3HDTA

Crystal structure of putative kinase from clostridium symbiosum atcc 14940
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
169
Chain Sequence
b'NKNLIITIEREYGSGGRIVGKKLAEELGIHFYDDDILKLASEKSPENLFKFQSEVMRELAESEPCIFVGRAAGYVLDQDEDIERLIRIFVYTDKVKKVQRVMEVDCIDEERAKRRIKKIEKERKEYYKYFTGSEWHSMKNYDLPINTTKLTLEETAELIKAYIRLKGFM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative kinase
publication title Crystal structure of putative kinase from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
molecule tags Structural genomics, unknown function
total genus 65
structure length 169
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hdtA00
1OE0A 2BBWA 1BYUA 5LBIA 2WKPA 4R9UC 1WQ1R 4PXAA 1NBMD 1VPLA 2GJSA 4DXAA 1ZW6A 4FWTA 1I4LD 3PJRA 2GCNA 2AK3A 3JVVA 4QNRA 4Q9IA 5G53C 3I5XA 3ECCA 4XWAA 3IIJA 4CZ2A 3EARA 1EFCA 1BOFA 1ZUHA 1VMAA 2IYXA 2N1BA 1VYVA 4KYIB 5FUXA 2A5YB 3C14C 4Q9JA 4ZDKA 1XXHE 1AGPA 1Z6AA 2N46A 5CK5A 2GVZC 2BKEA 4EFMA 3OFNA 2QMOA 4C0KA 4P32A 4MH0R 5KSZA 1YZLA 3PUWA 1NLYA 4M4SA 1N0VC 4XVQA 1FPMA 3VNUA 4OQFA 4TL7A 2YC2C 1ZM2A 4FXPA 4KCGA 1G7TA 5EZ5A 1LV7A 3KB2A 2J0QA 3RANA 2VRWA 3R7WB 3MRSA 1AS2A 4C30A 3QPUA 3AGQA 5L3SB 4NMMA 5L3RA 1P62B 1VKJA 5IHPA 4P4SA 4ZKEA 1N5JA 1NJFA 5DI3A 1XJ0A 4IVRA 4CVNA 1ZIPA 3H0KA 5AUPB 1GNRA 1TADA 2FU5C 3L0PA 1Q1BA 2Z6VA 1HURA 3CF6R 3QEJA 3ZD6A 1BMFD 4XOIA 2MMCA 2XX3A 4HDCA 2ZR9A 4N1AA 2ZR7A 1AIPA 3K0CC 1OB5A 1XWIA 3AVXA 4LBWA 4LBYA 3S1AA 1HYQA 1GUAA 4HATA 3ZZ0A 3K0SA 1LY1A 4B44A 2FZLA 2PL3A 2ZRIA 3CH4B 3DM5A 4QM7A 2QQEA 3QI2A 1KSFX 4Q9LA 4Q19A 5TXGA 1COWD 2AL7A 3KXKA 4JLBA 4TLDA 4B34A 3FVQA 4O3MA 3FFBA 5AJVB 5LPNA 4I81A 1WA5A 1I4DD 3CX8A 4C2UA 5KDOA 4O0MA 2OAQ1 3IO5A 1E0JA 5FBVB 3HYRA 4KSCA 3I73A 4GBMA 5CDFE 1OT3A 2QP4A 1XEXB 5F2EA 2I4IA 1XPUA 3ZS8A 3RRMA 1NMZA 5BWMA 1AGRA 1TUIA 4MYCA 4TT3A 2QTHA 1G291 1KI9A 1XEFA 2TMKA 4HSEA 3E2IA 2RGAA 1X1RA 2IXFA 3AV0B 4ESVA 4B3GA 5LDDC 4DSUA 4Q7MB 1MABA 1OXSC 1B23P 3LH5A 1GFIA 2O8CA 2VLIA 1LW7A 1E2FA 2ZRPA 3B78A 4NKRA 3SN6A 5JLJA 3FGNA 3GFPA 4GMXA 4TLCA 5JSZA 4X8LA 3AF3A 3SOPA 2GBLC 3SQXA 2JJ1D 4BECA 2AK2A 3U44B 2W58A 1NKTA 1AJEA 2Q3FA 1OHHD 5IF9A 4QGAA 5JJKA 5EUMA 4CEHA 2WBLC 1GIAA 1CEEA 4ZIRB 1G3RA 2IBMA 2QUZA 3GLHB 2IYWA 5JFGA 4HB2A 4Z8XA 5IK2A 4JVSB 1SHZA 4OK6A 4M8NE 2HEIA 4UNSA 1SVMA 4G01B 4PPGA 4FMDB 1E9CA 5SZKB 3SC3A 4LYAA 4ZCIA 4Q00A 1TL7C 3NBZC 1AK2A 1N6OA 1LS6A 1W4AA 4UNPA 2IK8A 5TDHA 2BHRA 1GKYA 4OI4A 1OXTA 1OH5A 5KYKA 2PJZA 3RAPR 5FUWA 4DLSA 5BN3A 3ZJYA 2WIAA 2O5VA 2WJYA 2AKAB 3CW2A 4W7SA 4QNMA 4JZKA 4TZ0A 3C5HA 1QVRA 4GOJA 1IBRA 2F1RA 5FTKA 1NG1A 4DWJA 3FMOB 1KTVA 3QIAA 2BV3A 3OAAD 2C78A 3OE7A 3O8BA 4Q4HB 2ORVA 4LRWA 1C4OA 1XTQA 1H8HD 5FOTA 2QI9C 3EZ9A 1JR3D 4M1KA 1EXMA 3RYTC 3T1OA 2IYQA 2PMDA 1ESNA 1LNZA 5FI0B 1J99A 2CCGA 5JRZA 4FCTA 4IOKA 1J90A 4C0SA 4ESHA 3FPAA 2KI5A 1M2OB 1RJ9B 2QE7D 4LK2A 3LRPA 5CM8B 2IUSA 4URVR 2ATXA 4ZPXA 2YWHA 3CNOA 2DPXA 4NYJR 5K8IA 2QN6A 4B74A 1GL6A 2CLCX 2F43A 5SZHB 1P61B 3EWSA 3VU9B 1W0JA 4CDGA 2WWFA 4ABYA 1ETUA 3AH8A 121PA 1G19A 3CRW1 4HLDA 4QG7A 2QQ0A 1TU4A 3B13B 1TEVA 3DKVA 3LVQE 2A5FA 1FP7A 4GDFA 1I2MA 3CUEF 3DMNA 4JBWA 3KQKA 4B48A 1N0WA 4GZMA 4PX9A 4DLVA 2AWNA 3BWDD 3UANA 3X1YA 4EFLA 1XX6A 5EJEA 2BVNA 3UXMA 3BXZA 4POAA 2R65A 4GP7A 4M9XA 4URYR 1UBCA 4QBGB 2VF8A 2IYYA 1KK2A 1W5TA 2OAP1 1HE8B 1SVKA 4B47A 3GJ0A 2FSIA 4H1UA 3KTAB 2OE2A 2IW3A 4Q1AA 2BBOA 3GLIA 1XD8A 3NXSA 3UMSA 5FOUA 1ZINA 1KSGA 3Q85A 2FSFA 2ORIA 1WRBA 3LAWA 4LGMA 4GL2A 3SJBA 1LVGA 2DB3A 4AKHA 3GLFB 4R98A 3A36A 2HJGA 2O8DA 3FKSA 4LC0A 1NJGA 1CJKC 4LSGA 2IYZA 4B33A 1FNNA 4DSNA 4L16A 1IY2A 2Q6TA 2OFWA 2RB4A 4HLCA 3W5JA 1YE8A 2Y8EA 2BBSA 1EFHA 1B0UA 3RDPA 2QPOA 1JALA 1W4RA 3RS0A 1BS1A 3QUSA 1WMSA 2VSFA 3CIOA 3TVDA 3U7HB 4LPSA 5TARA 6Q21A 1NRJB 1E6CA 2Q0HA 2ZI9A 2QSZA 1E1QA 4PZZA 5KOYA 4AURA 5JI2E 1R10A 2MSDB 1KO7A 2GZHA 2V7QA 4LI0A 4DSOA 3SJZA 5DHFA 1RIFA 2ASEA 3WMGA 4WAUA 1I2DA 4QJ5A 1QG2A 4PR0A 1FW6A 2LKCA 2ZU6A 2W6JA 3HR7A 1XJQA 3BB1A 3CZPA 2YHSA 1W44A 4W9MC 2VP5A 1QHSA 4Q1EA 1IN8A 2GK7A 2WMNB 4DCSA 4D26A 3PENA 2CJWA 5D3MB 4NBSA 4RJLA 1PLJA 2QM7A 4MYTA 2BCJQ 1R8SA 2O8BB 1KZ7B 2HYDA 4WZ6A 4LZZA 4DKXA 1SKYE 1YRBA 2ECKA 1KI7A 3IILA 5J40A 2GZAA 1IXZA 3QF7A 4YDSA 5JJLA 2GJKA 1G3MA 4HB3A 2V4ZA 4AYWA 3LBIA 2MMGA 3PEVA 2ZVQX 4PQRA 3DO6A 5CLLA 2O8FA 2VP6A 3DKPA 3FWYA 3PG5A 2OESA 3VR3A 2IX3A 4YMSA 1N6RA 1XD9A 1GVNB 2P65A 3KFVA 2WKRA 1ZAKA 1YR7A 1VG8A 5BYJA 5TMPA 1OFUX 3SBDA 4PZYA 2XNDD 1XNJA 2IUUA 1VHTA 4PSKA 3VR5A 2RGXA 3TQFA 4FWIB 2A5JA 2XTMA 3LX8A 4W5WA 3TKLA 3UG6A 4CYMA 2JLVA 1DAEA 5KSOA 1Q1EA 1Q44A 1OFTA 2C9OA 3GEEA 4YMWA 3L2OB 4JVMA 1M7HA 4PC3A 3Q8XB 4Q66C 1WB9A 1E0AA 2WIBA 3EA5A 5DN6A 4MITA 4A8JA 3QXJA 4CEIA 5JHGB 4EIWA 1F6BA 5BN5A 1OFIA 4PHFA 4TWZA 3ZH9B 2B21A 2OSBA 3QG1A 4QBHA 5DNYB 4I1SA 5GJCA 4C0QC 4BZXA 3AF1A 3HYTA 3TSZA 2ODEA 4F4JA 2CE2X 1OIVA 3DM9B 3WHKA 3KL4A 1SXJC 2GXQA 2CL7X 4GT1A 1H65A 1MO6A 3RS7A 1L4YA 1FMJA 1GNPA 1P2UA 4V0KA 1Z8FA 1UAAA 4KLZA 5CM9C 4XVRA 3K0EA 4PPQA 5EP4A 4AKGA 2WMOB 1T8TA 1EGAA 2QGZA 3ADCA 5HKKA 3CPHA 3RLFA 3UIEA 4CT5A 1II0A 4RD0A 