3HD7A

Helical extension of the neuronal snare complex into the membrane, spacegroup c 1 2 1
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
91
structure length
91
Chain Sequence
GSHMRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helical extension of the neuronal SNARE complex into the membrane
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
molecule keywords Vesicle-associated membrane protein 2
total genus 36
structure length 91
sequence length 91
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3hd7A00
1L4AD 3RL0B 1SFCA 2NPSD 4WY4C 5CCHA 1URQC 5CCGD 2N1TB 4N78E 4LGDE 1JTHB 2XDJA 1GL2C 3KYQA 1KILB 5KJ7C 1NHLA 1N7SD 2HFED 3B5NB 3HTKB 3RK2B 3M0DC 3HD7B 4W7ZA 1GL2B 1N7SB 1N7SC 4WY4B 2YMYA 5KJ7D 3HD7D 1L4AB 3RK3D 5CCHC 1GL2D 4JF7A 1URQB 2KOGA 2PP6A 3P8CE 5CCGA 3PP5A 4WY4A 5CCHD 3RK3C 3HD7C 1HVVA 3HD7A 1URQA 2NPSC 2WZ7A 4W7YA 1T3JA 1XTGB 2H8PD 1KILA 4OH8B 1GL2A 5CCGC 1SFCC 4WY4D 3RL0D 2NPSB 2N1TA 1L4AC 3RK3B 5KJ7A 2N1TC 3TSIA 3B5NC 1URQD 1KILD 3RL0C 2M8RA 1SFCD 2NPSA 1JTHA 1L4AA 3B5ND 3RK2D 3RK2C 3VOPA 1N7SA 2HG5D 4W80A 1KILC 1SFCB 3B5NA 2N1TD
chains in the Genus database with same CATH superfamily
1HTLC 3C1LA 1SQBG 3H1IJ 3E7KA 4YPCA 2WPVB 4RJTA 1IZNB 1S5LX 3E1RA 3OJAB 1M90Q 3VMXA 1LT9B 1NU1G 2ZVNB 3V2NA 3MZWB 3HUSB 2OQQA 1H0TA 1PV3A 1URQC 2WITA 1W2EA 2YIUC 3H1KE 1M1KQ 2K1AA 2QG4A 3CWBG 1HWTC 1S2EA 1VQ5P 1GK6A 1FDIA 1R5SA 1SQPK 1AVYA 1JTHB 1VPCA 2I1JA 2XDJA 3L70J 3L71J 1NWQA 1VQKP 3MP7B 3QWOC 4JQ0D 2ITAA 1OWAA 2B88A 1BDCA 5KJ7C 1CI6A 1NHLA 2NZ2A 1CI6B 1YJ9P 4PJ0H 1N7SD 1IJDB 3AE2C 1AA0A 3B8EB 2ZT9B 3I5CA 1YITP 4WWIA 1LTGC 1T8ZA 3SFEC 3Q2YA 3H1HD 3C8VA 2J58A 3FWNA 1AVOA 3CCMP 3D70A 1FS0E 3K5BA 1DEEG 3EFFK 1NVOA 2KNCA 1VQMP 1BE3D 2LR2A 1FC2C 1W5CE 1YJWP 2YKQA 2M5AA 3L74E 1IC2A 3II6A 2M3EA 3H1HE 1MV8A 1QEXA 1Q2NA 1N7SC 1S4XA 4D6TE 4WY4B 3PHLA 3WU2H 2YMYA 4R4LA 2C0XA 3SFDC 1KQSO 2IFNA 2JO1A 5KJ7D 3UIAA 5CHXA 2HPCA 2O3JA 2H43A 3H1LJ 5CBNA 1PL5A 3KQGA 3RK3D 1DEBA 4YXWH 5DJUB 5CCHC 4OGQC 1QLED 4JF7A 4JYBA 1K04A 5AVQB 5H2FE 2KS1B 4ZKPA 2Z5IA 1FE6A 1SQVG 3FWLA 1N73A 5TJHA 3RK3E 5KLVJ 5AW3B 3A5TA 2ZYGA 5CCHD 4DZOA 1RF0C 3HE4A 3RK3C 4BXLA 1U57A 2PGDA 5CBOA 4TT3H 1OVUA 4O9BA 5APXA 3AE8C 5E79H 3BRTB 1JCCA 1PP9G 2Y9YA 3SWFA 4Z1MH 4H44D 2Q1KA 1SQXK 2WSFH 2JJLA 2WVRA 1BSHA 3CXHD 1NTKE 3CWBD 1WRGA 3L73E 1ZRTE 1SQQG 3N4XA 5APQA 2R5DA 1JCDA 1NAYA 2WZ7A 3BCCG 1YBKA 3C9IA 1NTKK 3AECC 1M56D 1HH0A 1DD3A 2W6AA 1T3JA 3L73D 3A0HE 1XTGB 4EOTA 2H8PD 1NTZE 1RE3C 2M5AB 1PFIA 2KZJA 3L74J 3S4RA 3CCEP 3ITKA 1VQ7P 1SFCC 3CX5I 1L0NE 3L36A 4EI2A 1VF5B 4HH2A 1RF1B 1X79B 1EDJA 1K9MQ 2BCCE 1DH3A 5AVVB 2Q5UA 3CCSP 2VRSA 1X8YA 2BASA 1NU1J 2CK3H 4ZMDA 2YXRB 4AUWA 1H88A 3G4SP 2N1TC 3B5NC 4PV1C 1URQD 2KSJA 4JPZB 4BRYA 3P8CD 4GIFA 4JYCA 4HKZH 1IFJA 5AVYB 1OW7A 3VP9A 1ZW0A 2YNYA 1VQOP 3RL0C 2M8RA 5L8RJ 1R8EA 1G1IA 2E75D 2R5BA 1IK9A 3F5HA 2K9JA 1ZN5A 3IAOA 1JTHA 1NJIQ 2I1KA 2C0WA 1VDFA 1J1EC 1M1JB 1LP1A 5BU8B 1KZUB 2IBZI 4C7NA 2E75C 1FOSE 2WMMA 5AVZB 1PPJE 1USDA 4I6MC 2XZRA 5EFWB 1VQ9P 1HUCA 3I56P 3H25A 1SQBJ 4L74A 5AW7B 1K8AQ 2OYIB 1NTMG 3AEFC 2A06G 3WUVA 3PJSK 1ZR4A 1JMMA 1X0TA 2XNXA 5C39A 3CC2P 4HYTB 2N1TD 3AEBC 4PV1D 1JO5A 2B89A 2YMKA 1XTCC 2ZYDA 4ZNCA 2Q7CA 1BGYD 3EQ2A 4D6TD 2KZIA 1RE4A 4U3FJ 4AQRD 4U3FE 3TF5A 1GU4A 3RL0B 1SQPG 2E5YA 4IFFA 2NPSD 1YYCA 3L75E 4BWNA 1KB9I 1IFIA 1YQ3C 2OYOA 2O01N 2IDBA 2WSEJ 1R5LA 3LW5J 4HJGH 4IOIH 3MIWA 2WSFJ 5KLVG 1QL2A 1BE3E 4IL6X 4WB4A 3Q5PA 2OYHC 3NMDA 1OW8A 4XFJA 3GHGB 1X9VA 4Y28J 1IFDA 4B86A 2HR3A 2XV5A 4KJMA 1T6AA 4KT0J 2KS1A 3VTPC 5BU5A 2NRGA 4M3LA 1PP9J 1N73B 2PRRA 5AW4B 1LTSC 3GLMA 1FAVA 3CI9A 3CXHH 3L73J 3B5NB 4Y99C 5B66H 1UIXA 1DD4A 1AV1A 1OXZA 2FYUG 3HTKB 1VL2A 4I2LC 2YKOA 3CX5E 3LIDA 2O01J 3M0DC 4GKGA 4HB1A 4N78D 3WUUA 1AFOA 3CXHE 3HD7B 1ZOYC 1KYOD 4C7NB 5CJ0A 1JY3N 1NGMB 1L0LD 1OMIA 3CXHI 1N7LA 2Q3EA 3NTNA 1GL2B 4H44C 3BCCD 3VMZA 1HJBA 1VQLP 3G3ZA 1ZP0C 3L71E 3L70E 1Q86Q 1KYOE 2D2CD 