3HDTA

Crystal structure of putative kinase from clostridium symbiosum atcc 14940
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
169
Chain Sequence
NKNLIITIEREYGSGGRIVGKKLAEELGIHFYDDDILKLASEKSPENLFKFQSEVMRELAESEPCIFVGRAAGYVLDQDEDIERLIRIFVYTDKVKKVQRVMEVDCIDEERAKRRIKKIEKERKEYYKYFTGSEWHSMKNYDLPINTTKLTLEETAELIKAYIRLKGFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative kinase from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
molecule tags Structural genomics, unknown function
molecule keywords putative kinase
total genus 65
structure length 169
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hdtA00
4A82A 1E79D 1ZIOA 4JLKA 4NBSA 4DBLC 2DFTA 3G0HA 1VG9B 2GWHA 5JZVA 1ZYUA 1E3MA 4W5JA 3U44B 2PT7A 5J4KA 1CEEA 4NHOA 4YMSA 4DDUA 3ZVRA 4RFVA 5JMTA 4LX0A 3BOSA 4M2LA 3U7FB 1XZPA 4GL2A 2QTHA 2WTUA 2VF7A 3K70B 4OK6A 2D06A 2GZAA 5FUVA 3WRYC 3G5UA 3IPXA 2WV9A 5DO9A 4Q7LA 1ESNA 4R2HA 1YZGA 1RKBA 4OI1A 3GCGA 4TL6A 1XRJA 5G3YA 2GEUA 2J45A 4ZKDA 4BRUA 4Q18A 1GL7A 1KY2A 2VHJA 4MRRA 4Y0AA 5FBVB 2GZHA 2O52A 1R6BX 1E4YA 2JLRA 3TSZA 1WCV1 4M22A 2BBOA 1AIPA 2IYQA 2NZ8A 4LJ9A 2J1LA 2P6UA 2VPPA 1F3OA 4Q9HA 5JRJA 5CYPA 1TQ2A 3ND8A 4B76A 3DDCA 4AD8A 2QG6A 4YMTA 2GEVA 2Z4RA 1IM2A 3GLHB 3R9IA 4QGHA 4ARZB 2OO7A 2ZI6A 3K0FB 3P32A 1Z3IX 3KKNA 1F2TA 3QI2A 3U3RA 3RS0A 1KI1A 4V0LA 3PR1A 4BEBA 3ASZA 1PUIA 2ZSBA 1A5TA 1I2MA 1OFUX 1DVRA 4UXHA 2ECKA 4B34A 2CVHA 4LJ5A 521PA 2ZRJA 2ZUBA 4JL8A 3QBVA 3C14C 1CKEA 1US8B 1IHUA 3W5IA 4D82A 1XTJA 4OQMA 2QSZA 2YV5A 4XD7D 4RZUA 3I73A 3ZH9B 4AYWA 1N6OA 2IC5A 5LB2A 3KQKA 2OILA 4IXMA 3CLVA 3HPRA 4HUTA 2H5EA 4ZV4A 3KQLA 3ICEA 3TUIC 1FQJA 1P3JA 3OAAA 4DSOA 5JS7A 5A4JA 2WWHA 2NIPA 4RCYA 2R9VA 5SZKB 1SVIA 2CEAA 5FI0B 4KITB 1JR3E 4RCZA 4L15A 5CJ2A 1WRBA 2J87A 3RWMB 1OXTA 2MSEB 1GDDA 1XTQA 4QL3A 1SKQA 2WIAA 2WIBA 1P4SA 1LFDB 3THOA 3LD9A 2OCPA 5L3SA 4ZCLA 3LBNA 3CF2A 3MFYA 3Q9LA 4PO8A 3EZ9A 5C18A 4KSCA 2DCUA 4HDOB 1HT1E 3IO5A 4MGKR 1X1SA 4FD2A 5J5CA 3TAHA 3OEED 3IHWA 1NIJA 4OHZA 1Z0AA 3B78A 1C9KA 4Q21A 3PUZA 1J7KA 4D0LB 1DAIA 1QHYA 4UXIA 1QHGA 5LD2C 3H86A 3QE0A 2FPLA 1MOZA 1SHZA 3N5CA 2W0SA 1E2MA 4O0MA 5KO2A 1MH1A 4YMVA 3K70C 4TL8A 4Q1BA 3I5XA 1TX4B 2QMOA 3NHBA 1ZC4A 2DBYA 4YLGA 5FBLB 5CK4A 1FZQA 4JL5A 5AUOB 1BIFA 5EP3A 2QEQA 3O8DA 4DLRA 4YXWA 4D6PA 3PEYA 3RRNA 2W83A 4ASUD 4PZZA 4P4TA 3RHFA 3MD0A 3VKGA 4U7DA 3CRMA 4NCIA 5L3VA 4TYQA 4ESHA 2ATVA 3KTAA 1Z83A 2ODBA 3TVDA 1H8HA 3RS7A 4OI0A 4LY6A 4A6XA 4OJKA 5C2JB 3B9PA 1ZU4A 2BMJA 3MWLA 1DPFA 1G9XA 1XB2A 2FPKA 3F8TA 4LJ8A 3FMFA 3J81k 4ZIRB 1JAIA 2AFIE 3QQ5A 2RGDA 4ZKEA 1CR0A 2Q9BA 4KU4A 2VBCA 1R8QA 2HXYA 2VO1A 2O8CA 1FP7A 1KDOA 4R9UC 3D6TB 3SJCA 1M7BA 3KUDA 4DLZA 1ZNYA 2O8DA 3HP1A 1G64A 4M1TA 3K9LA 3EX7C 4XWAA 4E09A 3CPEA 5FTKA 1EK0A 1P9WA 3DEFA 4BFSA 3PVSA 4L4UA 1RJ9B 4FMBB 3AF1A 5FFMA 1ZNZA 2QT1A 2H16A 2XB4A 3A36A 2YZ2A 4BPBA 3RS5A 2V7QA 5KPDA 1E2EA 5F3WB 3GLFE 1DO0A 4JLDA 1CR2A 2GRJA 5CDFE 1G4UR 3EPJA 1IN6A 4XOIA 3RRMA 4GDFA 2OAP1 1A2KC 2PZGA 3U4QB 2IYZA 1FUUA 1HA3A 1J70A 4Q4JB 4NYJQ 2FG5A 3FMIA 1KI7A 1X8KA 4JZKA 3GPLA 1MKYA 1UF9A 2JAQA 2Z83A 1S1CA 1S9HA 4LBYA 3SC3A 3FWYA 3AUXA 4WZBE 4G1UC 1DOAA 1OIVA 4B3CA 5KDDA 1WQ1R 4B33A 2HJVA 1NG1A 1UEIA 1QDEA 2H1LA 1M2OB 1KOFA 1C1YA 5FOTA 5JFGA 2GETA 2GZDA 4A0GA 1Z0KA 1D9XA 4PSVA 2W2VA 3AKCA 1MRNA 3QG1A 1W4AA 5CJPA 5JHGB 1TPZA 2ORIA 4HB3A 4ACAA 1TNDA 1BMFA 1LY1A 3QXSA 2ZPTX 3GFPA 5HKKA 2FA9A 3V4FA 4QXAA 3U6KA 2AXPA 2WKQA 3WYFA 4R7ZA 4Q9IA 5FR1A 1E2KA 3GLGB 1EXMA 3ECCA 2C03A 5CIQA 4AIIA 4XIGS 1MO4A 2O8EB 3HU2A 2GESA 3TKLA 4O3MA 1Z5ZA 1PLLA 4OBEA 3K1JA 4MKGA 4Z8YA 4LI0A 1P61B 2C9YA 2H57A 4M1OA 5L3QB 2ZU6A 4NDZA 1WDTA 1E1QA 3PIRA 5JLJA 3GFTA 3GJ7A 3QUSA 4DLVA 2J0UB 3QVUA 5FTMA 3REFA 5JSZA 1N6NA 1S3SA 5IHPA 5B2ZA 4A9AA 3NDBB 3SQXA 1W0JD 2WM9B 5KSPA 2OFOA 2FNAA 1GKYA 1P73A 1W48A 1ZC3A 2EVWX 2IUTA 2WJVA 2F1IA 3B13B 3FDIA 2EFDB 3IIJA 4QBGB 1MR3F 4RD4A 4C0LA 4TMZA 4HSEA 3T12A 1AKYA 3P26A 4DRZA 1CJVC 1IOZA 3BK7A 4ILEA 1EFRD 1KJYA 1CRQA 3NG1A 3CZQA 1N25A 3MLEA 2QE7D 4HUQA 4A0RA 4RD0A 1EWQA 2FZLA 1OH7A 1KO4A 4NYIQ 2W2TA 3FVQA 1KDRA 1YZUA 4QHSA 1JB1A 4PQYA 1TEXA 4RFSB 3TUJC 1II9A 4LPSA 2FFQA 4KSBA 2J0QA 3GLHE 4KAXA 2NQ2C 4CGZA 1NP6A 1SKYE 3GLIE 2O5VA 3EIQA 1MO6A 1F6BA 3EXAA 4NCJA 4M9QA 3ADKA 1I4LD 3RRZA 2LKCA 3GJ0A 4QJ5A 2HDNB 1DG1G 3V9PA 3CZPA 2CBZA 4GP7A 1KSJA 1EFTA 4TMKA 2ZXUA 3Q7PA 1M7GA 2NTYC 4RZ3A 2ZRMA 4B6FA 3PCRB 2B8TA 1ZM3A 1G5PA 2GHIA 3TQCA 2ZR0A 1CULC 3P20A 221PA 5L3QA 4Q1FA 1CR1A 2JJ1D 4NCHA 1E99A 4OI2A 4YQFA 4TT3D 2Q3FA 4MRVA 1PJRA 1R2QA 4HLUA 2VP5A 5GVRA 3CX6A 3LVRE 4RD2A 4LPKA 1G8HA 2YC2C 4OQFA 4TSFD 3O8CA 4A2WA 2BCGY 3P1JA 1U0JA 4BECA 2ZYUX 1ESMA 3BB3A 3SE0A 3DHWC 4BLQA 4CYMA 2NOAA 1NLYA 4QGGA 4EJSA 2EU8A 2VHTA 1ZINA 4IRUB 1S4QA 2WWWA 1XTIA 4WA7A 1KKMA 4JLJA 2MMCA 3SOPA 1S8FA 1T5LA 1NIPA 2QZ4A 2V55B 3H2YA 3C8UA 4Q66C 1G3RA 3AF0A 1G17A 3SR0A 5E95A 1KZ7B 1L4YA 4A6PA 2CLCX 3HJNA 1XWIA 1E32A 4FN5A 3BFXA 2RKOA 2X8AA 1U99A 2QTFA 4OHXA 1R0WA 2JLWA 5H70A 1CJMA 1R0ZA 1VDZA 4YMUA 5EZ5A 1GAJA 1QHNA 5JS8A 2FV8A 2ATXA 4MDEA 1Q1ZA 3HR7A 4ASUA 3DPUA 4B2PA 