4XVUA 1EWRA 5EXSA 1C9KA 1VTKA 2ZSFA 4KLNA 1G5TA 1XFAA 3GJ3A 1VIAA 2NQ2C 2EFGA 3E1SA 3SJAA 3CNLA 1Q12A 1R0YA 1AN0A 1KDOA 3ZZTA 3C7KA 2PEZA 1AKYA 2O0KA 4IDNA 2JJ1A 1ZIOA 3JZMA 3ZLJA 3HJNA 2G0TA 3B1YA 3IGFA 3P26A 1NN3A 2RHMA 2IEZA 4NONA 3GFTA 5EUQB 4U02A 4Q7KA 2ZE8A 1HTWA 3QKRB 1YZUA 1HQYE 4DSTA 4BWYA 1XTKA 3E5HA 3GLGB 1XMVA 3VTKA 2RGNC 2O0JA 5FTNA 3AVPA 4IDOA 4MKFA 2OT3B 3EZ7A 5EE3A 5KDLA 3TK1A 1X8KA 2V6IA 2IS6A 4YMUA 4D0LB 3TH5A 2C03A 5AUOB 4OK3A 4NTZA 1M7GA 1KNXA 3ONWA 1N0UA 2QP9X 5IT5A 1BIFA 1F48A 4GMDA 3AVVA 1GWNA 2XNSA 1Z29A 3H2YA 4RCYA 3T61A 1U81A 4AG6A 4OI2A 2FSHA 1D9XA 2NO0A 5DE3A 1CJUC 1HT2E 2GCOA 1KI6A 3CRVA 3ZIAD 3THYB 2B7BA 2A7QA 3WY9A 5BXQC 3UK6A 4J0QA 1NVVQ 1Q1QA 2FPLA 4V0OA 4ACAA 1SXJA 1G6HA 4JLPA 2MSEB 2HCBA 3LO5A 3IBGA 2FG5A 2D06A 2FJUA 3I62A 4DLUA 1KO1A 2RGCA 3AKDA 4HAXA 1TF7A 1FX0A 1PLKA 1Q1ZA 2YWEA 3P32A 1BKDR 4LHWA 4KBFA 4NCIA 2GRJA 2QEQA 2NG1A 2QBYB 1SQ5A 1TTTA 3ZQ6A 3RHFA 1OH6A 1CJTC 2I1QA 1UADA 1QZXA 2C95A 3GD7A 3WYGA 2H92A 4TT3D 1KO8A 3IBYA 1P3JA 5DLQC 3QG5A 1XEWY 4HZUB 1E0KA 2CBZA 3KJGA 4ACBA 3QJYA 2AXPA 2HYIC 2UKDA 2ZI3A 3U7FB 3QXHA 1IN6A 1KK0A 2HXYA 3TSOA 4RKEA 5IDVA 2A3RA 3CX7A 2F1HA 2G83A 4AKEA 1OH7A 1W36B 2SHKA 2FFHA 4IKEA 5B58C 4V0NA 2PX0A 1RW4A 4WXRA 4WVFA 3MWKA 1DG3A 2YZ2A 1LF0A 2RGDA 2YKGA 2ZAOA 4MUAA 1F60A 2QY9A 1TF5A 1ZD9A 1I4TD 4GPTA 1IY0A 1SULA 3T5DA 3IIKA 1X8LA 1SKQA 1NY6A 2ZJZA 2IF2A 3W8NA 1UKEA 1XXHA 3RSLA 1VECA 2F7SA 2GKSA 2QAGC 3U7EB 5FH9A 2IA5A 4LBVA 3UMFA 3BFKA 2GEDA 3TQCA 1X8JA 4GP6A 1EX7A 3FFAA 1OW3B 1IJFA 1G7CA 4PC6A 2XTNA 3K0AB 1KY2A 3QF4A 1KKLA 1NLZA 2RMKA 4Y0AA 1GL7A 3T5GA 3VR1A 1UEJA 1IN5A 4IOLA 4IOMA 4LJ7A 4IOJA 4A9AA 3PCRB 2C2HA 3OE7D 1CBUA 2GK6A 2WJGA 1Z0AA 1YHNA 3K9HA 3SHWA 4D81A 3THWA 2J87A 4DEYA 3AKYA 1OV4A 4Q5IA 4BE7B 1SVSA 1L8QA 1R7RA 3EC2A 1Z0FA 821PA 2GNOA 4G5RA 4PPFA 1KO4A 2UZ3A 4MRRA 2C99A 4D6PA 5EP2A 2OBNA 5A0FA 1Q20A 1R5BA 4B3FX 4DVGA 4I99A 1FOEB 3SNHA 3GEHA 1GOTA 2NPFA 2O8DB 3KQLA 1WP9A 1YZTA 1W0JD 1YRAA 4X8HA 4LHYA 2JLRA 3T1TA 4IRUB 1KKMA 3K09A 3MLEA 3VR4A 3WHLA 2WKQA 1WBBA 2OBLA 2IEYA 4GOXA 2R8RA 3VR6A 4M53A 4D4LA 1ZNZA 3JZAA 2IYLD 3CF2A 3REGA 2NPIA 3EPLA 4C0HA 4MDEA 1ZCBA 4RZ3A 1E79A 2J46A 1SVLA 4EQ6A 4C7OA 2A78A 5DISB 3K8YA 5H1YA 1H8EA 4BFVA 3TUZC 4LUCA 1P75A 1U8YA 4PSVA 4RFVA 1G4UR 1TQ2A 4NHOA 1JJVA 4YONB 2V8OA 2J1LA 4LJ6A 2KBFA 3QPVA 1T8UA 3U4QB 3FKQA 4A4DA 1NMXA 2FSGA 2I3BA 4KI0A 4PAQA 4GSYA 5GJVC 4P4TA 3ICQB 4KO8A 2IYUA 1YR6A 2XEXA 2HF9A 1EWQA 4UJ5A 2OCPA 3FKSD 3KKNA 2XNDA 1WF3A 1XTJA 5TVKA 5FBLB 4EDHA 1M74A 2HT6A 3BJIC 3AKEA 2QZ4A 3D8BA 2QM8A 2WWWA 3R9XA 2ERXA 4EJSA 3GJ4A 3MJRA 4Q9HA 2PH1A 4JLMA 4H1VA 2ODWA 3L0SA 1P2TA 2AFIE 1KMHB 4P3YA 3W34A 1GKIA 1E3MA 2IYTA 3MG9A 2JLXA 2AR7A 3PEUA 1FQJA 3KX2A 1E1QD 3GMTA 4F4IA 2GXAA 5A4JA 2V55B 2V7QD 2X19A 4WIAA 3VHLB 1QF9A 2BDTA 5CIWA 5K8TA 3NDBB 1N5LA 3PUYA 4G0NA 3K70D 3TR5A 1G8YA 3AEZA 1UKVY 4NDZA 4LJ4A 5CLQA 1TX4B 1F2TB 5DO9A 1IY1A 2W6JD 5GJWC 3M1IA 2UVQA 4Q48A 2OXCA 3ZVLA 3OHMA 3K0FA 2FGJA 4Z1MA 2LKDA 2A30A 1HUQA 2CMKA 1P72A 3U3MA 1EG7A 3NTUA 4C2TA 2HF8A 1F5NA 1G64A 3F3YA 2WPDA 3L8ZA 1CU1A 1U98A 2GEUA 3CM0A 4L15A 4HUQB 4JVLA 4PPNA 1OSNA 3P4XA 3U6BA 3AP2A 3PIRA 3FMFA 2ZRDA 3P27A 1AM4D 1KZGB 1E9FA 1XTIA 3WXMA 1T4GA 2GTPA 5FTJA 4YDHB 1VG0B 4CGZA 2P3SA 2V1XA 4W5HA 2W0MA 4MA4A 4URUR 1YR9A 2GWHA 1W47A 2WJHA 4LX0A 4HZIA 1R5NA 4A0GA 3VHXA 2PLFA 4ILEA 1N6PA 4Q4JB 1JAHA 4RD3A 4ASUA 4NCNA 2DWOA 2C04A 1IXSB 1S1MA 2W2VA 4IDHA 5C4MA 2WTUA 2XXAB 2IHYA 4FD2A 5DN6D 5J47A 1OPXA 3A1UA 1G16A 1E69A 1R4AA 2ZRGA 4NE2A 4FW9A 3U61B 2IHBA 3ZIAA 1ZD1A 3B8HA 4Q4AB 2QROA 2E87A 2X77A 3G82C 4IW3B 5EE9A 3HPRA 3OZXA 2FFAA 2OCYC 4DZZA 4AI6A 4Z8YA 1SVOA 2ZRJA 3IDQA 4B6FA 5HCNA 2XB2A 1W1WA 2BEJA 1II8B 2DFTA 5FBWB 5E3HA 1RPZA 4X8OA 2ZJOA 1OF1A 1XZPA 1FNMA 5TV2A 2H57A 2PJRA 4QRHA 1UKZA 2AD5A 2XSZA 3B7GA 3V9PA 2PZFA 5HKKD 3T06B 1T5LA 3DOEA 5JBQA 2QPAA 2YYZA 4A0RA 4AWXA 5CJ2A 3THXB 4BLPA 2VH5R 2BC9A 3VAAA 4ZCLA 2JCSA 2WWXA 3BH7A 2V9PA 4TL6A 4WZAE 4JKYA 4Q7JB 3QKSA 3LY5A 4FMDF 1OIWA 4D25A 1US8A 4S2EA 1OYWA 2G9NA 3GLFE 1W2HA 3Q9LA 4YLGA 1FTNA 4EPVA 2IS4A 2PLRA 4GZLA 2JATA 3ND8A 3NWJA 4URWR 2IF0A 1XBTA 1SVWA 3ZVRA 2ZANA 4BLSA 3LWNA 3W6PA 3TBKA 1Q22A 1G21E 4KITB 1S0UA 1WE2A 4DBLC 3OESA 1E9AA 1KJYA 1QHHA 4DLZA 5J5CA 3W6OA 4L9WA 3JVUA 1ZC3A 1KI4A 4RZ2A 1VCMA 5KU1A 4OJKA 3I3SR 1UFQA 3NBYC 1T3LA 4E22A 1Z47A 3H1TA 3SU8A 3BB3A 4DJTA 2XZLA 2O8EA 3RS4A 4A6XA 1TNDA 1W0KA 1DG1G 1S8FA 3CLVA 4GNKA 4IFEA 4F91B 1SXJD 2KSQA 2W2TA 2RH5A 3CRRA 4JLVA 3B1XA 4M1TA 3OIWA 4F4CA 5CITA 4TLEA 3HU2A 4B6EA 1CP2A 1HT1E 2FMXA 3IQWA 4TMWA 3REFA 2BEKA 1G5RA 1IN4A 2GAOA 2QMEA 2ZYVX 1XF9A 1Z28A 5KNDA 3PQCA 3AVUA 4B32A 1E2MA 3Q5EA 3OIVA 3EIEA 4NYMQ 5DHAA 4UXHA 4B2LA 4CEJA 4JBYA 3T15A 1E2LA 3LW7A 3HPQA 4OI1A 4EKDA 2WOOA 1SHKA 3KQUA 5ELXA 2ANCA 3SYLA 3SYKA 1UKYA 3WNBA 2P6NA 3K70C 4XSHA 5FTLA 2N42A 3RRZA 3NC1C 4JSYA 4UNRA 3ASYA 5JECA 3AM1A 1F2UA 1HEIA 1PUJA 2JGNA 2AFHE 3QNUA 4HUTA 3GQBA 1YR8A 1Z07A 2QTFA 2XTZA 2E9SA 1DO2A 2ERYA 5K8UA 1OXXK 1UDWA 4CT4B 1K5DA 3Q7PA 3NIBA 4DC9A 1ZNXA 4RKFA 3T1VA 2CNWD 1NLFA 3N2IA 1XRJA 