1IFDA 4WB4A 2K3RA 1ZRTD 1H88A 1YJ9P 4N78D 1RF1C 2Z5HA 2K9JB 2KB7P 2PAJA 4IL6H 2ZYGA 3TSIA 5BVZA 2W8ZA 1GL2C 1CI6B 3H1IG 3WMM0 1GMJA 2K9YA 4Y99B 1T2KC 1BCCD 1YHQP 2JDIH 3AE9C 2WWWA 1XTCC 4Z1MH 2KNCA 3L70D 5AW3B 3V2RA 5APQA 2R3CA 3B5ND 3H1KD 1L4AB 1TU3F 2N1TB 1E5WA 2N1TD 1BE3J 3M0DA 3VMZA 1KFNA 1YYCA 2QSIA 1GTWA 1L0LK 5KLVJ 2FYUJ 3H1IE 3HRNA 1PGOA 2PP6A 1HUCA 2Q6QA 3NTNA 5E79H 2A45G 1SS1A 3IN6A 1BDCA 1W2BO 3GW6A 4K35A 3TK1A 3P8CD 3H32A 2YNYA 1SFCB 2RMZA 2BEZF 1SFCD 3W67A 4IOIH 1LT9C 1KILC 2O01H 3E1IA 2Y0CA 3VP8A 3CXHH 2XDJA 3CC7P 2GUSA 4ASVA 2WSCJ 1NTMG 2IBZI 1SQXK 4C7NA 2QJYB 3L71D 3VP9A 2PGDA 1SQPD 4WY4C 2W90A 4RO0A 3RL0B 1UIXA 1LTJB 1PP9G 4OVNF 1QL1A 3BATA 1VQKP 5CCHA 5APTA 1NU1J 2IZ1A 2E75B 1SQVE 3CXHI 3GMAA 3OAKA 4QMAA 2FXOA 3H1JD 2QM7A 3L73E 3CC4P 4PJ0E 2PRRA 2KP8A 4KHXA 1FDMA 1EDLA 5KAIE 2AXCA 4H44B 2NRGA 1GZLA 4ZNCA 2WT7A 3MD0A 1X0TA 5DJUB 1PP9E 3C1LA 1CSBA 1JY2N 5B66H 3CMAP 1IK9A 3T97B 1M56D 2R5BA 1L0LG 4ZKUA 1M1KQ 3A0HE 1M1JA 3SFEC 1HWTC 3BRTB 5CCGA 1G2CB 4YXWH 4OH8B 1VQOP 3S9OA 2XU6A 3H6PA 1AFOA 3RK3C 1JTHA 1OVRA 2FYNB 2ZFCA 5AVRB 3FWLA 1N7SA 2CPBA 1GK6A 1EZVG 1FZAA 4PD4H 1L0ND 3H1IJ 1LWUB 3EQ2A 3MIWA 4EI2A 2Y0DA 1AVOA 2QVAA 2R5DA 1NH4A 1CI6A 1NTKK 1N73B 3G71P 1KYOD 1M1JC 2QG4A 2A06E 4I2LC 4PV1B 5AVWB 5B5EE 4PV1D 5KJ7D 3TYYA 1SQXG 3N7NA 1J1EB 1SQBE 3CWBE 2Y9YA 1N7SC 4GKGA 4PD4I 2XNXA 2ZT9C 2POHA 1L4AA 4BXLA 2M5AA 2FYUK 3PH0A 1OW7A 1ZW0A 1E79H 3G6EP 3AEAC 1KV4A 5APYA 2OARA 1KILE 3M9QA 3A7OA 1AQ5A 1RF1B 3JC22 1VF5D 1NKZB 3MTUE 1AA0A 2AEFA 3I56P 3CC2P 4IFFA 4Y99C 3TF5A 3QH9A 2WPSA 1NO4A 3CCEP 1SQVJ 3AE7C 3V2NA 2W6BA 3VMYA 3MUDA 2KLVA 3L73J 1FJPA 1IK7A 2WSFJ 2N1TC 2GUVA 1RE3C 1Y9BA 3G3ZA 2IDBA 3RBXA 2WSCH 3U1CA 1JCDA 2BCCG 3Q1MA 1PP9J 2IX7C 3HUSC 2ZJSE 3F89A 2HLOA 1Z56A 1SQQG 2Q3EA 2ZYAA 4EDFA 4YTPC 2HFED 1LTJA 4L76A 1NU1K 1U7MA 2JP3A 2WSEH 4U3FD 2O3JA 4OGQB 1AJYA 1SFCC 1NVOA 2P10A 2E5TA 2BCCE 2YIUB 3V4QA 2P1JA 1NTKG 2K37A 4B86A 3D6ZA 1LT9B 2IBZD 1KILB 4C7RA 1OIPA 1SQQE 3G9RA 3IAOA 1RH5B 5H2FH 4UB8E 4GOEA 1KZUB 3ABVC 2Q7CA 2KSJA 3RK3E 5GTHH 3VMXA 2QJYC 4WBAA 1N86A 1BE3G 3CXHD 1ZV8A 1JO5A 3RL0C 4AYCA 1LTJC 1IZNB 2FYUG 2KZIA 3MZWB 3WU2H 1SQBJ 1VQNP 2QE7H 2GA1A 3L72E 3TNUB 2ZXEB 3BCCD 3H1HE 4H44C 3KPEA 2NZ2A 3M9HA 1KB9E 1Q2NA 5DJTB 4DJGA 1Q7YQ 2C0XA 1LWUA 3TGUE 2L91A 2IYPA 1S5LE 2GM4A 5C39A 1FZCC 1ZRTE 1N73A 4N78E 1PV3A 5CMZA 3UIAA 4W7ZA 1OZHA 2E74B 2IYOA 3AEBC 1FDIA 1QVFO 1Q86Q 1VQ6P 2A45H 3LW5J 1BCCE 3H25A 3H1LD 2LXBA 5CJ4A 2D2CD 1YBKA 3GHGB 3L37A 1JY3P 1QVGO 3SFDC 3H1KE 1LP1B 1NTZD 1RF0A 2MKVA 3GG2A 1BGYD 5AW2B 1N73C 1RF1A 1HJBA 2HG5D 4PD4D 1JY3O 1FE6A 1JOCA 5CHXA 4PV1C 1VQ7P 3JCUE 2WTYA 1SQVK 1T6AA 2WSFH 1J1EC 1GU5A 2BCCJ 5AVVB 4H13B 3KQGA 4H13D 2JEEA 5KAIH 3GF3A 1SQQJ 3WUUA 2ZT9B 1Q81Q 1K9MQ 3CX5H 4W7YA 2RKLA 5CCGD 4RJTA 2I1JA 1H0TB 1QX8A 5TISE 1VF5C 5KLVD 1S5LX 2KZJA 1AVYA 4U7JA 5APVA 4TLFA 1OW8A 1NTKJ 4UB6E 2B87A 1YI2P 4YXDC 4N3YB 2RN0A 1SQPE 3HTKA 2OTLP 3SWFA 3CX5I 2XZRA 3L72J 2UWJE 1FBMA 1D7MA 3B5NB 2B89A 2QA4P 4BRYA 4DZOA 5KTBA 2V7QJ 3H1HJ 5GTIE 1LT9A 2HYNA 1HBWA 1KILA 2AXTH 3H1JE 3IF4A 4ASWA 1HF9A 3RK2D 2Q3IA 3HUSB 4EIJA 4M3LA 1VQPP 3L74G 4OGQC 3A2AA 4WY4A 4JPZB 1SQBK 2YIUC 2K1AA 3AE4C 1PPJD 3KDPB 1SLQA 1NU1D 4H0LD 1BCCJ 3HE4B 1G1IA 1BSNA 1VQMP 1YTZT 2OTKE 1PGJA 3CCQP 1SQVG 4NPDA 3L73G 1HJ0A 3L74E 3A0BE 2BEQD 1EZVI 3FWNA 1S9KE 1Y47A 1YJNP 3PHLA 2WMMA 1S4XA 1QGKB 1L0NE 3L75G 