3HDTA

Crystal structure of putative kinase from clostridium symbiosum atcc 14940
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
169
Chain Sequence
NKNLIITIEREYGSGGRIVGKKLAEELGIHFYDDDILKLASEKSPENLFKFQSEVMRELAESEPCIFVGRAAGYVLDQDEDIERLIRIFVYTDKVKKVQRVMEVDCIDEERAKRRIKKIEKERKEYYKYFTGSEWHSMKNYDLPINTTKLTLEETAELIKAYIRLKGFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative kinase
publication title Crystal structure of putative kinase from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
total genus 65
structure length 169
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hdtA00
1G64A 1LF0A 3H86A 3U7GA 2QM7A 4QBHA 3WNDA 1MV5A 1Y3AA 1W4CA 2QU8A 3DZ8A 4JBYA 1NVUQ 3THXA 1CBUA 5HTKA 2YOFA 1E2FA 4HB3A 4TYQA 1KO4A 1JNYA 4FWIB 3HPQA 3MMPA 2NPFA 2BCGY 1FP7A 4HB2A 3VR5A 1OF1A 3BXZA 4M22A 1TNDA 2GJSA 3W6OA 1F60A 1KDRA 4M4SA 4BFXA 1H65A 4QHSA 1UKYA 5DGXA 2IYSA 1HE8B 4GSYA 1N6OA 4M9XA 1L7VC 2ZSDA 2GHIA 5CM9C 2IS4A 2ZJOA 4QNRA 1CJUC 2OZEA 2H8KA 3GLHE 2VIIA 4CZ2A 1W4AA 2R6CA 3GLIB 1SXJD 1W36B 3NDBB 4XH9B 1YR9A 2FZ4A 3D7MA 4JLJA 3IPYA 2IWRA 5CB8A 2Z4SA 4TSFA 4YMUA 3I62A 3ASZA 4V0KA 3RRMA 2ZJ8A 4RCYA 5BWMA 1ZNWA 2VHTA 2IYRA 4EQ6A 3EC1A 2DWQA 3MSXA 4P31A 2OAQ1 1KI8A 4LHZA 2OBMA 3LY5A 1NG9A 2ZRPA 5HKKD 3UK6A 3T1TA 1N5KA 1GITA 5TARA 1KKLA 3N70A 3QKTA 2PX3A 1GZSA 3WMFA 1P73A 2V1XA 4KI0A 3UWOA 5K8TA 3EIQA 3UMRA 1NNEA 3VHXA 2IUUA 5CK4A 3T35A 4M9QA 2HYIC 2VO1A 1EWQA 2Z83A 5DNYB 2WSSA 1JR3A 1FNMA 1KO1A 621PA 2JA1A 1Q3TA 4MA4A 1HYQA 2JATA 1W1WA 1DEKA 3M1IA 4E22A 1SKQA 4B3CA 1E9RA 5KPJA 2RGBA 2D74A 4C0HA 2FN4A 1DO2A 1U0JA 2WAYA 2GETA 2ZJ2A 3KQNA 2IYTA 3DM5A 5CIWA 2FDCA 3BFKA 2V54A 4MUAA 4DLYA 1Z6AA 2XZPA 3HJNA 5JS8A 4NPHA 2IYQA 5UKDA 4LC1A 1FUUA 4P4SB 4RJLA 3RANA 1TL7C 1ZAKA 2GZAA 1P3JA 1JALA 1N5JA 4HZUB 2Z6VA 1E9EA 2ZUBA 3KZ1E 4R9UC 4RZ2A 1W2HA 521PA 4MYUA 3V4FA 4RKFA 2KWIA 3IHLA 1OIWA 4C3ZA 2V7QD 1G4AE 3BGWA 1T8UA 3TSOA 4DCNA 3TVTA 3R9XA 3SFZA 4B47A 2G1JA 4LJ7A 4B6FA 4LUCA 1SHZA 3SN6A 2FGKA 2JLRA 3QIAA 1IONA 3SYLA 3ZD6A 4R2HA 1J90A 1MO6A 1XPOA 1WBBA 2JDID 3U7FB 2VSFA 2QY9A 1KNQA 1WXQA 2B7CA 2EFEB 3FDIA 3AKCA 2JLYA 3LW7A 3U3MA 2IXFA 3SFVA 4B2PA 3SJAA 2WJGA 5D3MA 1G18A 2FF7A 3LWNA 4Q4HB 5AUNB 4Q01A 1DG3A 2UVQA 3W34A 3TGPA 3KQHA 2YVUA 2V9PA 4M1MA 3VHLB 4MRRA 1UKZA 2GDJA 4PO1A 4D2IA 1Q3HA 5FOUA 2OFOA 4G5QA 1HV8A 4OHVA 2LCFA 4PC3A 1AA9A 3NC0C 4X8MA 1EX7A 2KBFA 3A4NA 2O5VA 3NIBA 5EP3A 4C2UA 4LYJA 1NBMD 1ZM3A 4IHQA 2P67A 1R8SA 5FTNA 2F3RA 2VP0A 4OK5A 1LV7A 3W5JA 4M53A 4RZXA 3IO5A 3HYRA 4CEIA 2VP6A 3SOPA 5BN5A 1S3GA 1XNJA 4PHGA 3BWDD 5EXSA 2ZSEA 4WOPA 3CONA 3EPHA 4OI2A 2ATXA 1BO6A 2P0EA 1Z28A 3RVBA 4H9GA 1Z0FA 8OHMA 2NMVA 2B8TA 4HDOB 2QROA 3K0FB 2ZRIA 4Q4AB 3U61B 3Q9LA 5TY0A 5ANRB 5JEEA 2AX4A 5FH9A 1SVMA 3I61A 4MGIR 2UKDA 3ZDQA 3OFNA 3CRMA 2JASA 3GFTA 3T5GA 3EZ2A 1ZD1A 3MLEA 2J5XA 2ODWA 1WB9A 3I8SA 3WRXC 2GJ9A 1R5OA 1XDBA 1CJVC 1WE2A 1G21E 3C4JA 4NTZA 5B2ZA 2IL1A 4NH0A 4MGYR 4G01B 2IX3A 2WJVA 3RAPR 1N0UA 2DY1A 3PQCA 1G6OA 2CHGA 4B3DA 1Q44A 2ZU6A 2DFKB 4PPGA 3U7HB 1T5LA 3ICEA 2O8DA 1P2VA 2H92A 2R44A 3IQXA 2G88A 3GJ8A 3ZQ6A 1OH7A 2JLUA 4C0JA 2WVJA 4XWAA 4DIDA 1KZGB 1LNZA 1NN5A 2REXB 1XCMA 4PPQA 3IPXA 3LRPA 5JS7A 1FX0B 4M0LA 3HR8A 4A9AA 2FGJA 2ORWA 1G9XA 1RVDA 3OIUA 4PHFA 4A0FA 2WWWA 2CCGA 2QMHA 2RGNA 3GJ3A 1KY3A 1X8LA 3B5JA 3NBZC 4MUBA 4QBFA 2XXAA 4JVMA 1DVRA 3ZJYA 4KVGA 4PHTA 4A2WA 3QXXA 