1XD2B 4P31A 5J4KA 3I72A 4JS0A 2ODBA 2BMFA 1DAGA 2PT5A 1HA3A 4ARZB 1JECA 4V0LA 2WSSD 1BYIA 2REXB 5L3QB 4A1FA 4RD4A 5HZHA 4X8MA 2XGJA 4LCBA 2KBEA 4UKDA 3BD9A 4PO1A 1XDBA 4TL8A 4EPRA 3SFZA 3BH0A 1T6NA 4IDPA 1Z2AA 2DBYA 2YJTD 3U7GA 5SZIA 1GM5A 3B85A 2IS2A 4BFZA 4IXMA 3O8DA 4TQUS 2DFLA 4NYIQ 1G18A 2ZRFA 1M1YE 2QAGB 2V3CC 5CB8A 1Z2CA 2Q3MA 5FUVA 1AS3A 1QHGA 2F1IA 5FOWA 1T3HA 5FUYA 3U2QA 1T0JB 4DDUA 3M6AA 4RFSA 1FUUA 3A37A 3U60B 5H8WA 3QQ5A 1E96A 1ZRHA 4L9SA 3C41J 4MRPA 2W2XA 4TN1A 4A8JC 2BIFA 4BGDA 1JR6A 2ZU0C 5AR1A 5KNBA 3GJ7A 2J0UA 4HLUA 1TUEA 3C4JA 3EAQA 3SR0A 4ZI2A 5C46F 2OFOA 2OFXA 2QG6A 2WM9B 4OHZA 1CR0A 3W90A 2HCJB 1HY3A 1DADA 2XAUA 2ZR0A 4PQYA 4D0NA 4QL3A 1E2PA 2X8AA 1JXOA 5F98A 5FFMA 3FB4A 2Z83A 1P5ZB 4PQFA 1Z0KA 4PFSA 4XH9B 4D2IA 3PUVA 4ZV4A 1ZM7A 4ZCMA 2FF7A 1A5TA 4KFTA 3EIQA 4G1UC 3WP1B 3GLGE 1JQLB 1AA9A 3O8CA 1E2GA 4DT1A 3GFOA 4DLXA 4EPTA 4B43A 4GRAA 3RSOA 1GNQA 3EC1A 2FEOA 3TLXA 4HB4A 5C2JB 3BRWD 3SYNA 2QMHA 5FPTA 4BRWA 1FZQA 1E79D 5B64A 3MFYA 2D74A 3TUJC 4G5QA 1H8ED 3DZDA 1VHLA 2X1VA 1Z6GA 2Z4RA 2R6DA 2XJ4A 2B8WA 1ZD8A 3LX5A 5JWHA 4B3BA 2QT1A 1T5IA 1GDDA 1RRPA 3CX6A 4LY6A 2K5UA 3W9YA 4M1MA 4KFUA 1LF5A 2ZJ5A 2EU8A 5CB6A 1A82A 1NN0A 1E2IA 4RZXA 3PITA 4Q01A 4JBXA 3TJZA 4HAVA 4Z51A 5B2ZA 3IEVA 3LW8A 3MWJA 2R62A 5GJBA 3WNDA 2OLKA 2REBA 3B1WA 1UBEA 4CRWB 4MRSA 4EFNA 2G3YA 3GJXC 2KJQA 1JXMA 3C15C 2PX3A 4TMVA 1KDPA 2BJVA 4M9SA 1JB1A 3Q72A 1UBGA 3B1VA 1OKKA 3KKMA 4DLYA 3EIHA 1Q57A 3FDIA 3AP3A 4P4SB 2Z5FA 2IWHA 4V02A 3WRXC 4UXJA 3CZQA 2DR3A 5DI3B 1U99A 2V6JA 2VIIA 3MCAA 3NHAA 2CEAA 5EE0A 4NCHA 2VP0A 1DAMA 1AKEA 3RS3A 1R5OA 1MRSA 2JLSA 3MMPA 4HAWA 1W4BA 2IXGA 5C18A 1M34E 4TYPA 1KJZA 2VA8A 1S3GA 2Q21A 4WZBE 1W46A 3AVYA 2WHXA 5KTYA 4GFDA 4PAOA 5BYKA 3S1AB 1NVVR 1KY3A 1P2VA 3CWZA 4LYHA 5EP3A 4M22A 4PHHA 3LVRE 5P21A 1TAGA 4M2LA 2CDNA 3LA6A 4B2PA 4Z1MD 1VCOA 3CRQA 3SBEA 4HI0E 2H1LA 2NO6A 4LWZA 2P5SA 3L0IB 3L0OA 1W48A 4US1R 2Q9CA 2YNMA 1NSTA 1L2TA 5DYIA 3ZVMA 2WPDD 1M8PA 1NSFA 1NVWQ 2BMDA 3LBNA 2QT0A 3BOSA 3TW4A 5B30A 4URZR 4FMCB 3W8RA 2C5LA 2Q9BA 3NEJA 3FHOA 2YWGA 5AWFC 4JL6A 2CVHA 3SDZA 2ZQ5A 3AVWA 1E2KA 2F9MA 5HCIA 4C4PA 1WBDA 5EP1A 2YOGA 1E0SA 2BWJA 2IT1A 3BS4A 4Y0VA 5CYOA 1MABB 2C77A 3R7WA 4XTRA 2CE7A 1E1RA 5L3SA 2O8CB 3HWSA 4TTRA 4WBSA 3HU1A 1A7JA 3ADDA 4BFYA 5JSZB 4ASUD 1QHNA 2GAAA 2J41A 4M0LA 1E2JA 4Q21A 2IS1A 1N6KA 3P20A 2GCPA 3BH6A 2QRZA 1W4CA 2ZRBA 4OK5A 1KAGA 2NIPA 1DS6A 421PA 4R71A 3KQHA 3LXRA 4DCUA 2ZRKA 3EZFA 4I1UA 4CEHB 1VYTA 5HE8A 3H4MA 3PVSA 3F5FA 5KSYA 2WZQA 1ZP6A 4XD7A 2J7PA 4Q1BA 5GVSA 2CCJA 1Z63A 3NVAA 2CLSA 5E7JA 1G1MA 2ZITA 3CR8A 5JRJA 1TQDA 1A2BA 3MD0A 2C8VA 1A4RA 4HLQB 4QBIA 4DLRA 2NGRA 1DELA 1XMJA 4M9ZA 1G41A 1IQPA 1TQ6A 2F55A 2J3EA 2ZRLA 4B75A 2YINC 1II9A 1SKYB 521PA 3QSYA 4D80A 2CHGA 1W5SA 4OHWA 1CR1A 2PZGA 2WOJA 2E1RA 5HE9A 3QXXA 4LV6A 2FEMA 2VYFA 4KBGA 3Q5DA 1XEXA 2XSZD 1A1VA 1KAOA 2JEOA 4B71A 1MO3A 2B8TA 4JLDA 4JLNA 3AUXA 2ZROA 2QNRA 3D31A 2P67A 1ZYUA 5FL3A 1JI0A 1U0HC 3LNCA 1DAIA 2D3WA 3K1JA 4BQSA 4QJ4A 1GG2A 4IVQA 1Q21A 2G6BA 2WWIA 1DBSA 2IYVA 3AB3A 3N2EA 4TMKA 1BH2A 2EFCB 2ZYUX 3CNNA 2WAYA 1KI2A 4BFSA 4C0AC 4MYHA 1O87A 3X1WA 1S3SA 5JMTA 3K09C 4A36A 3U44A 1EESA 1DAHA 3H86A 1G20E 1D2EA 2F3RA 3UKDA 1E2NA 3CF0A 2ZUBA 2DCUA 3PUZA 2CNWA 2HT1A 4ZIRA 2F43B 4JJZA 2FV8A 3GLHA 2PZEA 2EWVA 3AVQA 3KJIA 1Z6YA 2EFDB 2GVDC 3HU3A 3ZS9A 4G5SA 2J5XA 4FCWA 1KNQA 3DEFA 4XJXA 2FNAA 2FGKA 2PCLA 2VHJA 3FHTA 2WSSA 4FCVA 3QXCA 4TZ6A 2A9KA 2WV9A 4E07A 3EXAA 4OL0A 1FL9A 3SHFA 3Q3JB 4WA7A 3OIUA 4IFBA 3H84A 4M1OA 1KK1A 2AX4A 1U0JA 3VFDA 4XIGS 4BZPA 1F3OA 2CHVA 3A1SA 3HR8A 2ZJ2A 1MH1A 4FN5A 5KDDA 2ZI6A 3U3OA 4F38A 1W0KD 2FX3A 1TQ4A 1ZU4A 2RAPA 3A4NA 1U94A 4PSAA 3GLIB 4K46A 3CKLA 2ZIAA 1E9RA 1Z0JA 4U00A 4EJSC 3VKHA 1YZGA 2ZSAA 3C8UA 4ZKDA 1JAIA 1CTQA 1UF9A 3U3RA 1L7VC 4Q4HA 3ADBA 1CF4A 3FMIA 1QG4A 4OKSA 4US2R 1LS1A 3AUYA 4M1SA 3U6KA 3A4LA 1NNEA 4NPHA 8OHMA 4YQFA 1CS4C 2FFBA 1E2HA 2XB4A 3ZQJA 1U8AA 2OO7A 3X1XA 1RJ9A 1PV4A 1P9NA 1ZNYA 4E5UA 2BOVA 1XTSA 2EVWX 2RKOA 3QEOA 2JIZA 1MT0A 2HLDA 3BORA 4L5BA 4Q1DA 3KUDA 2VHUA 1D9ZA 2ZAMA 5ANRB 2J7KA 4PANA 3VU9A 4E03A 3KDSE 3K9NA 4HAUA 3CH5A 2QAJA 4TYYA 3PEYA 4YXWA 2DY1A 2ORWA 5K8LA 3HDTA 5HPYB 4UJ3A 1P6XA 5EZ6B 4QM6A 3SEAA 2QMUA 3R9IA 2C96A 1VYUA 5CK4A 1T91A 1IN7A 2CJWB 3KZ1E 3FOZA 1U9IA 3G5UA 4HAYA 4LJAA 4NP6A 3TSWA 5H70A 4ZO4A 2ZRMA 2VPPA 2FFQA 4LJ9A 1XJCA 1S9DA 1R0XA 2HUPA 2A5GA 1N6HA 3KTAA 4IXNA 1ZMXA 3R9WA 1ANKA 1DAKA 1PJRA 1RRFA 5CJPA 1XTRA 1KSHA 2O52A 4KODA 4TMTA 5GVRA 1VG1A 3CRMA 3A58B 2MSCB 3RWMB 2R6AA 2JLYA 1IONA 2ZSBA 4OHXA 3O47A 4FMBB 3GLFA 2O8FB 3L43A 1G17A 1NVXQ 4QGGA 3B9QA 3OF5A 1FUKA 2KWIA 1GRNA 3DL0A 4JT2A 3WBJA 1M6NA 3I4LA 1G6OA 2OG2A 4LYFA 5DGXA 3HP1A 3CPEA 1OH8A 5FOXA 4G5OA 3B60A 2FOLA 1NL3A 1ZM3A 4N3NA 1DOAA 4GI7A 5KNCA 4MKGA 1CJVC 3FE2A 1OB2A 1W2GA 1XP8A 2OV2A 3SJCA 3ASZA 2OCAA 4MQBA 4CIDA 5JI3E 1CR2A 1S1CA 3MJHA 2BCGY 2XJ9A 5A5GA 5TB5A 5BN4A 4R7ZA 3VMFA 1YQTA 4R2IA 5DIFA 2D62A 1T9HA 1FQKA 5HZKA 4KHZA 5EXXA 1E4YA 2OLJA 4G5GA 2J0SA 4A8JB 2ZRHA 4PZLA 4CEIB 4JYCA 2ZS8A 3BIFA 1SVIA 2ZETA 3RS5A 