3NMDA 1YTZI 2RH0A 2FY8A 2B88A 1A02F 3N4XA 3AECC 1BDDA 5BU8B 2QM8A 1KYOE 4AQRD 2WPQA 4HKZH 1OVVA 4XFJA 4L73A 1PIXA 3HE5B 3L75E 1PZQA 2NPSD 1MZ9A 1LP1A 1URQD 3W68A 1P84H 5KAFH 3H1ID 1RHZB 3I55P 1FZCB 2YXQB 2E74C 2FXPA 1FZGA 2DW3A 5EFWB 3V2QA 1IO4A 1S3JA 2C0WA 1SVFA 3CL3D 5TJHA 3O6QB 4NPFX 1L2PA 1OWAA 3GHGC 1SQQK 4IL6E 2LR2A 3FXDA 1P84I 2A06G 3H1JJ 2OTJP 1SQBG 1FJKA 3O8ZA 3CWBG 2I1KA 1H0TA 3R4YA 2YMKA 2QJPC 3NFQA 2M8RA 1JNMA 5KKZB 2K9JA 1J2JB 2P58A 3C8VA 2O1KA 1PFIA 3F5HA 2WZ7A 2FXMA 4BWNA 4WWIA 5AVXB 3KHUA 2K88A 2ZXXA 3AEFC 3P32A 4H13C 4XA4A 2V7QH 1FU1A 1LTBC 1GK4A 2FFDB 1SQVD 4U3FE 1KB9H 1AV1A 3B5NA 2IFNA 5E79E 3AE8C 2N1TA 1CW5A 1FOSF 1RE3A 2E76D 1NTMD 1AQTA 2FKWB 3L74J 1T3JA 2Q9IA 2IBZE 1GU4A 1FZFA 3HD7B 3PP5A 3HD7D 1VF5B 3HUSA 1L0NJ 1DEEG 1PP9D 3CX5D 4KJMA 3CCMP 2ZYDA 2OYIC 3Q2YA 3CXHE 1K05A 3D70A 1ZR4A 5AW4B 3B5NC 1KQLA 1LT1A 1GD2E 2XV5A 1SFCA 4JQ0D 2HPCB 3Q5RA 1GL2D 1X79B 4IL6X 2KSEA 3L75J 1FS0E 4GT1A 5AW7B 3LIEA 2ZAEB 3NXSA 4I1LA 1YITP 2YKPA 3WUTA 1L0LD 4WVZA 3JCUH 2M0BA 3P8MC 2B9BA 2P7JA 3CCUP 2CPSA 1H89A 3FXEA 1JMBA 5KLIB 2KK7A 4I7ZB 2HODB 2G8YA 1OFCX 4AUWA 1EZVD 2SPZA 3KZIH 1NWQA 1HGZA 2YKQA 2J5UA 2C9LY 1JM0A 1IFPA 1USDA 3S4RA 3USSA 3CCJP 1K8AQ 1BSHA 2KNCB 3A3YB 2PFXA 3H1LE 3L72G 3AEGC 2M3BA 4D6TG 2JKVA 3IFMA 1JEKA 3H1HG 5APWA 1X9VA 1NJIQ 1NTZE 3T97A 2WPRA 1WMKA 1FZCA 2R3SA 1BGYE 1SQXD 3QWOC 3TGUG 4JBZA 5AW1B 1SQPK 5APSA 2KIKA 3K5BA 4PD4E 1G2CA 3CWBJ 4D6TE 1EXJA 4W80A 5AW5B 2P2UA 1JY2P 1HH0A 4WY4D 2NPSC 3H32B 1R5LA 1N2DC 3V4WA 3B8EB 1NYHA 3FGAD 3R2PA 1BCCG 3CD6P 2YXRB 3EWKA 1IFNA 1JY2O
chains in the Genus database with same CATH topology
2H43A 1CSBA 1JY2N 3RK2C 1FBMA 3B5NB 2IFMA 4DZOA 5KTBA 1T2KD 2E42A 1IK9A 1LT9A 2HYNA 1HBWA 1KILA 5AVYB 1L4AC 1NOHA 1T3UA 2R5BA 3CI9A 3OJAB 4EOTA 3OA7A 4ZKUA 1LTSC 5AW9B 3U59A 5KJ7A 3RK2D 2Q3IA 1M1JA 1HWTC 3BRTB 5CCGA 1G2CB 3HUSB 3VYIA 2OYHC 4EIJA 4OH8B 1IFMA 4M3LA 5CCHD 3IR9A 2XU6A 3H6PA 1AFOA 3RK3C 1JTHA 2ZFCA 5AVRB 1N7SA 3A2AA 4WY4A 2CPBA 1GW4A 1KFMA 1GK6A 1N7LA 1FZAA 1L0NK 1SQBK 1LWUB 3EQ2A 5AVZB 3MIWA 3KDPB 1SLQA 3RK3D 3BRVB 3HE5A 3HE4B 3HTKB 3KYQA 4IFMA 2A45I 1G1IA 2NPSA 2R5DA 5KJ7C 1YTZT 1NH4A 1CI6A 1NTKK 1N73B 2YKOA 1URQA 2JJLA 2KYVA 2W6AA 1M1JC 2N9BA 2FFDC 1J1DB 5CJ0A 3L35A 1KILD 1JCCA 3BVHA 1CZQA 4I2LC 1S9KE 3EFGA 2HPCA 5AVWB 1SP4A 1DX7A 1MFZA 3P8CE 1FOSE 5KJ7D 3TYYA 4LLHA 3SWYA 3N7NA 1J1EB 3MGNA 3NMDA 1IFIA 2BASA 1N7SC 4GKGA 1YTZI 1ZLLA 2XNXA 1OXZA 1IC2A 4C46A 1A02F 3N4XA 2POHA 2FYZA 4O9BA 1L4AA 3HD7C 3M91A 3BASA 5BU8B 2QM8A 2FYUK 1ZN5A 1N7SD 3L36A 4AQRD 4WY4B 5APYA 1HTLC 2OARA 2WPQA 2H8PD 3M9QA 3A7OA 1URQC 1AQ5A 1RF1B 2O1JA 4HH2A 1NKZB 3MTUE 2OYIB 1FAVA 3HE5B 4LGDE 1LTAC 2L5GB 5BU5A 1VDFA 1IFJA 4N6JA 4IFFA 4Y99C 2NPSD 4XE5B 1MZ9A 4ZKPA 2HODA 2WPSA 1URQD 1NO4A 5AVSB 3V2NA 3A5TA 2W6BA 3VMYA 5AW8B 3MUDA 2KLVA 3CLQA 1FJPA 5AW0B 2YMYA 5AVUB 2N1TC 3M0AA 1FZCB 4IFDK 2GUVA 1WT6A 1RE3C 4C7NB 3RK2B 1FZGA 3G3ZA 2R32A 2IPPA 3V2QA 2WSCH 1IO4A 4GIFA 2FFDA 2C0WA 1ZR2A 3U1CA 1JCDA 1SVFA 2XKMA 1L4AD 3CL3D 1LGHB 2IX7C 3HUSC 1T8ZA 1OWAA 3GHGC 2HLOA 1SQQK 1Z56A 3I5CA 3L4FA 2OYHB 1FZEA 4I6MC 2J59M 2YO3A 3HD7A 2VRSA 1FJKA 1NKNA 3O8ZA 2I1KA 4JF7A 3RK3B 2HFED 1LTJA 1NU1K 1X8YA 2WSEH 1LWUC 3VOPA 4DOJA 3NFQA 2M8RA 3TNUA 1JNMA 2WT7B 2MJZA 1SFCC 3LIDA 3M06A 1J2JB 4LC1A 2O1KA 1PFIA 1RY3A 3V4QA 1MUUA 2P1JA 2WZ7A 2FXMA 1LTIC 1H8AA 4JYBA 5APUA 5AVXB 4B86A 2P67A 1LT9B 