4LOAA 1U8ZA 2OT3B 3QKRB 5SZKB 2RGAA 4QM7A 2ZIAA 1JI0A 3UG6A 2BMEA 2GEUA 1Q12A 3VKWA 3TK1A 4A0RA 4WXPA 3GLFB 4Q4JB 1UADA 1N6HA 1MR3F 3PR1A 1N6RA 4R71A 2P65A 1EFUA 1QF9A 2RMKA 2Q0HA 4JVLA 3CWZA 3UXMA 2W6JA 2A9KA 2ZI7A 2ZANA 2ZREA 5SZJA 1P2UA 2QPAA 1ODFA 1OXSC 1G4UR 2BV3A 3HU3A 1EFRA 4M1WA 1ZNXA 5KDDA 2BJWA 4JSYA 2QTHA 2FSHA 2R2AA 1ZM4A 4DC9A 4V0LA 1GDDA 2C5LA 5EE1A 5A4JA 5JJKA 1VKJA 1W36C 4D0LB 2CLCX 1OLOA 5L8VA 3VR6A 2Q6TA 1G5TA 4GL2A 4QFMA 5LBIA 5TDHA 1OPXA 3Q3JB 2QPOA 3U44B 2CHVA 4TL7A 4DIEA 1KI7A 2W6IA 3ZVRA 3SHFA 1RRGA 4IVRA 1JQJC 4F7WA 3A6PC 3BORA 2FSFA 3RWMB 1P75A 4F38A 2EYUA 3C16C 4LY6A 4DEXA 2BBOA 3BB3A 4OI4A 3B9PA 2IC5A 4IDOA 2WKRA 1HURA 2QP9X 3QQ5A 1NLFA 2QORA 4JL6A 4US2R 2FEMA 4C0SA 2CJWB 1XTSA 2AK2A 2Z4RA 4PZZA 4Z8XA 3CRVA 4GT1A 1X1SA 4P0TA 3WP0A 1XWIA 2RHMA 2ZROA 3ETLA 3BH7A 4Z51A 2JLZA 1G8FA 3PUZA 4TYPA 4ACAA 2AKYA 3AVXA 5B64A 1TU3A 1EX6A 3B8HA 3DOEA 2OSBA 3CNNA 3TUJC 4IEEA 4QGAA 4KBGA 4HUQA 3CZQA 2WKQA 2QP4A 1U94A 3ZIAA 1OB5A 4A8JB 2MSCB 2O52A 3AVYA 5KSPA 4NKRA 4DDUA 1ZINA 3SHWA 5J47A 3CPHA 4YONB 4C2TA 4YLGA 2GA8A 1Q0UA 2EFCB 1NY6A 4F92B 4GBMA 1CLUA 1Z6YA 1P6XA 1VCIA 3I4LA 3TNFA 1BKDR 2IF2A 4CW7A 3AP3A 3KUCA 1DOAA 1N0VC 5HE9A 4Q1CA 1MO5A 2OAP1 2YWFA 3WYFA 4Q1FA 5KSOA 1E3MA 2VRWA 4FMCB 3THYB 3K70B 4NU0A 1FMLA 2VP4A 2RH5A 4Q02A 5EE0A 1ZD9A 2W2TA 4ERNA 4DSTA 5F98A 5KU1A 4JJKA 1NKTA 1CKEA 2BOVA 2G83A 3CO5A 3ADDA 4KJZA 3R8FA 2AKAB 1BYUA 4LHYA 3LW8A 3NG1A 5FI1B 3GP8A 1DTSA 4IRUB 3SDZA 1G7CA 4HI0E 4MGZR 1SXJA 1A2KC 2YC4C 4GDFA 2OXRA 2L0XA 2GF9A 4KYUA 1JB1A 1XFAA 3K0CA 4KCGA 4PO8A 4QJ3A 1PV4A 1COWD 1G3QA 1BMFD 3ZVLA 5HR5A 4TZ0A 2A5JA 1P2TA 4BZQA 2F1JA 1XTRA 2ZE7A 4KU4A 2NQ2C 2ZJYA 2B92A 4UNNA 3WNBA 2ZVQX 4K46A 5JMTA 5EP2A 1NG1A 1II0A 2IHYA 1E9FA 4DT1B 4NONA 2OBLA 4K8OA 2IYUA 5HKKA 1YVDA 1U9IA 1I4TD 3QKUA 3IIJA 1Z0DA 2WJYA 5KSZA 4PZYA 5J4YA 3MJHA 3JVUA 4V0OA 3G5UA 2WWXA 2OLKA 3L0OA 4IOKA 3THXB 1FQJA 3GPLA 1S1CA 2PLFA 4RD3A 1U98A 2QSZA 2VYFA 4YC7A 4HYYA 3K0AA 4QM6A 2FPKA 2GBLA 4BLRA 1Q20A 3GJ5A 1GILA 5JCZA 3C7KA 4TMWA 1CIPA 3EZ9A 2GKSA 2IBMA 3KL4A 4ZDWA 1XMVA 2P6RA 1Z0KA 1IN4A 3HP1A 4KXFB 4M1OA 2GTPA 2YKGA 5BQ5A 2OCAA 5AUQA 2FZLA 4K81B 3WHLA 4CVNA 4XTRA 1Z29A 5EXPA 4IW3B 3EXAA 2WPDD 4ZDJA 3Q7QA 2A5DA 2D7CA 2IYYA 1E2JA 3C5CA 1TU4A 2F43A 4HB4A 5JCPA 1A7JA 3DM9B 3OEED 3OAAD 4RD6A 1UEIA 4OHWA 4D6PA 3K9HA 5FPHA 3AP2A 3CRQA 2ATVA 4KODA 1AIPA 4EQ6B 3B1VA 2XTNA 1XEWX 4DKXA 4TN1A 3V4RA 2AXNA 3BB4A 2CE2X 4TTRA 2KSQA 4LJ5A 1M74A 1DAMA 2P6NA 3B9QA 2ZITA 6Q21A 1G8HA 4FD2A 4HB0A 4W9MC 2J45A 3KKOA 1G3IA 1S3SA 3KQUA 2IEZA 4IJMA 2JDIA 2R6DA 3FYHA 4IXNA 2OCPA 5JSZB 4RVCA 5BN3A 2QRZA 2CNWD 3L0PA 2VBCA 4CRWB 1M1YE 4FINA 4G0NA 4PO9A 1RC8A 4U00A 1CU1A 1G3MA 1NI3A 1UM8A 4ARZA 3AM1A 5BXQC 5FOWA 3B82A 1MO3A 2ZM5A 3ZLJA 3CR8A 1MOZA 1XD2A 1YU9A 5GJVC 1YZUA 2IS1A 5J4LA 1FZQA 1EXMA 2JIZD 1JJ7A 4QBIA 4QRHA 1G7SA 3V00A 1CTQA 1E2EA 2XNSA 4GFDA 1NBMA 1KKMA 4HDCA 2QAGA 4TQ9A 4QXAA 1IY2A 3HPRA 3TAUA 1YQTA 2ZJZA 3MCAA 4NCIA 3W90A 3UMSA 1R0WA 3ZS8A 1YE8A 2FFAA 5FTJA 3AVVA 3REGA 2FPMA 4RD0A 5EUQB 1IM2A 1GNQA 3LBIA 1AM4D 1IJFA 2ZS7A 4AIIA 3JVVA 1IXZA 4YMVA 4OKSA 3KKPA 3U60B 2PBRA 3O8CA 2IS2A 1WQ1R 3KJGA 2E1RA 1EG7A 2F9LA 1T6NA 4W7SA 3Q72A 5KNCA 4NP6A 4B34A 3LBHA 1K6MA 2RGCA 3CB4A 1A82A 1J99A 1AGRA 1PVOA 1XTIA 4CYMA 2NTYC 4EAQA 4IDNA 2X77A 1VG1A 3QPVA 2R9VA 4DCUA 4PZLA 3CWQA 2OO7A 3TRFA 4KITB 3WNCA 