5BYJA 4JVMA 4AWXA 4LC1A 1ZP6A 2OLJA 4YONB 2IW3A 1LF0A 4G5QA 4ZIRA 3E1SA 1CF4A 3B6EA 1RZ3A 4JSYA 4MKIA 3LV8A 1G3QA 2NG1A 3VR3A 1K5GA 1S96A 4TQAA 4UJ5A 3TBKA 2C96A 2W2XA 4A1FA 1HY3A 1E9EA 2BM0A 2V8OA 2O8FA 3ZZUA 3FHTA 1Q0UA 4TMTA 4URYR 1WA5A 1E9AA 4PC6A 3ZIAA 3OESA 4P0TA 3FE2A 2F3TA 1YR9A 2BIFA 3K0SA 2ZSDA 4JLBA 3QY0A 1GIAA 1OPXA 2ANBA 2DWQA 3B1YA 3GEEA 3ZQJA 4C0SA 3ZGXA 3M1IA 4NE2A 3E70C 2OFWA 3RWOA 4CT5A 2ZS8A 2AFHE 2JJ2D 2QQEA 5SZHB 3UMFA 3IIMA 2EFHB 2R8RA 4D26A 2IYXA 2QI9C 3WP0A 2ZJAA 3C5CA 4ZO4A 2RCNA 5HTKA 2PLFA 3B1VA 2P65A 3BB4A 4KI0A 2CHGA 4K81B 2VA8A 4TL9A 2PMKA 2ZRIA 5FUYA 3PEWA 1W36D 4D0GA 1A82A 4PHTA 4DDTA 2QN6A 4EIWA 3LO5A 5FTNA 3HYTA 5KDOA 1J90A 1T0HB 3DZDA 1E2FA 3SI7A 3GLGE 2P6RA 1VCOA 1XEWX 4LBVA 3KB2A 1YJ5A 4QFMA 4ZDKA 1TTTA 1AGPA 1G18A 3WMFA 3UXMA 2P67A 3DL0A 1G3UA 1NVVR 1W46A 1E9FA 4AK9A 2XAUA 4PQFA 5KDLA 3FHOA 1U94A 4TWZA 3ADDA 3SBEA 1D8TA 3QF4B 1YQTA 4HATA 4Z1MA 1ZUNB 1KK3A 4V0MA 1BS1A 2G1KA 4LDJA 2RHMA 2P5TB 4CEHA 3EZ2A 4LYJA 3CWQA 4PFSA 1T3SA 2GXUA 4ON9A 3OZXA 2SHKA 5IK2D 2VP4A 1DELA 1HQCA 3HPQA 3KFXA 2WWYA 5AJXA 1NN1A 4OHVA 5BN3A 1OSNA 2ZR7A 4BLPA 1NY5A 2A78A 3RSOA 1XDBA 4LSGA 5EXTA 2NO6A 4QOSA 2ERYA 4ZDWA 1TU4A 4M9XA 2D2FA 1IN5A 3DOFA 2QROA 1N5JA 3V00A 1NBMD 2RB4A 4BFUA 3T15A 4Q19A 4W7SA 4JBXA 4WIAA 1EX7A 5FOUA 1GZSA 1KZGB 4IFBA 2QPAA 4II7A 4JLNA 1RYFA 3H84A 4DIDA 1W36C 3VHXA 5DN6A 3KTAB 2XZLA 2CMKA 5M04A 1KMHA 2WSSD 3I32A 1XD9A 2ZM5A 3I92A 2KBEA 4NONA 2GCNA 1AGRA 3VR2A 2WOJA 4HDCA 4Q4HA 2CHVA 3ZIAD 2HV8A 1E0AA 1GOTA 3KKOA 1Q3TA 4B43A 4V0ME 1ZJ6A 3QKUA 4DSNA 1G16A 3AKDA 1NNEA 4ZCMA 1OB2A 4LRWA 1SVWA 3A1SA 4QNRA 2PLRA 4AYTA 1CXZA 1II0A 1QG2A 1T8TA 4Q7JB 4A8JA 1P2UA 4MGIR 4I1SA 3BB1A 3K09A 3MSXA 3CF0A 4EAQA 3T1QA 1N6PA 1PUJA 3GEHA 3QXXA 3JZMA 4C0BA 4KFRA 1XD2B 1HT2E 4HB0A 4PHHA 1RRFA 4P4SB 2ZI4A 3T5DA 4PZLA 1ZD9A 1TU3A 4UNSA 5AUNB 1XJQA 4L5BA 3I72A 4AI6A 1HV8A 1ZUHA 3EARA 2OCBA 5JCZA 1ZCAA 1KYIA 1KJZA 1XXHA 2EW1A 2VP9A 5HZHA 1XD8A 1OJLA 4RFSA 1OT3A 4B3FX 1EGAA 3WNBA 4LHYA 5AWFC 1MABB 2FE4A 2ZREA 3NBFA 1B23P 3PITA 3THWA 2WJYA 2Q0HA 4A0FA 4Q7MB 3U44A 1YU9A 4D4JA 3KFVA 2NPIA 1GL6A 1YZKA 3NWJA 4GSYA 1Q57A 1ZRHA 3A58B 4DDWA 3GJXC 4O2LA 1DTSA 3X1YA 2ZJOA 4OHWA 1U8AA 1GL9B 2KWIA 1F5NA 4JVNA 4Q4AA 2XNDD 4NYJR 3R7WA 3QNUA 2PT5A 3SZRA 3X1WA 5B30A 2PJZA 2HCBA 4HB2A 3TNFA 1M1YE 4BGDA 4NCNA 4M0LA 1Q44A 3QBTA 4TLCA 4ABYA 4DXAA 3GP8A 2FEOA 2XJ4A 4DIEA 1VKJA 1UADA 1Z29A 2N42A 2RGNC 1II8A 1XD2A 2ZRHA 3CRW1 4KCGA 3EIEA 3W6NA 4FXPA 5DN6D 1JXMA 2IS2A 1XTKA 2OBMA 4AKIA 3VR4A 1KMQA 2G1JA 2PEYA 3KUCA 5TY0A 2AXNA 2BMFA 3LX8A 4M1WA 4R71A 1TQ4A 3LXRA 3VR1A 1E9BA 2BBWA 3UG6A 1KSGA 2Z5FA 2WJJA 3VKWA 2OXRA 1GTVA 2IWHA 2VHCA 4TZ0A 2A3RA 1G7RA 3AF2A 4M9ZA 1MT0A 1XMJA 2GKSA 2JGNA 4LJ6A 3JVVA 5L8VA 4M8NE 1KIMA 4MDFA 4Z1MD 5DLQC 4PO1A 5JBQA 2REOA 2ZJBA 4ITRC 1P5ZB 3EWSA 1Z0FA 1QZXA 2FSGA 4OI4A 4FCVA 4XVQA 2CHQA 3SS8A 4A92A 1E2HA 2WSMA 3NHAA 4DLTA 2H92A 3S1AB 3BFKA 5FBWB 4BLTA 3FOZA 3CF6R 1YHNA 2YC4C 3K53A 2PCLA 3EC2A 4DCVA 4DLXA 4TN1A 2XSZA 4Q03A 1DO2A 1WBBA 3O47A 2R62A 3MRSA 1A7JA 2KJQA 4L8GA 1Z22A 3UMSA 1DEKA 1N6KA 1Q1BA 1G1MA 1BO6A 4PC7A 3AVXA 1UBEA 1BYUA 1X8LA 3NBYC 4UQOA 2XITA 2CJWA 3LVQE 2W6JD 5K8UA 4EPYA 2PZEA 3SYLA 3QEJA 1VCNA 2MMGA 4QM7A 1FNMA 5B57C 3F3YA 5KYKA 4IOKA 3IILA 4MYHA 1Q3HA 3MWKA 4EPWA 4TLEA 2JJ2A 1EX6A 3BERA 3EZ6A 5FPYA 1OW3B 2ZI9A 3QKSB 1DAFA 1Z8FA 4MRPA 1SXJC 1P7CA 4F91B 5JSZB 3RANA 2ZI7A 1I4TD 4HAXA 5C1BA 2A5GA 1KI4A 4XTRA 4KVGA 3IBGA 3IBYA 4A8JC 3T34A 2FEMA 1Z07A 4E03A 1ZM7A 2B7BA 3AH8A 3G82C 3L43A 4QRHA 4X8LA 2AK2A 3U3JA 2BBSA 4GZLA 1HTWA 1UBCA 4HZUB 2ZR9A 2REXB 4KXFB 1NY6A 1XCMA 4EKDA 3FTQA 2OFXA 2OBLA 3LX5A 1TF7A 3I3SR 4GOKA 2IL1A 5AJYA 5BQ5A 5JJKA 3IPYA 2OT3B 2UKDA 1NN3A 4N0EA 5AUPB 1ODFA 3ZZ0A 3DVLA 3LY5A 4Q5IA 4DSTA 3QIAA 3CRQA 3K9HA 2ZRBA 1BYIA 3U3MA 3JZAA 4BLOA 4JJKA 1YRAA 4LWZA 4RZXA 3EIHA 1OXVA 1AKEA 1QBKC 1IXRC 4YDHB 3KB1A 1W0KD 1NSFA 4RSGA 4F4CA 2D74A 4Q48A 2V54A 5K8LA 3U6BA 2FWRA 5BWMA 4LYAA 2WMOB 1UAAA 2CL0X 2W00A 3TAUA 1DE0A 4XVRA 4FCWA 1KDTA 4GI7A 4DCUA 1RPZA 3DMDA 2GA8A 1I2DA 1VCIA 3VTKA 1OF1A 2QAJA 2RGEA 2VP0A 1IN4A 3AKEA 4PHFA 2XZOA 1KO1A 3EA5A 5EUQB 3U60B 4LJAA 2PX0A 1X86B 2JJ8A 5CIWA 4MRNA 3NIBA 5H1YA 3L2OB 4IW3B 3MWYW 3KJGA 4C30A 4FMDB 4BZPA 5DHAA 5TDHA 1KY3A 3GLHA 1ZBDA 1PLJA 4NCKA 3QPWA 3DM5A 4TYNA 1IJFA 2ZANA 5F2EA 1YVDA 4BFYA 2X2FA 2QGNA 2IYUA 4FW9A 4RKEA 2WMNB 5J4YA 2FPMA 5AR1A 2I3BA 2IHYA 3W34A 4UKDA 1T6NA 3PUYA 4PPFA 2D7CA 1ZM4A 3K9NA 2VSFA 2QM7A 3SN6A 2OE2A 4TMWA 2P5SA 2OCAA 3A37A 4C0QC 1US8A 1ZD1A 2QPTA 2VQSA 4V0KA 1T5IA 2Z6VA 3EPLA 4EQ6B 3CWZA 2ZUCA 4GMDA 2JIZA 1HUQA 3C41J 1QHXA 3Q5DA 4E5UA 2XTZA 3B85A 3FFBA 1G19A 2XNDA 4TLBA 4KFUA 5DI3B 4BWYA 4WZAE 3C7KA 1KJWA 1Y3AA 1IY2A 2QRNA 4HEJA 1KI9A 3MGCA 3KKPA 3TR0A 3ZYCA 3LQRA 3I1FA 1KI6B 2HT1A 4B75A 2EFEB 1UM8A 2BEKA 1NF3A 2QE7A 5JWRA 3TJZA 2AD1A 3VX4A 3VNUA 1N0WA 4X8OA 4FMCB 1FTNA 5A5GA 2G0TA 2R6FA 3W6PA 1G6HA 2A5YB 1M8PA 4PPNA 1UFQA 2J0SA 2WOOA 1W0KA 3CPJB 5DI9A 1CR4A 4AG5A 4C0KA 1OFTA 3QF7A 3QJYA 4PX9A 4ZDJA 2YHSA 3AGPA 4NMMA 3GQBA 4NYMQ 2EFCB 4GRAA 1VTKA 