1NAFA 1KILB 1FZBA 4C7RA 1HVVA 1J1DC 1GW3A 3M0DC 1GL2A 1KZUB 1NHLA 3P32A 4XA4A 2Q7CA 2KSJA 4HYTB 1FU1A 1LTBC 1M1JB 2YO2A 1GK4A 2FFDB 1EQ7A 3VMXA 3B5NA 4WBAA 2IFNA 1N86A 2N1TA 1LTTC 5AVQB 1CW5A 2WITA 1ZV8A 1RE3A 1NTMK 3LW5H 3RL0C 1FOSF 1JO5A 1JTHB 1RE4A 3U1AA 4AYCA 1LTJC 1N7SB 1JUNA 2FKWB 1A02J 1DEBA 5AW6B 1T3JA 2Q9IA 1GU4A 1FZFA 1RF0C 1XTGB 3HD7B 3PP5A 2E43A 3HD7D 3HUSA 4WB4A 1LTGC 1IFDA 1QL2A 3RL0D 1H88A 3TNUB 1G1JA 3GHGA 4N78D 1RF1C 2Z5HA 2OYIC 2KB7P 2NPSB 2Z4EA 1DH3A 2PAJA 2ZXEB 3TSIA 5BVZA 1GL2C 4RESB 1CI6B 3KPEA 1URQB 3II6A 3M9HA 1ZR4A 5AW4B 2C0XA 3B5NC 3WMM0 1KQLA 1LWUA 2C9NY 4Y99B 1T2KC 1GD2E 1MV8A 1SFCA 2XV5A 2HPCB 2WWWA 1XTCC 1GL2D 1X79B 1RE4C 2GM4A 1FZCC 1JMMA 3V2PA 1WRGA 5AW3B 3V2RA 1M7LA 5APQA 2R3CA 3B5ND 1N73A 4GT1A 4N78E 5AW7B 3LIEA 5CMZA 3UIAA 1L4AB 4W7ZA 2N1TB 1E5WA 3NXSA 2N1TD 3M0DA 4I1LA 2YKPA 3VMZA 1KFNA 2KOGA 1YYCA 1GTWA 1L0LK 5CCHC 3HRNA 2A45H 2PP6A 1HUCA 3P8MC 2Z5IA 3NTNA 5CJ4A 3VN0A 2A45G 2P7JA 1W2EA 1VPCA 3GHGB 2CPSA 1H89A 3L37A 1IJDB 1JY3P 2HODB 1NTZK 1S9KD 1RF0A 3TK1A 4AUWA 3VTPC 3P8CD 2W27A 5AW2B 1NWQA 1HGZA 3H32A 2YKQA 2C9LY 2YNYA 1N73C 1SFCB 5AVTB 1RF1A 1SFCD 2OYIA 1HJBA 2HG5D 1LT9C 1JY3O 1KILC 2O01H 4JYCA 3C9IA 1JOCA 3E1IA 1HGVA 3A3YB 5CHXA 1JY3N 2M3BA 2WTYA 3VP8A 1SQVK 2WSFH 1J1EC 2XDJA 3IFMA 1GU5A 2GUSA 5CCGC 5APWA 5AVVB 1X9VA 3KQGA 3T97A 2JEEA 2WPRA 1FZCA 1SQXK 3V5BA 4C7NA 3VP9A 5AW1B 1SQPK 2J58A 4W7YA 5CCGD 4WY4C 5APSA 2I1JA 1G2CA 3RL0B 3P7KA 1LTJB 1QL1A 3BATA 5KLVK 5CCHA 5APTA 4W80A 5AW5B 2P2UA 3OAKA 2QM7A 2Q5UA 1JY2P 1HH0A 4WY4D 2NPSC 5APVA 1GDTA 3H32B 2OYHA 1N2DC 3V4WA 5APXA 2KP8A 3B8EB 4KHXA 3R2PA 2LKMA 1FDMA 2H7HA 3M9BA 4N3YB 1GL2B 3HE4A 1GZLA 3HTKA 2WT7A 1IFNA 3MD0A 1JY2O 3SWFA 2XZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HVV A;  1N7S D;  3RK2 C;  3B5N B;  3M0D C;  4WY4 B;  1GL2 A;  1NHL A;  2H8P D;  1KIL A;  1URQ C;  1L4A C;  3B5N A;  4LGD E;  5KJ7 A;  3RK2 D;  2N1T A;  2NPS D;  3RL0 C;  1JTH B;  1SFC B;  5CCG A;  1N7S B;  1SFC D;  2HG5 D;  1URQ D;  1KIL C;  1T3J A;  4OH8 B;  5CCH D;  1XTG B;  3HD7 B;  3PP5 A;  3RK3 C;  3HD7 D;  1JTH A;  2YMY A;  1N7S A;  2N1T C;  2XDJ A;  3RL0 D;  4WY4 A;  3RK2 B;  5CCG C;  2NPS B;  3TSI A;  1GL2 C;  1URQ B;  3RK3 D;  1L4A D;  3HTK B;  3KYQ A;  2NPS A;  3B5N C;  4W7Y A;  5CCG D;  4WY4 C;  5KJ7 C;  1SFC A;  3RL0 B;  1URQ A;  1GL2 D;  5CCH A;  1KIL D;  4W80 A;  3HD7 A;  4JF7 A;  3B5N D;  3RK3 B;  4WY4 D;  2HFE D;  4N78 E;  2NPS C;  3P8C E;  1L4A B;  5KJ7 D;  4W7Z A;  3VOP A;  2N1T B;  2M8R A;  2N1T D;  1SFC C;  1N7S C;  2KOG A;  5CCH C;  2WZ7 A;  1L4A A;  1GL2 B;  3HD7 C;  2PP6 A;  1KIL B; 
#chains in the Genus database with same CATH topology
 3L70 G;  2H43 A;  2WPV B;  4HB1 A;  2O01 J;  5KLV E;  1KC8 Q;  3H1K G;  4L74 A;  5AVY B;  1P84 D;  1NOH A;  3CI9 A;  3OJA B;  4EOT A;  3U59 A;  3CPW O;  5KJ7 A;  2OYO A;  4EYY Q;  3VYI A;  2D2C B;  2BCC D;  3KXD A;  3D71 A;  5CCH D;  3IR9 A;  3L70 E;  1VQ4 P;  1SQQ D;  1OVU A;  2IZ0 A;  1Q82 Q;  5KKZ C;  1GW4 A;  1L0N K;  2QJP B;  3AE3 C;  5AVZ B;  1MKM A;  3RK3 D;  3BRV B;  4IFM A;  3KYQ A;  2A45 I;  1M57 D;  3ZDM A;  5KJ7 C;  1DIP A;  1NTK D;  2YKO A;  2JJL A;  1QLE D;  4PJ0 H;  2FFD C;  3RGU A;  1EDJ A;  3BVH A;  3EFG A;  4RKU J;  2HPC A;  2AEJ A;  1MFZ A;  2E76 C;  3P8C E;  1FOS E;  1KQF B;  1PPJ E;  3L71 G;  1ZLL A;  1S72 P;  4YPC A;  1SQP G;  4C46 A;  1M8O B;  