2FYZA 5KLIB 1IO4A 1E5WA 1EZVE 1NTZD 3CX5D 1PGPA 4H13B 2E76C 1FDOA 4EIJA 3HTKA 4I7ZC 1H89A 1KB9E 3L72E 1SQPJ 3H1JE 4EYYQ 3OW2O 1A02J 2QSIA 2O1KA 4KHXA 1LTIC 1FZEA 3OA7A 2Q6QA 1QVFO 5AVUB 3AE6C 1NTKD 2MJZA 1L0LG 5AW1B 3IF4A 3T97B 4Y99B 3G71P 5KKZB 3AE3C 3PP5A 2HYNA 2H88C 3H1LD 1CW5A 2RN0A 2FYNC 5AVSB 3BCCJ 4QMAA 2AXCA 1L0LJ 1BSNA 3HD7C 1USEA 1EZVI 2N9YB 2V7QJ 3AE5C 3VMAA 5AVTB 1KYOI 1BDDA 1HVVA 3A0HH 2A45G 2QIWA 5AW5B 1KV4A 1YQ4C 3A2AA 1L0ND 2LXBA 2L91A 4NPEA 4EDFA 2JR8A 2R44A 2IBZE 1Q81Q 5KLVD 2YO2A 3HUSA 3H1LE 4CPGA 3D6YA 2RH0A 3H1IE 1YI2P 1H0TB 5KAIH 4ASWA 2M0BA 5AVRB 1VF5D 3CWBJ 1FZGA 3GHGC 1M8OB 2ZJSE 3MHVA 3V4WA 2QJKB 1LTJA 1JB0J 2W6JH 3ABVC 1YTZI 2QJPC 3FXDA 1KILA 1SQVK 3RBZA 1SQBD 1N73C 3SSUA 1LP1B 1OZHA 1WT6A 3M0DA 3O6QB 1SS1A 2AXTE 3FX0A 1LWUA 1Q90D 2B87A 3M06A 1SQBK 2LKMA 3WMM0 5KTBA 3Q5SA 2PAJA 1YHQP 1GK4A 3CCQP 2N1TA 1KQLA 1VQNP 1EXJA 1KMIZ 3EWKA 1NTMK 2K9JB 2QE7H 4U3FD 1SQXG 2QM7A 1VQPP 3TSIA 3V5BA 1S9KE 4R4MA 1N86A 3H1HJ 3MUDC 5APTA 2W8ZA 3NXSA 4H0LC 2QJPB 5KLIC 1LNQA 1EQ7A 4PJ0E 5KAIE 1OVRA 1SQXJ 1JY2P 2G8YA 3G6EP 1GDTA 1Y9BA 4H0LD 5K5GB 1KC8Q 3A0BH 2FYUK 2E43A 2OYIA 2GUVA 3BASA 1U7MA 1BGYG 1RF1A 3TGUD 3RK2C 2KLVA 4LC1A 2IYPA 4NPDA 3G9RA 3V2RA 1IK7A 4W80A 2IPPA 1OIPA 1KILC 1PZQA 4H0LB 1S5LH 1IFMA 1LTTC 3VMYA 2Q9IA 1BCCG 1FOSF 2Y0CA 1OFCX 1NAFA 2E74D 2ZXEB 4AYCA 1GD2E 2P7JA 2W27A 2ZFCA 2FKWB 3B5NA 3CX5H 3MD0A 2JDIH 1ZR2A 2WPSA 3L35A 5B66E 3TGUG 2Y0EA 1JEKA 1L4AD 1EZVD 3SWYA 3GHGA 3HUSC 1VF5C 3IR9A 2KP8A 3JCUH 1RF1C 2ZXXA 2P1JA 3L37A 1KYOH 1SFCA 4WY4C 2E74B 1YIJP 1GU5A 3AE9C 5CCHA 3L73G 1GW3A 1FZCB 3MUDA 1P84H 2N1TB 3BCCE 4N78E 4PV1B 2SPZA 1NTKJ 4OGQB 1SQQK 4L73A 1KQFB 1GL2C 4DJGA 4N3YB 1N8RQ 2QEXP 2BCCJ 3KYQA 3JC22 4ZKUA 3E1IA 1KILB 3V4QA 3H32A 3KDPB 3L74G 5KLVK 1S5LE 3M91A 1JY2O 3H32B 5DJTB 2FY8A 1BGYJ 4A7PA 1HJ0A 1M57D 1NTZJ 2IX7C 3H1KG 5APYA 1ZMEC 3CWBE 2WSCH 3VYIA 2HPCB 3TYYA 1PGQA 3HE5A 3M9HA 1NU1K 2IBZD 2WTYA 3AEAC 1SVFA 1J1DB 3KHUA 4GOFA 3H1KJ 3LIEA 3Q1MA 4GDOA 2R32A 1EDIA 2P67A 2WSCJ 5KKZC 3KZIH 5AVXB 1EXIA 1N7SB 3PRJA 4PD4H 5AW8B 2ZT9D 1T2KD 4DOJA 3D6ZA 3D71A 2H7HA 3HE4B 2KIKA 1Z56A 3FGAD 3AE4C 4GT1A 4RESB 2XU6A 3AEDC 2AEFA 3HRNA 3CL3D 3P8MC 1PGOA 3A3YB 1ZV8A 3GMAA 5B5EH 1L4AB 4RO0A 5GTIE 1N2DC 2KYVA 2ZAEB 3B4SA 1GL2D 5E79E 1P84I 2Y9ZA 1DIPA 2BEQD 2P2UA 2G3AA 1URQB 2YIUB 2HLOA 1GMJA 3P8CE 5KAFE 4UB6E 2KUBA 3M9QA 3H1HG 2WPRA 4H13D 1LT1A 1P84D 1LWUC 1MUUA 1SQQE 2B87B 3U1AA 4D6TG 1S9KD 1MKMA 1NTMJ 4UB8H 3CCUP 1KFMA 5BVZA 2K3RA 3CLQA 1KORA 1SQBE 3L75J 1LTJB 3RGUA 4D6TJ 2W90A 3HD7A 1PGJA 1KTMA 3W68A 2ZT9C 1T2KC 1SQVE 3CMEP 1NU1E 4JBZA 1RE4C 1URQA 1SQPE 2NPSC 3AE7C 3H1JJ 3L72J 3QH9A 2QA4P 3W67A 1J2JB 2J59M 3P32A 3A7OA 2B9BA 1NKNA 2JP3A 4PD4I 1J1EB 1SQPD 1BE3G 4W7YA 4BRYB 1EC5A 4H44B 1NU1D 4U7JA 5CCGC 2HODB 1LTJC 2AEJA 1AJYA 1NYHA 1OW6A 1YTZT 1VQ6P 3CPWO 1K05A 1IFNA 3FXEA 2RMZA 4L75A 1UIIA 3T97A 2NPSB 2UWJE 3L75D 5APWA 1HGVA 2ZVOB 1RQUA 2QRXA 3RK3B 1S3JA 1NTMD 1AQ5A 1KB9H 3U59A 2YXQB 1W2BO 2R3CA 2O1JA 2KXPB 2CPBA 2WSSH 1IFPA 3GW6A 1E79H 1HGZA 3MTUE 1D7MA 2IYOA 1CZQA 2P10A 4N6JA 2OYHA 3CC4P 4UB6H 2BCCG 3L72D 3CMAP 2BEZF 1BCCJ 2KLUA 2ZYAA 2H89C 1NTME 4MN4C 2A06E 2NPSA 3B5ND 4DT0A 1DX7A 3L72G 3TGUJ 1EDKA 1RH5B 3PTZA 2A45I 1SQVJ 3TK1A 2HG5D 2OTKE 1G1JA 1FZFA 2Z4EA 4IFDK 1NO4A 1L0LE 1VQ4P 1JNMA 5AW2B 2FFDC 1SFCB 1PP9D 1KILE 1PIXA 2KSEA 1M7LA 1ZRTD 5H2FH 2RKLA 2MKVA 3H1JD 3BRVB 2IZ0A 5KLVE 5TISE 2KI7B 3HE5B 2OARA 5TISH 1K73Q 1KN7A 1AQTA 1PP9E 2KK7A 5GTHE 1KB9D 2WPQA 2WQYC 4I7ZB 2W6BA 3S1KA 3R4YA 3LW5H 4C7RA 1S72P 2FXMA 1FZCC 1A02F 2M3BA 1ZXGA 2R3SA 1NTKG 5APUA 3S9OA 1NKZB 3V2QA 2C9LY 1RQVA 3OAKA 2GUSA 2FXOA 2V4HA 5CCGD 1KFNA 1G2CA 1MFTA 4LGDE 2J5UA 4K3AA 1G2CB 1SP4A 1NTZG 1JMBA 1P84E 2WSEH 3TNUA 4TLFA 2OYHB 2CPSA 4U3FG 3TDKA 1NH4A 3M9BA 1FU1A 1L0NG 1JY3P 3L75G 1CSBA 1KQGB 2JKVA 2E75B 3L71G 2HFED 2POHA 1SLQA 3H1ID 1LT9C 1S1CX 5M1BA 3U1CA 4OGQD 2GM4A 3RK2B 3CCJP 1EDLA 3CC7P 1L0NJ 2OYIC 1SQVD 1H8AA 1M1JA 