3HDSA

Crystal structure of 4-methylmuconolactone methylisomerase in complex with mes
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
PQFEKIEGRMIRILYLLVKPESMSHEQFRKECVVHFQMSAGMPGLHKYEVRLVAGNPTDTHVPYLDVGRIDAIGECWFASEEQYQVYMESDIRKAWFEHGKYFIGQLKPFVTEELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and catalytic mechanism of 4-methylmuconolactone methylisomerase
pubmed doi rcsb
source organism Pseudomonas reinekei
molecule tags Isomerase
molecule keywords 4-methylmuconolactone methylisomerase
total genus 29
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature ec 5.4.99.14: 4-carboxymethyl-4-methylbutenolide mutase.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09448 MmlI Methylmuconolactone methyl-isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hdsA01
3VTIA 1TUVA 2LQBA 3LGMA 5F0WA 4DL0C 3IWLA 3TOQA 5B0BA 1TR0A 3TNVA 4HH0A 2QLWA 1N5SA 2GV1A 4ZOSA 5F0UA 4Y2KA 4FNIA 1FVQA 2XMWA 1FEEA 1TL5A 1U7LA 2XMTA 1ULRA 1N5QA 2GGPB 1FE4A 2OAUA 2VH7A 2KYZA 2LDIA 4YDXA 4ZA1A 1LQ9A 1QUPA 1YJUA 2ZDOA 2K7JA 3QGPA 4HI1A 3FRYA 2QLXA 4NL5A 5B0AA 3HF5A 2W4CA 3KKFA 1YRXA 2G9OA 1N5TA 3E8OA 1VQYA 5B0DA 5K9FA 3HDSA 2ROEA 3CJKB 2OKQA 1SQEA 1Y9OA 1MWZA 3BN7A 1OQ6A 2N7YA 4F67A 2GGPA 4FNHA 3FMBA 4HL9A 1APSA 1RJJA 1GXUA 2PGCA 2HLTA 3MZIA 1Y0HA 2FHMA 3HHLD 1JWWA 3BR8A 3UDCA 1Q8BA 5T7LA 4U9RA 1AW0A 5B0EA 2IFXA 2W4DA 2XMMA 2AJ0A 2RSQA 1URRA 3CJKA 2OD4A 3GZ7A 5B09A 3HHLB 1OQ3A 1OSDA 2FTRA 1Y3KA 3BDEA 4OJ3A 2W4PA 1YJTA 3K7RA 2AP6A 2K2PA 2FB0A 3LGNA 1FVSA 4QOTA 5IXUA 2KT3A 4YEAA 5B0FA 2N4DA 2BJDA 5T7LB 2GFFA 1JK9B 2K1RB 2QIFA 2OP5A 3HX9A 1Q4RA 1IUJA 1X8DA 2ZDPA 2RU9A 4NPOA 1CC7A 4OJ1A 3KG0A 2OFGX 5B08A 1Y3JA 2K7KA 3F44A 3HHLA 1KQKA 3HFKA 5B0GA 4HI2A 4A46A 2EW9A 1P6TA 2HLUA 2FIUA 2N4CA 2Q3PA 2AJ1A 1AFIA 5B0CA 2RMLA 3DCAA 2JDJA 3HHLC 1V3ZA 1CPZA 2L3MA 2GCFA 4A47A 1OPZA 2VV5A 2K1RA 2ROGA 4HH1A 2BBEA 1KVIA 1MWYA 1TZ0A 3T9NA 2OFHX 4EFAC 2ASYA 2BJEA 3BM7A 3KNGA 1X0PA 2XMKA 3FGVA 3I9ZA 4DPOA 2RILA 1P8GA 1R6YA 2KT2A 4DN9A 3LO3A 4Y2IA 2HFOA 2CRLA 1CC8A 3DXSX 2LXFA 2HFNA 2OD6A 1K0VA 1YJRA 2KKHA 5KAKA 1TL4A 2XMVA 1FE0A 1GXTA 3QMQA 4OJGA 5A6WA 2BUNA 3KG1A 2LQ9A 2BYCA 2PD1A 2GA7A 1WD6A 4Q2LA 2OMOA 2ACYA 1FESA 1Q8LA 4Q2MA 3TRGA 4Y2MA 3WDOA 1SI9A 1SB6A 1XBWA 2XMUA 3BF4A 3IWXA 4OJHA 1VQSA 2HQIA 1YG0A 2AW0A 3BGUA 1YJVA 1S6UA 3BB5A 1S6OA 2XMJA 2GO8A 4A48A 1N5VA 1AFJA 1X7VA 2QYCA 3MCSA 1KVJA 2HIQA 2IYIA 4A4JA 2IYGA 1FD8A 1W2IA 1Q53A 2ROPA 4OIXA 5A6PA
chains in the Genus database with same CATH superfamily
5GAGU 2HZVA 2UZAA 3TEHB 2D1CA 4C8OA 3ZZTA 2XEXA 2Z8QA 1FKOA 1NAQA 2YKNA 2F3JA 3NCPA 4ES2A 1OWXA 2IRUA 4ZCMA 4DV3J 1WOSA 1XEZA 1FDDA 2BKNA 4Y2KA 4JI1F 5GAGI 2VDIA 1X4FA 2BE7D 2OPSB 5MAOA 4JYAJ 1KKHA 1JLBA 2FVCA 4YDXA 2VH7A 4Q44A 2HNZB 2XTJP 2ZDOA 4E98A 4DWIA 2AJFE 2CFXA 2E7XA 3FRYA 3IR6B 5IT4A 4RU9A 4NCBA 4ZDNA 3HF5A 3QGHA 5ETRA 5F8MA 4GVBA 2J76E 1C0TA 1JMTA 1XR5A 1UZDA 1F60B 3ENWA 3CC4S 2FZGB 2B5JB 4L3KA 4W4MA 3BR9A 4R5PB 2UXDJ 2KFNA 4JI2F 1WC3A 3V5RA 5DETA 2YNFA 1M5SA 1NPRA 1OYEA 1ZAWA 5ETTA 1GH8A 2N3LA 1Y0HA 3HT3A 1UVLA 5ETSA 2RKIB 2YWGA 3BR8A 4WYWA 4LF6J 3S01A 2HMIA 4V19X 1U8SA 1RGVA 2RS2A 2AJQA 1AW0A 1FRIA 1MWQA 5HMWA 5J1EB 5LSOA 1NK5A 3CJTA 2P9GA 2Z58B 2IPOB 1NBEB 3QAEA 2PMZD 4DCPB 1T94A 3T3FA 1KLNA 2NZ4A 3M2UA 4CO1A 2DT9A 1NK4A 4ZIVA 2Y8WA 1EQMA 3N6MA 3LGNA 3VGTA 1JLFB 3I6PA 1GK8A 2EBGA 2D9OA 4ZS6A 1HWKA 3C15B 3DMJB 4P71A 2MXYA 4ECQA 5JUMA 2ZDPA 4USVA 1VR6A 4Y2AA 4YR3A 1TUWA 2FVPA 2ABYA 3C16A 2MZRA 1S1UB 2IAJB 5B0GA 4NI2B 4LF9J 5HQ8A 3N79A 3P6YC 2JHEA 1U1RA 2VPYB 3T5LA 1U47A 1FNOA 3TWZA 4A47A 3HHNB 2KFZA 1QTNB 3KXDA 4WU2A 4X66J 2VBYA 5CQGA 3HKZD 2R2TA 3D4JA 2E9TA 3HSZA 3FFIA 2QG9B 3F73A 2G4BA 4JI2J 4J9SA 2RIJA 3OR1B 3TA1A 3W63A 1H98A 1HW8A 1R8BA 5KFJA 2DR8A 1RKIA 2RH3A 4DPOA 4RW4B 1FJEB 3J7AN 4XPEA 3CCUS 1P8GA 2FJAB 4DFPA 1NEEA 1S57A 1TKZB 2KJVA 2QA1A 4ZVOB 2M5YA 2YNGA 4NPOA 1JNZB 3DM2B 1CJTA 3W64A 4DLGA 5D4NA 2H5EA 3GIKA 4X4UA 3GU0A 1KFDA 3DC2A 3OHAA 3CD0A 3M8QB 1WORA 3ENQA 1U49A 1KQSR 3BQ1A 1XERA 1VLOA 4ETXA 3OD2A 3BYRA 1PJ7A 3ZZPA 2ZBCA 1U1QA 1VHIA 3CWJA 1H3DA 1IWAA 3JSRA 2FY1A 2HVIA 1F5AA 1WHXA 1R31A 4X4NA 3KTQA 1RHJB 2GHVC 1FWLA 4ZLJA 1RWKB 1LW2A 1WF1A 4WE1A 1F5BA 1SB6A 5CAAA 5LOQA 1QLNA 3G82B 4RW6B 2D41A 3OTBA 3QIPB 1WC5A 4P74A 5E3CA 1NK9A 4QU6A 3CSKA 2OPPA 3IN5A 4DV1J 2GO8A 4B3MJ 1WWHA 2B4VA 4MIWA 1AFJA 1PJ6A 5EDWA 3K5OA 2CPJA 3K5PA 4L74A 1OS5A 2E9ZA 2W1BA 4AD6A 8RUCA 4DX8H 2IYIA 3HVRA 1FHTA 1HQUA 2VG5B 4C2MA 1EX8A 1NSAA 3AJ1A 2H54B 1VIOA 5A6PA 5EHHA 2MGZA 4LUBA 3KJVB 2R2UA 4F4KA 3CMQA 5T41A 4YB1P 1UAWA 1RU2A 4DL0C 3C6UA 4ZLLA 1SVDA 4CLKA 4F26A 2BOAA 2EFPA 1XJWB 1RT6B 2BW7A 2LMIA 4ED6A 4M1KA 2W2NP 1LW0A 4NCGA 1FEEA 4IR1A 2XMTA 2UUWA 5D4LA 1W25A 5DO2A 2IRYA 4J5OA 3QGPA 5ETMA 1HYSB 3KMQA 2F9JA 3CJQA 2SXLA 2MEWA 4J9OA 2W2OP 3I0SA 5F8NA 4CRJA 2LQJA 2UVUA 1U6ZA 5BR8F 1R27B 1FNMA 1GMUA 1Y9OA 2QFIA 2ZBIA 4OZJA 1OQ6A 1TKTB 4ELTA 2QLBB 4K4VA 4NLUA 3CCMS 4DR7F 1DJ0A 2HGNA 3IG1B 1NH8A 3MURP 1HNWF 1TK5A 2FJDB 4N41A 4Q0BA 2R2RA 3ET6B 1H73A 2CPIA 3DYAA 5CYMB 4F0HA 1QUVA 1S9GB 4XDCA 1DZ5A 3R5GA 