3H1L J;  2FYZ A;  1BE3 D;  3HD7 C;  2AEM A;  3OW2 O;  3BAS A;  1KB9 D;  4GOD A;  2FYU D;  3Q5P A;  1ZN5 A;  1N7S D;  3L36 A;  1U7J A;  3H1J G;  3A0H H;  1BGY J;  2OYI B;  4LGD E;  4L75 A;  3L71 E;  5H2F E;  3GF7 A;  1U57 A;  2KS1 B;  4XE5 B;  4D6T J;  2HOD A;  5GTH E;  5AVS B;  3A5T A;  5AW8 B;  5AW0 B;  2YMY A;  5AVU B;  3M0A A;  4IFD K;  1WT6 A;  3RK2 B;  1YIJ P;  1VQL P;  1VL2 A;  2R32 A;  3TGU J;  3TDK A;  2ZVN B;  3WU2 E;  2XKM A;  1L4A D;  2G3A A;  1T8Z A;  2M5A B;  3JSV C;  5B5E H;  1S1C X;  5KLI C;  3SSU A;  4I7Z C;  2OYH B;  4I6M C;  2YO3 A;  1L0N G;  2WVR A;  4H0L B;  4A7P A;  3AE1 C;  3TNU A;  1M90 Q;  3M06 A;  4LC1 A;  1YQ3 C;  3FX0 A;  4GOF A;  1RY3 A;  3L70 J;  1MUU A;  5K5G B;  1LTI C;  1H8A A;  1X22 A;  4JYB A;  5APU A;  1NAF A;  3H1K J;  1J1D C;  3GLM A;  3M0D C;  2CK3 H;  1UII A;  2ITA A;  5L8R J;  3MP7 B;  1LTT C;  5AVQ B;  2WIT A;  3LW5 H;  1RE4 A;  1FC2 C;  3EFF K;  5AW6 B;  1OMI A;  3AE2 C;  1XTG B;  1YQ4 C;  1QL2 A;  3RL0 D;  2KUB A;  1OW6 A;  1G1J A;  3GHG A;  3PJS K;  2NPS B;  2Z4E A;  1DH3 A;  2E75 D;  1PL5 A;  4RES B;  2WSE J;  1URQ B;  3II6 A;  4OWF A;  3RL0 g;  2KI7 B;  1NTM E;  1KMI Z;  1EDI A;  2C9N Y;  1MV8 A;  1ZOY C;  4R4L A;  1RE4 C;  4H44 D;  1KOR A;  1JMM A;  3V2P A;  1WRG A;  3L71 J;  1M7L A;  1MFT A;  2Q1K A;  3SWK A;  3CX5 E;  1N8R Q;  1SQP J;  3Q3D A;  2WQY C;  3AED C;  2D2C C;  3RBZ A;  2KOG A;  1ZXG A;  1NGM B;  4UB8 H;  5CCH C;  1S2E A;  2Z5I A;  1ZP0 C;  1DD4 A;  3VN0 A;  2QJK C;  4TT3 H;  1OX3 A;  1W2E A;  1VPC A;  4U3F G;  1IJD B;  4K3A A;  3L74 D;  1NTZ K;  1S9K D;  2Y9Z A;  3VTP C;  2W27 A;  1L0L E;  2IBZ G;  5AVT B;  2OYI A;  1K04 A;  2AXT E;  2N9Y B;  4MN4 C;  4JYC A;  3C9I A;  1HGV A;  1JY3 N;  2KS1 A;  3L73 D;  1USE A;  5CCG C;  4ZMD A;  1LJ2 A;  2E76 B;  1DD3 A;  1R8E A;  2V4H A;  3ITK A;  1EZV E;  3V5B A;  1S5L H;  2W6J H;  3L75 D;  3AE5 C;  3CCV P;  2J58 A;  2O01 N;  3P7K A;  4R4M A;  3G4S P;  5KLV K;  2JWD A;  1KB9 I;  2Q5U A;  3BCC G;  3VMA A;  1GDT A;  2KLU A;  2OYH A;  2OQQ A;  5APX A;  1SQX E;  1KQG B;  2LKM A;  1EXI A;  4GDO A;  2H7H A;  3M9B A;  1GL2 B;  3HE4 A;  1VQ8 P;  1KTM A;  1VQ9 P;  3RK2 C;  2LXC B;  2IFM A;  1EC5 A;  2E42 A;  1T2K D;  3B71 A;  3CME P;  1L4A C;  1T3U A;  2OGU A;  3BCC E;  3PRJ A;  1NTM J;  3OA7 A;  4Y28 J;  1LTS C;  5AW9 B;  2FBW C;  3PTZ A;  4HJG H;  1R5S A;  3AE6 C;  2OYH C;  3H1L G;  4NPE A;  1QEX A;  1W5C E;  1IFM A;  3E7K A;  4H0L C;  2H89 C;  3CCL P;  2A06 D;  1KD1 Q;  1NTZ G;  3CCS P;  1KFM A;  5B66 E;  5CBO A;  2B87 B;  1BGY G;  1N7L A;  1P84 E;  1PGQ A;  2JO1 A;  5KAF E;  2I8D A;  1SQB D;  3CWB D;  2ZVO B;  5TIS H;  3MUD C;  1PGP A;  3HE5 A;  3HTK B;  4OGQ D;  5CBN A;  5M1B A;  2NPS A;  2HR3 A;  4KT0 J;  1URQ A;  2KYV A;  2W6A A;  4BRY B;  4UB6 H;  3S1K A;  2N9B A;  1J1D B;  3B4S A;  5CJ0 A;  3L35 A;  2W83 C;  1KIL D;  1JCC A;  1CZQ A;  1FDO A;  1SP4 A;  1DX7 A;  1L0L J;  2E5Y A;  4LLH A;  3SWY A;  3MGN A;  1IFI A;  2BAS A;  1OXZ A;  2QEX P;  1IC2 A;  2H88 C;  1KN7 A;  4O9B A;  5GTI H;  3M91 A;  4U3F J;  2JR8 A;  3O6Q A;  4DT0 A;  5KLV G;  1NTK E;  4WY4 B;  2E75 C;  1HTL C;  2H8P D;  1URQ C;  1EDK A;  2O1J A;  4HH2 A;  1FAV A;  1ZME C;  1LTA C;  2L5G B;  5BU5 A;  1VDF A;  1IFJ A;  1RQU A;  4N6J A;  4ZKP A;  1BE3 E;  1Y8A A;  2FYU E;  1JB0 J;  3CLQ A;  2XND H;  4C7N B;  1SQX J;  2IPP A;  3CCR