1E1QD 1S1MA 1TQDA 2O8BA 3WBKA 5KNCA 3QKRA 1H8HD 4S35A 4ZPXA 4RD6A 4QKQA 4US0R 3K09C 1OH8A 3RSLA 3M6AA 1FPMA 4FWIB 4N1AA 4TTQA 5AK0A 4B44A 3ZZTA 3QOFA 3I8SA 2PL3A 4DHEA 2D3WA 4KLNA 4JKIA 3B1XA 1HH4A 3X1XA 1E4VA 4TTPA 3K0CC 2ZRPA 4Q4LA 1U2RA 2D62A 5E3HA 3T1OA 4U00A 3EG5A 1Y63A 1XCGB 4KBGA 1W4BA 3W9YA 4LK2A 2KE5A 3BAFA 3C16C 5E7MA 4QG7A 1U9IC 4EDHA 1E69A 2KI5A 2QBYB 5HCNA 5DHFA 3GJ4A 1G8PA 3ZS9A 4EJSB 1BMFD 3DKVA 1VPLA 2XGJA 3A1WA 2R6CA 1U0LA 3L8ZA 1ETUA 3S1AA 3KZ1E 5JJLA 2JLQA 5IDVA 4GNKA 3U7EB 2DB3A 3CONA 2YYZA 4QM6A 4NH0A 2YOGA 4V02A 1T9HA 1LVGA 2FJUA 1NLFA 1VYTA 1XEFA 5F9HA 2J7KA 1OIXA 3BD9A 2EQBA 4HYYA 2CNWD 2ZITA 3SQWA 1F2TB 3A6PC 5EE5B 2QENA 2ODEA 4U02A 4US1R 2QPOA 4HLCA 3RC3A 4XJXA 1KI2A 1KI6A 3AVVA 1KSFX 1RRCA 2JLXA 1DAHA 4EFMA 2QMUA 2IHBA 4A36A 1KDPA 2V1XA 4Z54A 3U2QA 1W2HA 4DWJA 2V7QD 1SKYB 3GLIB 1R10A 1NN0A 2ZE6A 1HEIA 2IXEA 4QHYA 1IXZA 3ZD6A 4C9BA 2ZEJA 1WE2A 4S2EA 1XXHE 1JJVA 5KNDA 5ELXA 4Q4JA 3QKTA 4KJZA 1G41A 3BRWD 4B74A 5KOYA 4FCTA 3T1TA 1K6MA 1XEXB 3WBJA 3QPVA 3AVUA 1O3YA 2G3YA 3GJ5A 4FI3C 2K5UA 4AKHA 5C46F 1BKDR 1SULA 3I61A 1W44A 3CNNA 1SZPA 1HE1C 5FI1B 4MH0R 2IS4A 1ELOA 4HLUC 2W6IA 2ZJYA 1OLOA 4M4SA 4TT3A 3IQWA 1YZLA 5L3SB 5F98A 4YXWD 1FP6A 4QJ3A 2GXSA 3DM9B 2JLUA 1AS0A 2QSYA 2ZRLA 4E22A 4BQSA 4HZIA 721PA 3CO5A 2ONJA 2VP2A 4AYXA 4F93B 3GLGA 4L9WA 2QUZA 1KI3A 4MGZR 1A1VA 2NPFA 2IYVA 2ZRFA 2PJRA 4KBFA 2PH1A 5FPTA 2OSBA 3B5JA 1OV4A 4YMWA 4E07A 2B92A 2OG2A 2HXSA 3OEEA 4RZ2A 4W5WA 5CDFA 2HLDA 3ZVNA 1IXSB 4WAUA 2XOKD 1T3LA 4V03A 2D2EA 2OXCA 2ZJ5A 3TW8B 4TMVA 4C7OB 2OEPA 4P4UA 3K0AA 4PR0A 2CVFA 4BRWA 3T1VA 1YZTA 1QF9A 1E1RA 1YZQA 4OYHA 2Z43A 4PTLA 1KAOA 2ZJ8A 5J4HA 2AD5A 2ZYTX 2ZE7A 3Q7QA 2ORVA 4BASA 3AVOA 2HF8A 2ZAOA 3OAAD 1N0VC 1P62B 2BKUA 3TK1A 2C95A 2EWWA 4LV6A 3UANA 4PAMA 4HI0E 3LNCA 1W0JA 3FMPB 3QEOA 2CJWB 3LFUA 1F48A 5AJWA 3PUVA 3L8YA 3LBHA 4DC9A 3FKSA 2FFBA 1KMHB 4HAUA 1NJGA 3AP1A 3AVTA 1UKYA 4DSUA 4LBZA 1D9ZA 1L2TA 5FOXA 3RVBA 1LTQA 2XJ9A 2IUSA 4H1UA 2A5DA 4URVR 1XMSA 5TVKA 1Z0IA 5EE0A 3DZ8A 4JSTA 1NRJB 2QGZA 2IYLD 2GK6A 4ARZA 1AJEA 2F6RA 1F2UA 5TMPA 4UJ3A 4JLAA 1G4AE 1GP2A 4DUGD 2X1VA 1DARA 1VMAA 2FU5C 4PC1A 1FTSA 1L8QA 4OL0A 1G291 4IKEA 3WMEA 1KAGA 3M4YA 3PJRA 3AVPA 2N46A 2CCKA 2E87A 3LAWA 4LGMA 1U8YA 3SBDA 1OH5A 3HU1A 4DLYA 3C5HA 4LUCA 3QG5A 2A7QA 1BH2A 1MRSA 2WSSA 4A15A 1FQKA 4P4SA 1E0SA 1P2TA 4IJMA 1E98A 5KSOA 1U81A 3IO3A 2CE2X 3LW8A 3V4RA 2A5JA 1NBME 1JXOA 3CX8A 4OQLA 3UIEA 2HJGA 2GVZC 3L0PA 3ZLJA 4C2UA 1RIFA 4HB4A 4Q1DA 2QL6A 5B58C 4B3GA 2C9OA 2IYYA 3EPKA 3MCAA 1D2EA 4MKFA 5IK2A 2VP6A 2FMXA 2QP3A 4TTRA 1DS6A 3TMKA 2J3EA 2OAQ1 1AN0A 3Q5EA 5BXQC 2WKRA 1HE8B 5E7IA 1OFIA 4NU0A 1CS4C 3UWOA 4BLRA 4B3XA 1VYVA 5KSYA 1Z47A 2WJGA 2IWRA 2WBLC 4PC2A 3K0AB 1KK0A 2L0XA 3GFOA 1NG9A 3SJZA 1ANKA 4I4LA 2FZ4A 1AM4D 2ZRAA 4WBSA 4LJYA 1MV5A 4MKHA 4BFTA 4DZZA 2BJVA 1AZTA 1KK2A 2G88A 3P4XA 4F7WA 1L7VC 3PG5A 1MO5A 2IT1A 1Z28A 2C78A 5TXGA 1T3HA 5L3RA 4EPTA 3PXGA 4GP6A 3UPUA 3A1UA 4A2PA 2QP4A 2FH5B 1AQUA 4QGAA 3A4MA 1FW6A 1F60A 1CBUA 1U98A 4F38A 4AY2A 2PZFA 4NYIR 4R98A 4RJLA 5EXPA 2CE7A 2NMVA 1KO7A 2IEYA 2FGJA 1J8YF 1G5RA 1OKKA 4KO8A 3VHLB 1YR7A 2ZAMA 4JYCA 1WXQA 3FGNA 4WXRA 121PA 5EJEA 4HAYA 4KODA 4LHZA 1EFUA 1UDXA 3PEVA 1F2UB 2ODNA 3CPHA 3CB4A 4B3BA 4IEEA 2ZQ5A 1W5SA 4EPRA 2HLDD 4LJ4A 2QM8A 1TADA 1D2NA 5LB4A 3N2EA 1OYYA 2F43B 3ZQ6A 1J8MF 1GNQA 3L82B 2RGCA 3BWDD 1N6HA 2UZ3A 4IDNA 4Q9KA 1WMSA 5KUTA 1M6NA 1JR6A 1R7RA 4PSAA 1XJ0A 1G6OA 3RC8A 1VG0B 3ZVMA 3IEVA 5AJVB 2VYFA 3LLMA 2YOFA 2W58A 3LXXA 3K0CA 3PEUA 1GNRA 3AVQA 2X2EA 1M34E 4C3ZA 1AS2A 4EQ6A 1XPRA 1ZW6A 2FGKA 3ZVLA 2YWGA 3VKHA 2WHXA 3D7MA 3D3QA 1GKIA 3W8RA 4GT1A 4LJ7A 4B2LA 4DLSA 1UBGA 5CITA 4LYFA 2EYQA 1FMJA 2JLYA 3TLXA 2JDIA 3GLFA 3RABA 2BM1A 2NGRA 1Q12A 4B2IA 1Q1QA 4G5SA 2AWOA 5K8TA 2KBFA 1G7CA 2O0HA 1Z06A 1E0JA 3VR6A 3SYKA 1KHTA 1N5KA 1WP9A 4D0NA 2ZROA 5DIFA 4XWKA 1E2DA 1E2GA 4AG6A 5LPNA 1HQYE 3VR5A 2D4HA 2DY1A 3W6OA 5HR5A 2R6GA 4CEJA 1U90A 1R0XA 3RS2A 1DG3A 1SVLA 3Q85A 3A4LA 1GVNB 3KXLA 2QAGB 2J46A 4YC7A 1S9DA 5DI3A 1DAEA 4DB4A 5DSZA 1S3GA 5H68A 4IVPA 3RLFA 4LHWA 1RE0A 1E9RA 3HU3A 2KB0A 4D4KA 2ZJ2A 3SNHA 2VL7A 1NVWQ 2BBTA 4IOLA 5CB8A 2O8FB 2GNOA 3WXMA 1XF9A 5G53C 5HE8A 5IF9A 1JECA 2VHUA 1SXJB 4BUJA 3BORA 4QHTA 2DR3A 2Q21A 3DO6A 5GJCA 1TQ6A 4G5OA 1FX0B 4KYIB 1DAGA 1W49A 4QC2A 1J2JA 2AHOA 4JS0A 2O8BB 2C2HA 2XNSA 3DKPA 3EAQA 4U5XA 2BV3A 3VQTA 1OXXK 1EESA 1VYUA 2VEDA 4OKSA 2VHQA 4IDOA 1XTRA 2B7CA 3B9QA 4B71A 1XTSA 2Y8EA 5FL7D 1NN5A 1J99A 2A30A 2VSXA 5FPSA 4DB2A 1NMZA 4TLDA 2IX3A 5LBIA 5J40A 1WB9A 1FMLA 2WJHA 3RYTC 3THXA 1LS1A 5DYIA 2JLZA 3GEIA 3THYA 2AL7A 1GKUB 3QXJA 3NXSA 1E0KA 1FL9A 1Q1EA 4URZR 2JASA 3DMNA 1SVKA 4EJSC 2VIIA 5DGXA 1JALA 4JVSB 4JBWA 5BN5A 2ZRGA 5HZKA 4XVUA 3BE4A 2Q9AA 2YWEA 2C98A 3O8RA 2O8EA 3WNCA 1JBKA 4AKGA 3KL4A 2ANCA 2REBA 2EYUA 3H0KA 2XZPA 1DAMA 3BH7A 4I1VA 5CK5A 3Q3JB 5EE1A 4PAOA 4A0HA 1UJ2A 1KO8A 2E1RA 3M0EA 1IN7A 3LA6A 3P27A 3PQCA 3THWB 3H1TA 3JVUA 2OESA 1SHKA 5GJWC 3ADCA 1G8FA 3LRPA 5LDDC 4HUQB 1GG2A 2CK3A 3U5ZB 1YE8A 2IYWA 4DUGA 1KO5A 1NLZA 1TEVA 1X6VA 2DWOA 