5JHHB 4FINA 1GTVA 3GLHE 4BEBA 3GP8A 3ZYCA 5JCPA 3CBQA 221PA 1SGWA 4AG5A 4YMVA 1E9SA 4RY2A 1Y63A 4N0EA 2NTYC 2ZS9A 5JCZA 4KU4A 4TQAA 5FR2A 3I61A 4QBFA 4XTCS 2NO9A 5D3MA 2RHDA 1KK3A 1E99A 1G7SA 2AHOA 3L82B 1KO5A 4JLJA 5JS8A 5LB2A 1O3YA 2O8BA 1HQCA 4URXR 1E4VA 2H18A 2IYRA 4LOAA 3GJ5A 3IQXA 1YJ5A 4RCZA 1XPRA 3NKVA 2VQSA 3MAAC 2WJIA 4A2WA 4DDWA 2BJWA 2OCBA 3TVTA 1XEWX 4Z54A 1AQYA 5EXTA 4TMZA 3A1WA 3P1JA 4B2IA 4EPWA 621PA 2RGGA 1D2MA 3LQQA 3PFIA 3M0EA 4TYQA 3BAFA 3DMDA 1JEDA 4B3XA 1KHTA 4M9QA 2ZJAA 1J8MF 4LPKA 3CONA 2W83A 3UPUA 2OEPA 1VIYA 4BFXA 4KVAA 2JJ2A 3X2SA 5BW8A 4BPBA 2ONJA 1Z0DA 3EX7C 4QGHA 2EFHB 2VL7A 3TRFA 4NCKA 5B57C 2FA9A 2RGBA 4JLAA 2GF0A 1E9EA 4IJMA 2VP2A 4DUGA 1OKKD 2JA1A 1V5WA 1IXRC 2ZJBA 3D3QA 5UKDA 5H68A 4ZDJA 4EUNA 4TYNA 5FPYA 3IIMA 1LB1B 1Y3AA 4F93B 2FN4A 4US0R 3NH6A 2PBRA 3ZZUA 5FTMA 2D2FA 2Q3HA 5DH9A 3NDPA 1OLOA 3TAUA 2NOAA 3EPHA 4LHVA 3I32A 4NU0A 3AGPA 2ODNA 3DVLA 3NEYA 4JIMA 1XPOA 1TMKA 3IHWA 1EFTA 1GP2A 1VCNA 4DLTA 5FPKA 4V0MA 3UG7A 3I8XA 3UWKA 5HR5A 1K6MA 3I1FA 3ND9A 1MKYA 4IHQA 1QVAA 1EFRD 1E98A 2ZXUA 5DSZA 4C0LA 2AN9A 1XZQA 1ZVQA 4MGZR 1RYHA 4NH0A 3VKWA 4A2QA 3C16C 2VHQA 2GCOB 1KI6B 3G0HA 4LDJA 1Z3IX 1CKEA 3NC0C 3RS2A 3RRNA 1MR3F 1SXJB 1PZNA 3QOFA 4Q47A 4BZQA 2G1JA 3FYHA 3QVUA 3ZGXA 5KPJA 4MGYR 4XWOA 2ATVA 1U0LA 4NYMR 1ZM4A 1RFLA 1UPTA 1FX0B 2AKYA 5JS7A 2FPMA 2ZRAA 3KXLA 5G3ZA 1R6BX 3EPKA 2R6GA 3NBFA 1FTSA 5KPDA 1Z5ZA 4NCJA 1S96A 4LBZA 3FHCB 1FMLA 4MKHA 3MGCA 1YZQA 2F9LA 2QP3A 3LLUA 1RRGA 2JASA 2DYKA 2XOKD 3NH9A 1IJEA 2CXXA 3BFVA 1G8HA 1W36C 1E1RD 1P73A 1XB2A 2OUKA 4P33A 4BEJA 3VKGA 1N6NA 1NY5A 3SI7A 3QKRA 4AK9A 4E09A 3BK7A 3K53A 1D6JA 3GLGA 4WW0A 4Q9KA 3D6TB 3DHWC 4MKIA 4Q02A 4I4LA 3ZDQA 3RC3A 1DARA 1WCV1 1KI3A 1PLLA 3K9GA 3NHBA 1LTQA 4DCVA 3B6EA 3IPYA 4QGFA 2G1KA 2ONKA 4R2HA 4IDQA 3ZVNA 3KUCA 1CRPA 4KYUA 1WXQA 2XZPA 4XD7D 2J7PD 4GOKA 1L4UA 2GJ9A 4LYJA 1XCGB 2VP4A 4QXAA 4TTPA 4TL9A 4A6PA 2NO1A 1RKBA 2H16A 4DEXA 3ICEA 5AUNB 1N6LA 2C9CA 1XXHB 3I8SA 4DCNA 4JYBA 3THYA 1JQJC 1ZUNB 3OEEA 1TF2A 4BASA 4NYIR 2ZE5A 3K0CA 4PTLA 1NG9A 1G3QA 4WOPA 3WMFA 4OYHA 2EFEB 3J81k 3TIFA 2CVFA 5FPHA 3W6NA 1E9DA 2C98A 2QA5A 3QF4B 5LD2C 2GDJA 3KKPA 4HLUC 2QBYA 1MO5A 2JDIA 3IO3A 3BE4A 3WNCA 3A4MA 4DHEA 1EX6A 4B35A 4DIEA 3QENA 4BLRA 2ZRCA 4M21A 2R6FA 4QHYA 3SE0A 3DDCA 4HZUA 4LHXA 4ON9A 1R8QA 5AJWA 1RVDA 1VCIA 2ZM5A 3THWB 4LJYA 5KHOC 1NIJA 2ZRNA 3TAHA 4EPYA 1Z22A 2WVJA 4HDQB 1CIPA 4OQLA 3BERA 1FFHA 3L8YA 1AQUA 2VO1A 2D2EA 1KYIA 1U8ZA 3TMKA 4A82A 3B82A 3QXSA 1P9RA 2H17A 1S2MA 5E7MA 2W6IA 5J4YA 5JZVA 2EYUA 4RVCA 4BRUA 2P0EA 4JLOA 1JBKA 4TSFD 3VR2A 4NZYA 2J59A 2GBLA 4W5JA 4LHZA 3RNLA 4PC1A 4PO8A 3EWAA 4MGKR 3TW8B 2WWYA 1HV8A 4BFWA 2AD1A 2X2EA 4V0ME 5KSPA 1A2KC 3NBXX 2ZYWX 4JLKA 5F9FA 1G8GA 3ZD7A 4EQ6B 2QL6A 3UWOA 4F92B 4C7OB 1E94E 4B3CA 1ZU5A 2ZS7A 2CL0X 2JLQA 1S9HA 3WMEA 4N0DA 3K0AA 4TYWA 3A1TA 4BFUA 4OHYA 4KFRA 2G0NA 3T35A 5HTKA 4C0BA 2RCNA 2VBCA 5E95A 1G3IA 3LLMA 3THOA 4TMXA 1IHUA 1R0ZA 2DFKB 2F3TA 1YZNA 5M04A 1R2QA 4D4JA 1P7CA 1RYFA 5E4FA 1XCPA 1G4AE 1QHYA 1C1YA 4CW7A 1MOZA 4RD6A 2WSMA 3IEUA 3KJHA 1J8YF 1D2NA 2ZJYA 4EJSB 1DEKA 3LXXA 3GEIA 5AJYA 3W3AA 3TUIC 3AF2A 4DDTA 1XCMA 1VDZA 2CK3A 2HV8A 2ZI5A 2ZPTX 1TEXA 3CO5A 4L8GA 5SZJA 4XWKA 1Z06A 2BMJA 2VF7A 4D82A 2VP9A 2JIZD 1XU4A 1OXUA 1G3UA 2HLDD 2VSOA 3BFXA 3OEHA 4PC2A 2ZYTX 1G8PA 4QOSA 1M7BA 5FBQB 5FL7A 4A0HA 4EPXA 4QKQA 1K8RA 4DIDA 4TLAA 2GA8A 2FH5B 3PV0A 1QRAA 1CXZA 1Q3TA 4NYJQ 5GADl 1NP6A 2F1JA 2NO7A 1WDTA 4QHSA 3W3ZB 4AYXA 2W00A 1W7AA 1G8FA 2B92A 4YXWD 1NBMA 4DLWA 1N2CE 1Z0IA 4IEEA 1ESMA 4ZDWA 4BUJA 1X3SA 1E32A 1OXVA 3K0FB 3K9LA 4QC2A 2ZE7A 4LJ5A 4KSBA 4AY2A 2NZJA 4G3XA 1GRRA 3TNFA 4KFSA 3LBHA 2YOFA 3SZRA 2C9YA 1YZKA 2ZUCA 4I1OA 4AD8A 1Z08A 1ZM9A 5FI1B 2GXSA 2I1VB 1E2DA 3DPUA 3P4YA 2BKUA 4UQOA 3AVTA 2GESA 3KXIA 3U4QA 2V1UA 4OQXA 1GKUB 3EASA 2D7CA 2P2LA 2R6CA 4HEJA 5KO2A 1T0HB 3CWQA 5AJXA 3WP0A 2QORA 4CF7A 1ZCAA 2R2AA 1Z6XA 3AF0A 4U5XA 4I1VA 1DAFA 4K81B 3VNVA 1NMYA 4PC7A 1OYYA 1ZUIA 4LV8B 2Z43A 3QBTA 5EQTA 2A5DA 1U90A 1DO0A 4D4MA 3DOFA 2ZREA 3A1VA 4Q03A 1KMHA 5AK0A 4JL8A 3PEWA 1AZSC 2HDNB 3KKOA 3GJ8A 3UATA 4D4KA 3KQNA 4O2LA 1NF3A 4DCTA 2ZSDA 1P9WA 2XITA 4FIDA 5D3QA 1YKSA 2CLDX 3EZ6A 4V03A 3V00A 1BMFA 4JJKA 4IEIA 4OJQA 2ZJ8A 4YC7A 1E2EA 3OIYA 4JKIA 1RC8A 4TLBA 3AKCA 1EFRA 4FMCF 4JL5A 4JVNA 4PHTA 1F2TA 2FE4A 4U7DA 2H5EA 5EE1A 2YOHA 5IRCD 2VSXA 1TU3A 2OILA 3LFUA 3N5CA 4P0TA 2DHRA 2BMEA 3TE6A 1COWA 1KGDA 4PAMA 1ZJ6A 2FPKA 4B3DA 3ADKA 1KSJA 2B7CA 4M1WA 4D0GA 4AKIA 5JEDA 4RSGA 3EW9A 3SFVA 4A2PA 4BFTA 2BM0A 4HUQA 2GZDA 3AF4A 1YVDA 3IPXA 1D5CA 2RGEA 4C9BA 4QFMA 1EK0A 4Q7LA 2GJAA 3GLIE 2XOKA 4Q1FA 1TPZA 3RABA 3OFND 1GILA 4DDVA 1UM8A 2R44A 4LC1A 1P60A 3QKSB 1US8B 2JJ2D 3WRYC 3KKQA 1CRQA 3VX4A 1UBFA 2D4HA 1ELOA 3WBKA 2PMKA 3T12A 4Q4JA 4RZUA 4MGIR 3PR1A 1ZBDA 3CPJB 4B76A 4QJ3A 4DUGD 1OHHA 3B2EA 2ZE6A 3F0TA 4HAZA 4XSGA 1X1SA 1FP6A 4ITRC 3EA0A 2QSYA 2WWGA 3T34A 4BLQA 3E70C 3QKTA 2XXAA 1GSIA 1P2SA 2VTKA 3QY0A 1UJ2A 5E7IA 3B1ZA 2G77B 4AYTA 2H7VA 1NN1A 1K5GA 3A6PC 5TY0A 1P4SA 4HYYA 2EQBA 1IAQA 1QHHB 1SZPA 2O0HA 2PEYA 