2FYUD 2FXPA 2GA1A 1RE3A 2IFMA 4IL6E 4W7ZA 3H1KD 3O6QA 1JOCA 2PFXA 4XE5B 1LWUB 1LTAC 2O01H 2LXCB 4H13C 3L4FA 1Q7YQ 1FZCA 4IFMA 1OX3A 2JWAA 3N7NA 2FYUE 3MGNA 2OTJP 2FYUJ 1FJPA 3HD7D 2AEMA 4WVZA 3Q5RA 1BGYE 3IFMA 2YO3A 3PH0A 1KD1Q 3EFGA 2E76B 4WBAA 3VP8A 1QL1A 3A0BE 2QM8A 1MZ9A 3P7KA 3PLNA 1GW4A 1PPJG 2KOGA 2PP6A 3JSVC 2IBZG 4GODA 1FZAA 4OWFA 4XA4A 2KB7P 2V7QH 3H1LG 4YXDC 5CCGA 3BVHA 4WY4A 5AW0B 1EZVG 2IZ1A 3O8ZA 5GTHH 3V6IA 1JM0A 1X22A 2JEEA 4GOEA 5CMZA 4RKUJ 2L5GB 3GF7A 1PPJD 2OTLP 5APVA 3L74D 2E76D 1LGHB 1L0NK 2WWWA 1LJ2A 1RF0A 3H1JG 4L76A 3B71A 4LLHA 3WUTA 1FJKA 2D2CC 3TGUE 2WT7B 1M1JC 2K88A 3NFQA 1U7JA 1FZBA 2XNDH 2FFDA 1BE3J 2AXTH 2XKMA 2QJKC 4OVNF 2Q3IA 2A45H 2QJYC 3SWKA 3M0AA 2YKPA 1J1DC 2K37A 4YTPC 1FDMA 1QGKB 1FBMA 1SQXE 1ZLLA 3KPEA 1SQQJ 4IL6H 2C9NY 5AVWB 2Z5HA 1T3UA 1VQ8P 4OH8B 1GL2A 3AEEC 3I55P 1HBWA 3TNUB 2WT7A 2D2CB 1LTBC 3H1IG 3AEGC 4NPFX 3KXDA 4WY4D 1LT9A 2DW3A 2A06D 3RL0D 4DCKA 1Y8AA 3L71D 3KZIE 2W83C 1WMKA 5AW9B 1Q82Q 1L4AC 1SQXD 5KAFH 5KJ7A 1QX8A 1L0LK 2K9YA 4PD4D 3V2PA 1OVVA 3CCLP 5APSA 1HF9A 5GTIH 3CCVP 1RY3A 2FFDB 5B5EE 2E74C 1GZLA 3AE1C 3GF3A 2E5TA 3WU2E 2FYNB 3L70G 3R2PA 3VN0A 3ZDMA 1KILD 2QJYB 3H6PA 3USSA 2E42A 1BCCE 2N9BA 2BCCD 1SFCD 1L2PA 2Y0DA 4K35A 4PD4E 1L4AA 3IN6A 3L70D 1RHZB 2FBWC 2KNCB 3RK2D 3CCRP 3VOPA 3RL0g 1QVGO 3GG2A 1Y47A 1SQQD 1N7SA 5AW6B 4ASVA 1JUNA 1JY2N 4C46A 1JY3O 2P58A 2HODA 3Q3DA 5CJ4A 1GTWA 1BCCD 1NTZK 2I8DA 3F89A 3JCUE 3RBXA 2OGUA 3BATA 3CD6P 1TU3F 1MFZA 4I1LA 4UB8E 1NOHA 2QVAA 2JWDA 1YJNP
chains in the Genus database with same CATH topology
1HTLC 3OJAB 3VMXA 1LT9B 3V2NA 3HUSB 1URQC 2WITA 1W2EA 1HWTC 1GK6A 1VPCA 2I1JA 1SQPK 1JTHB 1HBWA 1NWQA 2XDJA 1OWAA 5KJ7C 1CI6A 1NHLA 1CI6B 1N7SD 1IJDB 3B8EB 3I5CA 1LTGC 1T8ZA 2J58A 2YKQA 1IC2A 3II6A 1MV8A 1RF1A 1N7SC 4WY4B 2YMYA 2C0XA 2IFNA 5KJ7D 3UIAA 5CHXA 2HPCA 2H43A 3KQGA 3RK3D 1DEBA 5CCHC 5AVQB 4JF7A 4JYBA 4ZKPA 2Z5IA 1N73A 5AW3B 3A5TA 5CCHD 4DZOA 1RF0C 3HE4A 3RK3C 4O9BA 5APXA 3BRTB 1JCCA 3SWFA 1SQXK 2WSFH 2JJLA 1WRGA 5APQA 3N4XA 2R5DA 1JCDA 2WZ7A 3C9IA 1NTKK 1HH0A 2W6AA 1T3JA 1XTGB 4EOTA 2H8PD 1RE3C 1PFIA 1SFCC 3L36A 1RF1B 4HH2A 1X79B 5AVVB 2Q5UA 2VRSA 1X8YA 2BASA 4AUWA 1H88A 2N1TC 3B5NC 1URQD 2KSJA 3P8CD 4GIFA 4JYCA 1IFJA 5AVYB 3VP9A 2YNYA 3RL0C 2M8RA 1G1IA 2R5BA 1IK9A 1ZN5A 1JTHA 2I1KA 2C0WA 1VDFA 1J1EC 1M1JB 5BU8B 1KZUB 4C7NA 1FOSE 5AVZB 4I6MC 2XZRA 1HUCA 5AW7B 2OYIB 1ZR4A 1JMMA 1JO5A 2XNXA 4HYTB 2N1TD 1XTCC 2Q7CA 3EQ2A 4AQRD 1RE4A 1GU4A 3RL0B 4IFFA 2NPSD 1YYCA 1IFIA 3MIWA 2OYHC 1QL2A 4WB4A 3NMDA 3GHGB 1X9VA 1IFDA 4B86A 2XV5A 3VTPC 5BU5A 4M3LA 1N73B 5AW4B 1LTSC 1FAVA 3CI9A 4Y99C 3B5NB 3HTKB 1OXZA 4I2LC 2YKOA 3M0DC 3LIDA 4GKGA 1AFOA 4N78D 3HD7B 4C7NB 5CJ0A 1JY3N 3VMZA 1N7LA 3NTNA 1GL2B 1HJBA 3G3ZA 2FYZA 1IO4A 1E5WA 4EIJA 3HTKA 1H89A 1A02J 2O1KA 4KHXA 1LTIC 1FZEA 3OA7A 5AVUB 2MJZA 5AW1B 4Y99B 3PP5A 2HYNA 1CW5A 5AVSB 3HD7C 5AVTB 5AW5B 1HVVA 2A45G 3A2AA 2YO2A 3HUSA 5AVRB 1FZGA 3GHGC 3V4WA 1LTJA 1YTZI 1KILA 1SQVK 1N73C 1WT6A 3M0DA 1LWUA 1FZCB 3M06A 1SQBK 2LKMA 3WMM0 5KTBA 2PAJA 1GK4A 2N1TA 1KQLA 1NTMK 2QM7A 1S9KE 3TSIA 3V5BA 1N86A 5APTA 3NXSA 1EQ7A 1JY2P 1GDTA 2FYUK 2E43A 2OYIA 2GUVA 3BASA 3RK2C 2KLVA 4LC1A 3V2RA 4W80A 2IPPA 3VMYA 1KILC 1DX7A 2Q9IA 1IFMA 1LTTC 1FOSF 2ZXEB 1NAFA 4AYCA 1GD2E 2P7JA 2W27A 2ZFCA 2FKWB 3B5NA 3MD0A 1ZR2A 2WPSA 3L35A 3SWYA 1L4AD 3GHGA 3HUSC 3IR9A 1RF1C 2KP8A 2P1JA 3L37A 1SFCA 4WY4C 1GU5A 5CCHA 1GW3A 3MUDA 2N1TB 4N78E 1SQQK 1GL2C 4N3YB 3KYQA 4ZKUA 3E1IA 1KILB 3V4QA 3H32A 3KDPB 5KLVK 3M91A 1JY2O 3H32B 2IX7C 5APYA 2WSCH 3VYIA 2HPCB 3TYYA 3HE5A 3M9HA 1NU1K 2WTYA 1SVFA 1J1DB 3LIEA 2R32A 2P67A 5AVXB 1N7SB 5AW8B 1T2KD 4DOJA 2H7HA 3HE4B 1Z56A 4GT1A 4RESB 2XU6A 3HRNA 3P8MC 3CL3D 3A3YB 1ZV8A 1L4AB 1N2DC 2KYVA 1GL2D 2P2UA 1URQB 2HLOA 3P8CE 3M9QA 2WPRA 1S9KD 1LWUC 1MUUA 3U1AA 1KFMA 5BVZA 3CLQA 1LTJB 3HD7A 1T2KC 1RE4C 1URQA 2NPSC 1J2JB 2J59M 3P32A 3A7OA 1NKNA 1J1EB 4W7YA 5CCGC 2HODB 1LTJC 1YTZT 1IFNA 3T97A 2NPSB 