4MYTA 1R0YA 5EP1A 2HEIA 2YKGA 5F9FA 2AX4A 4C4PA 3KQUA 3MJRA 1PV4A 3CW2A 1E2JA 1R8SA 4UNRA 4F4IA 2J59A 2IXGA 1XJCA 3NBZC 1N3BA 3BC1A 1CRPA 4WW0A 4MQBA 3GMTA 1ZVQA 5HCIA 1JAHA 2CCGA 1C4OA 3EPHA 3TGPA 2IEZA 4F92B 1E2QA 4ACBA 2QT0A 4A4DA 5G41A 1QHHB 1W4RA 1S2MA 2XOKA 1NVVQ 2BCJQ 5UKDA 1UKZA 5JEDA 1O87A 4P3YA 1N6LA 3ZJYA 4PQRA 4PPQA 3TUZC 3MJHA 1T8UA 3SJBA 1W36B 1LV7A 4G01B 3IGFA 4P31A 2O8DB 2F1JA 4B73A 2QTVB 4TMXA 3ADBA 4GOXA 4AC9A 2A5FA 3PUXA 1VG1A 2IXFA 1SVOA 1U8ZA 5GVSA 2FSFA 2OZEA 2F7SA 3GJ6A 2XX3A 3B1WA 4BE7B 2GCOA 3BJIC 3WHLA 3U4QA 2QRZA 621PA 2LWIA 4TYWA 1E94E 2JATA 1E2IA 3X1ZA 4ERNA 1IY0A 1I4DD 5KSZA 4G5RA 1Z0JA 1GITA 3R8FA 4IFEA 4MITA 1Q21A 2RHDA 2ZYWX 4FMCF 4NKRA 3IQXA 4X8MA 1OB5A 3HWSA 3QKRB 2CXXA 4L16A 2R44A 1XMIA 2VSOA 3TIFA 1E79A 2KSQA 2AKAB 1K8RA 4G5GA 2F1HA 5TB5A 1RRGA 3TVTA 3AM1A 1NVXQ 3NDPA 4WXPA 2GCPA 1B0UA 1EG7A 2IK8A 2NO9A 2YINC 1H8EA 4D80A 3F5FA 5D3MA 3ND9A 2ZI5A 2GVDC 2CCJA 4RD1A 3SEAA 3CBQA 2BWJA 4Q02A 4PSKA 4HAVA 3W5JA 4PHGA 5FTJA 1OE0A 2WKPA 3PV0A 2XEXA 5P21A 5KPJA 2BMEA 4EFLA 2C9CA 5BW8A 4DDVA 1W7AA 1NI3A 1Z2CA 4HLDA 2BJWA 4LCBA 1IONA 2BOVA 2GDJA 4HAZA 4Q1EA 4RKFA 3UMRA 2CNWA 2HUPA 4K46A 3WRXC 2GF0A 2VF8A 1KI8A 3CX7A 4RD3A 5EQTA 3UK6A 2BHRA 2FFHA 3TSWA 5FUWA 4NP6A 4BFWA 3A1VA 1OYWA 3I4LA 4P33A 3R7WB 1JI0A 2JEOA 5JEEA 1EFHA 1H65A 4LC0A 3Q8XB 2HT6A 1II8B 4CVNA 1IAQA 2ZUDA 1JJ7A 2WWGA 4B32A 1RC8A 2DYKA 4FINA 2NZJA 4G0NA 4KFTA 3DOEA 2BKEA 2H18A 5EP2A 5JCPA 2ZRDA 1GRQA 1K5DA 1E9DA 4DT1A 5GJVC 2BC9A 5KU1A 5BN4A 3KXKA 2WWFA 2TMKA 1W2GA 5HPYB 2GCOB 4QNMA 1COWD 3D8BA 1P72A 3NBXX 1X1RA 3IUYA 3REGA 4Z51A 3FB4A 1JR3A 3MUFA 2XTMA 1RRPA 3HDTA 2YJTD 3N2IA 2C77A 3WP1B 3SHWA 1CTQA 2XTNA 421PA 1GWNA 1DAKA 2HYIC 3AUYA 2OBNA 3LW7A 1DADA 2B8WA 5EXSA 4M53A 3PFIA 2QAGA 3A8TA 5CM8B 4IDHA 1S0UA 4B35A 3NKVA 3BIFA 2XSZD 4JMPA 1KSHA 4JT2A 3QVVA 2QP9X 3BBPA 4C2TA 1JNYA 3HYRA 1U9IA 2DHRA 2ZU0C 3B7GA 1XNJA 2BVNA 1OXUA 5FH9A 2I1QA 4LOAA 5FOSA 4LHVA 1AS3A 3VAAA 3K70D 1SXJE 4K8OA 5LD2B 1FNNA 5KTYA 1V43A 4GBMA 5DNYB 3TSOA 5JECA 4PO9A 3ZS8A 2C99A 3OIYA 1XEXA 3R9XA 1W5TA 3BH0A 3T61A 5D3QA 2WPDD 5AJZA 1XPUA 2QU8A 2IS1A 3WY9A 3FHCB 4I81A 4KVAA 3ZDQA 2DFNA 3K0FA 3KXIA 3AP3A 2I4IA 2RAPA 3U3KA 1E9CA 3KQHA 1WBDA 1R4AA 4I99A 1D5CA 3EASA 2R65A 2JCSA 4KYUA 3WMGA 3B8HA 1CLUA 2IUUA 3TE6A 2WAXA 1R5BA 1TF5A 2G83A 2ZIAA 2CL6X 2JIZD 2Q3MA 2ZSEA 4WZ6A 2FF7A 4HZUA 2FSIA 5J4LA 5SZIA 2JJ1A 4BLSA 2GJSA 1QVAA 2ZETA 1KGDA 2LKDA 4DT1B 1Z6XA 3B1ZA 3R20A 3K8YA 1T91A 2F3RA 3C4JA 4B6EA 4GMXA 2ZJZA 4JKYA 3L0IB 2OLKA 2WWXA 4ZI2A 2QMEA 1PZNA 2F9LA 2H8KA 5FOVA 3UWKA 3AQ4A 3HR8A 2A9KA 5J4VA 4GZMA 1XXHB 3KJHA 2AN9A 1XFAA 3KX2A 5FBQB 2G6BA 3AEZA 2GAOA 4C0JA 6Q21A 4MYUA 1SVMA 3IDQA 2W0MA 3X1DA 3KQNA 2PBRA 1Z0DA 1KK1A 3WNDA 5FBRB 3BS4A 3NH9A 2F43A 3I8XA 1TUIA 2IF2A 2ZRCA 1JEDA 2Q9CA 3W3ZB 2QORA 3EA0A 2GJKA 3EW9A 3MAAC 8OHMA 1ZM2A 1ZAKA 1FFHA 1E6CA 1QHSA 2IYRA 3CR7A 2QQ0A 3GD7A 4LYHA 4B48A 4DEXA 2IYTA 1ZNWA 1EFRA 5JI2E 3SFZA 1N2CE 1XEWY 2OHFA 1G3IA 5EXXA 3VNVA 2PCJA 4NYMR 1AZSC 2CLDX 2VRWA 1OXSC 4MUAA 3H4MA 3OFND 1Q22A 4FMDF 3W8NA 1T4GA 1M74A 2RGBA 3BFVA 1GRNA 4KV9A 4HLQB 1P9NA 2V6IA 1G8GA 2AR7A 4OK3A 4LV5B 3MWJA 4TQUS 2WPDA 1VHTA 4QGFA 1XPOA 4UNPA 4XD7A 4BFVA 1KTVA 2OCYC 5FOWA 2WAYA 2GXQA 5JHHB 4XH9B 5SZJA 1P6XA 4JLVA 1IY1A 2DPXA 3GJ3A 4BFZA 2OUKA 4OHYA 4JLOA 4MRSA 2GBLA 5C4MA 5JI3E 1GM5A 1ZM9A 3VU9A 1WF3A 3QF4A 1T0JB 4FIDA 4TL7A 1G20E 1FX0A 4JIMA 1SXJD 5FPKA 2H17A 1HYQA 4Y0VA 1X3SA 1CJUC 3NVAA 4O2RA 4KLZA 1YR8A 2PMDA 3OF5A 2CK3D 2AKYA 1XMVA 3RNLA 2ZRNA 3L0OA 2YNMA 3P4YA 3SHFA 4AKEA 2FSHA 3RAPR 1CJKC 2J5XA 4DCNA 1V5WA 3PUWA 4W9MC 1TF2A 2R2AA 4Q01A 4OJQA 4M9SA 4Q00A 2O0JA 2NO1A 3AGQA 2ZVQX 5EUMA 1P9RA 1YRBA 2FX3A 1W47A 4Q7KA 3BH6A 4CEIA 3CNLA 4OQXA 821PA 5H8WA 1XX6A 3RRYA 2WWIA 2ZSFA 1JQJC 3EC1A 2W6JA 5E4FA 2ORWA 4IDQA 2PEZA 4UNNA 1U0HC 3FFAA 4OK5A 2D7DA 4MA4A 4DKXA 5KHOC 2FOLA 2EWVA 1XZQA 4DEYA 1NJFA 4JLMA 3KDSE 2C8VA 2N1BA 3CM0A 4Q4HB 4WVFA 4XSHA 5GJBA 3T06B 2ZS9A 4TZ6A 3NTUA 1VIYA 4LV8B 1AQYA 4PPGA 4Q9LA 1KKLA 5CLQA 3T5GA 1GFIA 2Z0MA 1SGWA 3EWAA 1YKSA 2HF9A 1TAGA 1NL3A 1XP8A 3GJ8A 1EFCA 1A2BA 2E9SA 4JVLA 2PX3A 1Q20A 3SJAA 1Z6YA 3SFVA 4D81A 1R5NA 3U7GA 2WICA 3TQFA 4M1KA 4EUNA 2QA5A 5KNBA 1N6RA 4LBWA 2V9PA 5TV2A 3W90A 2Q3HA 1OH6A 4CF7A 4BEJA 2RGAA 4DCSA 4D2IA 4MUBA 2Q6TA 3LH5A 3NC0C 5EE9A 4A2QA 4W5HA 3TH5A 3CNOA 4US2R 5J47A 5HE9A 4ZDIA 2QAGC 3KKMA 1CJTC 5FUXA 4NPHA 4Q1AA 4H1VA 1ZUIA 2MSCB 1G5TA 4WOPA 4HAWA 4B3DA 1JPJA 4BZQA 2QBYA 3O8BA 4O25A 3B82A 3ETLA 4XSGA 1UDWA 1ZIPA 3NH6A 1ZU5A 2V3CC 1VHLA 3Q72A 1H8ED 3IHLA 2IA5A 4GOJA 1YR6A 1QHIA 2R6DA 2NO7A 2AK3A 2GJAA 3N70A 1OHHD 4I1OA 2P0EA 4M1YA 1QHHA 2F1RA 4M21A 2A2ZA 3IEUA 1XBTA 5FL7A 4V0OA 4CT4B 3OEHD 1AA9A 2XB2A 2MSDB 4CZ2A 5JWHA 1MO3A 3QXHA 4CDGA 4IOMA 1W1WA 3OIWA 4H9GA 4PANA 2AWNA 4CW7A 1G7TA 1NSTA 5D3MB 5A0FA 2BEJA 1Z6TA 3A1TA 3FYHA 4JLPA 1RFLA 2CLSA 2QNRA 5EP4A 4F4JA 2V1UA 2IF0A 4I1UA 4EPVA 1Z08A 1UPTA 4Q1CA 1PLKA 2G9NA 1IQPA 3KJIA 1UKVY 2G77B 2DFLA 3F0TA 4CEHB 2HYDA 2X77A 3QENA 3NEJA 2ZVPX 1Z63A 3RS3A 4IEIA 2IYSA 1W4CA 1L4UA 2RGXA 3OE7D 5E7JA 