2UUAJ 2L48A 4OZ1A 2EFOA 3CULA 4ZVEA 3DHXA 4OJ3A 4TKTA 4TY8B 2XGPA 3NCRA 1AUDA 2VKZG 2DY9A 1AUSL 1F9FA 2IVYA 1J5OB 4MFBB 2DHAA 2EFQA 2L08A 1B4SA 1T9XA 1ZBTA 5IWAF 5KFFA 3SV3A 1PG5B 4XTTA 4G1PA 3CGIA 3H2VE 1F9HA 3MM7A 1B7YB 4OFZA 3UDLA 2V50A 1PYOB 3ICLA 3ZZ0A 4CO4A 5KOXA 3TYTA 5B0CA 2GJ2A 4K5RA 3DOKA 3H2UB 4ZVSB 5AE3A 2IC3A 1TELA 2FQQB 2ROGA 4AQYF 5AXKA 4P2FA 4X4OA 3T6BA 2XHCA 2OJ3A 3AAWB 1N34J 1HNZF 3GG1A 1YK9A 4X62F 3QO9B 1WI8A 4OLPA 1S1UA 2IAJA 3IGNA 3D0HE 4RUCA 5HP1B 1U1NA 2J6TA 4M5MA 4ED8A 4DX6A 3G2XA 3R2DJ 4DR7J 4Z2XA 2A0FB 2MZ1A 4DUYJ 4WK3A 3CDWA 2FVRA 4FF4A 5LT5A 4DN9A 1RA7A 2XLKA 2LEPA 1UPMB 4OZLA 2UVWA 3GSIA 1AXQA 2XZDB 2HURA 4JI3F 4LRAA 4X64F 2R7UA 2EI5A 2RRNA 3T1YJ 4JI7J 2EFGA 2HFSA 3QMQA 3L09A 4ECUA 1I6JA 5K20B 1IJEB 4ETZA 2AGPA 3SFUA 4QWEA 5I42B 2P2CB 4RKUC 4WP8A 1TKZA 3ZZZA 5D3GB 1HLWA 4WP3A 3AB4B 1WTBA 3NAHA 1UWBA 4UQGA 2DH8A 3SEOA 3KLFA 1NHKL 3QT8A 4IO1A 4LSNA 3HXMA 4LIRA 2V9WA 1VRTA 4ENOA 3DRRA 1RK8A 5IC6B 2B7CB 3M6VA 4OV6A 1RTHA 1KQFB 1ZAXA 1Q16B 5F9NA 3O6QA 4PWDB 2D9PA 4TN2A 1RWXB 4RJVA 1ZOTA 3KLGB 1RHUB 1V5IB 2FPHX 2QYCA 5CCMA 2F4VF 3M7VA 1SC6A 4QYRA 2RDDA 3KOAA 1KWMA 3AQOA 1MROA 1BMQB 2IYGA 3AY0A 5M2RA 2XS7A 1Q53A 1RAGB 3W66A 2GVZA 2HVDA 3K5MA 1KOHA 4RW9A 1TU0B 2HK2A 2VG7B 3MOZA 1S1VB 1YDLA 4A8MP 2BQ3A 2LQ5A 4ZCLA 2DRDA 4PZVA 4RW8B 2M52A 2DNOA 1Y5IB 3B4DA 3CO9A 4KH1B 4ZCKA 4CI0B 2YWEA 5L1KA 3V2UC 2L9NA 2GV1A 4U8VA 4UQTA 4DN0A 1JJ2R 3QJLA 4RNMA 3CPWR 1X9WA 2OI2A 3NKYA 1T9VA 1D9AA 1JLEA 2A18A 2BE2B 1RAAB 1N5QA 1ULRA 2HS0A 5HVFA 2VB6A 2MZJA 4CT9A 3MUTP 1P27B 3MCNA 3DRSA 3FBFA 3UI3A 1IJFB 1JLCA 1H6KX 3GYGA 4M5KA 1YRXA 3V81B 5LMUF 4QIVA 3W3SA 3E2EA 1Y10A 1U1MA 3ZNJ1 1RT2A 2N7YA 4ZVFA 2CPZA 4FXDA 4JI8F 2JJ4D 2BKPA 5BYSA 3ENAA 1NHVA 4WU3A 1HI8A 3WZ0A 2NCKL 3HSGA 2IDEA 4N7TA 3I0SB 4LT6A 5IV4A 4DPUA 1Y11A 2NS1B 1EP4A 3W9IA 1HBNA 3LUYA 3CUNA 5KOWA 1R0AB 2CAJA 3ZO7A 1HD0A 2LYVA 1BY9A 2RNEA 2HQ3A 3BDEA 2NXEA 3LAMA 4MH8A 4NI2A 5K14A 1VQ9S 1WOOA 3ZFVA 3C2PA 4H4KA 1WSRA 1HBUA 1TKDA 1DURA 1N0UA 4TU8A 2QIFA 1NHUA 2GQCA 4YY3F 4Q0BB 1UCNA 1VQ5S 1IUJA 2C2MB 3D7SB 4DHVA 3IA0A 3KHRA 4Q8EA 4TQSA 3KYLA 4TU7A 4ZITA 1VHFA 2H9ZA 2YX7A 2A6MA 3HHLA 5FDLB 2WSFC 4N8NA 4NLYA 2B7BB 4WFXA 3LP0B 1WDTA 3W8GA 5FLXU 2GJIA 2WBRA 2XB2D 4O4GA 2XG8A 1SL1A 4B9SA 3DCAA 4OI1A 1LFPA 1U1KA 1RAIB 1VOMA 2DXFA 1T9YA 4HH1A 4M5DA 3LPEA 2G1HA 2DYAA 4IR9A 3SZ2A 4YOEA 4F4YA 3SSQA 1S79A 5AT1B 3LP2B 1M5OC 2W01A 3D6TB 2WK4A 2MKJA 3CCSS 1RXOB 3OVAA 1I3OB 2BJEA 2GHWA 4FDFA 1UTAA 2I0XA 2V2QA 4KT0C 1M1KT 2FJWA 1HR0F 3TP2A 3RRGA 2RILA 3DOKB 4KFBB 3I0RA 3SFGA 3HCXA 3RU0A 3VGVA 2J7KA 2P9CA 3MEDA 1Q8KA 1CSJA 4OYWA 2VODA 1LW2B 4KC5A 4WE1B 5L9XA 2OD6A 4L75A 5C42A 2HHPA 5F3ZA 2CQBA 2W9CA 3K58A 2CA9A 1JJCB 2RUGA 2QSWA 5DS7A 2OPPB 5DZ6A 4FS2A 4ZIWA 4CDIA 1TP7A 1AZSA 1Q7LB 3QT6A 4K2XA 4A8XA 3PIPQ 4C3KA 3PACA 1CJVB 3MM5B 1ZM9A 2E5JA 1XBWA 2V4RA 1KOOA 2G0CA 2G2YA 3S6EA 4GRSA 3ONQA 5KFLA 1FEHA 4DL3A 1HWIA 5J2PA 2YBVA 1A7GE 1NK6A 3C3LA 3ETMA 3PHTA 3T1YF 1S1XB 3IMQJ 1DARA 3QSIA 2XMJA 4R8UA 4DFJA 4JI3J 1N5VA 2LECA 1H7XA 4JI1J 1YSJA 1FA0A 2KB2A 2PIIA 2QZ8A 4BWMA 2HHTA 2MTLA 1MU2A 2CQ1A 1HI0P 4Y34A 2HIQA 3VALA 1PBUA 3TJAA 1LW0B 3C19A 4NCGB 2I5JB 3WC0A 3D6HB 2ERRA 1RTHB 2IM1A 3IAM9 4EI2A 1B99A 2DIVA 3IM8A 4KGXB 3FK4A 4YMEA 5DQGA 3K57A 2J9EA 2UXBF 3LGMA 3UNYA 4CZCA 4KHMA 1WTFA 1YTYA 2DXDA 3A13A 3GIRA 3SIPB 3T1AA 1N5SA 2P6TA 2LQ8A 5E3AA 4I7FB 2DNKA 2AJ4A 3CJ4A 2AWZA 3H8YA 1TL5A 1FD2A 4XK8C 2QSFA 4KIAA 4MYUA 4RW9B 2VPWB 5IV3A 1YJUA 5KFUA 3ILIA 1EETB 4ZP9A 2KM8B 3IG1A 3BEGB 1N5YB 2G9OA 3VGUA 2QA2A 2UVVA 2VQEF 1AYEA 3DYAB 1H0HB 2CG8A 2IM0A 3TJ9A 4HEA9 1S9GA 1S6PA 2BJ7A 4LR8A 5KG3A 4C0HA 2KI2A 2CVEA 3AB2B 5KFYA 2HFZA 4LF9F 2HNYA 3BPDA 4FNHA 4RL1A 1WEZA 2P5VA 2PN6A 4LSLB 3CCWA 1LV5A 3CCZA 3M8SA 3MZIA 1TKXB 2F65A 3Q8UA 2KDOA 2BJ8A 5IS2A 2AEJA 4MFBA 4U9RA 1FK9B 1QAYA 1YQHA 1J2VA 4J9UE 5KT6A 2YKQA 5B0EA 1VQPS 5CA5A 2HKEA 3P49B 1HBMB 4FYVB 2KN4A 1EIYB 2XS2A 1TQLA 2RHQB 1OSDA 3MPDA 3TUZC 5D3GA 4V1Ak 1HMVA 1RT7B 2PI5A 1YJTA 2IIHA 3NNHA 2E1PA 2FB0A 3EDRB 4PAAA 5LM7E 2RU3A 4AL7A 3Q8RB 1FF2A 1ZPWX 4X66F 5D0EA 4USMA 4QU7A 2HQCA 4KKOB 3J7YI 1S4EA 4DV1F 4GC7A 4UY85 1SIZA 1C1BA 2OFGX 1TL1A 1RHRB 2V9KA 5B08A 3CCRS 5HP1A 1F1BB 5D8HB 2HNDB 3L3CA 2Q3PA 5ETOA 1AFIA 1O51A 4N56A 2B6AA 4JB8B 4ZKAA 5KFBA 2MLZA 4L6V3 4ZCIA 4NRUA 4WP9A 1OPZA 3I32A 8AT1B 4LFCJ 3U7JA 1DQAA 1NNDA 1S0MA 5KFKA 5H9EK 1REVB 2EVZA 4M94A 1FJ7A 1U6BA 3L95X 3PW4A 3FVYA 1S49A 3M8PB 3QRRA 3P3DA 3DU6A 2V68A 3R5CA 2MJUA 1RAFB 4FKXA 3EVMA 4G1QB 4LQ9A 3LTOA 4TLQA 1O0PA 4EGLA 4A8YA 4IO9Q 3P45B 1RU1A 4Y2IA 3KLEA 1NKCA 2GIFA 2R8GA 4FF3A 1HFEL 1CC8A 2D74B 2H5JB 1VQ6S 3QZ7A 1FRJA 4IH5A 3M30A 2M8DB 1LFWA 3KJQB 4N47A 2LP4A 1F3FA 4CO2A 1OIAA 2E1AA 3JQMA 2ADBA 2D3UA 3KG4A 1XNQF 2LDYA 4DU7A 3VAHA 3FEZA 4DI6A 3KLGA 3HZGA 1XMQJ 1U26A 2A2DA 2BMBA 5CYJA 3TZXA 3MM8A 2Y1JA 4HDGA 3TI0A 5CZVA 1HWJA 6FD1A 3GMGA 1PKUA 3M8WA 3UPFA 1GX5A 3ILOA 2ZH9A 2M88A 3RBDA 4J9PA 3R2CJ 1RWPB 1S1VA 2FZKB 1DFDA 2AGQA 1EARA 1S0NA 4RW8A 1J27A 2CKWA 4DFKA 1X7VA 1AZSB 2QJ3A 3S7RA 2I8EA 4LF6F 3C46A 1FJGJ 3M8ZA 3M32B 1WOPA 3HVTA 