P;  4GIF A;  2FFD A;  3WUV A;  3D6Y A;  1ZR2 A;  1LGH B;  3A0B H;  2E74 D;  3AEE C;  2M3E A;  3I5C A;  2WSS H;  3L4F A;  3BCC J;  2FYN C;  2QJK B;  1FZE A;  1RQV A;  2J59 M;  1NAY A;  3HD7 A;  1KQS O;  2VRS A;  1NKN A;  4DCK A;  1PPJ G;  4JF7 A;  3RK3 B;  3V6I A;  1X8Y A;  1LWU C;  3VOP A;  1NU1 G;  4DOJ A;  2WT7 B;  2MJZ A;  3LID A;  1KYO H;  2P67 A;  1FZB A;  3E1R A;  1VQ5 P;  1HVV A;  1K73 Q;  1LNQ A;  1GW3 A;  2KXP B;  1GL2 A;  1NHL A;  3L72 D;  1YJW P;  4HYT B;  4D6T D;  1M1J B;  2YO2 A;  1EQ7 A;  3PLN A;  2Y0E A;  1NU1 E;  2R44 A;  3H1H D;  1Q90 D;  4CPG A;  1NTM K;  1KYO I;  2JWA A;  1JTH B;  3U1A A;  1N7S B;  1JUN A;  1A02 J;  1DEB A;  3TGU D;  3Q5S A;  1NTZ J;  2ZT9 D;  1RF0 C;  2QIW A;  3KZI E;  2E43 A;  2QRX A;  3MHV A;  1LTG C;  1IFD A;  4WB4 A;  2K3R A;  1ZRT D;  1H88 A;  1YJ9 P;  4N78 D;  1RF1 C;  2Z5H A;  2K9J B;  2KB7 P;  2PAJ A;  4IL6 H;  2ZYG A;  3TSI A;  5BVZ A;  2W8Z A;  1GL2 C;  1CI6 B;  3H1I G;  3WMM 0;  1GMJ A;  2K9Y A;  4Y99 B;  1T2K C;  1BCC D;  1YHQ P;  2JDI H;  3AE9 C;  2WWW A;  1XTC C;  4Z1M H;  2KNC A;  3L70 D;  5AW3 B;  3V2R A;  5APQ A;  2R3C A;  3B5N D;  3H1K D;  1L4A B;  1TU3 F;  2N1T B;  1E5W A;  2N1T D;  1BE3 J;  3M0D A;  3VMZ A;  1KFN A;  1YYC A;  2QSI A;  1GTW A;  1L0L K;  5KLV J;  2FYU J;  3H1I E;  3HRN A;  1PGO A;  2PP6 A;  1HUC A;  2Q6Q A;  3NTN A;  5E79 H;  2A45 G;  1SS1 A;  3IN6 A;  1BDC A;  1W2B O;  3GW6 A;  4K35 A;  3TK1 A;  3P8C D;  3H32 A;  2YNY A;  1SFC B;  2RMZ A;  2BEZ F;  1SFC D;  3W67 A;  4IOI H;  1LT9 C;  1KIL C;  2O01 H;  3E1I A;  2Y0C A;  3VP8 A;  3CXH H;  2XDJ A;  3CC7 P;  2GUS A;  4ASV A;  2WSC J;  1NTM G;  2IBZ I;  1SQX K;  4C7N A;  2QJY B;  3L71 D;  3VP9 A;  2PGD A;  1SQP D;  4WY4 C;  2W90 A;  4RO0 A;  3RL0 B;  1UIX A;  1LTJ B;  1PP9 G;  4OVN F;  1QL1 A;  3BAT A;  1VQK P;  5CCH A;  5APT A;  1NU1 J;  2IZ1 A;  2E75 B;  1SQV E;  3CXH I;  3GMA A;  3OAK A;  4QMA A;  2FXO A;  3H1J D;  2QM7 A;  3L73 E;  3CC4 P;  4PJ0 E;  2PRR A;  2KP8 A;  4KHX A;  1FDM A;  1EDL A;  5KAI E;  2AXC A;  4H44 B;  2NRG A;  1GZL A;  4ZNC A;  2WT7 A;  3MD0 A;  1X0T A;  5DJU B;  1PP9 E;  3C1L A;  1CSB A;  1JY2 N;  5B66 H;  3CMA P;  1IK9 A;  3T97 B;  1M56 D;  2R5B A;  1L0L G;  4ZKU A;  1M1K Q;  3A0H E;  1M1J A;  3SFE C;  1HWT C;  3BRT B;  5CCG A;  1G2C B;  4YXW H;  4OH8 B;  1VQO P;  3S9O A;  2XU6 A;  3H6P A;  1AFO A;  3RK3 C;  1JTH A;  1OVR A;  2FYN B;  2ZFC A;  5AVR B;  3FWL A;  1N7S A;  2CPB A;  1GK6 A;  1EZV G;  1FZA A;  4PD4 H;  1L0N D;  3H1I J;  1LWU B;  3EQ2 A;  3MIW A;  4EI2 A;  2Y0D A;  1AVO A;  2QVA A;  2R5D A;  1NH4 A;  1CI6 A;  1NTK K;  1N73 B;  3G71 P;  1KYO D;  1M1J C;  2QG4 A;  2A06 E;  4I2L C;  4PV1 B;  5AVW B;  5B5E E;  4PV1 D;  5KJ7 D;  3TYY A;  1SQX G;  3N7N A;  1J1E B;  1SQB E;  3CWB E;  2Y9Y A;  1N7S C;  4GKG A;  4PD4 I;  2XNX A;  2ZT9 C;  2POH A;  1L4A A;  4BXL A;  2M5A A;  2FYU K;  3PH0 A;  1OW7 A;  1ZW0 A;  1E79 H;  3G6E P;  3AEA C;  1KV4 A;  5APY A;  2OAR A;  1KIL E;  3M9Q A;  3A7O A;  1AQ5 A;  1RF1 B;  3JC2 2;  1VF5 D;  1NKZ B;  3MTU E;  1AA0 A;  2AEF A;  3I56 P;  3CC2 P;  4IFF A;  4Y99 C;  3TF5 A;  3QH9 A;  2WPS A;  1NO4 A;  3CCE P;  1SQV J;  3AE7 C;  3V2N A;  2W6B A;  3VMY A;  3MUD A;  2KLV A;  3L73 J;  1FJP A;  1IK7 A;  2WSF J;  2N1T C;  2GUV A;  1RE3 C;  1Y9B A;  3G3Z A;  2IDB A;  3RBX A;  2WSC H;  3U1C A;  1JCD A;  2BCC G;  3Q1M A;  1PP9 