1UDXA 3MWYW 2J9RA 4FI3C 1N5IA 4Q4AA 3PXGA 2ZI4A 2AXNA 5LB4A 2D7DA 2AWOA 3AVOA 3QBVA 2QTVB 4HB0A 1JNYA 1JPNA 2ZEJA 3DZ8A 5JEEA 1NBME 5FR1A 4UXIA 1II8A 3I5YA 4A15A 5C1BA 2J45A 3MSXA 2GJ8A 4YMTA 4IVPA 2REOA 2BBTA 4OQMA 4OHVA 1X6VA 2YC4C 2O8EB 4KXFB 2WJJA 3KJEA 1E9BA 4RD2A 3M4YA 3B9PA 3V4RA 3IHLA 1N6IA 1T3SA 2HXSA 1YU9A 2WJVA 2P5TB 3LV8A 4M1YA 2B6HA 5DI9A 1CULC 1KJWA 1OIXA 5J4LA 5EE5B 3EZ2A 4WXPA 1QHXA 4MDFA 3D7MA 1RRCA 2V54A 2Z0MA 4II7A 3OAAA 3AQ4A 3THXA 3C5CA 5AUQA 2IWRA 1ZNWA 2KE5A 1H8HA 1JR3A 1R0WA 5F3WB 4PHGA 1N3BA 4C0JA 1KIMA 2P6RA 4CEJB 4UNNA 1GRQA 4C3ZA 2OHFA 3QE0A 1CJMA 3U3JA 2YVUA 5FBRB 1ODFA 5CYPA 3BC1A 1IM2A 3RRYA 2QPTA 3WYFA 1ZC4A 3LDAA 1DPFA 2EWWA 2QE7A 1XMSA 5G3YA 2G88A 4DB4A 2GXUA 1F2UB 4TSFA 1DTSA 2JAQA 2QU8A 5CIQA 2EW1A 1Q3HA 4P4UA 1MV5A 2GETA 4BLTA 1PUIA 1IOZA 3TR0A 2DWPA 1W49A 3MWLA 1U9IC 4UNQA 1G7RA 3TGPA 5C4GB 4DB2A 2J0VA 4O2RA 3X1DA 2ZVPX 2FZ4A 2R9VA 4NL4H 4Q18A 5G41A 3W5IA 4ERNA 3V4FA 3CR7A 3NG1A 1GL9B 2OZEA 3MUFA 2Z4SA 5IK2D 1LFDB 3EPJA 2RGNA 1S4QA 3VQTA 1DE0A 5JWOA 2A2ZA 2JLZA 3GPLA 4OI0A 5F9HA 2L0XA 1HH4A 3CB4A 2JLWA 2GEVA 2HJVA 2VHCA 3PUXA 2ZUDA 3OEED 1J2JA 4ZI3A 3VX3A 4PO9A 4LJ8A 4ZDIA 1J70A 1NN5A 1G5PA 4OBEA 1MO4A 2EYQA 1J7KA 2KB0A 2DFNA 5KUTA 1AS0A 3F8TA 5J4VA 4BLOA 3AP1A 3ETLA 2IXEA 2P6UA 2FDCA 5FOVA 2JDID 2YV5A 3SQWA 4EAQA 3U5ZB 1JPJA 3R8FA 3I92A 3IKJA 3FMPB 4RFSB 4A0FA 2GHIA 2XZOA 2IL1A 2QENA 3EG5A 2OBMA 1XMIA 1E2QA 3B5JA 2WAXA 1Q0UA 2IC5A 5EXPA 5LD2B 1KDTA 2UZIR 4MYUA 2ZSEA 2IUTA 2J0UB 3T1QA 1BO6A 2GF9A 4AC9A 4KJZA 1UEIA 2WWHA 2CHQA 3N70A 2FWRA 1W36D 1Z6TA 4TTQA 2PT7A 3K70B 2NMVA 2Q9AA 3BB4A 5AJZA 2W6ID 4JMPA 5J4HA 3QKUA 1AZTA 3RWOA 3RC8A 1OFHA 3BGWA 3RVBA 2CL6X 4TQ9A 3X1ZA 1CLUA 2OXRA 4Q1CA 3Q7QA 1X86B 4JSTA 2X2FA 1XD2A 1PVOA 4MUBA 3KFXA 5L3VA 4DT1B 5L8VA 2OM2A 2W0SA 3SS8A 1QDEA 2F6RA 1GAJA 2QRNA 1KOFA 4ARZA 2LWIA 4H9GA 4KV9A 4MRNA 4DRZA 1D8TA 1NKSA 1OJLA 2BM1A 5L3QA 4RD1A 721PA 3FTQA 3LQRA 1KMQA 2H8KA 4L4UA 5JJIA 4KAXA 2WICA 2ZI7A 5CDFA 3BBPA 1RE0A 1KI8A 1V43A 1CR4A 2IYSA 4AIIA 1G9XA 1U2RA 1N25A 1ONBA 3GCGA 2QAGA 2QGNA 4Q4LA 5JWRA 5DYGA 1SXJE 3O8RA 1EFUA 1RZ3A 1VG9B 3WYAA 2VEDA 1KDRA 5FPSA 2JLUA 3KB1A 4K8OA 1JR3E 3LD9A 1NIPA 4O25A 4S35A 5FOSA 3UMRA 3R20A 4HDOB 1GZSA 3U3KA 1MRNA 2NZ8A 4LV5B 1Z83A 1NVUQ 3IUYA 3R8CA 2ZTSA 2VHTA 4KVGA 1DVRA 2CK3D 1KI1A 1QHIA 1N5KA 4OQNA 1GITA 1NI3A 4B73A 1HE1C 3GJ6A 4QHTA 3QVVA 4A92A 1JJ7A 4JT4A 1JEEA 3OEHD 2ANBA 5FL7D 2LCFA 3QPWA 2GILA 4F7WA 5BQ5A 2DWQA 2YWFA 3A8TA 2PCJA 5G40A 2JJ8A 4MRVA 1QBKC 2CCKA
chains in the Genus database with same CATH superfamily
4C7JA 1C3OA 1RBQA 1U5CA 1QB7A 5EZYF 4R9UC 2X4IA 3TOVA 1SBYA 1R6VA 3K1AA 3UAYA 5K5EA 4PXYA 1VPLA 4M87A 4R8RA 1ZW6A 2XB6A 1Z4JA 1PS8A 4FWTA 4I3FA 1CUSA 2YJNA 3GELA 4LEIA 1R8JA 4Q9IA 3WNQA 3HJRA 4FPXA 2H4XA 1P45A 4H1TA 3ZW8A 2EW8A 3IIJA 3JR3A 4NZNA 4RTLA 2A9PA 1QFYA 1V1RA 1RZRD 1SB9A 1ZUHA 4DC1A 1ECBA 1JKJB 3B38A 4FNMA 3BD7A 5JSHA 4LDNA 2FWJA 1E60A 2N46A 1QK4A 4UHEA 4D0RA 2V97A 3AHEA 4DXHA 4C0KA 1Z5GA 4P32A 3ICCA 3TRJA 3H5VA 4WBNF 4ZTZB 1TA9A 4LNAA 3EOZA 4ZO6A 4UEQA 4C4YA 4RXUA 3DL7A 3KT8A 5LMZA 3VNUA 1O54A 4OQFA 1SG6A 1JZQA 4P53A 1ZM2A 4FYWA 2P9EA 1IHOA 4KCGA 1KEVA 1CY1A 3H5RA 1KVSA 4I4CA 2I6GA 2IPAB 1C9EA 4H0NA 1QU2A 2VRWA 3MRSA 2R5FA 5KQSA 3EE6A 3AGQA 4C7VA 4JDPA 4I6JA 1W8IA 1SB8A 2QRKA 2UZ1B 2LBPA 3A27A 3C3CA 4UEJA 4V3BA 5BRNA 5SV2A 3MEQA 4YAGA 1N5JA 2UDPA 3FTNA 2DSTA 2J5QA 1ZIPA 3HO8A 3I0MA 5KVQA 4P7KA 3E7DA 3O9MA 1GUDA 1HURA 4B7CA 3H4TA 4P0PB 5AK5A 4PTZA 1VI2A 2XDQB 3ZD6A 3WK6A 4LQ4A 3EUFA 4HFJA 4N1AA 2H0QA 2NV2B 5FHRA 3KVOA 3VHQA 3LHFA 4R40A 1OB5A 3AVXA 1IK6A 3T9FA 4LBYA 3D7SA 4Y1GA 3S1AA 1RAGA 5E3JA 3OZAA 3VPGA 4MRMB 1JQDA 1VA5A 2X6QA 4DCCA 3P9PA 2FPRA 2FZLA 2ZRIA 4PS1A 3LPDA 5JAHA 4RXMA 5MFPA 3NV7A 2IYEA 5KNBH 3EMDA 3QI2A 4Z4HA 4Q19A 3WRVA 5TXGA 3AM3A 2VAXA 3ZBTA 1O94C 2I2FA 3FA2A 2GO7A 1WA5A 1B43A 1CY4A 4I81A 5LPNA 1E3QA 1ZZGA 1U2PA 2P30A 4YRQA 1PS9A 5KDOA 1P0MA 2GBIA 4OQPA 3VPFA 4V1CB 4PINA 3WLSA 2QE6A 1HM5A 2YRFA 3AHHA 4HNGA 4KSCA 4BY9E 4GBMA 2R85A 1OT3A 5K1ZA 2QP4A 3C7TA 5F2EA 3HWWA 1JS1X 1XPUA 3UHFA 3ZS8A 3RRMA 1XLTA 3PWZA 3VGPA 5BWMA 1GQSA 2QMYA 2YFHA 3PXXA 1KEWA 1LDEA 4MYCA 4PE5B 1EXNA 3R5HA 1XEFA 4HSEA 4NNPA 3UCXA 1ZGHA 2OTCA 5BR1A 2RGAA 3G8DA 3GUHA 4CG1A 1PFVA 3M70A 3WLLA 4CF4A 2WYOA 1G6Q1 4DSUA 3C97A 1KZ6A 1AN9A 1GFIA 4NKRA 3M9XA 1FY2A 2ZRPA 4XDYA 3SN6A 1XZNA 3FGNA 2J07A 4MR7B 4B45A 4GMXA 5JSZA 3ONNA 3AF3A 2GBLC 3H1FA 2JJ1D 2DTXA 3N9IA 4UTOA 3OX3A 5A3JA 3JD1A 4H6PA 2Q3FA 1OHHD 4HFRA 3E48A 5JJKA 3B3JA 2WRZA 2HDOA 4TWBA 4ALKA 2CSXA 4CEHA 5B4TA 2HSZA 3L18A 1GIAA 3V7UA 1QS0A 3WMWA 5LYJF 3VZPA 1NVDA 3GLHB 1I2CA 4G85A 4ROTA 5JFGA 4HB2A 2UXBB 3ABSB 2C8JA 5IK2A 3UQYS 1RCFA 1NYRA 4L0MA 2OBXA 1B1AA 1YONA 2X7JA 2ZBVA 3CY6A 4Q12A 1E5DA 3EGOA 3EGEA 3GUZA 4LS3A 3FIUA 4U2BA 4TUYF 1EDEA 1RJDA 1KJJA 4HV4A 1E61A 4H1WA 5AESA 3OO1A 1MEEA 3NBZC 4OHBA 1AK2A 5KYYA 4EO4A 2YZ7A 1LS6A 1SCNE 1TW3A 1W4AA 5TDHA 5HRCA 4PYQA 5JNRA 1IMOA 1WABA 5F5LA 2B9VA 4OI4A 3JTEA 2PQMA 3A3PA 4KJXA 1OH5A 2E82A 4N6GA 2G07A 5E3IA 3RAPR 5FUWA 3RRFA 2EKPA 2P9TA 2WIAA 