4J0QA 2C2HA 1KI2A 5JBQA 2CL7X 5D3MB 1M7HA 1DS6A 3TW8B 1R5NA 4QHTA 5LB4A 1KO5A 1OKKD 3N2IA 3PCRB 4KLZA 3IBYA 4D81A 2CK3D 5ELXA 1I4LD 2W0MA 2QRNA 4JLKA 3CUEF 1T3LA 4GOJA 4Q9LA 1CS4C 1Q1QA 4XWOA 1UFQA 2HT1A 1GM5A 2VQSA 5KSYA 2ZS8A 2WMOB 3M4YA 4MKHA 1Z07A 1OH6A 2O0KA 1XB2A 2ZRMA 1E2DA 1FL9A 1OIVA 2FSGA 1F2UA 1VCMA 4A8JC 4CEIB 2NGRA 4P33A 1PUIA 4Y0AA 3U3JA 2BDTA 4JSTA 3ZS9A 4QOSA 5AUPB 1KHTA 5J5CA 4DWJA 1R10A 1W5SA 3LLMA 4IDPA 4OK3A 1GIAA 5SZHB 1JECA 1TQ4A 4DEYA 1G5RA 3FMFA 3CX8A 5JJLA 4Z1MD 2ZR0A 1ZRHA 4JT4A 3TVDA 4HUTA 1XPUA 1AZTA 2ZPTX 1WA5A 5M04A 1NP6A 4QNMA 5EE3A 1HQCA 1QHSA 4NCNA 5JWOA 2W6ID 2H5EA 4JT2A 3DOFA 3QJYA 3K70C 2C98A 3QXSA 1N3BA 5HE8A 4ZKDA 1ZUIA 2O8FA 3G82C 3LQQA 2BM0A 5AUOB 1GNRA 4BLTA 3S1AA 1QHYA 4DLXA 2ZTSA 2ZRCA 4GRAA 5K8LA 5KTYA 3NHBA 1G3RA 4EJSA 1PZNA 5IRCD 1VMAA 2WMNB 3R8CA 4MQBA 1OIXA 3A1TA 2OE2A 2CDNA 4G3XA 5EZ6B 3LV8A 4LZZA 2O8DB 4TQAA 1TEXA 4ZCIA 2O8CA 2GEVA 2XZOA 3RSOA 4URWR 1U0HC 3NH6A 4HLCA 1H8HD 3B60A 4JVNA 2N1BA 1IAQA 3H4MA 5L3RA 1E0AA 3CH5A 2EWWA 4URYR 1RJ9A 1FP6A 3B1YA 2BMDA 1X8KA 4A0GA 1X3SA 2VH5R 2XXAB 1UKVY 1IN8A 2GJKA 2GEDA 2NPIA 2REOA 2ZRAA 5EJEA 3PUYA 1XMSA 5EE9A 2D7DA 2CCKA 1DAGA 1TAGA 1N25A 3U6KA 4BGDA 4Q7KA 3UWKA 2C95A 5E4FA 4IDQA 3MG9A 3FHTA 1XZPA 3B1XA 3CNOA 1YZTA 1VYUA 2ZRGA 3SNHA 4LJ9A 5HCIA 5JLJA 2WHXA 2QEQA 1DARA 2JAQA 2W83A 2OXCA 4D4KA 1CR1A 1E6CA 1MKYA 2DWOA 2X1VA 4PANA 1MABB 2VP9A 2MSDB 5KOYA 1NVXQ 2ZI9A 4NMMA 4BFSA 2O8BA 1KDOA 1Z47A 2ONKA 2ZUCA 3MAAC 3MWLA 4O25A 3DDCA 1N6IA 2WOJA 3U5ZB 4YMWA 3VNVA 1TEVA 3AVPA 2BVNA 2WWGA 3P4YA 4ABYA 4EUNA 4Q7MB 4KFTA 3TR0A 1N6PA 2QMUA 4MYTA 1CR2A 3BB1A 3GJ7A 1S2MA 2H16A 3TUIC 3A36A 1DELA 1VPLA 2X2EA 3KJIA 3SC3A 4HAZA 4BE7B 2KE5A 4G5RA 4OI1A 4EKDA 4S35A 5L3SA 1N5LA 2ZU0C 4BUJA 1S8FA 3U3OA 4KBFA 1Z63A 4B76A 4L16A 1W0JD 2ZAMA 2IXGA 1E0SA 3FGNA 1OXXK 2V4ZA 4LBWA 4AYTA 1E0JA 3J81k 5FL7D 1ZM9A 2GXAA 2BEKA 3TW4A 1U99A 3ND8A 1GWNA 1T3SA 2ZJBA 4D82A 2YWEA 1E2PA 1D2EA 2C04A 2A78A 1YR8A 1P4SA 4MH0R 3KQKA 1O3YA 1COWA 4RD2A 1BMFA 2CHQA 1L4YA 4DJTA 4ON9A 1W7AA 4GZLA 4DVGA 5F3WB 5SZIA 1Z0AA 4HUQB 4PC2A 4JLOA 1TQDA 4JBWA 4HAUA 1SKYE 1GSIA 4RFVA 1DO0A 1LS1A 5FL3A 1Z08A 3GEIA 4HDQB 4JJZA 2ZQ5A 1E2HA 2JEOA 4L8GA 1ZCBA 5KYKA 2MMGA 4YDHB 2JCSA 2I4IA 2QGZA 2V55B 3SU8A 3IIKA 1V43A 1ANKA 4A0HA 1E32A 4LPKA 4MKFA 5K8UA 1KJZA 4I1SA 1JEEA 2ZSFA 3PITA 5DN6D 3PEVA 1E94E 4BLPA 3QEJA 4BFZA 2BMJA 4G5OA 4LJAA 3R9IA 2EU8A 2G1KA 4ZCMA 1Z8FA 4I1VA 3VFDA 5JECA 5FUWA 2ZE5A 1ZUNB 2PMDA 4YQFA 1JAIA 2J7KA 3T12A 1X1RA 1E0KA 3KUDA 4A6XA 1XXHA 4TLCA 3EWAA 5G40A 3QXHA 2G3YA 1ZC3A 2FX3A 4II7A 5CDFA 3EIEA 4MYHA 2OEPA 2FU5C 1XD9A 1ZW6A 2ZR7A 3EZ6A 2WPDA 4C0AC 3QY0A 4PC7A 1SXJB 3LAWA 2ODNA 1GNPA 3GLGA 5CIQA 4QGGA 3OAAA 3OEEA 3AQ4A 2RGGA 4XSHA 1FTSA 3GQBA 5J4HA 4HAVA 1UBFA 1DAIA 1W48A 1J2JA 1TUEA 3X1ZA 5FTMA 3TH5A 2CMKA 1YZKA 4G5GA 4PQFA 1L4UA 3T1QA 3QENA 3PENA 4TMVA 1PLKA 1S0UA 1KO7A 4LJ4A 3EPLA 2ORIA 1ZM7A 4F4IA 1XJ0A 2QG6A 2YV5A 1EWRA 5H68A 5F9FA 3EX7C 2XTMA 3GLIE 4OHXA 3LBNA 1XPRA 4DHEA 5JWRA 4P32A 1F6BA 2VSXA 2XB4A 4LI0A 2GJ8A 4NZYA 2QGNA 2ZI6A 2CNWA 1X8JA 3K0AB 3WMGA 4C4PA 3ZH9B 1AQYA 2D62A 3W6NA 4KLNA 4B74A 4W5JA 4Q9KA 1HE1C 4TYNA 4TTPA 3D3QA 4N0DA 1ZMXA 1R8QA 5BW8A 1GVNB 1YZLA 2B6HA 2X19A 1KAGA 1KI4A 1SGWA 3LO5A 3VAAA 3ZZ0A 1A5TA 1U8AA 2JIZA 1HA3A 3GEHA 5B57C 4LK2A 3ZD7A 3RDPA 5DHFA 1KZ7B 4D4LA 4BLOA 4JLVA 5FFMA 4XD7D 1F3OA 