1NKTA 2ZYVX 2NO0A 2RMKA 5FTLA 2O0KA 1M7HA 2FDCA 4JBYA 5G40A 3L0SA 1HURA 1CIPA 2UZIR 3ICQB 3QPUA 4D4LA 4FWTA 1E2LA 3AF3A 2XXAA 3CH5A 4DLUA 1EWRA 4X8HA 3IIKA 4ZI3A 3LWNA 3OIVA 1OFHA 1P75A 2P3SA 2P6NA 2WVJA 2BMDA 3SYNA 4POAA 2VH5R 2FN4A 1JEEA 1P60A 5EE3A 5JWOA 1CU1A 2J9RA 3OHMA 2C04A 3CUEF 4GPTA 5B64A 1SVSA 1LS6A 3BXZA 2UVQA 3CRVA 1GSIA 2F55A 4URXR 4LHXA 5G3ZA 2YWFA 1ZD8A 1A4RA 2DFKB 3E2IA 1N0UA 4PAQA 2GJ8A 3AP2A 3AVWA 2GEDA 2GK7A 1RW4A 2I1VB 3U7HB 1IBRA 1VECA 3LQQA 4IDPA 4EFNA 1GNPA 2VLIA 4QBFA 2C5LA 3VX3A 5C4GB 3FPAA 5JRZA 2JLSA 3KKQA 4C7OA 3CH4B 5JJIA 2G0NA 1RYHA 3TR5A 3ASYA 4TLAA 3UG7A 1OIWA 3LBIA 5FPHA 1LNZA 2ZI3A 5DE3A 5BYKA 4QBIA 4URWR 2ZTSA 1ZMXA 2RGGA 1D2MA 2GF9A 2CDNA 4NZYA 3THXB 4A8JB 2VTKA 3U3OA 3SDZA 1UEJA 2FFAA 2P2LA 3BGWA 1COWA 1N6IA 3AV0B 4D4MA 1TUEA 2YVUA 2QY9A 1LW7A 2ASEA 2V4ZA 3FMOB 2GJ9A 1XCPA 4M1SA 4IOJA 4JJZA 5FR2A 2QMHA 5FL3A 1G21E 3RDPA 4XWOA 2IBMA 5CYOA 5CM9C 5K8IA 1JPNA 2J41A 4DLWA 3E5HA 2IS6A 3QKSA 3CRRA 1E2PA 3AKYA 3TRFA 2W6ID 1ZCBA 4BZXA 4C0HA 5DYGA 2RGNA 4D25A 1NBMA 2J0VA 3ONWA 4ESVA 1E9SA 4KFSA 4LZZA 4MYCA 1YZNA 4L9SA 4DJTA 3C15C 1G7SA 1N5LA 4UXJA 1QVRA 1LF5A 4QJ4A 2DWPA 4NL4H 5HKKD 2GAAA 5CB6A 4IVQA 1VIAA 1P2SA 2WJIA 4Q4AB 1IN8A 4OQNA 2H7VA 2YOHA 1UKEA 1KNXA 2XXAB 2GBLC 3FKQA 3RS4A 1E96A 2ZRKA 4IVRA 5GADl 3WYGA 1D6JA 2JA1A 3CKLA 3GLFB 4CEIB 3K0EA 4G3XA 3AVYA 1PVOA 2J0UA 1TL7C 4IHQA 4YDSA 1LB1B 4HDQB 2B6HA 3X2SA 4MGYR 4Z8XA 1GUAA 4JYBA 5IT5A 3W3AA 4PZYA 4GFDA 3SU8A 2YWHA 2B21A 2ONKA 3AB3A 5IRCD 4CEJB 3B2EA 1NVUQ 4DCTA 3EZ7A 2ERXA 1JQLB 1ONBA 1KNQA 2X19A 3OIUA 1VCMA 1BOFA 4P32A 2V6JA 3TW4A 3VFDA 3CIOA 2J7PD 4KHZA 3R8CA 2ZSAA 3MMPA 3QSYA 5ANRB 3I62A 4RVCA 1JR3D 2JDID 3D31A 2WZQA 3QXCA 1RJ9A 1P2VA 2CL7X 4V0NA 1VG8A 1E1RD 1IJEA 3ZD7A 1GILA 3EZFA 3WYAA 2ODWA 2JLVA 1UBFA 1R5OA 1SQ5A 4CIDA 3B60A 4J0QA 2F9MA 1ZNXA 3K9GA 5DH9A 2O8CB 3OEHA 3GLIA 3UKDA 2Z4SA 2ZS7A 3AF4A 2GXAA 5DISB 3WHKA 4B47A 3LDAA 5EZ6B 4URUR 1OHHA 3MG9A 1AK2A 1SXJA 2HCJB 4JT4A 4CRWB 2J7PA 3I5YA 1NMXA 3THYB 3KJEA 1NKSA 1NMYA 1Z6GA 4UNQA 5TARA 2GTPA 1N5IA 3IKJA 2R6AA 4EPXA 4NTZA 2RH5A 3VMFA 4TYPA 2OV2A 4IXNA 1DBSA 3OFNA 4JL6A 4M1MA 1G3MA 5AUQA 3FKSD 3NC1C 4PXAA 4DVGA 4N3NA 2ZE8A 1X8JA 3OE7A 1QRAA 4TSFA 1GRRA 2EFGA 4C0AC 1QG4A 2BDTA 1FOEB 1G8YA 3UATA 3LLUA 5CLLA 4R2IA 3R9WA 1OKKD 4QBHA 3T35A 4XTCS 2OM2A 3PENA 1Z2AA 3CR8A 1FUKA 3A4NA 4BFXA 4TQ9A 1Z6AA 2ZE5A 2GILA 4Q47A 3NEYA 1XU4A 2LCFA 3VU9B 4Q9JA 4N0DA 4ZCIA 3U61B 4TYYA 1TMKA 1E2NA 4AURA 1CP2A 1MABA 4PC3A 1RVDA 4RY2A
chains in the Genus database with same CATH superfamily
5F3DA 4RNDB 1ZIOA 4NBSA 4A82A 2OXIA 3D8HA 3DBRB 1RHJA 1VG9B 3CN9A 1XRNA 2ZPUA 2GWHA 3VZRA 1CUBA 4BO1A 2WM2A 1BWPA 4ZAFA 4EGAA 5F77A 3PXXA 3W2EA 1UJCA 4LX0A 4M2LA 4G4SO 1XZPA 2VF7A 3A6LA 2J6CA 4OK6A 1MFZA 4CN9A 2BD0A 4JJFA 1QFZA 2ECFA 2EZ4A 2GZAA 3KQWA 4MW5A 3WRYC 5BNIA 2J4CA 2WV9A 5DO9A 1GGVA 4OH7A 4R2HA 4DCJA 1FK8A 3I1YA 4OI1A 4TL6A 2C7RA 4ZKDA 1VLMA 1UC9A 3OLXA 5LZ9A 2J3HA 2DTDA 4DMKA 3VKFA 1TCUA 1KY2A 2VHJA 3PP8A 1TJPB 3PXDA 1HDCA 2HTFA 1E4YA 4O5AA 1WCV1 3BKXA 1V26A 4LS3A 4ZEVA 2BBOA 1O96B 1YR3A 4OQPA 2NZ8A 3UWDA 1UKBA 2ADMA 4CMIB 4IDBA 5CYPA 1C4WA 5JRJA 4S04A 1TQ2A 1WPRA 3ND8A 4TV8A 1BE0A 5BSUA 3T7IA 2QQ5A 3D6JA 2R6JA 4Y9UA 5FORA 3ENWA 3EXHA 1IM2A 3U56A 2ORYA 4NG4A 5FJIA 1QH1A 3ZWQA 4QOFA 2UVPA 1F2TA 3IOBA 2NU6A 3QI2A 3U3RA 4EBBA 3CZCA 3NBAA 3ASZA 4BEBA 1K3FA 3U19A 3I6IA 3KAPA 5I01A 1YL6A 2X4LA 1AU9A 2TYSB 3JZDA 2I78A 3B3QA 3I5AA 2QLFA 4QPZA 4UXHA 3BMQA 1ZOSA 4UEWA 2B1IA 4ZU3A 1LBEA 4JFAA 2XMPA 3CSUA 1CZNA 4KQJA 4F2DA 4JL8A 2WT9A 3F6BX 1G63A 5IDWA 3W5IA 1IHUA 2YMLA 1BOOA 1XTJA 1KBQA 1E6EA 4BLUA 4HRVA 4K9SA 4OQMA 1R4MB 1ENZA 1I9GA 4Q0MA 4TS1A 1JUDA 2PH5A 3BXHA 3I73A 4NDNE 1GU0A 1N6OA 4AYWA 5LB2A 5A5DA 2OILA 1QRUA 3OCZA 4IO0A 4IXMA 5EJ6A 4OH1A 3GO4A 3HPRA 3QOWA 4HUTA 3PFFA 1T2CA 3ICEA 4A6EA 3TM4A 4QDTA 2GZRA 2IZ0A 1EVQA 3Q3IA 4UCFA 2C2YA 5U4XA 2OYCA 2DLCX 2H4FA 5A4JA 4KR2A 4GM0A 5AW4A 1C0IA 1Y5NA 2GLUA 2WG2A 3H5VA 4F2PA 1MOSA 3QVOA 4H3HB 1WRBA 4KITB 2AG1A 1QHEA 1XTQA 3PR2B 3H8VA 3FDZB 1V47A 2IHJA 3FZQA 2WIBA 3TCNA 1TCCA 3MS4A 4DMRA 5CGZA 4KOAA 4DNPA 4F46A 4ZCLA 3Q9LA 1E8MA 5G4KB 1X14A 3QE9Y 2WLTA 1QO0D 3NDJA 4MVYA 2Q5IA 1HT1E 1W85A 2J6BA 2D13A 2XWPA 3GLVA 3IO5A 3IQFA 4NSNA 4KMMA 1YFZA 1U9JA 2B1QA 4BWGA 1BMTA 2OHVA 3OEED 4H0CA 4OHZA 3OKPA 1N1EA 4MCJA 3WRWA 1LK7A 3Q7SA 1QV9A 4QGBA 2FRDA 1DAIA 1HL3A 4XGQA 4II3A 4MEJA 1T2UA 2FVYA 4XDGA 3TOSA 2O2IA 4B09A 3QE0A 3DOJA 2RHOA 3N5CA 4L07A 2W0SA 1WXDA 3JQFC 2XCTB 1E2MA 1ZCJA 2XCOA 3KAKA 4H7JA 4O0MA 1Z6ZA 1ZIYA 3O9MA 3G17A 3ZXYA 4TL8A 4Q1BA 2GPYA 4OKNA 1ZC4A 2DBYA 1O57A 4R2JA 5IUJC 3D0KA 2J48A 1G2QA 1JMYA 4PZCA 2NUPB 5EP3A 5CA0A 3FWNA 1RPTA 3WK5A 3V8PA 3R4VA 4DLRA 1U2EA 2JGRA 4OIMA 4RANA 3JWPA 3HO1A 3ML1A 2GT1A 3PEEA 4I6JA 3TW8A 2QLNA 3RHFA 1EVZA 4N5IX 4U7DA 1X0VA 3CRMA 3MOIA 1OTHA 4NCIA 2C3PA 1D7AA 1JWBB 2P1RA 1CEXA 3NKLA 2LCQA 1ZZGA 4BN4A 2CXRA 1H8HA 2FAXA 4IEFB 3UYKA 4C7BA 4A6XA 5ICGA 2R00A 4OJKA 1JE1A 1NZDA 3O4IA 1DC8A 1M5RA 4KXWA 5JC1A 3H1GA 4PZAA 1XB2A 2B3TA 3GMSA 4IWXA 1PR5A 3FMFA 2E5FA 4ZIRB 4HXYA 