1CJVA 2H1YA 2KRRA 3MM5A 4I4BA 4PYDA 4B08A 3I87A 1VDHA 4C4WA 3MM9B 4PABA 2KM8C 2ROPA 3Q2SC 4DR6J 2GQQA 4RZRA 2OIHA 1FXRA 3EPIA 4NZ0A 2NR0A 5D0HA 2LQBA 3BSAA 4OYAA 2YWFA 1UVMA 2DCUB 2VBZA 5IQQA 2KT5A 4BC9A 3EZ5A 3EM1A 4HTJA 2C3MA 2QLWA 3MECB 2E1RA 2CPYA 2DGXA 2X3GA 3TAQA 2DKOB 2L41A 1P9YA 2B9WA 4H4OB 2E5LF 2OHDA 1HR0J 2KO1A 4RNNA 3OTDA 3N6NA 4W92B 2BANA 3J7A1 4C8KA 1QJHA 5IM0A 4DF8A 4F67A 1S1TA 1N52B 1UFWA 2KYZA 2OH2A 4O3RA 2FLPA 4NYZA 1LXJA 1KRPA 3PJXA 3SCJE 2ADCA 1RBAA 1VQYA 2VD3A 3JS9A 4FXWA 5KFQA 4DQIA 1HBNB 2MJNA 4XDDA 5D4PA 1LWCA 3MM6B 3SQOP 3UR3C 3TJ8A 1C4AA 1M1HA 3CJKB 1UA1A 3VCDA 2WVCA 2DPIA 1D8YA 4KTQA 2GGPA 5G4DA 5GAEU 3T5HA 2HLTA 3BDPA 4K2JA 3K0JA 3QIDA 3F0NA 1R6VA 2XSJA 1HBUB 2NYIA 3OFGA 3QBCA 4IQMA 3UDCA 3W60A 2C28A 2HBYB 2DNMA 4QWBA 4Y00A 4QYZK 4IDKA 3VR1A 4R5PA 2AJ0A 3BV8A 1Q8IA 4OYBA 5J2QA 3IFEA 1VMBA 2QA4S 3IS9B 4C9DA 2X1BA 2R4FA 3V4IA 4DV7F 1NK7A 1Y3KA 1WACA 4DV0J 4C11B 3C8YA 3I4HX 4O4GB 3BBBA 4O3PA 5DGAA 1FRHA 4UOCA 4I69A 2VUGA 2N4DA 2B43A 4NEYA 4PG8A 1HKAA 2E7VA 3SDEA 4DQPA 2CNLB 4NCAA 2KTQA 4S0MA 1S0VA 3JB9k 2JNJA 1CC7A 4LF7J 3EXCX 4ED7A 4FPRA 1Y3JA 3MXHP 2CQ4A 3HULA 3I96A 3LP2A 4OZNA 4DL5A 1VQOS 2B9XA 1HMVB 3D6FB 1ACMB 3G6VA 2HAIA 2AJ1A 1OY9A 4F25A 1VQMS 1VLYA 1B64A 2DNHA 4KFBA 1NDKA 2HVZA 1DHMA 2WOMA 3I0RB 2IA0A 2CADA 4PXBA 1DTTB 3EYZA 2VQFF 2CQPA 1JLQA 2RE1A 5KFRA 4BDPA 4IOAQ 1LK7A 3MR6A 1GMVA 3VQTA 2DO4A 3NWGA 2LKZA 3DOLB 1GXLA 1TL1B 4PPZA 1QAIA 1NDLA 3BO3A 1ITPA 2HGLA 1Z4UA 1NPKA 2GIQA 5M2PA 2B56A 4R25A 5KG1A 5C24B 2YNHB 2BW2A 3D3BJ 2N7CA 1QY7A 1U2CA 2B6AB 2FZCB 2DGUA 5BYRA 1S9EB 1BXNA 2KL8A 5BYQA 3PX6A 3PO5A 1MNEA 3DFEA 5F41A 4ZVTB 1BD6A 4TU9A 1C1CB 3NNCA 1S1WB 4IYQA 2HFNA 4CLTA 1VYAA 2KKHA 3OR2B 1X5PA 2J8AA 2C42A 5J2PB 4DL2A 4OJGA 2VBWA 4NXMJ 4FS1A 4F4ZA 4I2PA 4R8UB 3W9HA 2ZH4A 1IN0A 1XK8A 5FJ4A 4F3MA 2YPYA 5MLCV 2ZJPQ 2OMOA 2V8PA 4ZPTR 3S1TA 4CLFA 5A8WA 4DXLA 3G96A 2ALZA 1KR4A 3POTA 2H4WB 9RUBA 3RBEA 2K3KA 5L1JA 3CCLS 2XI2A 4C98A 1TFWA 2Z4PA 2IVMA 2GIRA 2HHVA 2AW0A 3FCWA 1CJKA 1UKUA 3IWNC 2E44A 1QDUB 2FYXA 3AOBA 3LH2S 4HHUA 3LOUA 3PFEA 4LBPA 3KK1B 4DX7A 1QE1B 3CJ8A 3M6WA 1X0FA 3LPYA 1S7HA 3GYNA 2B0GA 2HIYA 5KFCA 3ZTRA 2QRRA 2ILZA 2W8KA 4F02A 1R8CA 2FLOA 4ED2A 4X4SA 3RBZA 2RS8A 4DSFA 4GKKF 2ZITA 1HPZA 4LRCA 4NXNF 3IWLA 2OPQA 5KG6A 4UY8T 2WONB 2KJWA 3IBCB 5DRKA 1I5OB 3G4SS 2M7SA 2W7OA 3PW7A 3OBIA 3DLKA 2JH3A 1HHSA 3M32A 1MG7A 1XNQJ 5E5NA 3VWSA 2CDRB 2CJXB 3T19A 4A8FA 3K8VA 2CPXA 3UFCX 1SH3A 4TY9A 1Y4ZB 2ZH2A 2HNYB 4CQ1A 4EBDA 1R43A 2JFKA 2RD5C 1X5OA 4D3GA 4DR6F 3O3LA 1CPZA 1RAJA 2Y1RI 2YTCA 3W8PA 4DCJB 4DG1A 1YKWA 4J9NA 3CCTA 2XCAA 3DLBA 1O6XA 3CO0P 2AYMA 2V2VA 5KFHA 3W2VB 1NK0A 3MF5A 4DFMA 3AA8A 1UEKA 3FUYA 1QSYA 2BANB 2EXUA 2HPUA 1AROP 3BBFA 1RT3B 3MEGA 4IFVA 4ZVPB 2ZBQA 4HVZA 1HHQA 2I1RA 2PGCA 1VBKA 4OZ3A 4RUBA 2XZWA 1Z2LA 3PDNA 4ZPDA 5KFOA 2N82B 2XMAA 1JWWA 3EZOA 1VQ8S 2DITA 5IQ6A 5CABA 1LWEA 4B9LA 1IKYA 4WYLA 3H5YA 3ZTOA 4DSLA 4PUOB 3HK2A 3M4XA 1FXDA 1URRA 4OHVA 3CJKA 2R7OA 1HBOA 4DPWA 1D1UA 1JXLA 4L72B 3MOJB 4HYKA 4LF1A 3H0PA 4C97A 4DQRA 1JX4A 1KVJA 1SCJB 1EB0A 2L9WA 3UDVA 2WTFA 4UZCA 1S72S 4N5SA 2WBMA 4YB7A 4KH0B 1VC0A 4DUZF 4YB5A 1VQ7S 2AHOB 3H5SA 3UE2A 3RB6A 3EX7B 1IBKJ 1REVA 1XIQA 5KFIA 2XYHB 2O3DA 4IRDA 5GVQA 4HI2A 1P6TA 3IO1A 3O2IA 2FHJD 2HLUA 2D3ZA 3GTYX 3UN3A 2DISA 1LWFA 4R0JA 3RW7A 2NYHA 4CTAB 5CHCB 3N28A 4ED4A 3OL8A 4JI4J 2Y0BB 3A4TA 4M5LA 4B9TA 2R7RA 3JSBA 4A8KA 1IBKF 4KPYA 5ITHA 1REGX 2MSTA 5GADU 5KFEA 2BKOA 3G86A 4F4XA 4FP9A 1RT4A 4ZHRB 3DLJA 2BVZA 4M63A 4O3QA 2HYIB 3OXLA 1B0VA 1LEOA 4DL4A 2ASYA 4I2QA 1JLGA 4X64J 2EKYA 3KNGA 3N6LA 1DTQB 2MYFA 2R8HA 1N88A 2OTJS 3HSJA 3R5AA 4RW7B 3NP5A 3VHQA 1DTTA 1I94J 2F4VJ 2QMXA 3TQ1A 1FKPA 2M0GB 2QMUB 4ZN3A 3PR5B 3CCJS 1QSLA 1SBRA 4K0KF 4DV2F 4KQZA 2LA4A 3IBFB 1TL4A 4BWJA 4YR2A 2BUNA 3PX0A 1CLFA 1U8WA 1YZ6A 3KG1A 3EGZA 4GO7X 2RUSA 4ILRA 1WC4A 1JXEA 4USIA 4OX9F 1T11A 5DM7Q 1NKEA 3HVTB 4UUXA 4K4YA 1GFWB 4K5SA 3L7PA 1IKVA 4C3MA 3MPUB 3H5UA 5F3TA 5DQIA 3OTEA 3CD6S 2IRXA 5K8MA 5CYQB 4OX9J 1C0UA 3MR2A 1Z1ZA 2CQ3A 1NJXA 5D78A 5A8WB 4HR2A 1X4DA 1RTDB 4CLYA 1YGYA 2MLYA 2J0QD 1FD8A 2FGOA 1RT1A 3S8SA 5IM0B 4WCEQ 4DS5A 1S59A 5B7WA 5E2QA 2R7XA 2JRSA 4F3QA 2MQOA 2FJVA 1KONA 3TOQA 1RWVB 2B4PA 3BH6B 4IG3B 4C6AA 4U67Q 2XGQA 4KY3A 5DLFA 3OFHA 4HH0A 1PYSB 4HHJA 4ZOSA 1J5EJ 4B9MA 4DSIA 1TFYA 4AQYJ 1T02A 2JVRA 2Y1LB 4PXEA 3HJFA 4P10A 3GPAA 1NSKL 3HVWA 2CQ2A 1OO0B 4LQ3A 1U7LA 3ADAC 4RUHA 2WB4A 3TVKA 4P7TA 1N6QA 3TA0A 4RU2A 4WZQA 1KLMB 2AF6A 2D3O1 5G0RA 1HPZB 3RYLA 2YPZA 3P4UB 2WONA 3AH6A 5HQLA 4CO3A 2M8HA 3E8OA 4JI0J 2BE9B 2KYXA 4I56A 4P72A 4FBUA 2V8VA 5J2QB 4K0KJ 5F8LA 4U7UK 1Q5YA 3V4IB 2NPFA 2CWKA 1DQ9A 2DH9A 4PPDA 4IRCA 4OYIA 2MKCA 1VGYA 2RDIA 4PXDA 2AU0A 2NSCA 3HHLD 3U1NA 1FO1A 2ZD1A 3PYFA 3H20A 4JV5F 2AGOA 1K0TA 3SDEB 2PSZA 5KFZA 3EVOA 2B8PA 3CJ5A 1T05B 3UWTA 2MY7A 3GFXA 4FF1A 1W26A 2OD4A 4EMDA 3SSRA 3IRWP 3NNAA 5SUHA 3JTPA 3PJ9A 3MEGB 5AXMA 2ZC4A 2YNFB 2W7PA 1ZZFA 3A1YG 3GWCA 4JI6J 4LBIA 4LBHA 1SH0A 1NSPA 2BJDA 5LJ5Y 3MFHA 2HMIB 2HQFA 4CH7A 1N32J 1Q4RA 2YX4A 4ZLNA 2XO6A 1IR2A 1FRKA 3NG8A 1SJFA 2DRAA 