4CEJA 2FEOA 4OQMA 4U7DA 3GLHA 2F43B 2FV8A 1T0HB 3BC1A 1WDTA 4NCHA 1R0XA 4UNSA 4DZZA 2GK6A 2B21A 3FHOA 3T1OA 1KTVA 2QT1A 3T61A 2FH5B 3U3RA 2IYVA 3SQXA 3BE4A 2C03A 5D3QA 2QA5A 2VL7A 5JI2E 5JFGA 2I1VB 2I3BA 2PZGA 4D4JA 3T5DA 4ZDKA 4TYWA 2J41A 3BFVA 2A30A 3VX3A 4W5HA 3QSYA 3IIMA 1RPZA 1F2TA 1NJGA 4B35A 4EPRA 1Z6TA 3ZQJA 2F1IA 2ZI5A 4GI7A 2RGNC 3KTAA 2YINC 5FBRB 5G3ZA 3REFA 1G19A 4FMBB 4ARZB 1AGPA 5LPNA 1E1QD 1G7RA 4B48A 2O0JA 1OKKA 3EW9A 2YOHA 3ASYA 4IOLA 2CK3A 2AWOA 1NL3A 1XD2B 1HT1E 2OUKA 1KI9A 2QMOA 3PUXA 2BBTA 3X1WA 4G5SA 2BC9A 2B8WA 4E09A 1I2DA 3CR7A 1YJ5A 2A5YB 3D31A 2WJHA 1RW4A 2EYQA 4LWZA 3NXSA 1KY2A 4PC6A 2E9SA 3PJRA 2QT0A 4JLAA 2JLWA 3NC1C 1N6KA 3X1DA 4HLDA 4C0KA 5TXGA 1PJRA 3QG5A 1WBDA 2V3CC 3KX2A 2GESA 3MWYW 3N5CA 4URUR 4AYWA 2J0QA 3AV0B 4JKIA 4F93B 4AKIA 3ZYCA 2J0UA 3AKDA 1GFIA 2ZE6A 3AF4A 1VYTA 1GRRA 2AN9A 1XTJA 1U8YA 4DCTA 1E2QA 4RD4A 3EZ7A 4WIAA 3K53A 4EFMA 4F4CA 5IHPA 1TPZA 4OQFA 1IN5A 3U7EB 4Z1MA 1NRJB 1AN0A 2J9RA 3QXCA 5FBLB 3AVQA 1NIPA 3QPUA 3LVQE 4OHZA 3B13B 4AG5A 2GRJA 2ZE8A 1D2MA 2RKOA 4C9BA 5CYOA 1GG2A 4XVRA 3U4QA 1ZCAA 2ANCA 4AWXA 1VDZA 1M34E 3P4XA 2PX0A 3SZRA 5CITA 1CRPA 821PA 2FJUA 3MD0A 1VCOA 1GKYA 1ONBA 4WA7A 4YMSA 2JLXA 3EAQA 5FR2A 1XX6A 3I5YA 2ZSBA 1N0WA 1ZIOA 5E7IA 3UKDA 3RC3A 1CXZA 2DR3A 3K9NA 2PCLA 4XIGS 3W8NA 2XZLA 5FOXA 4AG6A 1P7CA 3SEAA 4IVPA 3GFPA 3TE6A 5DLQC 2YC2C 3Q7PA 4QG7A 2HYDA 1H8HA 2D06A 3G0HA 4QC2A 5DI3A 1NIJA 1TADA 4PR0A 1NVVQ 2XNDD 5KDOA 1N2CE 1W2GA 4Z54A 4BECA 2DFLA 1IN7A 2NIPA 1AS2A 3I5XA 2J1LA 2Q9AA 4KHZA 4OBEA 4US0R 1PLJA 3RS4A 3EC2A 1TX4B 4IFEA 3EZFA 3PVSA 1E2IA 1E99A 3RS7A 3K9GA 4Q21A 2XJ9A 1U2RA 4PPNA 2WAXA 2R65A 3WY9A 4LC0A 5CJ2A 2X2FA 4GP6A 2O8FB 3SYNA 1G8YA 1IXRC 4UNQA 3O8DA 3S1AB 1W49A 4ZO4A 5DI9A 4B3FX 1EFHA 1VHLA 4WBSA 5JHHB 4HZIA 3KFXA 3GLFE 1AKEA 1N6LA 2Y8EA 3W9YA 1SXJC 4ZDIA 3K0EA 3CPEA 3AF3A 3K0CC 4IDHA 3QEOA 1MRSA 1S9HA 3KXLA 2O0HA 3QF4A 4Q7JB 721PA 1E2LA 4LYAA 3EPJA 5FOVA 2O8CB 2PZFA 3O8BA 1SVIA 2ASEA 4GPTA 1KNXA 221PA 3F3YA 3PUWA 5GJWC 4KSCA 3AUXA 1U9IC 5IF9A 3QKSB 3TQCA 1RJ9B 2IT1A 3NDPA 4JL8A 2ZRJA 5CLLA 1OH5A 5BYKA 2H57A 4Q00A 3WMEA 4CT4B 2IYLD 5DHAA 1W0JA 4OL0A 2WZQA 4JZKA 1WF3A 2AD5A 4PSKA 2J0VA 4BEJA 1ZD8A 1P9RA 5E7MA 1QVRA 3SBDA 4P4TA 5FL7A 2GBLC 2CVHA 1E2MA 4E03A 2BKUA 2A5FA 4ZI2A 4EPWA 2O8EA 5FTLA 1Y63A 4XOIA 1OYYA 1A4RA 4RSGA 4Y0VA 4L15A 5DE3A 3VKHA 5DIFA 2QI9C 4TLAA 1YHNA 5GJBA 2KJQA 3B1WA 2FFBA 2XOKD 5H70A 2O8BB 1K8RA 2H18A 1FPMA 1GKIA 3GJ4A 1G16A 3BBPA 1AKYA 1JPJA 4PHHA 2YNMA 1QHHA 3BD9A 1Z3IX 2PJZA 2AL7A 5J40A 4FCTA 4BEBA 2AFIE 1R0ZA 2GAAA 1M6NA 2ZI3A 3E70C 1SZPA 5DN6A 1KAOA 5FBQB 3A8TA 4M1TA 4ZPXA 5C46F 3CRW1 4DLSA 5B58C 5E7JA 3IEUA 5FOTA 3GJXC 5AJZA 4BQSA 2FE4A 3QOFA 2C96A 1T91A 2HXSA 4HLUA 4LDJA 5L3SB 2RGEA 4M9ZA 3CNLA 4NYIQ 1AK2A 1RRPA 2ZRBA 2Z5FA 3DMDA 4TL9A 5DISB 5TMPA 1XMIA 3SQWA 3QBTA 4AKGA 4I81A 3BOSA 4ZIRA 4Q03A 3RYTC 2FFQA 1OV4A 1UF9A 3CM0A 2WICA 2QUZA 1GUAA 4TZ6A 1GAJA 1WP9A 3E5HA 4DLZA 3FMOB 4XJXA 1D9ZA 1XEFA 2BCJQ 3LDAA 4LBVA 2Q9BA 2VP5A 3IBGA 1XU4A 4V0ME 4NYIR 1E2NA 2ZRNA 1E2KA 2NG1A 3NTUA 2FG5A 4DUGD 2ODEA 1CEEA 1CR0A 2DB3A 3A4MA 4X8OA 1JXMA 3TSZA 1NN1A 2AFHE 3L0SA 4KFSA 2K5UA 4BLQA 3VU9A 2V6JA 1KI6A 4TLBA 2PCJA 4P4UA 2QAGC 1NMZA 2Q3HA 3AVOA 3UPUA 5DYIA 2XAUA 4FCVA 2J7PD 4UQOA 3T1VA 1CR4A 3FMIA 3B78A 1II9A 4FCWA 3CPJB 2NZJA 4ZCLA 1T9HA 2ZRLA 2WWYA 2QP3A 4UJ3A 2QSYA 5P21A 5FBVB 