5APWA 1HGVA 3RK3B 1AQ5A 3U59A 2R3CA 2O1JA 2CPBA 3MTUE 2OYHA 1HGZA 4N6JA 1CZQA 2NPSA 3B5ND 2A45I 3TK1A 2Z4EA 2HG5D 1G1JA 1FZFA 4IFDK 1NO4A 1JNMA 5AW2B 2FFDC 1SFCB 1M7LA 3BRVB 3HE5B 2OARA 2WPQA 2W6BA 4C7RA 1FZCC 3LW5H 2FXMA 1A02F 2M3BA 5APUA 1NKZB 3V2QA 2C9LY 3OAKA 2GUSA 5CCGD 1KFNA 1G2CA 4LGDE 1G2CB 1SP4A 2WSEH 3TNUA 2OYHB 2CPSA 1NH4A 3M9BA 1FU1A 1JY3P 1CSBA 2HFED 2POHA 1SLQA 1LT9C 3U1CA 2GM4A 3RK2B 2OYIC 1H8AA 1M1JA 1RE3A 2IFMA 4W7ZA 1JOCA 4XE5B 1LWUB 1LTAC 2O01H 3L4FA 1FZCA 4IFMA 3N7NA 3MGNA 1FJPA 3HD7D 3IFMA 2YO3A 3EFGA 4WBAA 3VP8A 1QL1A 3P7KA 2QM8A 1MZ9A 1GW4A 4XA4A 2KOGA 2PP6A 2FFDA 1FZAA 5CCGA 2KB7P 3BVHA 4WY4A 5AW0B 1DH3A 3O8ZA 5CMZA 2JEEA 2L5GB 5APVA 1LGHB 1L0NK 2WWWA 4LLHA 1RF0A 1FJKA 2WT7B 1M1JC 3NFQA 1FZBA 2XKMA 2Q3IA 2A45H 3M0AA 2YKPA 1J1DC 1FDMA 1FBMA 1ZLLA 3KPEA 2C9NY 5AVWB 2Z5HA 1T3UA 4OH8B 1GL2A 3TNUB 2WT7A 1LTBC 4WY4D 1LT9A 3RL0D 5AW9B 1L4AC 5KJ7A 1L0LK 3V2PA 5APSA 1RY3A 2FFDB 1GZLA 3R2PA 3VN0A 1KILD 3H6PA 2E42A 2N9BA 1SFCD 1L4AA 3RK2D 3VOPA 1N7SA 5AW6B 1JUNA 1JY2N 4C46A 1JY3O 2HODA 5CJ4A 1GTWA 1NTZK 3BATA 1MFZA 4I1LA 1NOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4A D;  3RL0 B;  1SFC A;  2NPS D;  4WY4 C;  5CCH A;  1URQ C;  5CCG D;  2N1T B;  4N78 E;  4LGD E;  1JTH B;  2XDJ A;  1GL2 C;  3KYQ A;  1KIL B;  5KJ7 C;  1NHL A;  1N7S D;  2HFE D;  3B5N B;  3HTK B;  3RK2 B;  3M0D C;  3HD7 B;  4W7Z A;  1GL2 B;  1N7S B;  1N7S C;  4WY4 B;  2YMY A;  5KJ7 D;  3HD7 D;  1L4A B;  3RK3 D;  5CCH C;  1GL2 D;  4JF7 A;  1URQ B;  2KOG A;  2PP6 A;  3P8C E;  5CCG A;  3PP5 A;  4WY4 A;  5CCH D;  3RK3 C;  3HD7 C;  1HVV A;  3HD7 A;  1URQ A;  2NPS C;  2WZ7 A;  4W7Y A;  1T3J A;  1XTG B;  2H8P D;  1KIL A;  4OH8 B;  1GL2 A;  5CCG C;  1SFC C;  4WY4 D;  3RL0 D;  2NPS B;  2N1T A;  1L4A C;  3RK3 B;  5KJ7 A;  2N1T C;  3TSI A;  3B5N C;  1URQ D;  1KIL D;  3RL0 C;  2M8R A;  1SFC D;  2NPS A;  1JTH A;  1L4A A;  3B5N D;  3RK2 D;  3RK2 C;  3VOP A;  1N7S A;  2HG5 D;  4W80 A;  1KIL C;  1SFC B;  3B5N A;  2N1T D; 
#chains in the Genus database with same CATH topology
 1HTL C;  3C1L A;  1SQB G;  3H1I J;  3E7K A;  4YPC A;  2WPV B;  4RJT A;  1IZN B;  1S5L X;  3E1R A;  3OJA B;  1M90 Q;  3VMX A;  1LT9 B;  1NU1 G;  2ZVN B;  3V2N A;  3MZW B;  3HUS B;  2OQQ A;  1H0T A;  1PV3 A;  1URQ C;  2WIT A;  1W2E A;  2YIU C;  3H1K E;  1M1K Q;  2K1A A;  2QG4 A;  3CWB G;  1HWT C;  1S2E A;  1VQ5 P;  1GK6 A;  1FDI A;  1R5S A;  1SQP K;  1AVY A;  1JTH B;  1VPC A;  2I1J A;  2XDJ A;  3L70 J;  3L71 J;  1NWQ A;  1VQK P;  3MP7 B;  3QWO C;  4JQ0 D;  2ITA A;  1OWA A;  2B88 A;  1BDC A;  5KJ7 C;  1CI6 A;  1NHL A;  2NZ2 A;  1CI6 B;  1YJ9 P;  4PJ0 H;  1N7S D;  1IJD B;  3AE2 C;  1AA0 A;  3B8E B;  2ZT9 B;  3I5C A;  1YIT P;  4WWI A;  1LTG C;  1T8Z A;  3SFE C;  3Q2Y A;  3H1H D;  3C8V A;  2J58 A;  3FWN A;  1AVO A;  3CCM P;  3D70 A;  1FS0 E;  3K5B A;  1DEE G;  3EFF K;  1NVO A;  2KNC A;  1VQM P;  1BE3 D;  2LR2 A;  1FC2 C;  1W5C E;  1YJW P;  2YKQ A;  2M5A A;  3L74 E;  1IC2 A;  3II6 A;  2M3E A;  3H1H E;  1MV8 A;  1QEX A;  1Q2N A;  1N7S C;  1S4X A;  4D6T E;  4WY4 B;  3PHL A;  3WU2 H;  2YMY A;  4R4L A;  2C0X A;  3SFD C;  1KQS O;  2IFN A;  2JO1 A;  5KJ7 D;  3UIA A;  5CHX A;  2HPC A;  2O3J A;  2H43 A;  3H1L J;  5CBN A;  1PL5 A;  3KQG A;  3RK3 D;  1DEB A;  4YXW H;  5DJU B;  5CCH C;  4OGQ C;  1QLE D;  4JF7 A;  4JYB A;  1K04 A;  5AVQ B;  5H2F E;  2KS1 B;  4ZKP A;  2Z5I A;  1FE6 A;  1SQV G;  3FWL A;  1N73 A;  5TJH A;  3RK3 E;  5KLV J;  5AW3 B;  3A5T A;  2ZYG A;  5CCH D;  4DZO A;  1RF0 C;  3HE4 A;  3RK3 C;  4BXL A;  1U57 A;  2PGD A;  5CBO A;  4TT3 H;  1OVU A;  4O9B A;  5APX A;  3AE8 C;  5E79 H;  3BRT B;  1JCC A;  1PP9 G;  2Y9Y A;  3SWF A;  4Z1M H;  4H44 D;  2Q1K A;  1SQX K;  2WSF H;  2JJL A;  2WVR A;  1BSH A;  3CXH D;  1NTK E;  3CWB D;  1WRG A;  3L73 E;  1ZRT E;  1SQQ G;  3N4X A;  5APQ A;  2R5D A;  1JCD A;  1NAY A;  2WZ7 A;  3BCC G;  1YBK A;  3C9I A;  1NTK K;  3AEC C;  1M56 D;  1HH0 