J;  2IX7 C;  3HUS C;  2ZJS E;  3F89 A;  2HLO A;  1Z56 A;  1SQQ G;  2Q3E A;  2ZYA A;  4EDF A;  4YTP C;  2HFE D;  1LTJ A;  4L76 A;  1NU1 K;  1U7M A;  2JP3 A;  2WSE H;  4U3F D;  2O3J A;  4OGQ B;  1AJY A;  1SFC C;  1NVO A;  2P10 A;  2E5T A;  2BCC E;  2YIU B;  3V4Q A;  2P1J A;  1NTK G;  2K37 A;  4B86 A;  3D6Z A;  1LT9 B;  2IBZ D;  1KIL B;  4C7R A;  1OIP A;  1SQQ E;  3G9R A;  3IAO A;  1RH5 B;  5H2F H;  4UB8 E;  4GOE A;  1KZU B;  3ABV C;  2Q7C A;  2KSJ A;  3RK3 E;  5GTH H;  3VMX A;  2QJY C;  4WBA A;  1N86 A;  1BE3 G;  3CXH D;  1ZV8 A;  1JO5 A;  3RL0 C;  4AYC A;  1LTJ C;  1IZN B;  2FYU G;  2KZI A;  3MZW B;  3WU2 H;  1SQB J;  1VQN P;  2QE7 H;  2GA1 A;  3L72 E;  3TNU B;  2ZXE B;  3BCC D;  3H1H E;  4H44 C;  3KPE A;  2NZ2 A;  3M9H A;  1KB9 E;  1Q2N A;  5DJT B;  4DJG A;  1Q7Y Q;  2C0X A;  1LWU A;  3TGU E;  2L91 A;  2IYP A;  1S5L E;  2GM4 A;  5C39 A;  1FZC C;  1ZRT E;  1N73 A;  4N78 E;  1PV3 A;  5CMZ A;  3UIA A;  4W7Z A;  1OZH A;  2E74 B;  2IYO A;  3AEB C;  1FDI A;  1QVF O;  1Q86 Q;  1VQ6 P;  2A45 H;  3LW5 J;  1BCC E;  3H25 A;  3H1L D;  2LXB A;  5CJ4 A;  2D2C D;  1YBK A;  3GHG B;  3L37 A;  1JY3 P;  1QVG O;  3SFD C;  3H1K E;  1LP1 B;  1NTZ D;  1RF0 A;  2MKV A;  3GG2 A;  1BGY D;  5AW2 B;  1N73 C;  1RF1 A;  1HJB A;  2HG5 D;  4PD4 D;  1JY3 O;  1FE6 A;  1JOC A;  5CHX A;  4PV1 C;  1VQ7 P;  3JCU E;  2WTY A;  1SQV K;  1T6A A;  2WSF H;  1J1E C;  1GU5 A;  2BCC J;  5AVV B;  4H13 B;  3KQG A;  4H13 D;  2JEE A;  5KAI H;  3GF3 A;  1SQQ J;  3WUU A;  2ZT9 B;  1Q81 Q;  1K9M Q;  3CX5 H;  4W7Y A;  2RKL A;  5CCG D;  4RJT A;  2I1J A;  1H0T B;  1QX8 A;  5TIS E;  1VF5 C;  5KLV D;  1S5L X;  2KZJ A;  1AVY A;  4U7J A;  5APV A;  4TLF A;  1OW8 A;  1NTK J;  4UB6 E;  2B87 A;  1YI2 P;  4YXD C;  4N3Y B;  2RN0 A;  1SQP E;  3HTK A;  2OTL P;  3SWF A;  3CX5 I;  2XZR A;  3L72 J;  2UWJ E;  1FBM A;  1D7M A;  3B5N B;  2B89 A;  2QA4 P;  4BRY A;  4DZO A;  5KTB A;  2V7Q J;  3H1H J;  5GTI E;  1LT9 A;  2HYN A;  1HBW A;  1KIL A;  2AXT H;  3H1J E;  3IF4 A;  4ASW A;  1HF9 A;  3RK2 D;  2Q3I A;  3HUS B;  4EIJ A;  4M3L A;  1VQP P;  3L74 G;  4OGQ C;  3A2A A;  4WY4 A;  4JPZ B;  1SQB K;  2YIU C;  2K1A A;  3AE4 C;  1PPJ D;  3KDP B;  1SLQ A;  1NU1 D;  4H0L D;  1BCC J;  3HE4 B;  1G1I A;  1BSN A;  1VQM P;  1YTZ T;  2OTK E;  1PGJ A;  3CCQ P;  1SQV G;  4NPD A;  3L73 G;  1HJ0 A;  3L74 E;  3A0B E;  2BEQ D;  1EZV I;  3FWN A;  1S9K E;  1Y47 A;  1YJN P;  3PHL A;  2WMM A;  1S4X A;  1QGK B;  1L0N E;  3L75 G;  3NMD A;  1YTZ I;  2RH0 A;  2FY8 A;  2B88 A;  1A02 F;  3N4X A;  3AEC C;  1BDD A;  5BU8 B;  2QM8 A;  1KYO E;  4AQR D;  2WPQ A;  4HKZ H;  1OVV A;  4XFJ A;  4L73 A;  1PIX A;  3HE5 B;  3L75 E;  1PZQ A;  2NPS D;  1MZ9 A;  1LP1 A;  1URQ D;  3W68 A;  1P84 H;  5KAF H;  3H1I D;  1RHZ B;  3I55 P;  1FZC B;  2YXQ B;  2E74 C;  2FXP A;  1FZG A;  2DW3 A;  5EFW B;  3V2Q A;  1IO4 A;  1S3J A;  2C0W A;  1SVF A;  3CL3 D;  5TJH A;  3O6Q B;  4NPF X;  1L2P A;  1OWA A;  3GHG C;  1SQQ K;  4IL6 E;  2LR2 A;  3FXD A;  1P84 I;  2A06 G;  3H1J J;  2OTJ P;  1SQB G;  1FJK A;  3O8Z A;  3CWB G;  2I1K A;  1H0T A;  3R4Y A;  2YMK A;  2QJP C;  3NFQ A;  2M8R A;  1JNM A;  5KKZ B;  2K9J A;  1J2J B;  2P58 A;  3C8V A;  2O1K A;  1PFI A;  3F5H A;  2WZ7 A;  2FXM A;  4BWN A;  4WWI A;  5AVX B;  3KHU A;  2K88 A;  2ZXX A;  3AEF C;  3P32 A;  4H13 C;  4XA4 A;  2V7Q H;  1FU1 A;  1LTB C;  1GK4 A;  2FFD B;  1SQV D;  