1VYVA 2PLRA 1NLYA 2DYKA 4LV8B 3R20A 4TYYA 5A5GA 3QNUA 2PMKA 4LBZA 1T3HA 2GZHA 1IOZA 1LY1A 2P6UA 4EDHA 4D26A 2BMFA 4UXJA 3HR7A 2AR7A 1NF3A 4TMZA 4B33A 5KO2A 3C15C 2Q21A 4KYIB 2WWIA 4A36A 4CT5A 2ZVPX 1J7KA 2GCNA 3WHKA 4FMDF 2OESA 5JRJA 2HDNB 1XXHB 2NO1A 1OXTA 2QL6A 4OQXA 1IQPA 4D80A 4JLBA 2FNAA 5C1BA 3LA6A 3EG5A 1KJWA 3LVRE 4XD7A 1ZNYA 2OG2A 1LTQA 4RCZA 1XMJA 2AXPA 1ZU4A 3A1SA 3IO3A 2JJ2D 4BPBA 1Q1BA 2NO9A 1K5DA 3GLGB 1QHIA 1E79D 4EPXA 1ZIPA 3EIHA 4XTCS 2GNOA 1DAKA 4Q19A 4NBSA 1JR6A 3DKPA 4LJ6A 2BBSA 1GKUB 4PAMA 4QJ5A 3QVVA 2JJ1D 3OE7D 5L3VA 4CF7A 3CF6R 1R7RA 1ZYUA 2WJIA 1E9CA 4FW9A 2QAJA 4XVUA 3X1XA 3DL0A 1S9DA 2CLSA 3FTQA 3QG1A 2HCBA 4IXMA 1KSHA 1MH1A 2OV2A 1BIFA 1Z83A 2BWJA 2C9CA 5A0FA 3ZZUA 1KI1A 2CL0X 4JVSB 5LD2B 4Q66C 3P32A 3HDTA 2IUTA 5EZ5A 2J3EA 2RAPA 4R98A 3TAHA 1E1QA 4DDVA 2HV8A 3O8RA 5G41A 4B6EA 1E1RD 1Z5ZA 3AEZA 4KVAA 2IW3A 3E1SA 3K0SA 4NCKA 1Z22A 1P5ZB 1FQKA 4PAQA 1RE0A 3SJBA 5FTKA 4Q1EA 5H1YA 4KAXA 3CW2A 1DBSA 1P2SA 4OJQA 3EA5A 1BH2A 1G291 1XEWY 1JR3E 2CBZA 2CCJA 4HAXA 4N3NA 5FI0B 4CEJB 1NVWQ 5CM8B 4F4JA 3GLHB 4BWYA 4BZPA 3VX4A 2IA5A 1JJVA 3UMFA 5BN4A 4RKEA 3RWOA 3EWSA 3IHWA 4BFWA 4EJSC 2VF8A 1L8QA 3B7GA 4EPVA 2R6FA 3C8UA 4FXPA 3WBKA 3IUYA 4L9SA 3GEEA 3K09A 4B71A 1XEXA 1XTKA 4MDEA 1FMJA 3F5FA 3V9PA 4QGFA 1JBKA 2R6AA 3DKVA 1OHHD 1FUKA 1YR7A 2Q3MA 1Q1ZA 3A4LA 1F2TB 5C4GB 1ZVQA 2ZUDA 2OCBA 2ECKA 1W36D 1KI3A 2BBWA 3KTAB 4US1R 5EP4A 1RRCA 4AKHA 2ANBA 4YMTA 3AP1A 4O2RA 1NY5A 1R0YA 1SVOA 1KK1A 3OZXA 3SBEA 1KIMA 5FUVA 4O0MA 4LJ8A 4OJKA 4BRWA 1OE0A 2EFHB 3VNUA 2BJVA 3PUVA 3PXGA 4LYHA 5LB2A 4U5XA 4Q9IA 1CRQA 3Q8XB 4Q9JA 1G3UA 4BFTA 3I72A 2GF0A 5EQTA 3T34A 1IHUA 2PZEA 3L43A 4LBYA 1T0JB 2P5SA 3CX7A 1LF5A 121PA 1IJEA 1DPFA 3RSLA 4DCSA 3DEFA 1H8ED 2FA9A 3GJ6A 2XNDA 5FOSA 3PV0A 3PEYA 2J0UB 1TUIA 2PT7A 3SE0A 4H1UA 5J4KA 2V1UA 1G7TA 2C9OA 4M1SA 1KMHA 1DE0A 2YJTD 4M9SA 4LHXA 3GMTA 4V03A 2ZAOA 1IN6A 2ZSAA 3OEHD 4TT3D 4A82A 1B23P 3BIFA 1X6VA 4LCBA 1YRAA 2P2LA 3PG5A 4UNPA 2FFHA 1G8PA 3KB1A 4TMXA 2QZ4A 1JAHA 1S1MA 3TR5A 2WM9B 5CLQA 1G17A 1TF5A 4QL3A 2W2XA 3H2YA 3U4QB 1NLZA 1IBRA 1MRNA 1VECA 1YZGA 1KSFX 2SHKA 1KK3A 4GOXA 4TL6A 4O3MA 4DB2A 2VHJA 1N6NA 2WKPA 3RRYA 3W3ZB 3O47A 5KNBA 3W3AA 3CZPA 5EE5B 4WZ6A 2ERXA 1CJKC 4DLVA 3QE0A 1ESMA 4ZKEA 4XVQA 3I1FA 4JLPA 2QBYA 1ZJ6A 3C14C 1ELOA 3Q5EA 5JZVA 2PL3A 1NN0A 4WXRA 5EXTA 4C0QC 1T8TA 3CH4B 4ITRC 4D0GA 2OLJA 2W0SA 4A2QA 2QQEA 1LVGA 2F1RA 3EPKA 3Q5DA 4DLUA 3IDQA 1HEIA 4PFSA 5DI3B 3WBJA 2Q9CA 4PSVA 3ZVMA 4DSOA 3F8TA 2WOOA 4I1OA 3LFUA 1VG0B 1R6BX 2ZRHA 2EW1A 5IT5A 1ZM2A 3EASA 4Z8YA 1KK0A 2ZYVX 2H17A 1RIFA 1OXVA 1ESNA 4C30A 4P3YA 2WIBA 3L8YA 1YRBA 4ZI3A 1NJFA 1E9SA 4JKYA 5L3QA 3K9LA 5EXXA 3RS0A 5JSZA 1FFHA 2R6GA 2XTZA 4L5BA 3QVUA 4D25A 3ECCA 3WYGA 4B3GA 5KHOC 3C5HA 1KDPA 2HCJB 5AJVB 5AJXA 2FPLA 4C0BA 3KFVA 1SVWA 5GADl 3UANA 4I4LA 4OHYA 5HZHA 3R7WA 5K8IA 2HLDD 2DWPA 2C99A 3WXMA 1EFCA 1KO8A 2WWHA 2A7QA 2XOKA 5FUXA 3LH5A 1KJYA 2EWVA 4IFBA 1PUJA 4DLTA 4AI6A 3QUSA 5AJYA 1UBCA 3DHWC 1NSTA 4OK6A 1E96A 4LPSA 2WWFA 3QF4B 3TQFA 1DAHA 1LFDB 4PXAA 1ETUA 1HH4A 2F3TA 4N0EA 3VR1A 1E4VA 1EGAA 1Z06A 2N42A 3KKMA 2D2EA 4AKEA 3LNCA 1OH8A 5JJIA 4CEHA 2Q3FA 4RD1A 3MWKA 4OI0A 2CLDX 4JS0A 1J8YF 1OB2A 3SI7A 1RYFA 1XRJA 4UKDA 3BS4A 3ICQB 4BFVA 1CP2A 4JLMA 1KDTA 3TIFA 2ZI4A 4C7OA 1XP8A 1XTQA 1GL7A 1QG4A 3AGQA 5LD2C 3RRNA 3CX6A 4QHYA 1FOEB 2G0NA 1OFIA 2PH1A 3CF0A 