A;  1DD3 A;  2W6A A;  1T3J A;  3L73 D;  3A0H E;  1XTG B;  4EOT A;  2H8P D;  1NTZ E;  1RE3 C;  2M5A B;  1PFI A;  2KZJ A;  3L74 J;  3S4R A;  3CCE P;  3ITK A;  1VQ7 P;  1SFC C;  3CX5 I;  1L0N E;  3L36 A;  4EI2 A;  1VF5 B;  4HH2 A;  1RF1 B;  1X79 B;  1EDJ A;  1K9M Q;  2BCC E;  1DH3 A;  5AVV B;  2Q5U A;  3CCS P;  2VRS A;  1X8Y A;  2BAS A;  1NU1 J;  2CK3 H;  4ZMD A;  2YXR B;  4AUW A;  1H88 A;  3G4S P;  2N1T C;  3B5N C;  4PV1 C;  1URQ D;  2KSJ A;  4JPZ B;  4BRY A;  3P8C D;  4GIF A;  4JYC A;  4HKZ H;  1IFJ A;  5AVY B;  1OW7 A;  3VP9 A;  1ZW0 A;  2YNY A;  1VQO P;  3RL0 C;  2M8R A;  5L8R J;  1R8E A;  1G1I A;  2E75 D;  2R5B A;  1IK9 A;  3F5H A;  2K9J A;  1ZN5 A;  3IAO A;  1JTH A;  1NJI Q;  2I1K A;  2C0W A;  1VDF A;  1J1E C;  1M1J B;  1LP1 A;  5BU8 B;  1KZU B;  2IBZ I;  4C7N A;  2E75 C;  1FOS E;  2WMM A;  5AVZ B;  1PPJ E;  1USD A;  4I6M C;  2XZR A;  5EFW B;  1VQ9 P;  1HUC A;  3I56 P;  3H25 A;  1SQB J;  4L74 A;  5AW7 B;  1K8A Q;  2OYI B;  1NTM G;  3AEF C;  2A06 G;  3WUV A;  3PJS K;  1ZR4 A;  1JMM A;  1X0T A;  2XNX A;  5C39 A;  3CC2 P;  4HYT B;  2N1T D;  3AEB C;  4PV1 D;  1JO5 A;  2B89 A;  2YMK A;  1XTC C;  2ZYD A;  4ZNC A;  2Q7C A;  1BGY D;  3EQ2 A;  4D6T D;  2KZI A;  1RE4 A;  4U3F J;  4AQR D;  4U3F E;  3TF5 A;  1GU4 A;  3RL0 B;  1SQP G;  2E5Y A;  4IFF A;  2NPS D;  1YYC A;  3L75 E;  4BWN A;  1KB9 I;  1IFI A;  1YQ3 C;  2OYO A;  2O01 N;  2IDB A;  2WSE J;  1R5L A;  3LW5 J;  4HJG H;  4IOI H;  3MIW A;  2WSF J;  5KLV G;  1QL2 A;  1BE3 E;  4IL6 X;  4WB4 A;  3Q5P A;  2OYH C;  3NMD A;  1OW8 A;  4XFJ A;  3GHG B;  1X9V A;  4Y28 J;  1IFD A;  4B86 A;  2HR3 A;  2XV5 A;  4KJM A;  1T6A A;  4KT0 J;  2KS1 A;  3VTP C;  5BU5 A;  2NRG A;  4M3L A;  1PP9 J;  1N73 B;  2PRR A;  5AW4 B;  1LTS C;  3GLM A;  1FAV A;  3CI9 A;  3CXH H;  3L73 J;  3B5N B;  4Y99 C;  5B66 H;  1UIX A;  1DD4 A;  1AV1 A;  1OXZ A;  2FYU G;  3HTK B;  1VL2 A;  4I2L C;  2YKO A;  3CX5 E;  3LID A;  2O01 J;  3M0D C;  4GKG A;  4HB1 A;  4N78 D;  3WUU A;  1AFO A;  3CXH E;  3HD7 B;  1ZOY C;  1KYO D;  4C7N B;  5CJ0 A;  1JY3 N;  1NGM B;  1L0L D;  1OMI A;  3CXH I;  1N7L A;  2Q3E A;  3NTN A;  1GL2 B;  4H44 C;  3BCC D;  3VMZ A;  1HJB A;  1VQL P;  3G3Z A;  1ZP0 C;  3L71 E;  3L70 E;  1Q86 Q;  1KYO E;  2D2C D;  2FYZ A;  5KLI B;  1IO4 A;  1E5W A;  1EZV E;  1NTZ D;  3CX5 D;  1PGP A;  4H13 B;  2E76 C;  1FDO A;  4EIJ A;  3HTK A;  4I7Z C;  1H89 A;  1KB9 E;  3L72 E;  1SQP J;  3H1J E;  4EYY Q;  3OW2 O;  1A02 J;  2QSI A;  2O1K A;  4KHX A;  1LTI C;  1FZE A;  3OA7 A;  2Q6Q A;  1QVF O;  5AVU B;  3AE6 C;  1NTK D;  2MJZ A;  1L0L G;  5AW1 B;  3IF4 A;  3T97 B;  4Y99 B;  3G71 P;  5KKZ B;  3AE3 C;  3PP5 A;  2HYN A;  2H88 C;  3H1L D;  1CW5 A;  2RN0 A;  2FYN C;  5AVS B;  3BCC J;  4QMA A;  2AXC A;  1L0L J;  1BSN A;  3HD7 C;  1USE A;  1EZV I;  2N9Y B;  2V7Q J;  3AE5 C;  3VMA A;  5AVT B;  1KYO I;  1BDD A;  1HVV A;  3A0H H;  2A45 G;  2QIW A;  5AW5 B;  1KV4 A;  1YQ4 C;  3A2A A;  1L0N D;  2LXB A;  2L91 A;  4NPE A;  4EDF A;  2JR8 A;  2R44 A;  2IBZ E;  1Q81 Q;  5KLV D;  2YO2 A;  3HUS A;  3H1L E;  4CPG A;  3D6Y A;  2RH0 A;  3H1I E;  1YI2 P;  1H0T B;  5KAI H;  4ASW A;  2M0B A;  5AVR B;  1VF5 D;  3CWB J;  1FZG A;  3GHG C;  1M8O B;  2ZJS E;  3MHV A;  3V4W A;  2QJK B;  1LTJ A;  1JB0 J;  2W6J H;  3ABV C;  1YTZ I;  2QJP C;  3FXD A;  1KIL A;  1SQV K;  3RBZ A;  1SQB D;  1N73 C;  3SSU A;  1LP1 B;  1OZH A;  1WT6 A;  3M0D A;  3O6Q B;  1SS1 A;  2AXT E;  3FX0 A;  1LWU A;  1Q90 D;  2B87 A;  3M06 A;  1SQB K;  2LKM A;  3WMM 0;  5KTB A;  3Q5S A;  2PAJ A;  1YHQ P;  1GK4 A;  3CCQ P;  2N1T A;  1KQL A;  1VQN P;  1EXJ A;  1KMI Z;  3EWK A;  1NTM K;  2K9J B;  2QE7 H;  4U3F D;  1SQX G;  2QM7 A;  1VQP P;  3TSI A;  3V5B A;  1S9K E;  4R4M A;  1N86 A;  3H1H J;  3MUD C;  5APT A;  2W8Z A;  3NXS A;  4H0L C;  2QJP B;  5KLI C;  1LNQ A;  1EQ7 A;  4PJ0 E;  5KAI E;  1OVR A;  1SQX J;  1JY2 P;  2G8Y A;  3G6E P;  1GDT A;  1Y9B A;  4H0L D;  5K5G B;  1KC8 Q;  3A0B