1K6EA 2OZKA 2Z2IA 3PR2B 3ZXIA 1Y1QA 1K7YA 1GYRA 2QQFA 4TZ0A 3C5HA 1QVRA 4MKRA 3ZQUA 1F1JA 5FTKA 1SY7A 4DWJA 1NKVA 2PRSA 5CPBA 1YB7A 3IAS6 3TWOA 1Z4PX 4N4AA 5F33A 4R8KA 4EHIA 3O8BA 4MI9A 3D7KA 2ORVA 4LOLA 3AQIA 1XDSA 2AI1A 4LRWA 3DYBA 3Q3EA 1BMTA 4JROA 4KRYA 4A15A 3ND5A 3AEQB 2FY8A 1LNZA 5GAJA 1L5ZA 3RO7A 5KJCA 1N7GA 1TYDE 1CE8B 5T57A 2B3TA 3DMYA 2KQUA 1RT9A 4C88A 3KZOA 1MDFA 4WNCA 4X91A 5PGMA 4PN7A 4QLBA 3AWIA 4IJ6A 4W6ZA 3EAFA 3H42B 3OZBA 3W5VA 1ZOPA 1AXRA 4NARA 4II2A 1J8DA 2DPXA 3NFRA 5L3ZA 5K8IA 1H85A 2F43A 1KMIY 2DT8A 1XVUA 4R6XA 2P91A 3PFHA 1Y7IA 3FPCA 3BMXA 1X1DA 1YQGA 2WWFA 1BDMA 4OH7A 2PGNA 121PA 4C2UA 2WM3A 2ZIZA 3ABZA 4P4GA 3QWBA 3HCRA 3UM9A 1XL1A 1TU4A 3B13B 3V5NA 1MEJA 2AOTB 2Z4TA 5G4KB 3CUEF 1XZJA 3KQKA 1N0WA 5H9VA 2BH9A 4MK4A 1O97D 1XX6A 2X8BA 1CR6A 1IIBA 2BKAA 1P9LA 3N2KB 4TROA 1UMBA 3UXMA 3TRHA 2OM6A 2P90A 2BFMA 4URYR 1UBCA 1FLVA 2DFPA 4M1QA 4OUDB 1KK2A 4PYLA 1OWMA 4DMLA 1HE8B 2FSIA 1B26A 2D5LA 1T9KA 2SCUA 3KWMA 4H1UA 3DVQX 3C45A 4J1QA 3GLIA 5DNWA 3D1LA 2RGYA 3GDWA 4XQ0A 4FD3A 3WIOA 1AGXA 5IG2A 2ORIA 3BWBA 4WZAB 5GM2A 3I6YA 4X84A 2O2EA 5CM2Z 3EXHC 3CLKA 3ZE0B 4FGSA 3IYLW 4GQIA 4WOCA 2VBGA 4FZ5A 3GLFB 3ER8A 5KWIA 5CBKA 1NJGA 3QKWA 1HEUA 4L16A 5E1OA 3FTCA 4H3KB 4EG5A 2Q6TA 2BSAA 1BRMA 3SZGA 2BBSA 5ER9A 1EFHA 4KIFA 4TOIA 5TC4A 4XCVA 4YRRA 1VB3A 3I9KA 4KV7A 4OB8A 1FFXB 5IH7A 4QE3A 1R6AA 3OU2A 1QP7A 3UUFA 1BS1A 2HPAA 3ROMA 5D5HA 3W0LB 2VSFA 2OORA 4R16A 5M29A 2B83A 1JMKC 2Q5HA 3CXUA 3ND6A 4LPSA 5TARA 3U7HB 3KEMA 4O4HF 2J8ZA 5K0SA 4FW8A 1OI3A 2ZI9A 1JHDA 2YIJA 4LE1A 2WHPA 1R10A 3SHQA 3WGGA 4YXFA 2MSDB 1U1GA 2GZHA 3DZCA 4LI0A 3BXGA 2H11A 3SJZA 5CFPA 1RIFA 1GCIA 3O0DA 3OX4A 1NYQA 4RK5A 4WAUA 1H4SA 1NHWA 1L7MA 1ADYA 2PGDA 4PR0A 4M76B 2ZW9A 4KDEA 1XJQA 3CZPA 1NWCA 4J0JA 4W9MC 2IHKA 3OWOA 1WCYA 2QHXA 4WY5A 2GM9A 1Y1TA 3NT2A 4DR4B 1ZFNA 1IN8A 5HQTA 3LWZA 1PT8A 3MAGA 4JOQA 5LMUB 1V5FA 1HPLA 4L1KA 4L2IA 2CJWA 1PG5A 4NBKA 4WRRA 4AX8A 4D26A 1QIIA 5KC8A 3CLRC 3STUA 3JQDA 2QM7A 1HYGA 3HO6A 1XLVA 1DKMA 1RKVA 3SX0A 4HBGA 3EDQA 2VJMA 1AV7A 1U7DA 2A9JA 2QD1A 3IILA 3PRKE 4LZLA 1M1NA 2V98A 3E5MA 2GX6A 3GQVA 2AHRA 2OHXA 3SKVA 3QE3A 4MS1A 5JJLA 1BFKA 1G3MA 3ZGOA 2V4ZA 1FDWA 4AYWA 5B3AA 3IERA 5JAPA 1X70A 1EM8A 3GX1A 1T8YA 3IX7A 2ZVQX 4QASA 2O8FA 5CURA 2VP6A 3FWYA 5KHAA 4IIFA 2IX3A 3M6IA 1DKOA 1J4AA 2O2CA 1GFWA 3EGCA 3RVQA 1DMSA 3CYFA 4LF4B 3IT2A 4UVDA 2WWVD 1EXVA 3IDFA 3DOCA 1VG8A 1RQ7A 4R6WA 1ZHHA 3DMFA 5DNVA 5BYJA 1EWTA 1TKCA 3S81A 4PZYA 4KUEA 1NOJA 1XNJA 4ZAYA 1N4AA 3P9KA 4WNYA 1Z4KA 2QRVA 2RGXA 3QFHA 2A5JA 1DFGA 3AJEA 3HKDB 3LX8A 4FWIB 4W5WA 3TQFA 3UG6A 4B2YA 5LXTF 2IBSA 4JUCA 3ORRA 5F5NA 4PC3A 4OP2A 1VSTA 4OQZA 3Q8XB 4Q66C 4RA9A 1TZJA 1WB9A 4TVSA 1F0YA 2WZCA 3CJQA 3MA0A 5DN6A 5B37A 4A8JA 3QXJA 5MF6A 1J09A 4HNSA 1X1CA 3CW9A 5COAA 3PJGA 2K2WA 4KKVA 4KPFC 3G49A 4YGXB 5IBQA 4KR7A 5LOVA 1YMQA 2F17A 4JR1A 4QBHA 5DNYB 4I1SA 3L04A 5C80A 1RCUA 3AM4A 1JSRA 2P8JA 1JSCA 1NMQA 1TXGA 2HIGA 3LPAA 3PD1A 4FKBA 4L4XA 4N0MA 4Y9TA 5DTRA 1WCIB 4D45A 3ZNPA 3IP3A 4FVTA 1Y7TA 3WHKA 4BP1A 1KS9A 5EL0A 3JZFA 3DT9A 4GM4A 3NTXA 1IZ8A 5GWXA 3RS7A 4MUGA 1W85B 1IZ9A 4JI8B 1FMJA 1GNPA 2I2CA 1K27A 1ISRA 4PLHA 4JHXA 4RZQA 1XTPA 4ZT5A 3EUAA 3VH3A 4RE6A 1KETA 4YMGA 3IV9A 3FW1A 3BM5A 1LCIA 2E49A 2VQ6A 2J85A 3MTQA 4J0KA 4PPQA 4XVRA 3EH2A 1TZKA 5EP4A 3AO0B 2QNBA 1AF7A 2NO4A 2W4MA 3OUZA 3PNSA 3TGLA 4KNYA 2EL9A 5HKKA 3JQAB 4PSUA 4OP1A 4CU5A 1WDMA 2GZ3A 2QZJA 4XVUA 3JQ9A 4RNDB 1BROA 2ARKA 1C9KA 2QTGA 3NX4A 3ME5A 4KLNA 2ZSFA 4F46A 4DYVA 2VPYA 3F7NA 2ZQZA 3K0BA 3CNLA 1R0YA 4LA4A 3EZLA 4AJ4A 2W6NA 4GE0A 3WXMA 3C7KA 3QPBA 1VE7A 5K4GA 4OXIA 1AKYA 3Q7RA 2QYOA 2O3JA 3KSMA 1JKFA 2CZGA 1K2VN 1WMEA 2JJ1A 3IUEA 4FLEA 3IKMB 4IDNA 4KMRA 1VSUA 3JZMA 3RAGA 3ZLJA 4WSOA 5DYYA 2AZMA 4HOYA 1DBQA 3JQBC 3QFRA 4R1LA 3MOIA 2RHMA 1JHVA 1SFRA 2QN1A 4H7EA 4J91A 3ZDFA 3F4BA 4TV8B 3IE1A 1JH9A 5JCXA 5ARCA 4H3VA 5KAPA 1G59A 3FETA 4F9EA 5CB4B 1L3CA 1V26A 3E5HA 1YDWA 3MCVA 3I0ZA 3MGGA 4S04A 3GLGB 1N3YA 2HFKA 3UMYA 2O0JA 1VBKA 2J6CA 1BGXT 1JIVA 3D4BA 1FE8A 4IDOA 4MO2A 4DV6B 1LZKA 5EFZA 2IS6A 3OCYA 2BAGA 2BI4A 4D0LB 1GCAA 2QLTA 5AMXA 1R37A 1HWYA 1TCCA 4QOJA 5AUOB 1JRLA 4NTZA 4OK3A 2BD0A 4ETNA 1XPJA 5JAQA 1J1UA 1N0UA 2FK7A 1OC2A 3FLEA 3VU1A 4AO8A 2QTBA 4ES6A 3O92A 1GQFA 1BIFA 3AVVA 4OX9Y 1CQXA 1GWNA 2XNSA 1Z29A 3AMVA 4QUBA 4RCYA 4QU0A 4J9UE 3V34A 2UYCA 3L92A 5EMKA 3VV2A 4CF6A 3EZXA 3EZGA 2FVXA 3UMVA 2Y0DA 1AUVA 1HT2E 4QEKA 1OOEA 1NW5A 3LBFA 4P98A 1IB6A 3WQRA 3WY9A 5BXQC 4J0QA 1DSSG 1Q1QA 5D00A 1YVPA 1YAHA 1ENYA 2IX9A 4V0OA 5TGZA 3EJWA 1VPEA 1WEKA 2EL7A 3ZI4A 2MSEB 2C9ZA 3IBGA 2OGTA 1N9KA 1ZKDA 3CB2A 5AVUA 1KO1A 2RGCA 4QQNA 4W1QA 3EXFA 1PLKA 1Q1ZA 4XCQA 3I6IA 4NCIA 4LHWA 4KBFA 4G26A 4Q3CA 3QU2A 5ELMA 2E5WA 1YQXA 2ZWMA 1P18A 1BFUA 1CJTC 2I1QA 3DC2A 3S2FA 3WYGA 5BMVB 4TT3D 2MR5A 1KO8A 1U0FA 1T10A 4LXHA 3HMQA 2VDJA 3QG5A 1N0IA 5G4LA 1SBCA 3P94A 1AHHA 2PWBA 2HYIC 4OOEA 3X44A 2PRYA 2FUG6 1FU8A 1D1TA 1EVZA 1YDGA 4YAEA 4C7BA 1AKQA 3JASA 1LW6E 1JIJA 5FWNA 4NXMB 1NVTA 3U7FB 5LJLA 1IN6A 1DIAA 1H2FA 3ET4A 3OM1A 4N54A 4TRMA 1M6VA 3CX7A 4WZBB 