1HUQA 3A1UA 3I32A 3THWA 3B6EA 1W46A 4IOMA 3L2OB 2R62A 2NO0A 1XBTA 4U02A 5GVRA 3PEWA 4URZR 3HWSA 4UJ5A 3RLFA 5IK2D 4LHVA 2O8EB 3KXIA 2F1HA 421PA 4DUGA 2GZDA 4DDWA 4FIDA 5CB6A 4AYXA 1ZUHA 1G41A 1P9WA 2QE7D 2W2VA 4JLNA 2YWGA 1U81A 2GJAA 2HJVA 5FUYA 4POAA 4A92A 2J7PA 3LQRA 3QBVA 3T06B 4TLDA 3RNLA 1EK0A 3VR2A 1QHHB 4NDZA 3ZZTA 5G53C 3DPUA 2UZIR 4CIDA 1M7BA 1BOFA 3UATA 1KSJA 3VR3A 4A1FA 2ZXUA 5F9HA 5KDLA 1W0KD 4LX0A 5E95A 4B3XA 3AVUA 3FFBA 5AJWA 3RHFA 3NEJA 4PQYA 1Q57A 2ODBA 5FPYA 4UXIA 4XSGA 1ZBDA 4WW0A 1IXSB 2VEDA 1P61B 1US8A 4V0NA 1Q21A 3DVLA 3P26A 3FKSD 1ZU5A 2V8OA 4NYJQ 4BLSA 4ZIRB 2YZ2A 4EFLA 3FMPB 2WTUA 1D5CA 4I1UA 5C2JB 3FHCB 1NMXA 2XX3A 3K8YA 2E87A 3ADBA 3RS3A 4PX9A 5LDDC 4ASUD 1GRQA 2D4HA 2JJ2A 1ZNZA 1OXUA 2P5TB 3DO6A 3GJ0A 3PFIA 4M8NE 4MRNA 4TQUS 5B30A 4Q9HA 5CK5A 4B2IA 4RFSA 1HT2E 3FE2A 3X1YA 1E79A 2NOAA 3W8RA 1QHNA 1RFLA 4O2LA 2DCUA 2PEYA 4NYJR 3CLVA 5AR1A 2X8AA 3CKLA 3L8ZA 3VU9B 3EA0A 1KI6B 3AF2A 3B2EA 3LX5A 2JJ1A 3OE7A 3HYTA 1LW7A 2VA8A 5DH9A 4ACBA 4MKIA 2JGNA 3JZMA 1TF2A 3AB3A 2IWHA 1GL9B 4QJ4A 1SXJE 1GTVA 2ZEJA 5JI3E 2ORVA 3VR4A 1Z2AA 3AVWA 5CJPA 1SULA 2GXSA 2GCOA 2QAGB 4M2LA 4TTQA 3TJZA 4D0NA 1UJ2A 2UZ3A 3A1WA 3AKYA 3ND9A 1AS0A 2BEJA 3D6TB 4S2EA 3F0TA 4JLDA 3UG7A 4JYCA 1E1RA 1JEDA 2P3SA 3TBKA 4EPYA 1II8A 4TLEA 2ZJ5A 1IY1A 2OHFA 3B1ZA 2ONJA 4H1VA 3C41J 4M1KA 2DHRA 1VG9B 2CVFA 1R4AA 1UBGA 1VHTA 4GMXA 1A2BA 1W4RA 1QDEA 2MSEB 1XJQA 4FMDB 2EFDB 4XWKA 1NSFA 2A3RA 1AZSC 4JYBA 1TTTA 1AS3A 2ZJAA 1OT3A 3ADKA 2YHSA 1HQYE 3T15A 2HEIA 1XCGB 4IKEA 3K70D 2LKCA 1MABA 3RS5A 4DDTA 4C0LA 4Q5IA 1F5NA 2QTFA 1SVSA 3KQLA 3LXRA 2JLSA 4UXHA 2CL6X 3LXXA 2XSZD 3CIOA 1OHHA 4EIWA 1JXOA 4F91B 5H8WA 2JLQA 2D2FA 3ADCA 2AD1A 3KKQA 3L82B 2HXYA 2VHUA 1YKSA 2ZRKA 1E9AA 4PPFA 1VIYA 3GLIA 4Q18A 4LGMA 4YXWD 1G5PA 2J59A 3MGCA 5E3HA 1F2UB 2RHDA 2G9NA 3RS2A 1E4YA 4FN5A 1CJMA 4HATA 2ERYA 3L0IB 5HCNA 3EARA 3U3KA 2REBA 3CBQA 1D8TA 3NVAA 4QGHA 3PIRA 2EVWX 1JPNA 1SHKA 3BH6A 3NEYA 1QRAA 1TF7A 1V5WA 1L2TA 1EESA 4JMPA 4ESVA 1GRNA 3AF1A 3BRWD 2TMKA 4NCJA 3R9WA 5JRZA 4BASA 3W5IA 1NVVR 4IVQA 2ZRDA 3DZDA 1NMYA 3MWJA 4HAWA 3PEUA 1H8EA 2VTKA 1SVLA 4DLWA 1Z6GA 4G1UC 5KNDA 4QBGB 3VMFA 3HU2A 3RABA 1DAFA 3NBFA 2VHQA 1RYHA 2FSIA 4GNKA 1XEXB 2CEAA 4EJSB 3TSWA 1Q1EA 4GP7A 1NBME 1J70A 3FFAA 1QVAA 3OEHA 1C9KA 4TT3A 2GAOA 5C18A 2IS6A 2F55A 4PQRA 2YOGA 4AC9A 4NYMQ 1K5GA 4B2LA 4EPTA 2WIAA 4P4SA 2GK7A 2IHBA 2GCPA 2MMCA 2XJ4A 2RCNA 4LSGA 1WCV1 5TVKA 2Z43A 4B3BA 4M1YA 4HZUA 4TSFD 2KB0A 4HEJA 2WJJA 1NN3A 3BFXA 1CJTC 2N46A 2OM2A 3RRZA 1BYIA 4TMKA 4QKQA 4URVR 5FBWB 5IDVA 4OQLA 4FWTA 1VTKA 2FWRA 1KMQA 1X86B 4EFNA 2XGJA 2YWHA 1GOTA 1AJEA 4CDGA 1GP2A 3IGFA 1I4DD 4ILEA 4NYMR 2PJRA 3K1JA 2YYZA 3D8BA 4JBXA 3IEVA 1VCNA 2H1LA 3H0KA 3H1TA 2A2ZA 2LWIA 3NWJA 4DB4A 4JIMA 2G0TA 3I8XA 3KXKA 1E9BA 2WSSD 1JR3D 1RZ3A 2ZS9A 4B75A 3X2SA 4LV5B 3H84A 4BZXA 2EQBA 5DSZA 4A15A 2XB2A 2BKEA 4Q4HA 1OFHA 1O87A 5C4MA 4MITA 2PT5A 3BH0A 4R2IA 5GVSA 4AD8A 1QHGA 3VQTA 1CULC 3BK7A 2VLIA 1XJCA 5BYJA 1T5IA 1II8B 2G6BA 2VHCA 2VSOA 3OESA 4DLRA 3NH9A 5CYPA 5AK0A 1D2NA 2HF9A 1KMHB 4KV9A 3B85A 1E69A 1M2OB 1A1VA 4A2PA 1SVKA 1YZNA 4AURA 2CXXA 4DSUA 1ZP6A 4TWZA 1I2MA 4HSEA 4MYCA 1KSGA 1P62B 1OFTA 4OQNA 1W5TA 4HLUC 3FPAA 4ZV4A 2QMEA 4WVFA 3CF2A 3ZGXA 4DBLC 1U90A 4GZMA 2HLDA 2IF0A 1MO4A 1OSNA 3K0FA 2IYZA 3SYKA 4LHWA 4Q4AA 1AQUA 1VIAA 2H7VA 2VPPA 3AUYA 3I92A 5FPSA 2XEXA 