H;  2FYU K;  2E43 A;  2OYI A;  2GUV A;  3BAS A;  1U7M A;  1BGY G;  1RF1 A;  3TGU D;  3RK2 C;  2KLV A;  4LC1 A;  2IYP A;  4NPD A;  3G9R A;  3V2R A;  1IK7 A;  4W80 A;  2IPP A;  1OIP A;  1KIL C;  1PZQ A;  4H0L B;  1S5L H;  1IFM A;  1LTT C;  3VMY A;  2Q9I A;  1BCC G;  1FOS F;  2Y0C A;  1OFC X;  1NAF A;  2E74 D;  2ZXE B;  4AYC A;  1GD2 E;  2P7J A;  2W27 A;  2ZFC A;  2FKW B;  3B5N A;  3CX5 H;  3MD0 A;  2JDI H;  1ZR2 A;  2WPS A;  3L35 A;  5B66 E;  3TGU G;  2Y0E A;  1JEK A;  1L4A D;  1EZV D;  3SWY A;  3GHG A;  3HUS C;  1VF5 C;  3IR9 A;  2KP8 A;  3JCU H;  1RF1 C;  2ZXX A;  2P1J A;  3L37 A;  1KYO H;  1SFC A;  4WY4 C;  2E74 B;  1YIJ P;  1GU5 A;  3AE9 C;  5CCH A;  3L73 G;  1GW3 A;  1FZC B;  3MUD A;  1P84 H;  2N1T B;  3BCC E;  4N78 E;  4PV1 B;  2SPZ A;  1NTK J;  4OGQ B;  1SQQ K;  4L73 A;  1KQF B;  1GL2 C;  4DJG A;  4N3Y B;  1N8R Q;  2QEX P;  2BCC J;  3KYQ A;  3JC2 2;  4ZKU A;  3E1I A;  1KIL B;  3V4Q A;  3H32 A;  3KDP B;  3L74 G;  5KLV K;  1S5L E;  3M91 A;  1JY2 O;  3H32 B;  5DJT B;  2FY8 A;  1BGY J;  4A7P A;  1HJ0 A;  1M57 D;  1NTZ J;  2IX7 C;  3H1K G;  5APY A;  1ZME C;  3CWB E;  2WSC H;  3VYI A;  2HPC B;  3TYY A;  1PGQ A;  3HE5 A;  3M9H A;  1NU1 K;  2IBZ D;  2WTY A;  3AEA C;  1SVF A;  1J1D B;  3KHU A;  4GOF A;  3H1K J;  3LIE A;  3Q1M A;  4GDO A;  2R32 A;  1EDI A;  2P67 A;  2WSC J;  5KKZ C;  3KZI H;  5AVX B;  1EXI A;  1N7S B;  3PRJ A;  4PD4 H;  5AW8 B;  2ZT9 D;  1T2K D;  4DOJ A;  3D6Z A;  3D71 A;  2H7H A;  3HE4 B;  2KIK A;  1Z56 A;  3FGA D;  3AE4 C;  4GT1 A;  4RES B;  2XU6 A;  3AED C;  2AEF A;  3HRN A;  3CL3 D;  3P8M C;  1PGO A;  3A3Y B;  1ZV8 A;  3GMA A;  5B5E H;  1L4A B;  4RO0 A;  5GTI E;  1N2D C;  2KYV A;  2ZAE B;  3B4S A;  1GL2 D;  5E79 E;  1P84 I;  2Y9Z A;  1DIP A;  2BEQ D;  2P2U A;  2G3A A;  1URQ B;  2YIU B;  2HLO A;  1GMJ A;  3P8C E;  5KAF E;  4UB6 E;  2KUB A;  3M9Q A;  3H1H G;  2WPR A;  4H13 D;  1LT1 A;  1P84 D;  1LWU C;  1MUU A;  1SQQ E;  2B87 B;  3U1A A;  4D6T G;  1S9K D;  1MKM A;  1NTM J;  4UB8 H;  3CCU P;  1KFM A;  5BVZ A;  2K3R A;  3CLQ A;  1KOR A;  1SQB E;  3L75 J;  1LTJ B;  3RGU A;  4D6T J;  2W90 A;  3HD7 A;  1PGJ A;  1KTM A;  3W68 A;  2ZT9 C;  1T2K C;  1SQV E;  3CME P;  1NU1 E;  4JBZ A;  1RE4 C;  1URQ A;  1SQP E;  2NPS C;  3AE7 C;  3H1J J;  3L72 J;  3QH9 A;  2QA4 P;  3W67 A;  1J2J B;  2J59 M;  3P32 A;  3A7O A;  2B9B A;  1NKN A;  2JP3 A;  4PD4 I;  1J1E B;  1SQP D;  1BE3 G;  4W7Y A;  4BRY B;  1EC5 A;  4H44 B;  1NU1 D;  4U7J A;  5CCG C;  2HOD B;  1LTJ C;  2AEJ A;  1AJY A;  1NYH A;  1OW6 A;  1YTZ T;  1VQ6 P;  3CPW O;  1K05 A;  1IFN A;  3FXE A;  2RMZ A;  4L75 A;  1UII A;  3T97 A;  2NPS B;  2UWJ E;  3L75 D;  5APW A;  1HGV A;  2ZVO B;  1RQU A;  2QRX A;  3RK3 B;  1S3J A;  1NTM D;  1AQ5 A;  1KB9 H;  3U59 A;  2YXQ B;  1W2B O;  2R3C A;  2O1J A;  2KXP B;  2CPB A;  2WSS H;  1IFP A;  3GW6 A;  1E79 H;  1HGZ A;  3MTU E;  1D7M A;  2IYO A;  1CZQ A;  2P10 A;  4N6J A;  2OYH A;  3CC4 P;  4UB6 H;  2BCC G;  3L72 D;  3CMA P;  2BEZ F;  1BCC J;  2KLU A;  2ZYA A;  2H89 C;  1NTM E;  4MN4 C;  2A06 E;  2NPS A;  3B5N D;  4DT0 A;  1DX7 A;  3L72 G;  3TGU J;  1EDK A;  1RH5 B;  3PTZ A;  2A45 I;  1SQV J;  3TK1 A;  2HG5 D;  2OTK E;  1G1J A;  1FZF A;  2Z4E A;  4IFD K;  1NO4 A;  1L0L E;  1VQ4 P;  1JNM A;  5AW2 B;  2FFD C;  1SFC B;  1PP9 D;  1KIL E;  1PIX A;  2KSE A;  1M7L A;  1ZRT D;  5H2F H;  2RKL A;  2MKV A;  3H1J D;  3BRV B;  2IZ0 A;  5KLV E;  5TIS E;  2KI7 B;  3HE5 B;  2OAR A;  5TIS H;  1K73 Q;  1KN7 A;  1AQT A;  1PP9 E;  2KK7 A;  5GTH E;  1KB9 D;  2WPQ A;  2WQY C;  4I7Z B;  2W6B A;  3S1K A;  3R4Y A;  3LW5 H;  4C7R A;  1S72 P;  2FXM A;  1FZC C;  1A02 F;  2M3B A;  1ZXG A;  2R3S A;  1NTK G;  5APU A;  3S9O A;  1NKZ B;  3V2Q A;  2C9L Y;  1RQV A;  3OAK A;  2GUS A;  2FXO A;  2V4H A;  5CCG D;  1KFN A;  1G2C A;  1MFT A;  4LGD E;  2J5U A;  4K3A A;  1G2C B;  1SP4 A;  1NTZ G;  1JMB A;  1P84 E;  2WSE H;  3TNU A;  4TLF A;  2OYH B;  2CPS A;  4U3F G;  