1NB7A 1S4FA 2EW9A 2HK3A 3BKUA 3OVSA 3VAMA 2FIUA 3QPIA 5C24A 4DV4F 2CZ9A 3R3TA 2DNQA 2HRTA 5IT9Y 5HVGA 3HHLC 1R3NA 4KAIA 1YWXA 5JJBA 2NREA 1IR0A 2WVFA 4G65A 1AT1B 1Q79A 4A8OA 1YBAA 5I3UB 4ID5A 2KXHA 2NQPA 2GJFA 1Q0NA 2AX0A 2XBPA 4F2SA 1RKJA 1IM4A 4ZVRB 3FZ2A 4QIGA 4B9NA 3ISND 3A3OB 1IKXA 3MTKA 1X0PA 2NXJA 4MKVA 1E6VB 1S5ZA 3DLGB 2QX0A 3LAKA 1V3SA 4C8LA 5JXSA 4PQUB 4M5HA 2BJ1A 4MAKA 2WSCC 3HFVA 3L4BC 4C3LA 2VA3A 3P96A 3QGIA 4JI4F 4N8OA 4B3MF 4ZPAA 3BKFA 2C2KB 2CZ4A 4GC6A 5AXNA 2E1CA 2HWHA 2XMVA 4NMLA 3ZZYA 4ZPWR 4Q7AA 3HMJG 2FY8A 1CJKB 3I5AA 1CVJA 4LF4F 1P1LA 2MQLA 3A8IA 3EUNA 2YNGB 4BCAA 5HJYA 3L9ZA 3T5JA 1QVFR 3ZTQA 1FKPB 3M1VA 1U2FA 4B02A 4AXIA 2DEIA 3M8QA 1H2VZ 4NASA 3VV2B 2XLJA 3GONA 1TL7B 3DU5A 2H48B 4Y65A 2VA2A 4G1IA 4AFFA 1KTQA 4EYIB 4UTGA 2QEXS 3TVZA 4DEZA 2J0SD 1FKOB 1I51B 1GNKA 2YKNB 5D0GA 8ATCB 1S6QA 2E5LJ 3T1HJ 4KB7A 3DLKB 1FFWB 4URSA 2C2EA 1N56A 4OYZA 4TNOA 1EQ0A 1WSVA 1ZA1B 2M4MA 3LWLA 1JKHA 1H2UX 5H9EJ 2MHNA 4CT8A 1VJWA 2G2ZA 3C66A 1U48A 2NXUA 3CW2C 3LANA 3D1OA 3GE9A 1NH7A 2CQHA 4O3NA 2V69A 3ZZOA 1KNZA 3JYTB 1LOUA 2PEBA 1TR0A 2MZSA 2CIMA 2LA6A 2PE8A 2C2OB 2GQ2A 2VPZB 2WSEC 3OFEA 4USKA 3TANA 1VQKS 2LXUA 1CS4A 2B5JA 1FCAA 4P73A 4CLWA 5HAOA 4NLDA 5AXLA 1ZZNA 2O67A 2J9CA 1NXIA 4PRFA 2RRAA 4ZA1A 2KXFA 3AA9A 1MN9A 1VRUB 2MQ8A 3DDIA 1L3TA 1GAOA 1RDRA 2OLWA 2MKIA 4RUAA 3NWRA 1FWKA 1FX2A 2W4CA 5KT7A 5EGYA 2C3PA 3QYYA 5DZ7A 3CIMA 3N9UC 4LSZB 5L8RC 2PDAA 3BO4A 1HIYA 4PUOA 4NRTA 1M90T 1HNVB 3JSYA 4IFYA 1SQEA 3PHEA 4NLVA 4OI3A 1N6QB 2O66A 3FMBA 4NLPA 3PO4A 1ZM3A 3FC9A 3ILJA 3MPYA 4CP5A 2X51A 4WIIA 3J80U 4DV6F 4IOBA 2I9SA 1D3WA 4K4TA 3MCOA 5T7LA 4ES3A 4QIFA 2DNNA 1VI7A 2C3OA 2VFRA 2W4DA 5DQHA 3OV7A 2RSQA 3EICA 2W2PP 5SZTA 3G8SA 3IC1A 5L1IA 2V63A 3GV8B 2POKA 2QE5A 4DV6J 5LMNJ 5U47A 1NZAA 3K7RA 3N0VA 3W62A 1XMOJ 3KNAA 3C6TB 3N01A 3IR7B 3NGDA 2UP1A 1BQMA 4MKAA 3ISNC 4DU8A 4ILMA 1FDBA 4FKYA 1UVNA 3ET6A 3MDFA 4ZN1A 1N8RT 1X8DA 3Q8SB 4F8RA 1JXVA 2JZ5A 3A12A 2CJQA 3D3CJ 3FFIB 2BRKA 1RCOB 3MEKA 4Y28C 4C8MA 4ERDA 3AOCA 2QV6A 2P8IA 1GMWD 2AEMA 2DHHA 1SUQB 2JX2A 2PA8D 3CD5A 4WK1A 5DJBA 5C2GA 4B3RF 1S12A 2E66A 3FQKA 4CM2A 3ZZUA 1SQGA 3DM2A 1ZYQA 1NPPA 3OVBA 3JTNA 2OFHX 3CMES 4WJBA 4NZ7A 4NMXA 4O23A 3NBPB 4Y3CA 1ZTTA 3NMAA 3VAIA 4EFAC 1H7WA 1YHQS 2BQUA 1Q1KA 4ZPBA 5C25B 2R42A 3UNGC 4TYBA 5EWFA 3FGVA 3OJUA 2B8QA 2OTLS 1NU4A 4DR1F 1V3RA 1URNA 1IQTA 2UV8A 4OZ2A 2Q6CA 1TTHB 1FDAA 3M9OB 4WFYA 2XC9A 1L5UA 3OLAA 3O1LA 4R0EA 4DV3F 1IKVB 3TAMA 3TW0A 2KHDA 3EWGA 4AT1B 1UMJA 1TL3B 3VAJA 1N33J 3F41A 4MKBA 3V6HA 1TAUA 2PI4A 4ZJOA 4LRDA 1N34F 4B3SF 1KVKA 3DI6B 2QC3A 1XNRF 2XCPA 4KJIA 2BM1A 3GIMA 5HLFA 1FESA 2MQMA 3GCXP 1RTDA 2KU7A 1IR1A 1A9NB 4QW9A 4HACA 4DQQA 1DAXA 1NUEA 4OJHA 3SMZA 5LSRA 5AJ3J 2ZH3A 2IVFB 4DSEA 2C2RA 2HW3A 2PC6A 1L3VA 1HW9A 2YKPA 4H4MB 3OHBA 3WX4A 1R8HA 1ZETA 4IG3A 2DTJA 4E0DA 3JQKA 5HN0A 4DOZA 3IBWA 5HBMB 3FZBA 4YB6A 3DDNA 4ZP7A 1VRTB 1JB0C 2EG2A 2H5IB 2ZHOA 4OV1A 3TVYA 4K4SA 4CNZA 1N0VC 2R8KA 4DF4A 1TL7A 1KLMA 3VTIA 1TUVA 3MEEB 4BC7A 5KG7A 3RR8A 1YZ7A 5IC4B 4MIBA 2UXCJ 4F7VA 5B0BA 4QIEA 4J9MA 4OMFG 1QSSA 4ECVA 3GG0A 2ZOMA 5KFAA 4HHHA 3VZHA 5KFPA 1EKSA 3T41A 1QVGR 3OW2R 2LU1A 1JKHB 1PO6A 1UETA 2DR6A 1RB0A 2OEJA 2JWNA 7AT1B 3C14B 4ZVGA 3KLVA 4DV0F 3DLLQ 2EK1A 3CEDA 1X9MA 1H2TZ 5HVHA 4QQBA 3KKFA 4OI0A 4JV1A 1RZMA 3I56S 5C5JA 2H65B 1SKWA 2HFVA 3FKBA 4IKAA 2XULA 3U1LA 1X4EA 3BN7A 2QLFB 1TMMA 4ZVUB 4J90A 1EHWA 1JLAA 3LWMA 1APSA 3G8QA 2NZCA 3BGLA 1Y5NB 3DOMB 3VVTA 4N76A 2RQ4A 3Q8YA 2QT7A 4I6AA 1M5KC 2MKYA 2HHSA 4I64A 3UN5A 5CCLA 5JVHQ 1S0OA 2IFXA 2VL1A 4BLGA 3AJ2A 2WVDA 1CULB 5LXRA 2ZH7A 1SV5B 2I6WA 1SC1B 1UP1A 2Y0SD 3DDKA 4MK7A 3J7Z5 2QL9B 4ZK7M 4QOTA 2DHGA 5GAHU 3TARA 2KZMA 2YXLA 4OZ0A 2ZH6A 3THVA 2XYGB 4ICLB 1W7WA 2K1RB 1EP4B 3L7UA 4OJ1A 4YUDA 4RBTA 2J9DE 4ALZA 3PEHA 3WIVA 1R0AA 1R7IA 5HL7Q 1WHVA 1WF2A 1R0BG 1IKWA 4PWWA 5LXYA 4U6PA 3VAGA 1GX6A 4Z37A 1E6VA 3A8EA 3X3UA 2HBRB 2JDJA 2FJXA 2ZC3A 4NWBA 2ZBRA 2F40A 1BQMB 3D67A 2LEBA 3O5TB 1QD1A 4DSJA 5KG4A 2ATLA 3MFIA 2OSQA 5KT3A 1VQLS 4K59A 2Q79A 4AUKA 3DGPA 4P52A 1ICEB 4KE5A 3TZYA 3O8WA 3OXFA 4UW2A 4ZLPA 4F50A 2W24A 4EO8A 4GKJJ 1F6TA 3GILA 5I42A 2FC9A 3D0GE 1RLDA 4ANDA 2WRMA 4M5DB 5HROB 3M6UA 2YKOA 1VS3A 2C3UA 3M1VB 3RB3A 4NLSA 1N36F 2QTWA 1WG4A 4GKJF 1FWPA 3NBPA 5E7OB 3NGSA 3GP9A 1FKAF 2VBXA 2DGOA 1VCTA 4GMKA 3LA0A 2GAHC 4KSEB 2BYCA 1WEYA 2GMLA 2VG6A 1KHWA 4QR0A 3U02A 4WBFA 5A8RA 4DR2F 1ZA2B 1S6QB 2YVSA 4K4UA 5IFMA 3E01B 3N5BA 5IT0A 2EFVA 5F8GA 3UVJB 2E9RX 2ZWOA 3H59A 4NA2A 4LFCF 1LKZA 2DHXA 2HAFA 4USHA 4W98A 1K9MT 5L1LA 2VG7A 2G1DA 2FLLA 2QL5B 2GW8A 3R5JB 1UZHA 2QMWA 3OTOJ 4ZVQB 4A48A 3KHLA 1IWGA 2C1EB 2HBZB 3DI6A 2XM3A 3PIOQ 5HK4A 1RYSA 1HNZJ 4LR7A 3CJ2A 4B3SJ 2Q43A 4RWXA 1CS4B 3CDEA 3KLIA 4DZDA 3Q22A 2CDQA 4IUFA 1W2IA 2MHEA 2PEHA 3QT7A 1NRKA 2P6SA 2OGUA 5D6GA 4URQU 4LREA 4JI0F 5J2MB 2MKKA 3R27A 1SKUB 2DGSA 4H4MA 4EK2A 1HNXF 4MKYA 1QAXA 2O5DA 4ECRA 2ACMA 4DS4A 1JLCB 1HHTP 2DR9A 3DXBA 1D09B 3V6DB 1RI7A 5IOLA 4F0KA 1MU2B 1TV6A 1T3NA 5F0UA 2JFDA 4E2FB 1XNRJ 1HNVA 4IFYB 1WC1A 2XMWA 1YJNS 1TMJA 3P5TL 2VZ9A 1KD1T 4LFBJ 2LDIA 