1OH7A 3ZNOA 3CMMA 3X2EA 2OB2A 5ALRA 3ENKA 3PLNA 3HC7A 4WXRA 1UUFA 4YV7A 3DPSA 4WVFA 2CDBA 4KZKA 1BEUB 4MW5A 1WUHS 1RQLA 1KAQA 3VPAA 1I3MA 1LF0A 1DAOA 1M1XB 2RGDA 4C87A 2ZAOA 1T3GA 1F60A 3SZMA 2VH2A 3ZWYA 3T5DA 1IY0A 4IH9A 3JRNA 5LNK1 2HADA 4MR9B 1SKQA 2QVXX 1KBOA 4ZVNA 5B1SA 1QC5B 1UKEA 3Q41A 1XXHA 4MQ6A 1VECA 3I8OA 5CCXA 2R7AA 4NBRA 3PU6A 1X7YB 3S4YA 3NUZA 1VJCA 3BFKA 2ZATA 3TQCA 1LU9A 2R00A 4GP6A 4ZRMA 2V7GA 1ZK2A 4EOGA 2OCXA 4J7AA 1IQUA 4PQGA 1KQPA 5DTEA 3FFAA 2AIRA 1OW3B 3HYLA 1G7CA 1Z7YA 1XALA 1CDOA 1RYEA 2WJWA 3WXBA 2W2QA 1MRZA 3P9CA 5ALYA 3KV3O 1QIKA 3HYSA 1RI3A 3VR1A 4UM9B 4IIJF 2XUDA 4WXEA 4ARCA 4IOMA 4IOJA 4PW0A 4QARA 1N34B 4A9AA 3PNVA 3ZWQA 3OE7D 3BJMA 4UW9A 2XH8A 1CBUA 3DXFA 4KPUA 1T24A 1HTBA 3L1HA 4YH1A 2JAOA 3W5SA 3WBFA 3K9HA 3FCYA 3LFTA 4YPFA 4L51A 4BPRA 3R0ZA 3B5IA 2J87A 3OM0A 1OLXB 4DEYA 1OV4A 2CXRA 5L45A 2P2DA 2OQ2A 1L8QA 5BSRA 3LC7O 4XI9A 5AVRA 2BGMA 3L01A 5L6LB 1Z0FA 821PA 2GNOA 4KQ2A 1ZR4A 1M2VA 3TM5A 2PE5A 1Z16A 4HRVA 1A8HA 4DLNA 3ESQA 3N1UA 2COEA 2OBNA 3LZ6A 6AT1A 1LX6A 4WACA 1Q6ZA 2TECE 5HZMA 2O1XA 2VRCD 1JIQA 4G89A 4B3FX 3H2KA 1Z68A 3GNTA 1ADGA 4I99A 4DVGA 1GOTA 2ZCVA 3FCAA 5IABA 1E3JA 2GM5A 2O8DB 2G1PA 3EFOA 1EIWA 2I5PO 1NXVA 1A0OA 1ISJA 1W0JD 1YRAA 1YZTA 2HA5A 3GRUA 2JLRA 3CUVA 3N3BC 2I4MA 3O93A 2G28A 2NZYA 2VDMB 3KPUA 1B6SA 4IRUB 4R9RA 5EMMA 1WBBA 4W8GA 1PGJA 1QPZA 3RSFA 3DDUA 1XZMA 4RA6A 4NZMA 3REGA 4FOPA 3TINA 3EPLA 3U0BA 2ACVA 3RE1A 4AKSA 2PLAA 5GZ3A 1YB5A 4OGGA 3ZN2A 1ZHOA 3BDIA 3H99A 4RZ3A 4JV5B 4DRYA 3KM0A 4QDJA 3Q7TA 3V33A 1EGMB 5L51A 1H8EA 4BFVA 3TUZC 1ZJZA 4EMSA 2PKRA 1XV5A 3Q6MA 2XGOA 3G23A 4E1VA 3QELA 4GI3A 4QO7A 4RFVA 3NQ41 1JJVA 2V8OA 1SC1A 5JPCA 1FU7A 2IW1A 2BRUA 2JGLA 3QPVA 3LUPA 3EGDB 1S2IA 3ELBA 2IDZA 4V39A 5H0IA 1QQTA 5SYNA 2VYCA 3SQNA 4WNAA 3DAGA 3FDZB 4KREA 4TT8A 1O95A 3EVZA 3H97A 5GJVC 2VF5X 1HG0A 3QPAA 3MINB 2OCPA 2OKCA 3DOUA 4OHUA 1RI1A 3P9NA 3UBMA 3BMQA 1WF3A 1KERA 2HT6A 2QZ4A 2WM8A 3K1TA 1G20B 2QM8A 4DCUA 4M7RA 3R9XA 1HDGO 4U1RA 1UJ5A 1JDUA 1M6YA 1RKXA 2E4WA 2IOFK 4DS3A 1EJ0A 4M38A 2HO5A 4CMKA 1JIUA 3VYRB 2XYHA 5HS6A 2ORED 4NC9A 2EZ4A 1L4LA 2P75A 5LLDA 1GKIA 5IAGA 1R0RE 1XIVA 1L9XA 3A1NA 3FCOA 3MG9A 5LCXA 3KX2A 4GOMD 3LPNA 1V3TA 3GMTA 4C4SA 1ICEA 4F4IA 2GXAA 2G09A 1WD7A 3Q3CA 4Y1FA 3RM3A 1S2LA 4MR8B 4XXHA 1H66A 1N9GB 2UVDA 1QV6A 5CIWA 1DG9A 2BDTA 3SC6A 3NDBB 4D8WA 3PUYA 1CJSA 1JR2A 1MOSA 5A6SB 3V8VA 1KXJA 3K70D 2ZGVA 3O2JA 3TR5A 1G8YA 4OM8A 1UKVY 2B36A 4X95A 1R9JA 4HXFB 2XB8A 2W6JD 4CUZA 2FPSA 2C7RA 1R0LA 3QBDA 1DLJA 3G6WA 3OHMA 3EFHA 3NM4A 3RK0A 1V25A 4JGGA 1WY7A 3NHRA 4RDHA 1SHTX 4B6QA 3MWEA 1TYAE 5CVUA 3PVZA 3SEQA 2A30A 3KUKA 1PNTA 1P72A 3U3MA 5JNVA 1DRWA 3V6LA 2DULA 3ORSA 1F5NA 1G64A 2JD2A 4EHKA 2IZZA 2VUSA 1BS9A 1U98A 1UBUS 2YJ6A 5THXA 3U9TA 3LTEA 5IDYA 3P0IA 4IO1A 4X9XA 3VBCA 3QUTA 4JGIA 3CM0A 4LJSA 4HUQB 2PH3A 4JVLA 4C43A 4EUFA 3H3FA 2Z3VA 1AC5A 5E6UB 3AP2A 2VNAA 3O75A 3PIRA 5TT0A 4EWLA 1W5FA 3U1TA 2A86A 2AQHA 2FUEA 1STOA 2WFZA 3CZRA 3ZE1B 1E9FA 4ZEMA 1RXEA 1YDEA 4M9UA 3O4IA 1LUAA 3LA8A 2VK1A 5JZBA 4ZI7A 1YR9A 1TTQB 2O54A 2GWHA 2BTQB 5DF1A 3UAVA 5CGZA 3GLUA 2GLXA 4KZPA 5FUMA 3QX3A 1R5NA 4OIFA 5I8WA 1N33B 4FILA 3HKCB 1U0GA 1NTOA 2PLFA 3KRTA 3ORHA 1OCEA 1N6PA 4Q4JB 4WKGA 4ASUA 4ZMRA 3TB6A 1IL0A 3ZY6A 3W7VA 4BP9A 2BFAA 2FN3A 3M1LA 3A28A 1BAPA 2Q3BA 3MLAA 4IDHA 5C4MA 2XXAB 2I54A 2IHYA 3HCDA 3HBMA 4QVKA 4Z0TA 4BC0A 2Q1WA 4R4JA 4ZVSA 4BX3A 2EP7A 3WISA 5DXAA 1GAQA 3U37A 3SMVA 1LI4A 4FZRA 5A4AA 5CVJA 2JBHA 1RNLA 1R4AA 3HI6A 4K9LA 1DT3A 4BO0A 2PPLA 3IT3A 3FYSA 3FBGA 4FW9A 2IHBA 3GZNB 3NP7A 1E0DA 2ID4A 4R8VA 4F96A 1RI4A 1U1CA 3ZZNA 3BGSA 2H48A 4IW3B 5TPWA 5EJGA 3HPRA 4KQ1A 1A77A 1JYSA 1YZVA 1GNSA 1I33A 1WXGA 1BHJA 1M2JA 3P2KA 4Z8YA 1SVOA 4KMSA 5ALKA 4B6FA 5HCNA 2XB2A 1W1WA 3KKZA 3ZDEA 4MAAA 5FBWB 2AC7A 3W3AH 5AI5A 4KXUA 2O1EA 3ZHRA 1LH0A 1P0PA 1OF1A 1E2BA 3FVTA 1U7OA 5H4HA 5B1IA 3D1VA 3WGTA 2PJRA 1RABA 2AD5A 3H3XA 3PIIA 4W7IA 3LI2A 1UCFA 5KYWA 4JUBA 4MX8A 5B6PA 3CLRD 3V9PA 4BUZA 1RKUA 1KE2A 3T06B 1QOPB 4JNCA 5JBQA 3T5PA 3UT5B 2XGSA 4AROA 4CIAA 1KYWA 4Q6WA 4A0RA 2QRLA 4AWXA 1Z5PA 3AY3A 2FJ0A 5CJ2A 3HFGA 3THXB 1FUYB 3BDVA 3H9JA 3BD8A 3T5AA 1E4OA 1PL6A 2DECA 3KHSA 4BKPA 4ND6A 4WZAE 3A3OA 4XVHA 4Q7JB 1P2DA 1LBHA 3TOSA 2AZXA 4CL0A 1OYWA 1YCHA 4BYGA 3GLFE 1O5TA 4YLGA 1V3VA 2GBCA 3KUUA 3LUJA 3MJSA 4KI7A 1FTNA 5LYYA 3ZDZB 4EPVA 4XEUA 4AL4A 2H9IA 4EKNB 4DMRA 3QOWA 1QYDA 3ND8A 2VAVA 4G1CA 4GLOA 4Y6LA 2YYSA 1AG9A 3ZVRA 1TYEB 1YCDA 3W6PA 4D9HA 1Z3CA 1EUDA 1S0UA 2QTLA 4A27A 3RHTA 1WE2A 3PFNA 4IICA 4HS4A 3EPRA 4MZXA 4N7JA 4DBLC 3OESA 4B4VA 4D9KA 1E9AA 3RVNA 4JP8A 1DL5A 2POCA 5KC9A 4YAOA 3PC3A 3W6OA 4EATA 3JVUA 4OU5A 5E7QA 2Z5LA 4X62B 4DR5B 4OJKA 1YTLA 3JQCA 5D3ZA 1G63A 4RIFA 3NBYC 5D2CA 5E6SA 1CUHA 1P0CA 1T3LA 3TLMA 2DY0A 3W06A 4MAFA 5IKPA 5TS2A 1CQIA 4NIMA 4UTVA 2LRHA 3D6VA 4XIYA 4QTXA 2DUUA 2QD3A 5F1OA 5FOQA 5EQDA 1V11A 2ALJA 4RK0A 5FAKA 2QIPA 4L4YA 4RXTA 1K1EA 3U7IA 4DR1B 4GNKA 3TZEA 4F91B 4BXOA 4IH4A 4IWYA 2W2TA 1QTNA 4N82A 1EDDA 5FWYB 1JBEA 1W5AA 2ACWA 4GZ6A 3QVMA 5IAKA 5A7GA 3B9RA 4MP6A 3DLTA 2YHUA 1MJHA 3AJRA 