2QBYB 1T4GA 1OJLA 1Q22A 1Z2CA 1E9DA 2ZYUX 2C8VA 5FR1A 2AK3A 5G3YA 2GVZC 2GXQA 4IEIA 4PTLA 3W6PA 3TUZC 3A1VA 4GMDA 2G77B 3N2EA 1W47A 2V7QA 5EUMA 3DMNA 1UDXA 5TV2A 5J4VA 3P27A 1VG8A 1XCPA 2C77A 3GD7A 2VP2A 1C4OA 4YDSA 1FW6A 4RY2A 5HPYB 1Z0JA 4LRWA 3GFOA 3QI2A 5AWFC 1DG1G 3NHAA 4PSAA 1R5BA 2JLVA 2FOLA 5GJCA 5DYGA 2HF8A 2V6IA 3OIYA 1TMKA 1Z0IA 3NKVA 3Q85A 5JEDA 4MRSA 5JHGB 3KJHA 4TL8A 5L3QB 4MDFA 4WZAE 1TQ2A 4RZUA 3RC8A 4GOKA 4HLQB 1QZXA 2RB4A 1WRBA 1P9NA 1QHXA 1D6JA 2JJ8A 4Q1DA 1E98A 5IK2A 1N5IA 1FX0A 3NBYC 1W4BA 2BM1A 4B73A 1FNNA 2OBNA 2VF7A 2F6RA 4NL4H 3R7WB 3GCGA 1GL6A 2QM8A 2QE7A 4L9WA 2C9YA 4MRVA 1Z6XA 2FMXA 2HUPA 2IYWA 3WRYC 2BHRA 2IEYA 1OFUX 3QKRA 4CGZA 2IYXA 2C78A 3KJEA 5KPDA 3AH8A 1QG2A 1UKEA 4DSNA 1UDWA 2AWNA 3GLFA 4Q4JA 3OIVA 2QQ0A 1JQLB 2W58A 2NO7A 3OFND 1XF9A 1KK2A 1W0KA 3ZVNA 4LJYA 1UAAA 3SJCA 2KBEA 1OYWA 4OYHA 3VKGA 4ESHA 2PEZA 3IILA 4CEHB 4KFRA 2QNRA 4RZ3A 4Q1BA 3A58B 4Q4LA 5HZKA 2CE7A 2WV9A 4L4UA 3UIEA 3IKJA 3FVQA 4Q1AA 2GVDC 2OFWA 2OILA 2QTVB 3FKQA 3LLUA 3FKSA 3TKLA 4C7OB 4MRPA 3BJIC 2QN6A 4B32A 4URXR 3U44A 1HY3A 3THWB 3M0EA 3SS8A 1UPTA 4Q47A 4TMTA 3U2QA 5TB5A 3LD9A 4NE2A 1EFTA 4M21A 4ASUA 2J0SA 4W5WA 1M8PA 2NZ8A 2OCYC 3KDSE 5FPTA 2IUSA 1KGDA 1KOFA 2GILA 5KUTA 1BS1A 4KSBA 1PLLA 2W00A 3BAFA 4A6PA 1KYIA 3CRRA 3MFYA 3QPWA 2AHOA 1U0LA 4WZBE 1B0UA 2GWHA 3E2IA 4X8LA 2CJWA 2RGXA 1SQ5A 1C1YA 1P72A 3AVTA 4MGKR 3WP1B 1LB1B 4DRZA 1D9XA 1WMSA 2KI5A 2ZYWX 3MRSA 1OW3B 4AY2A 3AGPA 3AKEA 3MUFA 1XZQA 4I99A 4R7ZA 1G1MA 4BFUA 2DPXA 2W6JD 3AF0A 3HU1A 2HJGA 3K09C 2QENA 2DFTA 3QF7A 1P60A 3M6AA 5DO9A 2HT6A 1EFRD 2LKDA 2GXUA 2J46A 4A4DA 2DFNA 2ZETA 1US8B 4A8JA 3P1JA 2IK8A 2J87A 4UNRA 1F48A 1M7GA 1G20E 4PC1A 3SR0A 3MJRA 2IXEA 2XITA 2ZRFA 4V02A 3TMKA 1LS6A 3KKNA 2NO6A 5FPKA 4FI3C 3FB4A 1MT0A 4FMCF 4E5UA 3I3SR 4LV6A 1RKBA 3IQWA 1G8GA 3LX8A 4RFSB 4NHOA 4WAUA 4B43A 3THYA 2DBYA 2B7BA 2EFGA 4V0MA 5F2EA 3TLXA 3VTKA 4MKGA 1S4QA 4JL5A 2I1QA 1DAEA 1YZQA 1XXHE 3FOZA 2WBLC 4B44A 1CF4A 4IOJA 5EP1A 4DCVA 1E2GA 2QPTA 4DXAA 4Q7LA 3FWYA 3ONWA 2WSMA 1ZC4A 3U6BA 3I73A 3NBXX 5CDFE 3SJZA 1SKYB 2XSZA 2ZYTX 1IY0A 1FTNA 4BRUA 1QBKC 5JWHA 2BIFA 2D3WA 1YR6A 3QXJA 3GLGE 4N1AA 4Q48A 3OF5A 2F9MA 3A37A 2GCOB 3KB2A 1R2QA 1S96A 4HAYA 4YXWA 4D4MA 2ZR9A 1DADA 1UEJA 3OHMA 1UBEA 3BERA 2A5GA 1NKSA 3THOA 3QKSA 3WYAA 2RGDA 4KFUA 1TQ6A 2R8RA 2Z0MA 1G6HA 4E07A 4KO8A 4BFYA 4AK9A 3OIWA 1HTWA 1XD8A 4LYFA 3JZAA 4X8HA 3ZIAD 2OFXA 1W44A 4DT1A 2F7SA 4PAOA 1RRFA 1J8MF 3P20A
chains in the Genus database with same CATH superfamily
1R6XA 3AFOA 4PZCA 1EFAA 1P81A 1LGYA 3DQQA 3G5TA 1WF6A 1X19A 4FZ3A 1VRWA 1JQ5A 4CIYA 1VM6A 3MCTA 4QBHA 4ZJUA 4URFA 3AUAA 4ENWA 5HFNA 2OOKA 1N9GB 1D2AA 4PRZA 3BXGA 3HB7A 4TYQA 2OCXA 4HWRA 4BVKA 4GLJA 1JNYA 4X62B 2HI0A 4AS2A 1KVRA 2BCGY 3ESXA 4HB2A 1OXKB 2H51A 4TRNA 3NHKA 2CBGA 1G38A 1J1IA 1Z15A 3X1JA 1OLSB 1YD7A 3K1TA 3TIIA 5CTAA 4BV3A 5DGXA 1R4MB 4QHSA 2G17A 5I7UA 3MGKA 4FS8A 1CDEA 4J91A 4M9XA 3B3AA 2OZEA 1JYEA 1HLGA 5A4FS 2I99A 1NW7A 1DRJA 1LRLA 4BNXA 4CZ2A 4PAGA 5IM5A 2VZLA 1ZXXA 1AT1A 3HUUA 3QVGB 1L4NA 3PXDA 3NDBB 1BDMA 1V3QE 3RVPA 4BAZA 3D7MA 4JLJA 3IPYA 1LNQA 2WM2A 2FMUA 5U4XA 1CR6A 4D8WA 3TVYA 3ASZA 1JDBB 1O77A 4V0KA 4UM9D 4Z7NB 1VJRA 1B00A 4R1TA 2HPVA 4EQ6A 3HDJA 2DWQA 1XZKA 2ONCA 4RHUA 2OL4A 3BJRA 3R74A 1L5OA 4FHZA 5D5PA 2COEA 2ZRPA 5EQFA 5HKKD 1XNHA 4GOND 1N5KA 2IH5A 1S4MA 3N70A 5ICGA 3QKTA 