2XY6A 3AODA 3QATA 4OI2A 3I4PA 2DO0A 2Z0GA 3ZC4A 2IBOA 4YR0A 5B0AA 4AL5A 3MTJA 4KV8B 4L3NA 5C7PA 2CVIA 4P6QA 2LEAA 1DRZA 2FHOB 2J5AA 2GAGC 1X4AA 5K9FA 4EWTA 2Y1IA 2J6UA 2DNYA 4I1TA 4C48A 2OKQA 3M9MB 3NS5A 1MWZA 4O3SA 2L9DA 4NA3A 3QRPA 2OELA 2MPUA 1S99A 1IQZA 4G6VB 1EZZB 2J6SA 2C3YA 5EUHA 4DL6A 4J9VA 2YQ0A 5FLXY 5DG9A 3KHHA 3ZZRA 3I55S 1GMWA 3I5BA 3HHLB 1JIHA 3PNIA 3BN4A 3EZUA 3DLEA 2F9DA 5J2NB 4XO0A 1FTCA 4I6WA 1PGZA 2W4PA 4MTPA 5EX3A 1M5VC 2DB1A 4J91A 2W9AA 2K2PA 1UVJA 2FUG9 3TZZA 6AT1B 3M8RA 1OY6A 2Y3YA 3JTOA 1BWVA 2GX8A 3HVAA 3GFHA 1RABB 2RU9A 4AYBD 4J9QA 4MK9A 2K7KA 3F44A 5DG8A 1SV5A 2E7WA 2HWTA 3HFKA 1WI6A 2M70A 2EC2A 2E1MC 3M2UB 1KQKA 5DDQC 3KHGA 3WC2A 2N4CA 5C25A 2RJZA 5LSLA 3OUYA 3SYZA 4MIAA 4LF8J 2HRUA 3QJJA 3CDBA 4M5GA 2EBEA 2JL9A 2X7IA 3W9JA 2VICA 4RNOA 1HNWJ 1RADB 2K1RA 4OYMA 3SCLE 2CQCA 4HKQA 1MWYA 1TZ0A 1RTIB 1UEUA 3T9NA 5EWEA 1YITS 3B6BA 4HT7A 3HZEA 4NA1A 4P2SA 1TL3A 1IKWB 2PMHA 4CH0S 2MDAA 1WNEA 2J7WA 3GV5B 2RQCA 5HJXA 5C2CA 2DNGA 3AJDA 1BQNA 2B4UA 1HQ2A 2KT2A 4ITSA 5KFWA 5IWAJ 4DDFA 1WELA 2ZBPA 2LXFA 1WUUA 2YKMB 3SXLA 3HJVA 2X3DA 4G3IA 1UFLA 3AT1B 3PM9A 5KAKA 2ZOFA 3DGPB 2ZJQQ 2AEFA 2F7VA 4USJC 3A3PB 3SI8A 2I2YA 2GVDA 4G1QA 3KK2B 4Q8FA 5CH7B 1HD1A 1U1LA 4LFAF 4ECYA 2DR5A 2BQRA 3H40A 3KLEB 1J5EF 2WW4A 5HROA 4X65F 3TZWA 3PRDA 3EPGA 3PVXA 5HANA 2G2OA 2QFJA 5ETQA 2VU5A 3RAMA 2XMUA 3M30B 3OL7A 3NOGA 3KLHB 1SC3B 4IOCQ 2CQIA 2FLNA 2LCWA 1WKJA 1PCAA 1PJ5A 1YG0A 3MEEA 4OZ5A 1YJVA 2NUHA 1SH2A 4X65J 2ZUAA 3EGWB 2HHXA 3FNNA 5E0OA 3MCSA 1RWOB 2CUYA 3W5XA 2Q66A 7FDRA 4X2BA 2YWHA 3MPWA 2OPSA 3B82A 4NYPA 1DY3A 3G9CA 1JJ4A 1G7CB 3Q89A 1NM2A 4OIXA 2V0NA 3C14A 4TXSA 4DUTA 2DY1A 2LU2A 2J8SA 4RR5A 3WBZA 3FEYB 3PCOB 2AJ2A 3QGGA 2JEIA 1XMBA 1NZ8A 1N5YA 3D66A 2EKNA 4GVBB 3TEGA 1XWLA 1YRUA 2CG4A 2FJEB 2K3IA 3JAMU 2C2DA 1XR7A 1X4GA 1HQUB 2VG5A 3GJSB 3KLIB 4LVNP 3OTOF 4J9RA 4JI5F 2ZUGA 3W1YC 4XAKA 2BX6A 2OAUA 3BH7B 1PAEX 4LSLA 4DR4J 3DOMA 4JP8A 3V6KA 4PWUA 1RWUA 1T8EA 4KGKA 1FX4A 1UJ4A 4NE9C 1N5TA 3V6DA 3QWUA 2CXEA 1TV6B 4QWAA 1YJWS 3HDSA 1X4BA 2A2CA 4H4OA 2NXNA 3NS6A 1RWNB 3WQPA 1CULA 1XR6A 1XMOF 1T03A 2ZZTA 1KTVA 2YQ1A 1KEKA 4TQRA 2DH7A 1IBLF 5L39A 1RHKB 2J7UA 2B9EA 2IJNA 2V34A 4KV8A 4ZJLA 5KTQA 2UXDF 3OXGA 4HLBA 2AZ3A 1CJUA 3C15A 3DMJA 2RHSB 3GJTB 3OT9A 3Q83A 4OYPA 3MUMP 2BDPA 1R8AA 3AD8C 1EJ7L 1Q81T 5HI7A 5B09A 2ZHBA 4F4WA 1TKTA 3C16B 1RT5A 3VVUA 4JI5J 1S77D 2V6AA 2WCXA 1GTEA 2HNDA 3MCMA 4CCHA 4QBUA 2AD9A 4OHZA 1V9OA 2XLIA 4CH1A 1FVSA 1U0SA 2UU9J 5IXUA 1HWLA 3RZAA 4KGMA 1LK5A 4WIQA 4ZP6A 3H98A 3MAAA 4EBEA 4A8WA 2CZVC 3R1HA 1SJ4P 1FJCA 3R7NB 1FRXA 1OMSA 4J7CA 4YDDB 4Y0FA 4DR3J 4DL7A 4W90B 1N33F 4X4RA 3DLEB 3KDOA 2GMHA 4RWWA 5J2NA 2R7VA 3OR1A 4CLSA 3GIJA 2ZH1A 3AXKA 3OTCA 4KPCA 2ZE2B 4LR9A 2GHPA 1UJ5A 2VV5A 2RVJA 3CNQP 3HFZB 5K8NA 1HI1A 3Q8VA 2AX1A 3IXQA 4O4RA 1PIEA 3GCWP 3M2RA 4RX6A 2BM0A 1WKLA 1NK8A 1M0SA 3BGFA 2IM3A 3PRVA 1RTJB 3BGRB 1SJ3P 1DLOB 1KN6A 2HHQA 2VG6B 2VQEJ 2IC3B 5A8RB 4CYUB 1JLQB 1U02A 2HEKA 4LRBA 3DLHA 2OPRA 3MPVA 2JSXA 3UQSA 2WB1D 3EMTA 4WFBQ 3OUYB 2BOPA 3DN9A 3UVJA 1WC0A 3M05A 2BABA 3H5XA 3ZXWA 3WHIA 2UUCF 4FVCA 3G82A 4RW6A 4DMZA 2D69A 1RCXB 3QQCD 4ZVHA 5DDRC 1VIXA 4O0NA 2V5HG 5GMDA 3VGSA 2QN6B 4ANCA 2LQ9A 4B17A 2XWXA 1S9EA 3PYDA 3JSMA 4YY3J 1WD6A 3R9LA 2OUGA 4M5JA 1RAEB 1T0TV 3HT0A 4O0IA 1AA1B 2UUBJ 3IM9A 1C1CA 3U27A 4PG6A 3WDOA 3J81j 4RLEA 1F0XA 4UOHA 3NGUA 3BF4A 3UR0A 5J2MA 1VQSA 2GS8A 2R2SA 3KJVA 3IAS9 2GVDB 3KK2A 4DV5F 1LWXA 3SSSA 1S6UA 2XSFA 2JC1A 3U1MA 1KSPA 3I82A 3J81Y 4JYAF 2UUBF 2MKHA 3MR5A 1VK3A 1RAOA 1RT6A 3ENVA 3KLFB 4ED5A 4LSNB 3POTB 3GQCA 3HI9A 3FMWA 2E29A 4B3RJ 3DRYA 3KLHA 5HMYA 3ITHA 1R0CB 2V94A 4QR2A 3RJMB 2DNLA 4WFNQ 1S1TB 1RP5A 4U8YA 1YRTA 1HYSA 1C2PA 4Y2CA 3G71S 5BXIA 1G3OA 2LFVA 3AFGA 3TNVA 1VQ4S 4WKRA 4ECWA 4LVOP 1YJ7A 4DJBA 1OPIA 2ZJRQ 1HWUA 1NSQA 4U7UD 3KUEA 1BQXA 1N54B 2HFUA 2ZKUA 4P7VA 4GKKJ 1FE4A 4CLZA 5F9LA 2UUCJ 1FRLA 4J9KA 1FNXH 1QUPA 3HD1A 1SC4B 4QWDA 5BR8J 2DR7A 4NL5A 2YQ3A 4QR1A 3UDEA 3J7YU 2OPQB 2XSJB 3NY0A 2VC0A 3MHYA 3T9ZA 4LRFA 3QSYB 3KK3A 3DKDA 1HARA 5J1PA 5CYMA 1M5PC 2DK2A 4IDKB 2XQCA 3FJ2A 3OQ2A 3I31A 2F5GA 3NGKA 1H38A 1JLEB 1BE4A 4ID8A 1U0HB 2M9KA 4TY8A 4C11A 2EC0A 3E51A 2MZQA 1B0TA 1CBKA 3H4DA 2A6OA 4IH7A 3HP6A 4OHYA 3KUHA 2OEKA 1SKRA 1J5OA 4RNHA 4TVAB 3V81A 1FTRA 1O8BA 3TAPA 2QGFB 4JV0A 1WHYA 2R7TA 3OSPA 2R3VA 3H90A 4X4QA 1OQ3A 1GEHA 2BEFA 1NO8A 2BV3A 3NCQA 1FFGB 1RQ0A 4EUVA 1RT3A 4ZMMA 1T03B 3QRQA 5K8OA 1X5TA 3I5CA 2ZNYA 4O3OA 2KT3A 1PILA 2ZFHA 2ILYA 2B9YA 3R5BA 1CQNA 5LJ3Y 2VONA 2GC8A 1S97A 2OP5A 3GSDA 2AKWB 1RTIA 2ZEJA 4OQJA 3CCVS 3V6JA 1KS2A 1FERA 1UFKA 2HSEB 4CLLA 2FJBB 1RLCL 3IRXB 1KFSA 2RF2A 2NLWA 3KFWX 4HTIA 1DBDA 2L3MA 1BQNB 1SIWB 3TR5A 2LXIA 3R8YA 5L38A 2BBEA 2M3DA 3MAAB 4PR6A 3FQLA 3UO0A 5L9NA 1S1WA 2ALYB 2F8HA 5IZHA 2UUAF 3RW6A 1R89A 2CQ0A 2YH1A 1GTHA 3OR2A 5I4MA 1Q86T 2RB7A 4F0MA 2EK6A 2UV8G 1S48A 4EU0A 4B3TJ 3FEXB 1ZS6A 2DBBA 1V6HA 1WG1A 1NLKL 4DR3F 2ZE2A 1RBLA 3PKMA 4C8ZA 2HFOA 1UWBB 5BJRA 3BO2A 3GFZA 4DBQA 2DPJA 3B8HA 3M2RB 4HT5A 2IMOA 2KRBA 1ZPVA 2PA3A 2ZHAA 4D3HA 1T95A 3E3XA 4I2QB 1FE0A 4WF9Q 