4IO0A 4TLEA 3AL2A 1HLGA 5CRIA 4CM8B 5CITA 3RUHA 1BEZA 4AWBA 3IQWA 3NU1A 2AV6A 3REFA 3ROPA 4BFCA 2EGUA 1GTJ1 3WWEA 2NWQA 1XF9A 1CFJA 2OORC 3A1FA 3T7RA 2Q5FA 5B53A 3L79A 3AVUA 3L07A 4IV8A 1E2MA 1MUUA 3OIVA 4CEJA 4G5YA 4BS9A 4JBYA 2HPZA 2WJAA 3MQFA 4EKDA 1NR5A 1BTOA 1SHKA 1NVEA 1KEUA 3KKLA 3SYLA 3Q15C 1P4AA 5EJIA 3WNBA 2XZDA 3FDXA 5FTLA 2N42A 4OOFA 3PT5A 2AJLI 2QV7A 5C53B 4G0ZA 1F2UA 3WK5A 4RQTA 3DEYX 2ZJ0A 3UK0A 2FPGB 4PRKA 1Y8QB 1I9CA 3K4QA 3E3AA 1Y6FA 1G98A 1Z07A 4RGBA 5K99A 4QODA 1J33A 2ERYA 2HCTA 3H5WA 5JANA 2N3ZA 5CH3A 3JYPA 1WXDA 2O2DA 3I04A 4U7TB 1GUZA 2XXJA 1K5DA 1SUPA 3K5PA 3SHOA 3CNQS 1ZNXA 2NUPA 3BCSA 1NLFA 5LD2C 3ZCXA 1PEAA 1XRJA 2EBHX 3O03A 5JC8A 4DUYB 3F1LA 2J3IA 5ES3A 4JS0A 4DMHA 1JPVA 2BFDA 4LYYA 1CFZA 5KOHA 2BMFA 2FPXA 3HBJA 3WWDA 1T9AA 5JYCA 1DAGA 1D0SA 1QV7A 1SVUA 1HOTA 2I1WA 4ARZB 4F1JA 4H4CA 1JECA 3EULA 4V0LA 4NV3A 2O8NA 2V5VA 4R1TA 2JBAA 2REXB 1FP2A 3STXA 4A1FA 3RYFA 1MGOA 3ACCA 5F73A 1JAZA 1JH8A 3TKYA 3RT9A 3QMPA 1A96A 1X7YA 5J2TF 4JA0A 3KVYA 1Y8CA 4NJEB 3O38A 5T4FA 3SFZA 1AQ6A 1XQWA 1WPXA 2WILA 2E4AA 4JEIA 2YJTD 4JI2B 3FCCA 3DQQA 3O8DA 1C30A 1QU3A 1XDWA 1B7GO 7GPBA 4EHNA 1SUBA 2Q3MA 4MMYB 2WIFA 2O6HA 2F1IA 3BTOA 5FUVA 1T3HA 3W2GA 3S55A 1SZDA 4KMMA 5IASA 3NRCA 4G4GA 4RFSA 3EMBA 3K16A 5LLSA 1GU0A 1PX2A 3CF4G 3ND7A 1YKGA 2DKOA 3C41J 3Q3VA 4A8JC 1XWWA 1EZ4A 3A9SA 1Y1LA 1XMXA 2AE1A 3B48A 4ZQIA 5G1OA 4YCLA 1L5RA 1FDSA 5G2OA 1BA2A 1WCWA 1WO8A 3VAZA 3C4JA 4ZI2A 1JG7A 4HHEA 4ZU6X 2OFOA 5JH7F 5COQA 2OFXA 1RXIA 3CLSD 4OHZA 4ARIA 5DNCA 4CLEA 2I87A 2O7RA 1DADA 2XAUA 2VRBA 3KQSA 4TVKA 2O4CA 4D0NA 4R9SA 1SK9A 2JI7A 3EXG2 3FB4A 2Z83A 4GM0A 1Z0KA 4PFSA 1UH5A 2W6PA 3AFGA 4X3CA 4RVDA 4XH9B 4BRSA 4D2IA 2D2IA 1BG6A 4MINA 4ZCMA 2FF7A 2JZNA 3GJSA 1JTEA 2CYCA 2VF2A 2BONA 1A7UA 4Z4IA 3L7MA 5J5AA 1EEXB 2DUNA 3DE4X 1WSWA 4G1UC 4RVOA 4ZCPA 2PA0A 4QYMA 3GLGE 2X22A 3UW1A 4OHOA 3VR4D 4BBPA 3HKEA 3BEOA 3G2MA 1PR6A 4EPTA 1T1SA 1X7DA 4UPDA 3VR6D 4BEWA 4ANFA 4GRAA 3RSOA 1GNQA 1CZUA 2BEVA 5IJZA 4QXQA 1NJ8A 2B8JA 3DNPA 3EC1A 4HH4A 4RY8A 4UBNA 4HB4A 1UBLS 3BRWD 3JQ9C 3SYNA 3C3DA 5FPTA 3BG5A 2PWPA 5E9AA 5B64A 1V16B 3UENA 2NLOA 4G5QA 3EUWA 4EF6A 5KKCA 1TCBA 2CXQA 2Y1OA 1Z6GA 3DZDA 4KIGA 4O2BA 5AW2A 4WCDA 3T1HB 1MNAA 3GRVA 3PGVA 3TM4A 1DMRA 4JLUA 1LWNA 1ZD8A 1ABEA 5JWHA 3LVBA 4WKPA 4EDHA 2QT1A 4G36A 4MXDA 3CX6A 3H5LA 4LY6A 2Q1UA 1C7EA 2EHJA 2FYTA 4BJ5A 2G7MC 5FAXA 3JQGA 1P44A 4XIJA 5LP1A 1KAHA 3ECAA 3KHTA 3E5NA 4LY9A 1ZUD1 1DJOA 1SU7A 1NYTA 2FZ5A 1E3IA 4JBXA 1CK4A 4R1PA 3RC2A 5HFNA 2ZZMA 1W1IA 2PL9A 4WDQA 5DEIA 3IEVA 5LUBA 3OOSA 4D43A 1TVEA 5ISMA 2VJYA 2R62A 1NNUA 3T0FA 2I4OA 2X14A 2REBA 3UJ9A 5K8JB 4FS3A 1S01A 2JNWA 1LLCA 1T1GA 2CYAA 3PC8C 2PX3A 4NFYA 4DPKA 3ZCUA 4TMVA 3SSOA 1JVNA 3VO8A 1C9NA 1E6KA 1W6RA 1V47A 3B1VA 4O4IB 2MYNA 1CDDA 3RI3A 1MB2A 5LM3A 1TVKA 1T0BA 2YWJA 5HMLA 5A5VA 1AHIA 5EWLA 2P9BA 3U39A 1A5SB 3AUAA 3CZQA 5IKEA 2R60A 1Z2PX 1CS0B 2V6FA 3NBMA 1U1DA 3WK9A 1NW4A 3COWA 1DAMA 2WWYA 1B41A 4HAWA 3MMPA 3T9CA 4XX0A 3K94A 1HF3A 3VKFA 4A03A 2A1TS 4TYPA 1H2BA 2WW8A 5EY5B 2BMAA 2XW6A 4QYTA 2Q21A 3HBFA 5HJ2A 4WZBE 1W46A 1DEOA 5DBGA 2A33A 4HWPA 4B4OA 4Z0PA 5HOQA 2C2OA 3BQNB 3HCNA 2EKLA 4GFDA 5HJ5A 3LBAA 3R0VA 1P2VA 1SK8A 3AJDA 4CKBA 1T3TA 2ECFA 5LA6A 2Z6UA 4G1BA 1JG4A 4MJ3A 3BWYA 2W6QA 1P1KA 3E7PA 3ICPA 4PHHA 4M2LA 5CNJA 4E13A 1UJNA 2PG3A 3AIOA 4J49A 4DQVA 1VCOA 2ZCUA 4PF1A 1R4NA 4YT8A 1SHUX 4WCVA 3HL4A 2NO6A 2C07A 4YUXA 1ZL2A 3L0OA 4TV8F 1ZW1A 4KK3A 4ARUA 3L84A 2YNMA 1NSTA 3FSJX 4CLOB 1O6BA 1OR8A 3HKBB 2WPDD 1M8PA 1NSFA 1NVWQ 2XBUA 4R81A 4D99A 5JALA 4MHTA 2QT0A 5B30A 4UFPA 3OPVA 1NLUA 1PYGA 1POXA 2GAJA 3PR3A 4FMCB 2ONYA 3SHVA 5F7JA 1O8CA 2Q62A 1INLA 2GSWA 2YWGA 2B98A 3H8SA 4LJKA 5E2BA 3W9SA 4L5CA 4JL6A 5COBA 4GOLD 3H2BA 3AVWA 3U81A 3NGXA 4C3OB 3H11B 2AEMA 1ZD3A 1Z8NA 2YJGA 3TFWA 2IT1A 3R7WA 5JTTA 2P2ZA 2XQJA 3HN6A 2G5GX 4XTRA 1E1RA 2BCEA 3WRWA 4F6CA 1U2SA 3ZCVA 5TJHA 1F8FA 4FFPA 4B6PA 4CKZA 4BV8A 4WBNA 3PJFA 1QHNA 2GAAA 3NDIA 3NIDB 3JWJA 2P4SA 2CMFA 1N6KA 4Q21A 5DJ5A 3TEJA 3BH6A 5EVCA 2ZRBA 4ENUA 1Y6GA 3DF9A 421PA 2RHCA 1ZH2A 4R71A 2DLDA 3B1FA 4FS8A 1AQIA 2GH1A 4Q3NA 2ZRKA 4K2AA 1XJWA 2AXEA 3ANNA 1YAJA 1ZEMA 2FP4B 3GR6A 1OC4A 3DWEX 3LU1A 4QVGA 1CUBA 2OHVA 2QN2A 5DBOA 4ZHSA 2X0KA 2FCAA 3MTAA 4DIKA 3GT3A 1ZP6A 4XD7A 3ESZA 1SQGA 2I4RA 1Q0RA 2J7PA 3ACBA 3P2YA 4HTFA 4F85A 2IXDA 5FV4A 4NJMB 2JGJA 4WLFA 1OX4A 3KYCA 4JOBA 4B8WA 1C7JA 1U8UA 3E9QA 1TQDA 4Q4DA 2C8VA 1HKHA 4HLQB 2XTJA 4QBIA 4ER5A 5BVGA 2NGRA 1XMJA 2HJ9A 5DPMA 4YRIA 1G41A 2QPLA 2QR3A 3TMAA 4BQFA 5MN5A 2F55A 3CN7A 2ZRLA 4B75A 4DRXA 2Z1NA 1II9A 2GN2A 1VJDA 2AI2A 1SKYB 3N0XA 521PA 5K6TA 3VVMA 2Q5EA 2A9QA 4AB1A 2UXDB 4PGMA 3PPYA 1XZDA 3QXXA 2JI9A 4LV6A 2XZTA 4LSWA 2VYFA 1FXWA 2ZIFA 4FR2A 3Q5DA 4HWOA 1XEXA 1HEYA 4DV4B 3SXUB 1RIIA 1QQBA 1OZFA 1MO3A 3DKRA 4JLDA 1GPLA 2ZROA 2QNRA 3AUXA 3KYBA 4IX1A 5KWSA 2GBFA 2B1GA 2P67A 5FL3A 1LDNA 2Q8NA 4CCYA 1JQKA 1JI0A 2PS3A 3ONFA 3HDHA 4D74A 2DBVO 3OJ0A 1X7XA 9LDBA 4BQSA 1SC6A 3AR7A 4JEHA 4IVQA 3OBIA 4DABA 2QK4A 2G6BA 2CVZA 2XQFA 4ILKA 5JU6A 3N2EA 1N2IA 4KXVA 4B84A 1ZJWA 1BU5A