4U3F E;  1KB9 H;  1AV1 A;  3B5N A;  2IFN A;  5E79 E;  3AE8 C;  2N1T A;  1CW5 A;  1FOS F;  1RE3 A;  2E76 D;  1NTM D;  1AQT A;  2FKW B;  3L74 J;  1T3J A;  2Q9I A;  2IBZ E;  1GU4 A;  1FZF A;  3HD7 B;  3PP5 A;  3HD7 D;  1VF5 B;  3HUS A;  1L0N J;  1DEE G;  1PP9 D;  3CX5 D;  4KJM A;  3CCM P;  2ZYD A;  2OYI C;  3Q2Y A;  3CXH E;  1K05 A;  3D70 A;  1ZR4 A;  5AW4 B;  3B5N C;  1KQL A;  1LT1 A;  1GD2 E;  2XV5 A;  1SFC A;  4JQ0 D;  2HPC B;  3Q5R A;  1GL2 D;  1X79 B;  4IL6 X;  2KSE A;  3L75 J;  1FS0 E;  4GT1 A;  5AW7 B;  3LIE A;  2ZAE B;  3NXS A;  4I1L A;  1YIT P;  2YKP A;  3WUT A;  1L0L D;  4WVZ A;  3JCU H;  2M0B A;  3P8M C;  2B9B A;  2P7J A;  3CCU P;  2CPS A;  1H89 A;  3FXE A;  1JMB A;  5KLI B;  2KK7 A;  4I7Z B;  2HOD B;  2G8Y A;  1OFC X;  4AUW A;  1EZV D;  2SPZ A;  3KZI H;  1NWQ A;  1HGZ A;  2YKQ A;  2J5U A;  2C9L Y;  1JM0 A;  1IFP A;  1USD A;  3S4R A;  3USS A;  3CCJ P;  1K8A Q;  1BSH A;  2KNC B;  3A3Y B;  2PFX A;  3H1L E;  3L72 G;  3AEG C;  2M3B A;  4D6T G;  2JKV A;  3IFM A;  1JEK A;  3H1H G;  5APW A;  1X9V A;  1NJI Q;  1NTZ E;  3T97 A;  2WPR A;  1WMK A;  1FZC A;  2R3S A;  1BGY E;  1SQX D;  3QWO C;  3TGU G;  4JBZ A;  5AW1 B;  1SQP K;  5APS A;  2KIK A;  3K5B A;  4PD4 E;  1G2C A;  3CWB J;  4D6T E;  1EXJ A;  4W80 A;  5AW5 B;  2P2U A;  1JY2 P;  1HH0 A;  4WY4 D;  2NPS C;  3H32 B;  1R5L A;  1N2D C;  3V4W A;  3B8E B;  1NYH A;  3FGA D;  3R2P A;  1BCC G;  3CD6 P;  2YXR B;  3EWK A;  1IFN A;  1JY2 O; 
#chains in the Genus database with same CATH homology
 2H43 A;  1CSB A;  1JY2 N;  3RK2 C;  1FBM A;  3B5N B;  2IFM A;  4DZO A;  5KTB A;  1T2K D;  2E42 A;  1IK9 A;  1LT9 A;  2HYN A;  1HBW A;  1KIL A;  5AVY B;  1L4A C;  1NOH A;  1T3U A;  2R5B A;  3CI9 A;  3OJA B;  4EOT A;  3OA7 A;  4ZKU A;  1LTS C;  5AW9 B;  3U59 A;  5KJ7 A;  3RK2 D;  2Q3I A;  1M1J A;  1HWT C;  3BRT B;  5CCG A;  1G2C B;  3HUS B;  3VYI A;  2OYH C;  4EIJ A;  4OH8 B;  1IFM A;  4M3L A;  5CCH D;  3IR9 A;  2XU6 A;  3H6P A;  1AFO A;  3RK3 C;  1JTH A;  2ZFC A;  5AVR B;  1N7S A;  3A2A A;  4WY4 A;  2CPB A;  1GW4 A;  1KFM A;  1GK6 A;  1N7L A;  1FZA A;  1L0N K;  1SQB K;  1LWU B;  3EQ2 A;  5AVZ B;  3MIW A;  3KDP B;  1SLQ A;  3RK3 D;  3BRV B;  3HE5 A;  3HE4 B;  3HTK B;  3KYQ A;  4IFM A;  2A45 I;  1G1I A;  2NPS A;  2R5D A;  5KJ7 C;  1YTZ T;  1NH4 A;  1CI6 A;  1NTK K;  1N73 B;  2YKO A;  1URQ A;  2JJL A;  2KYV A;  2W6A A;  1M1J C;  2N9B A;  2FFD C;  1J1D B;  5CJ0 A;  3L35 A;  1KIL D;  1JCC A;  3BVH A;  1CZQ A;  4I2L C;  1S9K E;  3EFG A;  2HPC A;  5AVW B;  1SP4 A;  1DX7 A;  1MFZ A;  3P8C E;  1FOS E;  5KJ7 D;  3TYY A;  4LLH A;  3SWY A;  3N7N A;  1J1E B;  3MGN A;  3NMD A;  1IFI A;  2BAS A;  1N7S C;  4GKG A;  1YTZ I;  1ZLL A;  2XNX A;  1OXZ A;  1IC2 A;  4C46 A;  1A02 F;  3N4X A;  2POH A;  2FYZ A;  4O9B A;  1L4A A;  3HD7 C;  3M91 A;  3BAS A;  5BU8 B;  2QM8 A;  2FYU K;  1ZN5 A;  1N7S D;  3L36 A;  4AQR D;  4WY4 B;  5APY A;  1HTL C;  2OAR A;  2WPQ A;  2H8P D;  3M9Q A;  3A7O A;  1URQ C;  1AQ5 A;  1RF1 B;  2O1J A;  4HH2 A;  1NKZ B;  3MTU E;  2OYI B;  1FAV A;  3HE5 B;  4LGD E;  1LTA C;  2L5G B;  5BU5 A;  1VDF A;  1IFJ A;  4N6J A;  4IFF A;  4Y99 C;  2NPS D;  4XE5 B;  1MZ9 A;  4ZKP A;  2HOD A;  2WPS A;  1URQ D;  1NO4 A;  5AVS B;  3V2N A;  3A5T A;  2W6B A;  3VMY A;  5AW8 B;  3MUD A;  2KLV A;  3CLQ A;  1FJP A;  5AW0 B;  2YMY A;  5AVU B;  2N1T C;  3M0A A;  1FZC B;  4IFD K;  2GUV A;  