1BGXT 4OYXA 1RTJA 3BGRA 4PWDA 4CO0A 3PTWA 3H25A 4TYAA 1DLOA 1MSWD 1TVRB 2PD1A 4L76A 3KK1A 2XY7A 3MEDB 4WZMA 2UVRA 2KVQE 1CG2A 2ZNZA 4Q2LA 5ETLA 4CYUA 3BSOA 1WHWA 1S76D 3G6ES 1VJQA 4Y2MA 2RDJA 1MROB 3LF0A 2V4QA 4DUYF 2GVZB 3IWXA 2ZOGA 4Q45A 3KUGA 5D15A 2W9CB 3MD3A 2AYBA 2IDLA 2AT1B 1SL2A 2JEJA 2ZKTA 4AE5A 3JSMB 4B9VA 5M2UA 2W25A 4QPXA 4ATNA 3CJSA 3M6XA 1SJ1A 4KO0B 4X4PA 4USWA 4A4JA 4CLPA 2BE2A 4EYHB 2MQPA 4UZBA 3NMRA 4KHPF 3BKTA 5A2QY 3DRSB 5KFGA 1TUGB 1E6YA 5A2QU 3CC7S 4DG1B 5CZXA 3J81U 1FI4A 1RISA 1UWAA 2HHHF 3KJFB 2HQDA 2KH9A 5GMEA 3CD7A 1JJHA 3FCVA 4FNIA 3F56A 4EZ6A 3LQVA 4O44B 2AZ1A 1RT2B 2FGCA 2I5JA 4L73A 1O5JA 3ITHB 3NEKA 4CM0A 2OO4A 4IFVB 4Z7YA 3BS9A 4PEOA 4NLXA 3AXMA 3EVWA 4ZPCA 3RUBL 4HI1A 2K7JA 2CJAA 3K8WA 5E41A 1ZTWA 5IT9U 3NGRA 3HHKA 2Z56B 3FCHA 3B4MA 1CJUB 1FJGF 1LWEB 2EFNA 3B78A 4PCQA 4B3OB 2NSBA 2QLJB 4P9SA 4YFUA 1HQEA 3B54A 4F4AA 4OX8A 1RT5B 3KJNB 3G6YA 5KFVA 2W7AA 4HL9A 4QW8A 2BACA 5K14B 5KT2A 4CIOA 2FHMA 1EETA 4FPIA 4U95A 1IBMF 4ELUA 5F8JA 3PV8A 3QNWB 2DGVA 2F4FA 2PT0A 1Q8BA 2ASLA 4MYTA 4NEZA 2ZM6F 3RB4A 2AQ4A 1M5HA 3BREA 2AMCB 3VF0B 5RUBA 1XMQF 4DV5J 1Y5LB 2ASDA 5FDLA 3BQ0A 1XQIA 1U0HA 2PO4A 3LP0A 3OPKA 2HQGA 1B70B 4GO5X 2VF3A 1GQEA 4QWCA 3GIIA 2AP6A 1U25A 1TKXA 2R8IA 4X62J 2CPEA 2B51A 4RO0A 3R97A 2CNKB 4DR2J 3HX9A 5KG5A 1YI2S 3PR4A 1HBMA 4X4VA 4JI6F 2RQKA 1HNXJ 3K2YA 4DPXA 3MMJA 1F9EB 4TLRA 4QCLA 1JLGB 4I67A 3GYXB 2XO7A 4CLUA 4U7CA 2RMLA 1DTQA 3CB4A 4YHHJ 1NJIT 5D0RA 2AYEA 1PAUB 1U24A 3W2WB 4ECXA 1KC8T 1N48A 2XHWA 4KKOA 2OPRB 2CWXA 4K4XA 1UJ6A 3TO8A 2HHUA 4C0OC 2VJUA 3FDSA 3ULHA 5C42B 2ZH8A 3PRBA 3PXGa 2RF2B 5E33A 4JV2A 2ZVIA 2MY8A 2YNIB 2CPFA 2FVQA 3QT5A 1R6YA 1U2RA 5I3PA 2VIHA 3LO3A 3H4BA 4UF4A 3UD3P 1F2HA 1WC6A 1Z2ZA 3CVKA 2R7WA 4ID5B 5ETNA 3MGJA 4QYZJ 2ASJA 2DIUA 9ATCB 4AL6A 4OL8A 4Q5VA 4LFBF 4N77A 3BZQA 4ECTA 1G1XA 2VPXB 2BR0A 1NJWA 1S1XA 1Q7YT 1R8PA 3PW0A 5J1NA 4ZPVR 4PQUA 1N4LA 2J0XA 2VQFJ 2DHSA 2CQGA 4I6YA 3MMBA 7FD1A 2CJYB 4M95A 1A6LA 4ELVA 2JVOA 4DR1J 1M1GA 3R6GB 3A8JA 3D6MB 4DPYA 5E3QA 2MKSA 3JXOA 5DLGA 5HSPA 2VC1A 1SPBP 1VK8A 3CE8A 3LGHA 4GVLA 1RACB 2MZTA 2EWHA 5I3QA 4YP3A 4A8QA 4LIWA 5H1SV 4DUZJ 3ETOA 2AV5A 1IM6A 2NUUG 4FYWB 4OI4A 4WWSA 2AYGA 4Z7CA 3BGOP 2UU9F 4I7FA 4QIWD 5H9FK 3KWMA 3Q24A 3CXCR 5CXTA 1X5SA 3OFFA 3CCES 3THTA 4OHWA 5A8KA 3H2LA 1NKBA 1B3TA 3LP1A 3RAQA 2DCLA 3KDNA 4NZ6A 4DPTA 5KG2A 1N36J 1OJ4A 4PXCA 4WPAA 5F0WA 1U1OA 3AD9C 1PSDA 3W61A 2KFYA 1B0PA 5AE1A 3W65A 5LMNF 3KK3B 3PX4A 1HA1A 3DRPA 2ATCB 2MQNA 1ELOA 1HNIA 2NPIA 1S6PB 2QYGA 2W9BA 3MM9A 4H4KC 1QAJA 4FXVA 4M8LA 4DLEA 3IR5B 2Z2MA 1SL0A 2MB0B 2UXBJ 1LQ9A 3NAIA 2O01C 2R8JA 4F2RA 2CYYA 3H7HB 1E6YB 2VOPA 2ZD1B 1G4CA 3EGVA 1I94F 4WXOA 1U45A 1FK9A 3MECA 3CT9A 3VAKA 1NMEB 4ANEA 1T05A 2JEGA 2ROEA 2ZZNA 3CMAS 1IVZA 1RAHB 1FFSB 3BQ2A 3ISZA 3PEJA 4NLTA 5EWGA 1LXNA 4I0WA 3M2VB 2W9BB 5JVGQ 1XTZA 2WAQD 3JAMY 1NDCA 3VAFA 3GFYA 1RT7A 3UCGA 2GZOA 2X1AA 2RRBA 3ZNUA 4DSKA 2QL7B 3MD1A 3HD2A 4IG0B 4WFAQ 2F8MA 3MMCB 2X1GA 1DQ8A 2HHWA 1FT8A 4HDHA 3GR0A 3D5MA 4B3OA 2XNQA 1LWCB 2XMMA 3MM6A 5FD1A 1X4CA 4BS2A 1C1BB 1HQEB 4XPCA 4FF2A 3NL0A 2VKRA 4H54A 3IRXA 4FBTA 3QLHB 4NLGA 4RNFA 2F1FA 5EN1A 2HGMA 2H3EB 3W5YA 4OI6A 5T7LB 2K06A 2MQQA 4ER8A 5KFMA 3HLUA 1RTZA 2YY3A 2V8HA 2V8GA 2DGQA 1X4HA 1HL6A 2DJWA 2W2MP 1T9UA 4KYZA 2K8GA 3PG9A 1KQGB 5KFSA 3IS9A 2R7QA 2JC0A 1VISA 4DR4F 3M8PA 4I68A 1IKXB 1NCLA 3HM9A 4ZJQA 4EZ9A 3HPOA 3MR7A 3ELHA 1UVIA 1VRQC 1ZM4A 1MLAA 2OEMA 1NJZA 1KVIA 1KHVA 2P9EA 1K1SA 4P75A 5ETKA 2N3OA 5KFDA 5H9FJ 3NS7B 2HBQB 1ZH5A 1K8AT 2HS3A 1IBLJ 2IJFA 1OY8A 3HO1A 6FDRA 3CF5Q 1UA0A 2YWKA 2V4JB 2CJBA 2XI3A 2XMKA 1Q82T 1SUQA 2PMWA 4NLRA 4UOGA 2WOMB 1TVRA 4CNYA 1RWMB 5LMUJ 4LF5F 3W2WA 4EBCA 2GO9A 3MM8B 1F5CA 1T9TA 3NGTA 3Q23A 2CRLA 4ECSA 2Q1LA 3SCIE 3CCQS 1VBYA 1CQMA 4IH6A 2Z2ZA 1XC9A 2YNHA 3A8KA 2XS5A 4LMZA 1BUXA 4KGVB 1N32F 3K5LA 2GA7A 2UUTA 4PG5A 3OSNA 2JLGA 3FRZA 2XNRA 1L3UA 4Q2MA 3TX8A 3TRGA 1EAYC 2E5HA 1GT8A 4KO0A 3VZIA 3G6XA 3FBBA 2BA9A 2C2NA 2D3OR 1S9FA 1SI9A 3FSYA 4ECZA 1VBZA 3BYPA 4EO6A 4WTOB 2WHOA 3UCZP 1FXLA 2YWWA 4P2XA 1K44A 1RBOB 1OYDA 3PYGA 4J37A 4OX6A 3BBCA 3R7SB 3JYTA 1S6OA 3FBCA 3D68A 4I2PB 5A76A 1T9WA 4C8NA 3MMAB 4FN5A 1YLXA 4QZVB 1QTMA 5HLFB 4JV5J 2DRBA 4O44A 4YHHF 1YBTA 4ED0A 1VRUA 3RG6A 1PBAA 3ILLA 2CNOB 2APOA 3EDQB 2RQMA 4MJKA 3UW1A 4KBIA 1S10A 2Z2YB 4CWBA 2WZ1A 5HBMA 4PKDB 1X60A 2Q6BA 2KXNB 1FVQA 2HS4A 1JQGA 3MI7X 3Q0AA 2UXCF 4K4WA 5A8KB 2GGPB 4YQWA 2KHCA 2EG1A 5KFTA 3BSCA 2IMWP 2IBKA 1VQNS 1JNRB 2CJ9A 1SQFA 2QLXA 1F3VA 5ETPA 3G8TA 4NLOA 1YIJS 1QM9A 1TK0A 1T3OA 4K7QA 1U4BA 1ROFA 1EKRA 2PFDA 2B4OA 3GR1A 3I9V9 1HNIB 1LNQA 4BBYA 3M9NB 2HZCA 4UT4A 5E3PA 2E5IA 2B3TB 2VASA 4FYYB 1T7PA 1JLBB 2R9LA 1AB8A 2F63A 2G13A 1I1GA 2MSSA 2Z57B 1GXUA 4WXWA 2YKAA 1IBCB 4YN3B 4DV2J 4PQAA 4M5NA 3C6TA 2IJRA 3D28A 2EEYA 3NRBA 2DVIA 3D1HA 2DGWA 4DQSA 3D2WA 2I38A 3Q86A 3CC2S 1Y00A 3MR3A 3SQGB 3X1LB 1PYTA 5JMNA 3UD5A 2W8LA 3IGVA 4BHQA 3WIUA 2Z30B 2U1AA 1JLAB 1UVKA 2E5GA 2QA4G 4JI7F 1U09A 4ILLA 2HWIA 2DGTA 5CD4A 1ZAVA 1RSCA 3DHWC 4IG0A 4X84A 4YEAA 5B0FA 2HVEA 1WJ9A 3MMCA 5A0YA 2GFFA 1JK9B 1OSCA 