2AFIE 4RDXA 2OQ2A 1JHYA 1I3CA 4KU4A 5INTA 2W9XA 1H4VB 1U4NA 3IP1A 1YK0A 2VO1A 4YJHB 3UH1A 4DS3A 4MQLA 3WBFA 2O8CA 1KDOA 3MT9A 2XYVA 4R9UC 3SJCA 1P77A 1VE1A 5A6SB 5KNDD 4PCUA 1IH8A 2WIFA 5E4YA 1E3EA 2B1JA 2I6XA 1OLSA 2Q0QA 5H16A 4D9IA 2CFRA 4JJAA 1FRZA 1X7DA 2C9MA 3GLUA 1U2TA 5JPCA 3TG2A 2GM5A 5JFOA 3DEFA 1PT7A 1VLZA 1B74A 4FMBB 2MSKA 4GXNA 1AQIA 3LKVA 1X0XA 5FFMA 3AKZA 1ZQ9A 1DWPA 5A6VA 3GLSA 2H16A 1F6DA 2XB4A 5JATA 4BPBA 4IJVA 5KS2A 2DPLA 4GWKA 4HDKA 3KC2A 3A6DA 5KPDA 1E2EA 1NVDA 2VQ3A 4JLDA 1CP3A 1CR2A 1ZUD1 1NAHA 1PQUA 1ETHA 5ALMA 1VE5A 2FPIB 3SHQA 1IN6A 5BSHA 1KMMA 3AUFA 3C39A 3WLRA 2D2XA 3D6NB 1N1GA 3GVCA 3U4QB 3RARA 1FUUA 4RHTA 1K4YA 2FKAA 3R24A 4KO4S 2CBXA 1KYXA 4D4HA 3AJ8A 4Y6RA 2Z83A 3F9CA 3WYCA 4EUFA 3P4UA 5EMHA 1A27A 3SC3A 3FWYA 3M7IA 4MUIA 4ZI7B 4YDQA 1ZMTA 4D6XA 1YH3A 2BFMA 4EJ6A 4F45A 5HEKA 3UMJA 5AW7A 3D3JA 1NG1A 4YAKA 4FHFA 1KOFA 4HADA 1WOMA 1KXJA 1JKIA 4AJJA 3BWEA 5JFGA 3LXMA 3DUWA 4C08A 4PSVA 1MRNA 4NMHA 1UIMA 1W4AA 5K8CA 2ORIA 3L40A 3EEBA 4KREA 4ACAA 2GN0A 1LY1A 5JAZA 2JFUA 5HF8A 1T2AA 2F62A 2RHBA 5EUCA 4B31A 4J7AA 3WA6A 1IQRA 1CLEA 1Y0BA 2WKQA 4Q9IA 2AQ8A 3WGTA 2O19A 5AM0A 2HK9A 2G36A 3OTHA 4WFIA 1EZZA 2C03A 1SZDA 1LTHR 5CIQA 3T0IA 3ECAA 3HU2A 3KZXA 5K0ZA 4B45A 1WW2A 1EAMA 1PLLA 1UMDA 3OD1A 4RHFA 3H1BA 3HO6A 1P61B 1BXRA 3WISA 5L3QB 2ZUUA 2D4AA 1U2GA 5BORA 2C5FA 4G5HA 4QO7A 1WDTA 3WB1A 1E1QA 4G0YA 1DXQA 1LPAB 3QUSA 1FDOA 1W36D 3QVUA 3PL1A 3WI7A 3CLRD 4R54A 1SKUA 1EFPB 2OKGA 4JUFA 1KRHA 1W0JD 1RC1A 2M1ZA 2QHXA 4V39A 2LTAA 5B58T 1AV6A 1DHRA 2IUTA 1Q92A 1RXCA 1ZC3A 3GMDA 4U7HA 2F1IA 2EFDB 4RD4A 3T5CA 1MR3F 5AESA 3AO0B 2REQB 5H4HA 2CD9A 1DQRA 3A4IA 3RUIA 3QX3A 4REOA 4YCSA 4JDPA 1CJVC 4ILEA 1PV4A 1DBVO 2FSVA 5IYZB 3VC2A 1KJYA 2WAAA 3M81A 3W6UA 4DJFC 2I9PA 3MLEA 2WU1A 5CGQB 3VUEA 4HKTA 3ZG6A 1T5TA 1SB9A 3LPNA 1TVMA 1EWQA 2MINA 3MWEB 4B83A 4CPDA 1KVRA 4FWBA 2Q3LA 4JQSA 1RU3A 1NDQA 1W0CA 4UDXX 2E6KA 4RFSB 1II9A 1M2EA 2FFQA 4KAXA 1BCRA 1FJXA 1ARZA 1S89A 1RYBA 4J03A 5TMEA 3GLIE 1F6BA 1XHEA 3M6UA 3GDGA 5AVWA 2HHAA 3F5DA 1R4NA 4INPA 3ADKA 5DM4A 1GVHA 2HM7A 2IOFK 1E1NA 1GQQA 3O9VA 2YZKA 4FYXA 4JYZA 3U0VA 3UNXA 2IH5A 3DE4X 4F5EA 1REQB 1M7GA 3GPIA 1BXGA 4JI1B 1T9GR 4ZYUA 1JNXX 3PCRB 3OQMA 4ZCRA 1DRJA 4YJKA 1G5PA 1PR9A 1WBJB 5IJ0B 2AX3A 4PQGA 3ZWNA 3WL7A 1EGQA 1OI2A 4TT3D 4YQFA 4KQ2A 5CB4F 4MRVA 1SUIA 1L4HA 1M1YA 1RWOA 3NQ41 1PJRA 2GGSA 4OSEA 4F04A 1HFEL 4KWTA 3BT7A 2PFSA 4RD2A 4LPKA 4JGGA 3G2NA 2BEUA 3UGTA 4TSFD 3ZHSA 3K8QA 3BHJA 1JQ3A 5BMVB 1M1NB 2BCGY 2VF5X 5HUQA 3NV7A 1ESMA 2Q3BA 4QHTA 4RADA 1JSZA 2PXCA 5GZ1A 1MW9X 5BR4A 3GLTA 3UWPA 5AVXA 1YA6A 5J5AA 4NOKA 4BMVA 2QLMA 3EAFA 5E1MA 3VDMA 3VHQA 3R5HA 4FR5A 1NQOA 3DGFC 4IRUB 4CMKA 1WR8A 2BFEB 1KKMA 3IALA 4IUBS 4JFRA 4ARBA 1AO3A 1NIPA 2V55B 4PZ0A 3EDQA 3H2YA 4YO7A 3LL7A 1YA8A 3DH0A 1GPWB 3K9WA 1G3RA 1HFJA 3TOXA 5AVYA 1G17A 1CUVA 3A2KA 3A6ZA 5EPOA 5FNVF 1KZ7B 1RI4A 1ISHA 5J43A 4L9AA 5IVHA 5DN9A 4FN5A 3RUEA 4NE9A 1U99A 1HOTA 1R0WA 1OGYA 1FYEA 1Y1RA 1R0ZA 1ZSVA 3VAYA 3X2EA 3P9QA 4EHDA 1GAJA 1PWZA 5G0WA 4CV2A 3OCWA 5JS8A 4Q15A 2F8LA 3OF2A 4MDEA 4FEGA 5F2KA 1D4OA 2NQTA 2DPHA 4JVMA 5LDGA 4AWXA 4C5CA 3EDMA 1XIVA 2QYOA 1U5CA 2OLJA 3ZZ1A 4B4WA 2IW3A 3DW3X 3ESRA 5ALSA 4BFCA 3Q40A 3ROTA 1YFLA 1DQPA 4JT8A 2DPMA 3VR3A 3SHOA 4Z3OA 3G6WA 4XVHA 5LWQA 5HFJA 1L6IA 1MJFA 5JCOC 5FLYA 2G5PA 4MNTA 3RC2A 2QTLA 1R15A 1Z39A 5TS2A 3ZU4A 2GYVA 2XD4A 1XKTA 4P0TA 3FE2A 1SXPA 1ECLA 3K0SA 1JSCA 1ZFNA 4YIHA 3JW8A 2P0AA 5BSRA 4RJKA 4DYDA 1S8NA 5L9AA 1OPXA 2ANBA 1L7AA 2DWQA 3B1YA 2V03A 3C1TA 3GEEA 3LYAA 1I3KA 3ZGXA 1AMOA 4NE2A 2E5LB 2EW8A 2C92A 2WHRA 1PJCA 3IIMA 1M6HA 2PU7A 4MB0A 3PEFA 3DQZA 5DBGA 4EUKA 2RCNA 5HTKA 1LC0A 4G6ZA 4JC0A 2PLFA 1VZ2A 3G2KA 5BVHA 4KI0A 2CHGA 4H4CA 1OTXA 5KQSA 4GX0A 1FSFA 3I6BA 1NWHA 4I6EA 4TL9A 4MR7B 3PEWA 3VZSA 4FD3A 7YASA 4MTCA 3WKEA 1JSLA 3ELBA 4CXMA 3HDYA 1MTOA 2QN6A 3ZWOA 5SYNA 3TOZA 5AXBA 4MRMA 4BB6A 1U2DA 2FETA 3DOHA 5KDOA 3FNHA 2I62A 5JNVA 1VCOA 2Y1CA 1RJFA 1Y4AE 4KO1S 4UTVA 2D8MA 4ZDKA 1TTTA 1AGPA 1KVSA 4H3VA 1GGKA 5IKOA 3IP8A 1BDJA 2XAUA 1ZLYA 4PQFA 4AK9A 2QRUA 3H97A 3PXEA 1MB2A 2FRDC 1T35A 1U3DA 1G42A 1ZEJA 3PFCA 4O4LB 4OQYA 3SBEA 1YQTA 3UA3A 1ZI9A 2O5RA 1A98A 3NORA 2O9JA 2WNIA 1PR4A 4EKIA 3HFRA 2PQ6A 4U39A 2PS9A 3MT0A 3MHTA 3GR6A 4IILA 2P5TB 4CEHA 4PFSA 4A10A 1M33A 1EUCA 1P5RA 1C1DB 2FN8A 4BGIA 5IK2D 2H7YA 2FSUA 1RWMA 3HPQA 3LZCA 3SC4A 2YJZA 4PAWA 4Y2HA 4B4UA 1CB7A 2VCEA 3MW8A 1OSNA 4QOJA 2ZBGA 1RCTE 3TW0A 3ZW9A 4BLPA 5GIPE 1NY5A 1WCWA 4ZDWA 4C6TB 1TGYA 2ERYA 2CFIA 4R2XA 4M9XA 2VUHB 4IQFA 4FNGA 2VSNA 2G6TA 3MS7A 2GO7A 2IIPA 3IQDB 4DKJA 1RABA 3PQ3A 1NBMD 2PL9A 5ETJA 4BFUA 5I7AA 2LR0A 4W7SA 1SBQA 5FOUA 2IZ7A 5KVSA 2CVQA 2P6MA 3DTVA 1W36C 4U9IS 2HO4A 2AC7A 4OLHA 4YNBA 3UT5B 1WEHA 1V6AA 3F46A 2QRGA 3I92A 1GZ5A 1VB3A 1EZ4A 1RI5A 2C07A 2EX0A 2QTRA 3KR2A 1GXSA 3N7TA 3OF3A 4G1BA 2PSSA 1AGRA 1K5PA 3MMZA 5ELLA 2WOJA 4HDCA 3VR2A 5KYTA 2HV8A 3TLGA 1MA0A 1C3VA 1GOTA 3FKJA 4I9NA 5LJLA 2GM4A 4MWZA 2GHTA 1OWNA 4JAVC 2QDXA 4ZANA 4CFYA 1AN9A 4IIHA 3AKDA 1NNEA 1FUYB 3KQSA 4MVJP 2XMGA 3HUDA 2EX4A 1UZMA 