3TDK A;  1NH4 A;  3M9B A;  1FU1 A;  1L0N G;  1JY3 P;  3L75 G;  1CSB A;  1KQG B;  2JKV A;  2E75 B;  3L71 G;  2HFE D;  2POH A;  1SLQ A;  3H1I D;  1LT9 C;  1S1C X;  5M1B A;  3U1C A;  4OGQ D;  2GM4 A;  3RK2 B;  3CCJ P;  1EDL A;  3CC7 P;  1L0N J;  2OYI C;  1SQV D;  1H8A A;  1M1J A;  2FYU D;  2FXP A;  2GA1 A;  1RE3 A;  2IFM A;  4IL6 E;  4W7Z A;  3H1K D;  3O6Q A;  1JOC A;  2PFX A;  4XE5 B;  1LWU B;  1LTA C;  2O01 H;  2LXC B;  4H13 C;  3L4F A;  1Q7Y Q;  1FZC A;  4IFM A;  1OX3 A;  2JWA A;  3N7N A;  2FYU E;  3MGN A;  2OTJ P;  2FYU J;  1FJP A;  3HD7 D;  2AEM A;  4WVZ A;  3Q5R A;  1BGY E;  3IFM A;  2YO3 A;  3PH0 A;  1KD1 Q;  3EFG A;  2E76 B;  4WBA A;  3VP8 A;  1QL1 A;  3A0B E;  2QM8 A;  1MZ9 A;  3P7K A;  3PLN A;  1GW4 A;  1PPJ G;  2KOG A;  2PP6 A;  3JSV C;  2IBZ G;  4GOD A;  1FZA A;  4OWF A;  4XA4 A;  2KB7 P;  2V7Q H;  3H1L G;  4YXD C;  5CCG A;  3BVH A;  4WY4 A;  5AW0 B;  1EZV G;  2IZ1 A;  3O8Z A;  5GTH H;  3V6I A;  1JM0 A;  1X22 A;  2JEE A;  4GOE A;  5CMZ A;  4RKU J;  2L5G B;  3GF7 A;  1PPJ D;  2OTL P;  5APV A;  3L74 D;  2E76 D;  1LGH B;  1L0N K;  2WWW A;  1LJ2 A;  1RF0 A;  3H1J G;  4L76 A;  3B71 A;  4LLH A;  3WUT A;  1FJK A;  2D2C C;  3TGU E;  2WT7 B;  1M1J C;  2K88 A;  3NFQ A;  1U7J A;  1FZB A;  2XND H;  2FFD A;  1BE3 J;  2AXT H;  2XKM A;  2QJK C;  4OVN F;  2Q3I A;  2A45 H;  2QJY C;  3SWK A;  3M0A A;  2YKP A;  1J1D C;  2K37 A;  4YTP C;  1FDM A;  1QGK B;  1FBM A;  1SQX E;  1ZLL A;  3KPE A;  1SQQ J;  4IL6 H;  2C9N Y;  5AVW B;  2Z5H A;  1T3U A;  1VQ8 P;  4OH8 B;  1GL2 A;  3AEE C;  3I55 P;  1HBW A;  3TNU B;  2WT7 A;  2D2C B;  1LTB C;  3H1I G;  3AEG C;  4NPF X;  3KXD A;  4WY4 D;  1LT9 A;  2DW3 A;  2A06 D;  3RL0 D;  4DCK A;  1Y8A A;  3L71 D;  3KZI E;  2W83 C;  1WMK A;  5AW9 B;  1Q82 Q;  1L4A C;  1SQX D;  5KAF H;  5KJ7 A;  1QX8 A;  1L0L K;  2K9Y A;  4PD4 D;  3V2P A;  1OVV A;  3CCL P;  5APS A;  1HF9 A;  5GTI H;  3CCV P;  1RY3 A;  2FFD B;  5B5E E;  2E74 C;  1GZL A;  3AE1 C;  3GF3 A;  2E5T A;  3WU2 E;  2FYN B;  3L70 G;  3R2P A;  3VN0 A;  3ZDM A;  1KIL D;  2QJY B;  3H6P A;  3USS A;  2E42 A;  1BCC E;  2N9B A;  2BCC D;  1SFC D;  1L2P A;  2Y0D A;  4K35 A;  4PD4 E;  1L4A A;  3IN6 A;  3L70 D;  1RHZ B;  2FBW C;  2KNC B;  3RK2 D;  3CCR P;  3VOP A;  3RL0 g;  1QVG O;  3GG2 A;  1Y47 A;  1SQQ D;  1N7S A;  5AW6 B;  4ASV A;  1JUN A;  1JY2 N;  4C46 A;  1JY3 O;  2P58 A;  2HOD A;  3Q3D A;  5CJ4 A;  1GTW A;  1BCC D;  1NTZ K;  2I8D A;  3F89 A;  3JCU E;  3RBX A;  2OGU A;  3BAT A;  3CD6 P;  1TU3 F;  1MFZ A;  4I1L A;  4UB8 E;  1NOH A;  2QVA A;  2JWD A;  1YJN P; 
#chains in the Genus database with same CATH homology
 1HTL C;  3OJA B;  3VMX A;  1LT9 B;  3V2N A;  3HUS B;  1URQ C;  2WIT A;  1W2E A;  1HWT C;  1GK6 A;  1VPC A;  2I1J A;  1SQP K;  1JTH B;  1HBW A;  1NWQ A;  2XDJ A;  1OWA A;  5KJ7 C;  1CI6 A;  1NHL A;  1CI6 B;  1N7S D;  1IJD B;  3B8E B;  3I5C A;  1LTG C;  1T8Z A;  2J58 A;  2YKQ A;  1IC2 A;  3II6 A;  1MV8 A;  1RF1 A;  1N7S C;  4WY4 B;  2YMY A;  2C0X A;  2IFN A;  5KJ7 D;  3UIA A;  5CHX A;  2HPC A;  2H43 A;  3KQG A;  3RK3 D;  1DEB A;  5CCH C;  5AVQ B;  4JF7 A;  4JYB A;  4ZKP A;  2Z5I A;  1N73 A;  5AW3 B;  3A5T A;  5CCH D;  4DZO A;  1RF0 C;  3HE4 A;  3RK3 C;  4O9B A;  5APX A;  3BRT B;  1JCC A;  3SWF A;  1SQX K;  2WSF H;  2JJL A;  1WRG A;  5APQ A;  3N4X A;  2R5D A;  1JCD A;  2WZ7 A;  3C9I A;  1NTK K;  1HH0 A;  2W6A A;  1T3J A;  1XTG B;  4EOT A;  2H8P D;  1RE3 C;  1PFI A;  1SFC C;  3L36 A;  1RF1 B;  4HH2 A;  1X79 B;  5AVV B;  2Q5U A;  2VRS A;  1X8Y A;  2BAS A;  4AUW A;  1H88 A;  2N1T C;  3B5N C;  1URQ D;  2KSJ A;  3P8C D;  4GIF A;  4JYC A;  1IFJ A;  5AVY B;  3VP9 A;  2YNY A;  3RL0 C;  2M8R A;  1G1I A;  2R5B A;  1IK9 A;  1ZN5 A;  1JTH A;  2I1K A;  2C0W A;  1VDF A;  1J1E C;  1M1J B;  5BU8 B;  1KZU B;  4C7N A;  1FOS E;  5AVZ B;  4I6M C;  2XZR A;  1HUC A;  5AW7 B;  2OYI B;  1ZR4 A;  1JMM A;  1JO5 A;  2XNX A;  4HYT B;  2N1T D;  1XTC C;  2Q7C A;  3EQ2 A;  