2V8DA 2JEFA 1NB2A 3BPSP 4FVMA 2VDHA 3DOLA 1UW9A 3T6JA 4CO5A 3R5DA 3AQPA 2X1FA 4A46A 1RWWB 3SV4A 3N5FA 1D9DA 2VFUA 1PC5A 1FRMA 2IM2A 2DXEA 3P5BP 5FIIA 3D9BA 3Q8QB 4DR5F 3RRHA 3NOCA 3DGVA 3UN2A 2YNIA 3T5KA 2GNKA 1V3ZA 2IY5B 1JLFA 1U6FA 2GCFA 5DGBA 4LF7F 3TUPA 3JQJA 3PY8A 1SJRA 3TA2A 4PG4A 3AD7C 1X31C 2YX1A 5T14A 5HMXA 2G0IA 3BJYA 4K4ZA 2HG4A 1XN9A 1VBXA 3OL6A 3TAMB 2XYPB 4JI8J 3W5ZA 2C2ZB 5HO4A 5KFXA 1LWFB 1PC4A 2OMLA 3D0IE 4USUA 3GB0A 4E8UA 3LW5C 2HVHA 2CPHA 1SXLA 2ZH5A 4ED1A 2BRLA 2VFTA 3MMBB 4NLWA 5I3UA 5E3RA 3US5A 1RYRA 3OJSA 1S7IA 3RRKA 4X4TA 4FYDA 1FDNA 1YJRA 2ZWPA 3Q2TC 4HACB 1SJQA 2A10A 3QFHA 2V4JA 5D4OA 1K47A 5A6WA 3TQEA 1V5VA 1ZM2A 4NLQA 1Q95G 2QO3A 4RW4A 3P8BB 4F04B 5DG7A 5KFNA 3DNCA 1VC5A 2HHHJ 2CQDA 2LLZA 1QE1A 1CJTB 2ACYA 3QJPA 2W2QP 4WTYA 3J7ZT 2J0WA 4U96A 3V4MA 4LF5J 3EXYA 4K50A 1F2GA 4ES1A 1H72C 4KHPJ 1H74A 1RE1B 3O44A 3PYEA 5F8HA 5GADI 1MN7A 1Q78A 4PG7A 2H51B 2ZZMA 3LP1B 4DCOB 4MK8A 3BGUA 2IHR1 2H4YB 3CJ0A 2XZTB 2COLA 3DRXA 4FZVA 4NX9A 4PYAA 3GLJA 3QFWA 1B7FA 2J9DA 3DRPB 3QAUA 3D54A 4RPFA 3CDAA 3E01A 1YJ9S 3M8YA 3ZTPA 3H42A 1BWEA 1D8ZA 4K8RA 2ZVSA 5K8PA 2M2BA 3WX8A 2A1BA 3HHDA 4C0BA 2NXCA 3HSDA 4C7QA 2HNZA 2C22A 3QZ8A 1UL3A 2FDNA 2GMJA 4DV4J 5K5MA 4Y6IA 5AE2A 2D7SA 2Y8YA 2KG1A 3MMAA 1C0TB 3AOAA 3NXZA 4JUZA 5DDPC 3W2VA 2EPIA 4A8SA 3SCKE 4XIUA 2RAQA 3RBXA 3M2VA 3RAXA 1L3SA 2MGZB 3PZPA 4IQXA 2KG0A 2DNZA 4J9LA 3RGIA 4OLOA 1K1QA 5GAEI 4Q43A 2RKIA 1YBUA 1MW7A 3CDUA 4KGZB 5ADZA 1MMLA 3AHPA 3A3NB 5DDOC 5B0DA 3T1HF 2BJ3A 1IKYB 4DX5A 5J1EA 3FSIA 3K5NA 1CEZA 4QPTA 2G0JA 1D9FA 4P2MA 1Q5VA 1HBOB 2BZ2A 4JOUA 4ED3A 4EEYA 2DEJA 4B3TF 2V2KA 2F8EX 2WVEA 3CJ3A 1RJJA 1TAQA 3RB0A 3R1LA 1SKSA 3N4WA 5G0RB 3QLHA 4MT1A 4FYXB 3R7BB 1P1TA 1YX2A 4ICLA 2FHJA 1G6BA 4JBCA 1BHNA 2BJ9A 5GAHI 1VC6A 4LF2A 5LL6d 2HRYA 2O1PA 4ZP8A 2FVSA 4V19J 2DD8S 4LF4J 3GZ7A 1RHQB 3OL9A 2IA6A 1P9QC 5AJ3F 5KT5A 2FTRA 4DV7J 2WVBA 4UOFA 3IP0A 2HZAA 3K89A 2PFFB 2CPDA 3NLCA 5CD4H 3R6LB 3THPA 3PKYA 1KBRA 3FSXA 2VOOA 1YVFA 2DNRA 3HKWA 4NXNJ 3KG0A 3SQGA 1RT4B 4ZHRA 3GV7B 3UCUP 3GJRB 1KDNA 4OX7A 4LJMA 4WFZA 3PW5A 1WKKA 2VFVA 1TK8A 2KZZA 3K17A 5ETVA 4DR5J 2MMYA 2U2FA 3MWBA 3K59A 2VFSA 4AXJA 3EJMA 4KR0B 4CTAA 4RW7A 2A3JA 5A0YB 3KMSA 2XY5A 5GMKa 2CJKA 5KT4A 4OHXA 1RUSA 5F8IA 2FD2A 2Y9HA 4C8YA 2BXJA 3CJRA 4NXMF 1RHMB 2KVIA 3ZTSA 1MMDA 3D1QA 1Y7PA 2OSRA 2FC8A 5D77A 4LF8F 3MM7B 3TUIC 1UPPA 1A0OB 3BM7A 1G2EA 3I9ZA 1BLUA 1MMNA 5THWA 1L3KA 3RTVA 4USTA 4B9UA 2CNNB 1WG5A 2V2ZA 5L46A 1IXKA 1UEVA 1WF0A 3HHEA 4NYOA 3CTRA 3TX0A 3MUVP 2Z2LA 1WDDA 2XWYA 3EE3A 1KP6A 3DXSX 4UUWA 2DNPA 2LVWA 3L7OA 2FHKA 4QJVA 3QO9A 4RBUA 5HQMA 3BSNA 1IBMJ 1K0VA 1NDPA 3PFOA 1VFJA 4M5IA 4RBVA 2VHGA 3PW2A 1GXTA 1RA6A 3QIPA 3W7BA 5DM6Q 1X9SA 3DLGA 3LALA 4OYOA 4F3OA 2MLXA 2R7SA 5CYQA 4F36A 2RT3A 3CIZA 1D0EA 1C0UB 4KHRA 3VQSA 1Q8LA 1BC6A 2V67A 3MAHA 2VJVA 4KRWA 1UW4A 4URGA 2YKMA 3G87A 3GJQB 5HATA 2JLFA 2WW8A 4LFAJ 1C4CA 3SBMA 4WKYA 1RT1B 2HQIA 1W2BR 4YS2A 5HMZA 3FBEA 3J80Y 3Q8PB 3OLBA 3BB5A 4NOHA 3RR7A 3C6UB 1WEXA 2ZM6J 2AIRB 5EX0A 3UD4P 1U1PA 1K73T 3QWPA 3TUJC 4IRKA 4MMOA 2JOQA 3EGNA 4DZ6A 2JLEA 3DRRB 3MAQA 5KG0A 2YH0A 3PJWA 1NJYA
chains in the Genus database with same CATH topology
5GAGU 2UZAA 4C8OA 2D1CA 3ZZTA 2XEXA 2Z8QA 1FKOA 1NAQA 2YKNA 2F3JA 3NCPA 4ES2A 1OWXA 2IRUA 4ZCMA 1XEZA 4Y2KA 1FDDA 4JI1F 5GAGI 1X4FA 2OPSB 5MAOA 1JLBA 2FVCA 4YDXA 2VH7A 4Q44A 2HNZB 2ZDOA 4E98A 4DWIA 2AJFE 2CFXA 2E7XA 3FRYA 3IR6B 5IT4A 4RU9A 4NCBA 4ZDNA 3HF5A 3QGHA 5F8MA 2J76E 1C0TA 1JMTA 1XR5A 1F60B 3ENWA 3CC4S 2B5JB 3BR9A 2KFNA 4JI2F 3V5RA 5DETA 2YNFA 1M5SA 1ZAWA 1GH8A 2N3LA 1Y0HA 3HT3A 1UVLA 2RKIB 2YWGA 3BR8A 4WYWA 3S01A 2HMIA 4V19X 1U8SA 1RGVA 2RS2A 2AJQA 1AW0A 1FRIA 5HMWA 5LSOA 5J1EB 1NK5A 2P9GA 3QAEA 2PMZD 1T94A 3T3FA 1KLNA 3M2UA 4CO1A 2DT9A 1NK4A 3N6MA 3LGNA 1JLFB 3I6PA 2EBGA 2D9OA 4ZS6A 1HWKA 3DMJB 2MXYA 4ECQA 5JUMA 2ZDPA 4Y2AA 4YR3A 2FVPA 2ABYA 2MZRA 1S1UB 2IAJB 5B0GA 5HQ8A 3N79A 2JHEA 1U1RA 2VPYB 3T5LA 1U47A 1FNOA 4A47A 3HHNB 4WU2A 2VBYA 5CQGA 3HKZD 2R2TA 2E9TA 3FFIA 2G4BA 3F73A 4J9SA 2RIJA 3OR1B 3TA1A 5KFJA 1H98A 1HW8A 1R8BA 2DR8A 2FJWA 1RKIA 2RH3A 4DPOA 4RW4B 1FJEB 4XPEA 3CCUS 1P8GA 2FJAB 4DFPA 1NEEA 1TKZB 2KJVA 2QA1A 2ZHBA 5D3GA 2M5YA 2YNGA 4DLGA 1JNZB 3DM2B 5D4NA 2H5EA 4X4UA 1KFDA 3DC2A 3OHAA 3CD0A 3M8QB 3ENQA 1U49A 1KQSR 3BQ1A 1XERA 4ETXA 3ZZPA 2ZBCA 1U1QA 2FY1A 3CWJA 1H3DA 3JSRA 1F5AA 1WHXA 1R31A 4X4NA 3KTQA 2GHVC 1LW2A 1WF1A 4WE1A 1F5BA 1SB6A 1QLNA 4RW6B 2D41A 3OTBA 3QIPB 5E3CA 1NK9A 4QU6A 3CSKA 2OPPA 3IN5A 2GO8A 1WWHA 2B4VA 4MIWA 1AFJA 5EDWA 3K5OA 2CPJA 3K5PA 1FHTA 1OS5A 2E9ZA 4DX8H 2IYIA 3HVRA 1HQUA 2VG5B 4C2MA 3AJ1A 5A6PA 1VIOA 2MGZA 5EHHA 3KJVB 4LUBA 2R2UA 4F4KA 5T41A 4YB1P 1UAWA 4DL0C 3C6UA 4F26A 2EFPA 1RT6B 2LMIA 4ED6A 4M1KA 1LW0A 4NCGA 1FEEA 4IR1A 2XMTA 2UUWA 5D4LA 1W25A 5DO2A 2IRYA 4J5OA 3QGPA 1HYSB 3KMQA 2F9JA 2SXLA 4J9OA 3I0SA 5F8NA 2LQJA 2UVUA 1U6ZA 5BR8F 1R27B 1FNMA 1Y9OA 2ZBIA 4OZJA 1OQ6A 1TKTB 4ELTA 4K4VA 4NLUA 3CCMS 1DJ0A 2HGNA 3IG1B 1NH8A 3MURP 1HNWF 1TK5A 2FJDB 4N41A 4Q0BA 2R2RA 2CPIA 3DYAA 5CYMB 1QUVA 1S9GB 4XDCA 1DZ5A 2L48A 4OZ1A 2EFOA 