4H17A 2AH5A 3I6QA 3A9VA 4LRWA 1Y42X 3NRCA 1QOPB 4S1NA 2YJNA 5AFSA 3UJ9A 3A3NA 4A8JA 4P3KA 4XPIA 1VGRA 5TQ2A 5LR6A 3IBTA 3BB1A 3F8WA 3BIXA 4G0MA 4B87A 2Y1OA 1NNI1 4JENA 2VSQA 3GEHA 3QXXA 2DQYA 2JIBA 4CTMA 3OCCA 2GARA 4C0BA 4F96A 1XU7A 2XEDA 3OOYA 1XD2B 4HB0A 1DBPA 3I9V1 1TU3A 3OOHA 4YRKA 5AUNB 2I4RA 3I72A 2M32A 1SHTX 2DX7A 5C5EA 1IHOA 1AKRA 2WVAA 2RAVA 2OCBA 5JCZA 2HU7A 4PBRA 1ZCAA 3R0JA 1KJZA 1XXHA 2VP9A 3LZDA 3PC8A 4MQ4A 4PR3A 4RFSA 1YUNA 1H2EA 3EBOA 3RNOA 2FQQA 1EGAA 3E3LA 3NW9A 4G24A 3WNBA 1DIBA 5AWFC 4F3CA 3TLGB 3V46A 3QWHA 1NWCA 4UU1A 4LF6B 3PITA 1NXXA 4M1EA 4ZCSA 4WZZA 2NNLD 1H85A 4J90A 3U44A 3AB8A 4LW8A 4GSYA 1YZKA 1YDEA 4JP3A 4HNVA 4YI3A 1XNHA 1PGJA 1QYWA 3CZRA 3H9UA 5HK8A 5KHAA 2PV7A 3ACDA 3R7LA 4OHWA 1Y3CE 1Z17A 3X1YA 1F4PA 4XYGA 3X1WA 2XNDD 3N6VA 5KYGA 1Y5LA 3DE0X 2SICE 4DPKA 2BFDB 4NCNA 2JI6A 4DXAA 3QBTA 4Y1EA 2AEEA 2I2WA 3MRVA 4KEAA 4BO8A 4EHFA 3U13A 1VA4A 2N42A 2YXBA 1KZ6A 4UMEA 5FWAA 5IXJA 3LWBA 4KCGA 3DUFB 2X5NA 4WACA 4DM3A 3MTBA 3W6NA 4M3NA 3FXAA 1KYYA 3KSMA 4L6AA 2WYOA 4F6CA 5BT8A 1J0EA 1GYPA 4R5HA 3ZI4A 3H8WA 5JNLA 2DT5A 1PD1A 1QRDA 3HADA 1BEZA 2PWBA 3KUCA 5TY0A 5EJ7A 2AXNA 4M1WA 1ZN2A 3PQ8A 1YS9A 4HX5A 3B36A 3LXRA 1KOGA 5AVZA 4OQ4A 1WVIA 2BBWA 2FEWB 1VMEA 5A05A 3QNMA 4P7JA 2VDOB 2Z5FA 3VKWA 1AQNA 3ETDA 1TA9A 4UE6A 4XLTA 3F6YA 3MBOA 4LGVA 2VEOA 4OHCA 2WFZA 4TZ0A 3GJZA 4RVGA 5G4KA 2A3RA 3IOMA 1F0NA 1FNSA 1G7RA 1SU4A 3AYXB 1CQJB 2XI4A 3SEQA 1TMGE 1Y1KE 4BNIA 1PL7A 2GKSA 2JGNA 4CM7A 2VVTA 2IVZA 3BA1A 5KWVA 1RQ2A 1PS8A 4MDFA 1UFVA 2X9LA 5DLQC 4I1IA 1QGDA 5DM1A 2NUAA 2REOA 5JBQA 3X43A 1E58A 3L49A 2ID8A 3K9BA 4ER0A 5FAKA 1OUMA 4XVQA 2CHQA 3SS8A 2I03A 4I9UA 4OFZA 4U63A 2FW8A 3NHAA 3NHRA 2Z5VA 5BVHB 5FBWB 1YHNA 3SBXA 2BHNA 3I1IA 4W1RA 4MZDA 2Q7DA 3OT5A 2XSZA 2DY0A 3AR8A 1B6SA 4P2BA 4AMVA 3FJOA 4XARA 4DLBA 5L45A 5DYWA 1CUDA 4G1FA 3BXFA 5I8ZA 3LQYA 3IAM1 1KA9H 1YULA 1Z22A 1DEKA 1N6KA 1YBFA 4Q3OA 4D57A 4EL0A 1F9AA 1NXOA 4O6VA 1SO8A 1BYUA 1X8LA 3ZEIA 4DARA 3WWEA 4UQOA 2A9OA 3I30X 3LVQE 1ZD2P 1T8YA 2W6JD 2V4MA 2VJNA 4EPYA 1DDOA 2J9YB 2Y6UA 2QYTA 3P96A 5F23A 4PPYA 4IOKA 1ORWA 3LWDA 5FWYB 3NP7A 1O95D 1Q3HA 5JS6A 1FFGA 3UHFA 2I7CA 1P19A 2G40A 3A2NA 4ENWA 3ZXIA 1BJTA 3C8MA 1YGYA 1DAFA 1SCDA 3L0DA 1WHSA 4MRPA 3AEYA 1ECFA 3I9V6 4XPZA 5LP6A 1P7CA 3RANA 3I4CA 1NBOA 4KE9A 5C1BA 1XA0A 1N7HA 3N0RA 1DWQA 3D1JA 3IBGA 2ACWA 3RHZA 4V1CI 3GLQA 3L84A 5HS6A 4A8HA 5JG7A 1C3LA 3G82C 1I13A 1P1RA 1SKAA 1XZAA 1PU2A 2OB2A 5I3CA 4BO0A 4GZLA 2P90A 4B3IA 3RT9A 3ZQ4A 1TIPA 4GLOA 4KXFB 5DULA 4C87A 3L05A 1M2VA 1NY6A 1DEAA 1UBUS 3GZJA 4JYPA 3N2GB 1TXGA 5C1PA 3LX5A 1OA0A 3DP7A 2P9ZA 1JHQA 4QREA 3VM6A 2XDQA 4RQUA 4L74A 4QIHA 2YX1A 4H7DA 4N0EA 2ATIA 1ODFA 2D5CA 1L7NA 3HVKA 2DR0A 3DVLA 3LY5A 4IIJA 3W4IA 4AO6A 4DGSA 3HXTA 4M7WA 2WJPA 3ETHA 3F73A 6NULA 2HMVA 1V5EA 3GL9A 3PS9A 4UAJA 5EIFA 4CG1A 5ILOA 2YNMD 3HBLA 2XXJA 1RXSA 3HB1A 3FAKA 1AC5A 1AKEA 4GZ3A 4R2WA 4G89A 5AVTA 2AF4C 5CTAA 2BW0A 1QV7A 1G5HA 1NT2A 2CLEB 2JLCA 2IY9A 1WO8A 2XECA 3HZHA 3V1TC 5K8LA 3H9CA 4QUJA 3TD2A 5KOHB 5BWMA 5DHTA 2BH2A 1EIWA 1R0RE 2I7TA 3H1FA 2HQRA 2W00A 3AQIA 5F9MA 1BMQA 1C9DB 1XRRA 2O2HA 3OMXA 2HA3A 3COPA 4XVRA 3CLTD 1XLUA 3RR2A 4AZ0A 1RPZA 1L4LA 1QFXA 4RIEA 5ALQA 4W6QA 1I2DA 1VCIA 3B52X 3GCDA 4L5CA 5F4ZA 2QAJA 4HMQA 1IN4A 2ZCVA 3EA5A 4L72A 3U60B 1DCKA 2G9ZA 2IZOA 2OOKA 2WA1A 1NXQA 2JJ8A 3PFKA 3MJFA 4C30A 3WQHA 3QEAZ 3PYLA 4HAOA 2WFLA 1Y6GA 1RQ7A 2R1TB 2BGTA 3WE7A 5TDHA 2GAJA 2I66A 3NV9A 2H3EA 2PX6A 4W8HA 4D96A 1PLJA 2TECE 3AJDA 2C4NA 3NT4A 3CRNA 5EMLA 5I3ZA 4D3ZA 2VHWA 3INNA 1YVDA 2WTBA 1TW2A 2F90A 4CGYA 1MOQA 2WMNB 5J4YA 1NUHA 1P8JA 1A04A 1F0PA 2BDUA 1OAAA 2I3BA 7MHTA 1VLHA 3JVIA 5TEVA 3WGQA 4NENA 3PUYA 2D7CA 1ZM4A 2IY7A 1P81A 3K9NA 1E5TA 2W43A 3GAZA 1Z68A 1QFMA 3HI4A 3QKWA 3A37A 4C0QC 4V0KA 1T5IA 4DUZB 4S1VA 4Q24A 3CWZA 3OQPA 2ZUCA 3LKBA 3BMQB 3F49S 3KLPX 4P82A 2XTZA 3M6LA 4FOOA 1PL6A 1Q6ZA 3AEUA 1D4ZA 4MMYB 3DWFA 3FFBA 5DI3B 3LHDA 1V8OA 1J20A 4P5PA 5DNEA 2XCLA 1HLDA 3I0MA 4WZAE 5D5PA 4AROA 1KJWA 2O59A 2WFAA 4GD3Q 1KI9A 2R1TA 4JGIA 3ZYCA 5EG5A 4Q3KA 1DKQA 3JQBA 4MO2A 3PDUA 4MZXA 3VNBA 2IH2A 2HT1A 1ECBA 2MT9A 2EFEB 1UM8A 3L7OA 4WKBA 5JWRA 3ZW7A 5BXYA 2AD1A 4YJ3B 4Z99A 1RXWA 3VX4A 3RUCA 5TC4A 2J3KA 3VNUA 1A3CA 4TROA 1T29A 4QPJC 5A5GA 4UUPA 5FNVB 2OCXA 4N39A 4BX8A 4OHPA 1R9MA 4WV3A 2WOOA 1W0KA 3PXCX 1MPXA 1TYAE 3CPJB 1S01A 3PC8C 3QYAA 1CR4A 4YGYA 3DZKA 1KEPA 2I67A 3FZEA 2GJ4A 3CYFA 4X1IB 5AW1A 1SXIA 4INJA 3H1PA 2FJ0A 4NMMA 2R4TA 3RJMA 5CURA 5C81A 3Q8LA 3DOUA 1AH2A 2NUBA 3NBQA 1GUYA 3J7AC 3DEAA 3ABQB 1HT3A 3I34X 2I2BA 4ZPXA 4RD6A 4FILA 2H2DA 1WB4A 3DDUA 3C3PA 3MCWA 5L51A 3HYSA 1FXWF 3T99A 4F86A 4JI0B 2IP4A 3MM4A 3U26A 2PL3A 1B8PA 3ZZTA 4AIRA 2D3WA 3KUUA 3MBKA 3G0BA 1HH4A 4PLVA 2XDAA 2N1MA 4WPGA 1A5AB 5DTRA 5JT1A 3PYXA 4PIVA 3C43A 3AFOA 4FFWA 3UOGA 3IVRA 4BVAA 4DV1B 4J16C 1F8UA 5ES3A 1VXOA 1RT9A 1Y63A 2XB9A 4QTXA 4YLEA 2ONCA 5E0KB 4HVLA 4P92A 2KE5A 5IX8A 1YONA 2QWXA 5E7MA 1D03A 2DE0X 4QG7A 5A5VA 3U31A 2CXOA 2WF6A 1ZH8A 2OBBA 3T0FA 4LK3A 1JX6A 4L9RA 2VKTA 4EJSB 3TX6A 3NTRA 1VPLA 5B55A 2XGJA 1M1YB 4U2BA 