4AQR D;  1RE4 A;  1GU4 A;  3RL0 B;  4IFF A;  2NPS D;  1YYC A;  1IFI A;  3MIW A;  2OYH C;  1QL2 A;  4WB4 A;  3NMD A;  3GHG B;  1X9V A;  1IFD A;  4B86 A;  2XV5 A;  3VTP C;  5BU5 A;  4M3L A;  1N73 B;  5AW4 B;  1LTS C;  1FAV A;  3CI9 A;  4Y99 C;  3B5N B;  3HTK B;  1OXZ A;  4I2L C;  2YKO A;  3M0D C;  3LID A;  4GKG A;  1AFO A;  4N78 D;  3HD7 B;  4C7N B;  5CJ0 A;  1JY3 N;  3VMZ A;  1N7L A;  3NTN A;  1GL2 B;  1HJB A;  3G3Z A;  2FYZ A;  1IO4 A;  1E5W A;  4EIJ A;  3HTK A;  1H89 A;  1A02 J;  2O1K A;  4KHX A;  1LTI C;  1FZE A;  3OA7 A;  5AVU B;  2MJZ A;  5AW1 B;  4Y99 B;  3PP5 A;  2HYN A;  1CW5 A;  5AVS B;  3HD7 C;  5AVT B;  5AW5 B;  1HVV A;  2A45 G;  3A2A A;  2YO2 A;  3HUS A;  5AVR B;  1FZG A;  3GHG C;  3V4W A;  1LTJ A;  1YTZ I;  1KIL A;  1SQV K;  1N73 C;  1WT6 A;  3M0D A;  1LWU A;  1FZC B;  3M06 A;  1SQB K;  2LKM A;  3WMM 0;  5KTB A;  2PAJ A;  1GK4 A;  2N1T A;  1KQL A;  1NTM K;  2QM7 A;  1S9K E;  3TSI A;  3V5B A;  1N86 A;  5APT A;  3NXS A;  1EQ7 A;  1JY2 P;  1GDT A;  2FYU K;  2E43 A;  2OYI A;  2GUV A;  3BAS A;  3RK2 C;  2KLV A;  4LC1 A;  3V2R A;  4W80 A;  2IPP A;  3VMY A;  1KIL C;  1DX7 A;  2Q9I A;  1IFM A;  1LTT C;  1FOS F;  2ZXE B;  1NAF A;  4AYC A;  1GD2 E;  2P7J A;  2W27 A;  2ZFC A;  2FKW B;  3B5N A;  3MD0 A;  1ZR2 A;  2WPS A;  3L35 A;  3SWY A;  1L4A D;  3GHG A;  3HUS C;  3IR9 A;  1RF1 C;  2KP8 A;  2P1J A;  3L37 A;  1SFC A;  4WY4 C;  1GU5 A;  5CCH A;  1GW3 A;  3MUD A;  2N1T B;  4N78 E;  1SQQ K;  1GL2 C;  4N3Y B;  3KYQ A;  4ZKU A;  3E1I A;  1KIL B;  3V4Q A;  3H32 A;  3KDP B;  5KLV K;  3M91 A;  1JY2 O;  3H32 B;  2IX7 C;  5APY A;  2WSC H;  3VYI A;  2HPC B;  3TYY A;  3HE5 A;  3M9H A;  1NU1 K;  2WTY A;  1SVF A;  1J1D B;  3LIE A;  2R32 A;  2P67 A;  5AVX B;  1N7S B;  5AW8 B;  1T2K D;  4DOJ A;  2H7H A;  3HE4 B;  1Z56 A;  4GT1 A;  4RES B;  2XU6 A;  3HRN A;  3P8M C;  3CL3 D;  3A3Y B;  1ZV8 A;  1L4A B;  1N2D C;  2KYV A;  1GL2 D;  2P2U A;  1URQ B;  2HLO A;  3P8C E;  3M9Q A;  2WPR A;  1S9K D;  1LWU C;  1MUU A;  3U1A A;  1KFM A;  5BVZ A;  3CLQ A;  1LTJ B;  3HD7 A;  1T2K C;  1RE4 C;  1URQ A;  2NPS C;  1J2J B;  2J59 M;  3P32 A;  3A7O A;  1NKN A;  1J1E B;  4W7Y A;  5CCG C;  2HOD B;  1LTJ C;  1YTZ T;  1IFN A;  3T97 A;  2NPS B;  5APW A;  1HGV A;  3RK3 B;  1AQ5 A;  3U59 A;  2R3C A;  2O1J A;  2CPB A;  3MTU E;  2OYH A;  1HGZ A;  4N6J A;  1CZQ A;  2NPS A;  3B5N D;  2A45 I;  3TK1 A;  2Z4E A;  2HG5 D;  1G1J A;  1FZF A;  4IFD K;  1NO4 A;  1JNM A;  5AW2 B;  2FFD C;  1SFC B;  1M7L A;  3BRV B;  3HE5 B;  2OAR A;  2WPQ A;  2W6B A;  4C7R A;  1FZC C;  3LW5 H;  2FXM A;  1A02 F;  2M3B A;  5APU A;  1NKZ B;  3V2Q A;  2C9L Y;  3OAK A;  2GUS A;  5CCG D;  1KFN A;  1G2C A;  4LGD E;  1G2C B;  1SP4 A;  2WSE H;  3TNU A;  2OYH B;  2CPS A;  1NH4 A;  3M9B A;  1FU1 A;  1JY3 P;  1CSB A;  2HFE D;  2POH A;  1SLQ A;  1LT9 C;  3U1C A;  2GM4 A;  3RK2 B;  2OYI C;  1H8A A;  1M1J A;  1RE3 A;  2IFM A;  4W7Z A;  1JOC A;  4XE5 B;  1LWU B;  1LTA C;  2O01 H;  3L4F A;  1FZC A;  4IFM A;  3N7N A;  3MGN A;  1FJP A;  3HD7 D;  3IFM A;  2YO3 A;  3EFG A;  4WBA A;  3VP8 A;  1QL1 A;  3P7K A;  2QM8 A;  1MZ9 A;  1GW4 A;  4XA4 A;  2KOG A;  2PP6 A;  2FFD A;  1FZA A;  5CCG A;  2KB7 P;  3BVH A;  4WY4 A;  5AW0 B;  1DH3 A;  3O8Z A;  5CMZ A;  2JEE A;  2L5G B;  5APV A;  1LGH B;  1L0N K;  2WWW A;  4LLH A;  1RF0 A;  1FJK A;  2WT7 B;  1M1J C;  3NFQ A;  1FZB A;  2XKM A;  2Q3I A;  2A45 H;  3M0A A;  2YKP A;  1J1D C;  1FDM A;  1FBM A;  1ZLL A;  3KPE A;  2C9N Y;  5AVW B;  2Z5H A;  1T3U A;  4OH8 B;  1GL2 A;  3TNU B;  2WT7 A;  1LTB C;  4WY4 D;  1LT9 A;  3RL0 D;  5AW9 B;  1L4A C;  5KJ7 A;  1L0L K;  3V2P A;  5APS A;  1RY3 A;  2FFD B;  1GZL A;  3R2P A;  3VN0 A;  1KIL D;  3H6P A;  2E42 A;  2N9B A;  1SFC D;  1L4A A;  3RK2 D;  3VOP A;  1N7S A;  5AW6 B;  1JUN A;  1JY2 N;  4C46 A;  1JY3 O;  2HOD A;  5CJ4 A;  1GTW A;  1NTZ K;  3BAT A;  1MFZ A;  4I1L A;  1NOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...