3CULA 4ZVEA 3DHXA 4OJ3A 4TKTA 4TY8B 2XGPA 3NCRA 1AUDA 2VKZG 1F9FA 1J5OB 2IVYA 4MFBB 2DHAA 2EFQA 2L08A 5IWAF 1ZBTA 5KFFA 4G1PA 3CGIA 3H2VE 3UDLA 3MM7A 4OFZA 2KZZA 3ICLA 3ZZ0A 4CO4A 5KOXA 3TYTA 5B0CA 2GJ2A 4K5RA 3DOKA 3H2UB 5AE3A 2IC3A 4AQYF 2ROGA 5AXKA 4X4OA 3T6BA 2OJ3A 3AAWB 1HNZF 3GG1A 4X62F 3QO9B 1WI8A 4OLPA 1S1UA 2IAJA 3IGNA 3D0HE 4RUCA 5HP1B 1U1NA 2J6TA 4ED8A 4Z2XA 2MZ1A 4FF4A 4WK3A 3CDWA 2FVRA 5LT5A 4DN9A 1RA7A 2LEPA 4OZLA 2UVWA 1AXQA 4JI3F 4X64F 2R7UA 2EI5A 2RRNA 2EFGA 3QMQA 3L09A 4ECUA 1I6JA 1IJEB 4ETZA 2AGPA 3SFUA 4QWEA 5I42B 4RKUC 1TKZA 3ZZZA 5D3GB 3AB4B 1WTBA 3NAHA 1UWBA 4UQGA 2DH8A 3SEOA 3KLFA 4LSNA 4IO1A 3HXMA 2V9WA 4LIRA 1VRTA 3DRRA 1RK8A 2B7CB 3M6VA 1RTHA 1KQFB 1ZAXA 1Q16B 5F9NA 3O6QA 4PWDB 2D9PA 4TN2A 1ZOTA 3KLGB 2FPHX 2QYCA 5CCMA 2F4VF 1SC6A 4QYRA 3KOAA 3AQOA 3AY0A 1MROA 2IYGA 5M2RA 2XS7A 1Q53A 3K5MA 1KOHA 4RW9A 2VG7B 3MOZA 1S1VB 4A8MP 2BQ3A 2LQ5A 4ZCLA 4RW8B 2IMWP 2ZZNA 2M52A 2DNOA 1Y5IB 3B4DA 3CO9A 4ZCKA 4CI0B 5L1KA 2YWEA 3V2UC 2L9NA 2GV1A 4UQTA 4DN0A 1JJ2R 3QJLA 4RNMA 3CPWR 1X9WA 3NKYA 1D9AA 1JLEA 2A18A 2BE2B 1ULRA 1N5QA 2HS0A 2VB6A 2MZJA 4CT9A 3MUTP 1P27B 3DRSA 3UI3A 1IJFB 1JLCA 1H6KX 1YRXA 3V81B 5LMUF 4QIVA 3W3SA 3E2EA 1U1MA 1RT2A 2N7YA 4ZVFA 2CPZA 4FXDA 4JI8F 2JJ4D 5BYSA 1NHVA 4WU3A 1HI8A 3WZ0A 3I0SB 4LT6A 2NS1B 1EP4A 1HBNA 3LUYA 3CUNA 5KOWA 1R0AB 1HD0A 2LYVA 1BY9A 2RNEA 2HQ3A 3BDEA 3LAMA 4MH8A 1VQ9S 2VONA 5K14A 3ZFVA 3C2PA 4H4KA 1HBUA 1TKDA 1DURA 1N0UA 4TU8A 2QIFA 1NHUA 2GQCA 4YY3F 4Q0BB 1VQ5S 1IUJA 4DHVA 3KHRA 3IA0A 4Q8EA 4TQSA 3KYLA 4TU7A 1VHFA 2H9ZA 2YX7A 3HHLA 5FDLB 3WC0A 2WSFC 4N8NA 4NLYA 2B7BB 4WFXA 3LP0B 4B9LA 2XB2D 2GJIA 2WBRA 4O4GA 2XG8A 1SL1A 4B9SA 3DCAA 4OI1A 1LFPA 1U1KA 1VOMA 4HH1A 4M5DA 4IR9A 3SZ2A 4YOEA 4F4YA 3SSQA 1S79A 1M5OC 3LP2B 2WK4A 2MKJA 3CCSS 3OVAA 2DR7A 2BJEA 2GHWA 4KT0C 1M1KT 2I0XA 3RRGA 1HR0F 3TP2A 2RILA 3DOKB 4KFBB 3I0RA 3SFGA 3RU0A 2J7KA 2P9CA 3MEDA 1CSJA 2VODA 1LW2B 4KC5A 4WE1B 5L9XA 2OD6A 5C42A 2HHPA 5F3ZA 2CQBA 2W9CA 3K58A 2RUGA 2QSWA 5DS7A 2OPPB 4FS2A 1TP7A 1Q7LB 4K2XA 4A8XA 3PIPQ 4C3KA 3PACA 3MM5B 1ZM9A 2E5JA 1XBWA 2V4RA 1KOOA 2G0CA 3S6EA 5KFLA 4DL3A 3ONQA 5J2PA 1FEHA 1NK6A 1HWIA 3C3LA 1A7GE 3T1YF 1S1XB 1DARA 2XMJA 4R8UA 4DFJA 1N5VA 2LECA 1H7XA 1YSJA 1FA0A 2KB2A 2PIIA 2QZ8A 4BWMA 2HHTA 1MU2A 2CQ1A 1HI0P 4Y34A 2HIQA 3VALA 1LW0B 4NCGB 2I5JB 2ERRA 1RTHB 2IM1A 3IAM9 4YMEA 2DIVA 5DQGA 2UXBF 2J9EA 3LGMA 4CZCA 4KHMA 1WTFA 1YTYA 3T1AA 1N5SA 2P6TA 5E3AA 4I7FB 2DNKA 2AJ4A 3CJ4A 2AWZA 3H8YA 1TL5A 1FD2A 4XK8C 2QSFA 4KIAA 4MYUA 4RW9B 2VPWB 1YJUA 5KFUA 1EETB 4ZP9A 2KM8B 3IG1A 3BEGB 1N5YB 2G9OA 2QA2A 2UVVA 2VQEF 3DYAB 1H0HB 2IM0A 4HEA9 1S9GA 1S6PA 5KG3A 4C0HA 2KI2A 2CVEA 3AB2B 5KFYA 2HFZA 4LF9F 2HNYA 4FNHA 1WEZA 2P5VA 2PN6A 4LSLB 3CCWA 1LV5A 3CCZA 3M8SA 3MZIA 1TKXB 2KDOA 5IS2A 4MFBA 5KT6A 4U9RA 1FK9B 1QAYA 1YQHA 1J2VA 1VQPS 2YKQA 5B0EA 5CA5A 3P49B 1HBMB 2KN4A 2XS2A 1TQLA 1OSDA 3TUZC 1HMVA 1RT7B 2PI5A 1YJTA 3NNHA 2FB0A 2RU3A 4AL7A 3Q8RB 1FF2A 1ZPWX 4X66F 4QU7A 4KKOB 3J7YI 4DV1F 4GC7A 4UY85 1SIZA 1C1BA 2OFGX 1TL1A 2V9KA 5B08A 3CCRS 5HP1A 5D8HB 2HNDB 3L3CA 2Q3PA 1AFIA 1O51A 4N56A 2B6AA 5KFBA 4ZKAA 4ZCIA 4L6V3 4NRUA 1OPZA 3I32A 3U7JA 1DQAA 1NNDA 1S0MA 5KFKA 4M94A 1REVB 2EVZA 1FJ7A 1U6BA 3L95X 3PW4A 3FVYA 1S49A 3M8PB 3P3DA 3DU6A 3R5CA 4LQ9A 2MJUA 4TLQA 4G1QB 1O0PA 4EGLA 4A8YA 4IO9Q 1NKCA 4Y2IA 3KLEA 2R8GA 4FF3A 1HFEL 1CC8A 2D74B 1VQ6S 3QZ7A 1FRJA 4IH5A 3M30A 2M8DB 1LFWA 4N47A 4CO2A 1OIAA 2E1AA 2ADBA 2D3UA 3KG4A 1XNQF 2LDYA 3VAHA 3FEZA 3KLGA 3HZGA 1U26A 2A2DA 5CYJA 2Y1JA 3MM8A 4HDGA 3TI0A 5CZVA 1HWJA 6FD1A 3GMGA 3UPFA 1GX5A 2ZH9A 2M88A 3RBDA 4J9PA 1S1VA 1DFDA 2AGQA 1S0NA 4RW8A 2CKWA 4DFKA 1X7VA 3S7RA 4LF6F 2I8EA 3C46A 3M32B 3HVTA 4B08A 3MM5A 2KRRA 4I4BA 4C4WA 1KVJA 3I87A 3MM9B 2KM8C 2ROPA 3Q2SC 2GQQA 4RZRA 2OIHA 1FXRA 3EPIA 4NZ0A 2NR0A 2LQBA 3BSAA 1UVMA 2YWFA 2DCUB 2VBZA 5IQQA 2KT5A 4BC9A 3EZ5A 4HTJA 2C3MA 2QLWA 3MECB 2E1RA 2CPYA 2DGXA 2X3GA 3TAQA 2L41A 2B9WA 4H4OB 2E5LF 2KO1A 4RNNA 3OTDA 3N6NA 4W92B 2BANA 3J7A1 4C8KA 1QJHA 5IM0A 4DF8A 4F67A 1S1TA 1N52B 1UFWA 2KYZA 2OH2A 4O3RA 2FLPA 4NYZA 1LXJA 1KRPA 3PJXA 3SCJE 2ADCA 1VQYA 2VD3A 4FXWA 5KFQA 4DQIA 1HBNB 2MJNA 4XDDA 5D4PA 1LWCA 3MM6B 3UR3C 1UA1A 2OTJS 1C4AA 3CJKB 1D8YA 3VCDA 2DPIA 4KTQA 2GGPA 5G4DA 5GAEU 3T5HA 2HLTA 3BDPA 3K0JA 3QIDA 4IQMA 2XSJA 3OFGA 1HBUB 2NYIA 3UDCA 2C28A 4QWBA 2DNMA 4Y00A 4IDKA 3VR1A 4R5PA 2AJ0A 5J2QA 1Q8IA 3IFEA 1VMBA 2QA4S 3IS9B 4C9DA 2X1BA 2R4FA 3V4IA 4DV7F 1NK7A 1Y3KA 1WACA 4C11B 3C8YA 3I4HX 4O4GB 4O3PA 5DGAA 1FRHA 4UOCA 4I69A 2VUGA 2N4DA 2B43A 4PG8A 3SDEA 2KTQA 4DQPA 4NCAA 1S0VA 3JB9k 1CC7A 3EXCX 4ED7A 4FPRA 1Y3JA 3MXHP 2CQ4A 3I96A 3LP2A 4OZNA 4DL5A 1VQOS 2B9XA 1HMVB 3G6VA 1VQMS 2HAIA 2AJ1A 4F25A 1B64A 1VLYA 2DNHA 4KFBA 2HVZA 3I0RB 1DHMA 2WOMA 2IA0A 4PXBA 1DTTB 3EYZA 2VQFF 2CQPA 1JLQA 2RE1A 5KFRA 4BDPA 4IOAQ 1LK7A 3MR6A 3VQTA 2DO4A 3NWGA 2LKZA 3DOLB 1GXLA 1TL1B 4PPZA 1QAIA 3BO3A 2HGLA 1Z4UA 2GIQA 5M2PA 2B56A 4R25A 5KG1A 5C24B 2YNHB 2BW2A 2N7CA 1QY7A 2B6AB 2DGUA 5BYRA 1S9EB 5BYQA 3PX6A 3PO5A 3DFEA 1MNEA 5F41A 3NNCA 1BD6A 1C1CB 1S1WB 4IYQA 2HFNA 2KKHA 3OR2B