2BUBA 5JRZA 1A9PA 3WSTA 1TYDE 1RWWA 4DRXB 2HK7A 1ETUA 1PDVA 3S1AA 3KZ1E 4LFCB 5DGIA 1YTLA 4HDMB 3AR7A 3JVDA 3LU1A 1F17A 3UJ6A 1EUZA 3AJAA 4GNKA 4I2NA 2YYZA 4DGQA 1QM5A 1RWQA 4YRMA 4UUOA 1VBKA 3KAJA 3P2IA 3FBWA 4BX3A 1CY2A 2XMRA 4I3HA 3Q8WA 3R7AA 4AFNA 5IULC 3V8EA 4WFKA 1WNTA 4IIYA 4Y9TA 1SMKA 1N8NA 2ZITA 1CD5A 2COUA 3E15A 4XWTA 3DP9A 1ES9A 4JI6B 3LBYA 1MH9A 2X3FA 3IEIA 2WI8A 4OHKA 4U6QA 3S1SA 2PQ0A 4BO4A 2Z6UA 1JVBA 1RRCA 3MJEA 5F2NA 3FUUA 3MGBA 1PTJC 3GLRA 2ENUA 4WMLA 3BJZA 5F51A 2RHWA 1IMJA 4A36A 3HCAA 2V1XA 2J09A 3KM0A 4Y2RA 4Z54A 3G1WA 1D3AA 2YICA 2NSLA 1SKYB 2ZE6A 1MO2A 1B15A 5K3OA 3HZRA 3HP7A 5CNJA 2YY5A 1IXZA 2A5LA 2JVIA 3EF1A 1MB0A 5IN4A 4BTLA 5HKLA 3N6XA 1F0KA 1OROA 3DZCA 2I6FA 3W5DA 1Z9BA 5FT9A 2P75A 4XGKA 2QUHA 3AFNA 3CNHA 3FLBA 3ZHCA 2P30A 5C7IO 3T1TA 1Q91A 5A3JA 2B94A 3MPOA 4BN0A 1K9VF 1QRTA 1NFFA 4FI3C 3AERA 3WWYA 1SULA 1YQQA 3R3WA 1ZN9A 3IR5A 1W44A 3UJDA 5JQWA 2GN6A 2ACVA 2XDQB 4BCBA 1MGPA 4KH1A 5FI1B 4BKOA 1NV9A 2ENWA 4E7PA 1TTPB 2HKIA 3BG5A 4E1VA 2W6IA 4DW8A 4PYMA 2YS6A 2EKQA 2IBTA 3P0IA 4PX2A 4B3MB 4YXWD 1E77A 1JH8A 4HWPA 1AK1A 2JLUA 3H9EO 3OEYA 1ZWKA 3Q2KA 4BQSA 3CO5A 1GU7A 2OQIA 3DL4A 1KE1A 4F93B 3VR4H 2D1YA 1ZH0A 3VU3A 1RXVA 4XZ3A 2CWDA 3VXKA 1KI3A 2CLKB 2MR6A 3PRHA 4CL3A 9GPBA 3KQKA 1A1VA 5EUBA 3CKMA 4RZQA 5GOTA 1CDDA 3IXQA 4FFSA 2O7NA 3GRCA 4UOEA 4HVTA 5B7NA 3OE4A 1JFLA 3B5JA 2NZVG 4YMWA 5LYJF 4RZ2A 3TLBA 3RIYA 2HLDA 3ZVNA 5AW6A 1JAZA 1IXSB 4I4NA 3RUHA 2XOKD 3PDWA 2B2CA 2D2EA 3U4DA 3E9CA 2JRLA 1NW3A 1C7RA 1FP4A 2LZ0A 4MJ7A 3OI7A 3UUFA 1Z2DA 2ZLBA 4RO0A 1VSVA 5KCMA 4PR0A 4M88A 1D6MA 1JKJA 5TQJA 3ED5A 4G25A 3GJYA 1QF9A 4K03A 5ALKA 4AKTA 3T5PA 4I2VA 4JA2A 4PTLA 2EHJA 2ZJ8A 2H2HA 1QIHA 3SS7X 3Q7QA 1U31A 1KL7A 2GYYA 1OVGA 3B5EA 3LYUA 3IT3A 3S44A 4GI5A 6AT1A 2ZAOA 3T9EA 4YMGA 1QE0A 2JD2A 4KDCA 4EB8A 5NULA 2VQDA 4KAAA 2EXXA 3ELWA 3I2KA 4EJ2A 1EX1A 4F2WA 3F7NA 3FMPB 1FJGB 4HX9A 1W29A 1FS6A 3MMNA 1Z73A 4BNTA 3L8YA 2Q2QA 2QN8A 3GNTA 1R16A 1AXEA 3LS2A 1ZXLA 3LDGA 4HAUA 3DZFA 1UDCA 1UKYA 4UE3S 5BV1A 4LBZA 1HG0A 2ZWIA 5GPBA 1VHWA 3E81A 3FPBA 1T4DA 4DJAA 3DHEA 1H69A 5D1NA 1KXZA 1RFGE 1ADGA 2AN4A 1PJTA 1WP4A 4E2ZA 1A88A 3DZ8A 1NRJB 2ID4A 2QGZA 4NBKA 3C8DA 4ARZA 1AJEA 5ABPA 2F6RA 2H8GA 1GP2A 2GS9A 2X1VA 1VIVA 1G8MA 3R6DA 1E64A 1DARA 1VMAA 2GI4A 4QO8A 1L8LA 5H3CA 3UC5A 4M76B 4ONEA 3AR2A 4ZQFA 2DBZA 1GT6A 1G291 3D02A 1KAGA 2PR2A 3M4YA 4HK4A 1U28C 3NWOA 1QTRA 2RSLA 1U8YA 3PC3A 4B6QA 3HU1A 4DLYA 3C5HA 2EBHX 3JYLA 5AOAA 4LUCA 3I05A 3C48A 3QG5A 3KSRA 5K3FA 4UCXA 4ZEOA 1E98A 2CUKA 5KSOA 1C7IA 1M72A 2CE2X 3KZMA 3JQ6A 1XVTA 2XGMA 1BZYA 4JMLA 4PLHA 5ISMA 4TS9A 4Y7DA 4EEKA 3UIEA 3LY9A 2GVZC 3R6LA 5EPUA 1GPLA 2VWHA 1RIFA 3PDHA 1VJRA 1WDWB 2Y1GA 4HEQA 4MR9A 2NO5A 4Q1DA 5D7BA 5FF9A 5HILA 5CCDA 3MCAA 5H4GA 4B3GA 1BVHA 2VP6A 4ILKA 2G1PA 1NYTA 5IJAA 3GGJA 3AR9A 3KTOA 2C9ZA 4TTRA 2Q49A 2YN0A 1PD0A 3CIFA 3UQYS 3TMKA 1U2PA 1WPXA 2OAQ1 1HC7A 1IIBA 4QOEA 1KP3A 1T2EA 1KJJA 3PGA1 1OZFA 5K3EA 5KSYA 2WJGA 3OJFA 4LI3X 1XZ8A 2WBLC 5TJ9A 3K0AB 1KK0A 1Z2EA 2L0XA 4Y7CA 4D3DA 4DNQA 3OQOA 1NG9A 2G82A 3SJZA 4I4LA 4XIFA 3UYLA 2ZRAA 3NETA 3LTEA 2Q07A 3E82A 3ZVKA 3H9JA 4BNDA 3ZJTA 2FHSA 1BRMA 1ZA1A 2VAXA 3SJUA 4CBVA 2EJWA 1EVJA 3IUEA 3G68A 1ZK3A 1H94A 4F7WA 3ZKWA 3KEFA 3RAFC 4YJ2B 4JKOA 5TXGA 5EJIA 4UULA 5KZMB 1GKLA 5IC6A 4OO3A 4EPTA 1DU4A 3OTWA 2V6BA 2X0RA 3EJWA 3PXGA 3UPUA 3HDGA 3A1UA 3DFIA 4A2PA 2PV0A 4UHJA 2XVMA 3RBXA 1KYVA 3VGJA 1CRLA 1SUEA 1H6BA 1ZISA 1RCUA 2GX6A 3A4MA 4YRRA 3HDQA 4NFLA 1U98A 3IUNA 1YTUA 5FWDA 4NYIR 4R98A 1KH1A 2JHFA 4MO9A 1V3UA 3ZGLA 4FONA 2YVAA 3N7AA 3SP1A 4KO8A 1G5RA 4OQEA 3RU2A 1CNFA 5BWOA 3VJKA 3O90A 2I2DA 4EMSA 4KG7A 2COEA 4ZEWA 3VOBA 2X5OA 3IA7A 3L4BC 3FOEC 4NPCA 121PA 4S0ZA 2HJ9A 3PRKE 4KOEC 1WABA 2EJUA 2XUZA 1Y8ZA 3GGSA 3WIOA 5SY9A 4LE2A 2ODNA 4UVHA 2ZQ5A 3EUAA 2CLLB 2OVFA 3R7NA 4D3XA 4G86A 2RB5A 4LJ4A 4KXNA 1EPUA 4O4LA 4ZO9A 1N2XA 3MK31 1GNQA 4LDRA 3B7PA 4B81A 1EVEA 1AK9A 4D0RA 3D7RA 1Y7LA 1NW4A 2FLVA 2PSHA 4LMAA 4G8BA 3RC8A 4LQCA 1VG0B 1M2FA 5ALJA 3IEVA 4HN9A 3CLUC 3GPCA 4X20A 1RAFA 2W58A 5EERA 3TOCA 1U0EA 3SNKA 1JG7A 3ZJ5A 3K0CA 4UBOA 1GNRA 4RHEA 1ZL2A 1A2QA 4LZOA 1PDOA 4OL9A 1AS2A 2LE0A 5KTKA 1ZW6A 2QG9A 2VJKA 4R81A 1DX4A 4AUKA 3ZVLA 1CDZA 2A9PA 2ZIFA 3GARA 3R0IA 3TGWA 3U62A 5C32A 1GKIA 3W8RA 1RAHA 4PX5A 3P2MA 3WV4A 1J7JA 1MFPA 3GFQA 1BX0A 5CITA 3CGGA 1Q15A 1XO1A 1FMJA 2K7ZA 4IX9A 4J6FA 4MKXA 4R1UA 4XKJA 1ZQ1A 3RSHA 3RABA 3VO1A 3GLFA 2BM1A 2J3IA 4AP9A 5IABA 4LWPA 1Q12A 3X1MA 3GQVA 1U02A 3H13A 1Y8QA 3Q0TA 4TPKA 3KBOA 1TUBA 2H85A 1N8SA 3FR8A 1XLWA 2SCUA 2CKDA 1VPEA 3L7DA 3PJGA 3RS9A 1VSBA 1JTEA 4FQ7A 3TG8A 4OCZA 2P5YA 4R1SA 5LPNA 3VMMA 2AJDA 4X54A 2DY1A 3W6OA 4NBTA 3MN1A 5HR5A 1HZZA 3WJ7A 5KTOA 1E89A 10MHA 1KEWA 3L1IA 1XQYA 5LWHA 1PEAA 4QPDA 3PSHA 3VZQA 1NRWA 3N74A 3JQDA 4DMFA 5B3KA 2PD6A 5IU6A 3HXMA 4YR7A 2TRSB 1U1EA 1S9DA 2NTVA 1DAEA 3D6HA 3I23A 4GKVA 5DI3A 1S3GA 1QONA 3N2NA 2H00A 2YMPA 2HU5A 4L57A 3S68A 3WYEA 1E92A 2PYIA 4N7RA 4IVPA 5EQFA 2QV0A 4LHWA 4C4AA 1EB9A 2XRZA 1O95C 2KB0A 5THQA 1YB7A 4D4KA 1URPA 3ILVA 3SNHA 2I71A 1AHNA 2JI7A 1MMFB