1WT6 A;  1RE3 C;  4C7N B;  3RK2 B;  1FZG A;  3G3Z A;  2R32 A;  2IPP A;  3V2Q A;  2WSC H;  1IO4 A;  4GIF A;  2FFD A;  2C0W A;  1ZR2 A;  3U1C A;  1JCD A;  1SVF A;  2XKM A;  1L4A D;  3CL3 D;  1LGH B;  2IX7 C;  3HUS C;  1T8Z A;  1OWA A;  3GHG C;  2HLO A;  1SQQ K;  1Z56 A;  3I5C A;  3L4F A;  2OYH B;  1FZE A;  4I6M C;  2J59 M;  2YO3 A;  3HD7 A;  2VRS A;  1FJK A;  1NKN A;  3O8Z A;  2I1K A;  4JF7 A;  3RK3 B;  2HFE D;  1LTJ A;  1NU1 K;  1X8Y A;  2WSE H;  1LWU C;  3VOP A;  4DOJ A;  3NFQ A;  2M8R A;  3TNU A;  1JNM A;  2WT7 B;  2MJZ A;  1SFC C;  3LID A;  3M06 A;  1J2J B;  4LC1 A;  2O1K A;  1PFI A;  1RY3 A;  3V4Q A;  1MUU A;  2P1J A;  2WZ7 A;  2FXM A;  1LTI C;  1H8A A;  4JYB A;  5APU A;  5AVX B;  4B86 A;  2P67 A;  1LT9 B;  1NAF A;  1KIL B;  1FZB A;  4C7R A;  1HVV A;  1J1D C;  1GW3 A;  3M0D C;  1GL2 A;  1KZU B;  1NHL A;  3P32 A;  4XA4 A;  2Q7C A;  2KSJ A;  4HYT B;  1FU1 A;  1LTB C;  1M1J B;  2YO2 A;  1GK4 A;  2FFD B;  1EQ7 A;  3VMX A;  3B5N A;  4WBA A;  2IFN A;  1N86 A;  2N1T A;  1LTT C;  5AVQ B;  1CW5 A;  2WIT A;  1ZV8 A;  1RE3 A;  1NTM K;  3LW5 H;  3RL0 C;  1FOS F;  1JO5 A;  1JTH B;  1RE4 A;  3U1A A;  4AYC A;  1LTJ C;  1N7S B;  1JUN A;  2FKW B;  1A02 J;  1DEB A;  5AW6 B;  1T3J A;  2Q9I A;  1GU4 A;  1FZF A;  1RF0 C;  1XTG B;  3HD7 B;  3PP5 A;  2E43 A;  3HD7 D;  3HUS A;  4WB4 A;  1LTG C;  1IFD A;  1QL2 A;  3RL0 D;  1H88 A;  3TNU B;  1G1J A;  3GHG A;  4N78 D;  1RF1 C;  2Z5H A;  2OYI C;  2KB7 P;  2NPS B;  2Z4E A;  1DH3 A;  2PAJ A;  2ZXE B;  3TSI A;  5BVZ A;  1GL2 C;  4RES B;  1CI6 B;  3KPE A;  1URQ B;  3II6 A;  3M9H A;  1ZR4 A;  5AW4 B;  2C0X A;  3B5N C;  3WMM 0;  1KQL A;  1LWU A;  2C9N Y;  4Y99 B;  1T2K C;  1GD2 E;  1MV8 A;  1SFC A;  2XV5 A;  2HPC B;  2WWW A;  1XTC C;  1GL2 D;  1X79 B;  1RE4 C;  2GM4 A;  1FZC C;  1JMM A;  3V2P A;  1WRG A;  5AW3 B;  3V2R A;  1M7L A;  5APQ A;  2R3C A;  3B5N D;  1N73 A;  4GT1 A;  4N78 E;  5AW7 B;  3LIE A;  5CMZ A;  3UIA A;  1L4A B;  4W7Z A;  2N1T B;  1E5W A;  3NXS A;  2N1T D;  3M0D A;  4I1L A;  2YKP A;  3VMZ A;  1KFN A;  2KOG A;  1YYC A;  1GTW A;  1L0L K;  5CCH C;  3HRN A;  2A45 H;  2PP6 A;  1HUC A;  3P8M C;  2Z5I A;  3NTN A;  5CJ4 A;  3VN0 A;  2A45 G;  2P7J A;  1W2E A;  1VPC A;  3GHG B;  2CPS A;  1H89 A;  3L37 A;  1IJD B;  1JY3 P;  2HOD B;  1NTZ K;  1S9K D;  1RF0 A;  3TK1 A;  4AUW A;  3VTP C;  3P8C D;  2W27 A;  5AW2 B;  1NWQ A;  1HGZ A;  3H32 A;  2YKQ A;  2C9L Y;  2YNY A;  1N73 C;  1SFC B;  5AVT B;  1RF1 A;  1SFC D;  2OYI A;  1HJB A;  2HG5 D;  1LT9 C;  1JY3 O;  1KIL C;  2O01 H;  4JYC A;  3C9I A;  1JOC A;  3E1I A;  1HGV A;  3A3Y B;  5CHX A;  1JY3 N;  2M3B A;  2WTY A;  3VP8 A;  1SQV K;  2WSF H;  1J1E C;  2XDJ A;  3IFM A;  1GU5 A;  2GUS A;  5CCG C;  5APW A;  5AVV B;  1X9V A;  3KQG A;  3T97 A;  2JEE A;  2WPR A;  1FZC A;  1SQX K;  3V5B A;  4C7N A;  3VP9 A;  5AW1 B;  1SQP K;  2J58 A;  4W7Y A;  5CCG D;  4WY4 C;  5APS A;  2I1J A;  1G2C A;  3RL0 B;  3P7K A;  1LTJ B;  1QL1 A;  3BAT A;  5KLV K;  5CCH A;  5APT A;  4W80 A;  5AW5 B;  2P2U A;  3OAK A;  2QM7 A;  2Q5U A;  1JY2 P;  1HH0 A;  4WY4 D;  2NPS C;  5APV A;  1GDT A;  3H32 B;  2OYH A;  1N2D C;  3V4W A;  5APX A;  2KP8 A;  3B8E B;  4KHX A;  3R2P A;  2LKM A;  1FDM A;  2H7H A;  3M9B A;  4N3Y B;  1GL2 B;  3HE4 A;  1GZL A;  3HTK A;  2WT7 A;  1IFN A;  3MD0 A;  1JY2 O;  3SWF A;  2XZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...