3M1YA 2HTEA 1FP2A 2CXUA 2GLXA 3WMFA 1P73A 5LCXA 2B4YA 1OA0A 1I14A 1XTVA 4KJXA 1KH1A 5TQ0A 1HDXA 3IL2A 1PT9A 4DMMA 2IUUA 1MFZA 5CK4A 5K3CA 3SE7A 1EP1B 4M9QA 3T35A 2VO1A 1FYXA 2WM3A 4HQRA 2HYIC 1ADJA 2WSSA 3DMTC 1JR3A 2XB9A 2YHUA 1Q3TA 1X13A 3IAS6 4MA4A 1HYQA 2CFSA 1W1WA 2FPIB 2JATA 2P4EA 2RJ3A 2WSYB 3LT4A 2PX8A 4KQEA 3UICA 4N5NA 3WLAA 4B3CA 1ULBA 4E22A 4RTMA 4LQ4A 4ZVVA 2PO5A 4HEA1 1EJ0A 5HQTA 1CNFA 2D74A 4C0HA 1OWPA 1SBIA 1NRXA 1QVWA 3C98A 4O4HF 4KDCA 4YJFA 2QTGA 4H1TA 1U0JA 2Q07A 2WAYA 3AXTA 3G9TA 2R66A 4MWEA 4UZSA 5IBCA 3AC0A 3I8OA 1QIFA 5IKEA 4JI0B 4TRMA 3TX2A 1RMQA 2PSEA 1T35A 3DFFA 2XZPA 4H77A 3ZUPA 5BNZA 5A4DA 4RJLA 3EUEA 1ZD5A 3E81A 2XQIA 2O5RA 4ND4A 4XYGA 4AU1A 1P3JA 1W25A 1JALA 1HK7A 1MAAA 1ILWA 4P3XA 4LZWA 3RFCA 3AIIA 2D6FA 2GKOA 1Q77A 2WFZA 1ZUD1 4MYUA 1P2DA 1TM2A 1ZRMA 2QUBA 4QREA 4RKFA 1OIWA 3T5PA 5KKNB 2V65A 4QGSA 1G4AE 1JEQB 1RYEA 3MTIA 1IHXA 5AM5A 1V11B 2C4WA 4N5HX 5AK5A 3TSOA 3TVTA 2IIVA 5IC4A 3SFZA 3DEAA 4BRZA 5AQ1A 1JIKA 2HNKA 3T9BA 3TQSA 4J0IA 5MHTA 1SHZA 1R66A 2X7HA 4Y1EA 1TTQB 1J90A 3OO1A 1ZK4A 1J56A 1P1IA 2J5BA 4R8KA 2M1XA 1KNQA 4OUKX 2EFEB 5AKGA 1LQUA 4R84A 3WGVA 3OZRA 1SCAA 3U3MA 3DTVA 3DEKA 3SFVA 2HDOA 3U40A 2Y92A 4C1NA 3TFWA 3EMKA 4O08A 4LW8A 5D3MA 5EUCA 2FF7A 5AUNB 3TTWA 1Y3BE 3TW8A 4NU5A 4Q01A 2UVQA 4M0UA 3W34A 1ESZA 5KMGB 4M1MA 5LA6F 5BOVA 1XGKA 3IAFA 3BA1A 2E2WA 3O21A 2C2ZA 2OFOA 4G5QA 1O5IA 1FTQA 4OHVA 2CVPA 1YXMA 1BRTA 4G89A 2A84A 1EX7A 2HMWA 3DZJA 1L3IA 5JNUA 4C2UA 4O2BB 3H8SA 3ZCSA 2Z04A 1K4MA 4LYJA 4EITA 1AMNA 4H7IA 1BW9A 1P7YA 5IZCC 1W75A 1R8SA 3E22B 5FTNA 2PD4A 4OK5A 3W5JA 1RRMA 1GQYA 4RZXA 1QQ6A 3M1AA 4XQEA 3PLAE 5KOHB 4CEIA 2N1MA 2VP6A 4XDZA 1UWVA 4YIHA 4N7JA 3SS7X 3W6UA 1X38A 2ZSEA 5GONA 1JVNA 2YVQA 1T36A 2DH6A 3EGXB 4ZQCB 1L3CA 2ATXA 3OIFA 4EM6A 1Z28A 2PUTA 3DE7X 1GEEA 3GXBA 4LF7B 3S7ZA 1TQHA 1U7UA 2X4GA 5AXAA 3NWEA 4YRIA 1MX5A 2G09A 3L06A 3OQ6A 1N7JA 2X1HA 3PNBA 5D3KA 4QVKA 2IOFK 3RYIB 3EZXA 1Z17A 4BNKA 5JD5A 3Q9LA 3ED5A 4YJGA 4MCJA 4B6QA 2HBRA 4GQBA 1TVEA 3LC2O 2AX4A 3ZCUA 1J2RA 3PHHA 1IWBB 4MGIR 4X54A 3RQIA 6PFKA 5FORA 4CIAA 2IY8A 3QE9Y 2F8SA 3UW1A 3GFTA 5HM6A 4ZI7B 4B6PA 3IIEA 3ER9A 1GA1A 2CD7A 2CYAA 3G2MA 1NP3A 3MLEA 5CA1F 1JQ3A 1GCAA 2NU6A 1GNVA 4M36A 1CJVC 1MIOA 4Y2SA 2CDCA 4FCCA 3E1GA 3QOYA 3ZTTA 3ZN2A 4NH0A 2CXTA 3UK0A 1N2CB 2HA6A 2NM0A 1BS2A 3P7MA 4MGYR 5FUBA 2VNJA 4EVRA 4F9TA 4ZGWA 1L4KA 1UDAA 4K6GA 4RENA 3PQCA 2KX7A 2KMLA 3NPMA 3THRA 4B3DA 3M70A 1JSLA 2DFKB 2H8GA 2JKVA 4PPGA 1WY5A 3EVZA 1Q0HA 3W78A 4EUHA 3UM9A 3N8NA 5KSWB 3ZJVA 2H92A 4BKOA 4I5FA 3MINA 2AJCA 3CUVA 1RWNA 3TO5A 2VRBA 1DX9A 4N5LA 3F73A 4C0JA 2HRRA 1RI3A 3R0QA 4YASA 5CA0F 4FQ8A 4PPQA 5HGXA 5JT1A 1D6SA 1NLMA 2C92A 4NPAA 2WJ4A 2XLCA 3OM0A 1PSWA 2HXGA 2LCIA 5MFZA 2ZYIA 4MUBA 4M6WB 1KY3A 1X8LA 2NZ2A 4QBFA 3ZWMA 3TIXB 2C59A 2G5PA 4PR3A 1U8ZA 4Y6LA 1O6GA 1HE3A 1YB6A 4UFNA 3UG6A 2BMEA 3VKWA 5BSWA 2RHLA 2NU7A 4WXPA 1NNI1 2VPYA 4EB6A 5PGMA 4BVEA 1N6HA 4RJ2A 4ZAGA 5JAQA 3EXHC 3PR1A 1QIJA 2FW9A 5I01A 1XAIA 2WIGA 1HT3A 1ZGCA 3Q9UA 5LP6B 2PUGA 1FCJA 3CWZA 3VYVA 3UXMA 3WDKA 2VAVA 2QPAA 3HY4A 5FWNA 3CT6A 1G4UR 3FPFA 1XA4A 4E5SA 4ZOLA 1OBVA 1N36B 2BJWA 4YYZA 1GCGA 1E3JA 2BPOA 2R2AA 1JEOA 4DG8A 4MWSA 4BJ5A 5U4QA 2FVXA 1GDDA 4W1RA 5I7RA 1ACMA 1VKJA 3Q15C 1RTKA 2CC2A 3Q2OA 4JLSA 4TXHA 4F97A 3VR6A 2IIQA 1G5TA 2WTUA 4QFMA 5TDHA 2QPOA 3PPVA 4OEHA 4D3XA 4E32A 1YA6A 3TXXA 1A71A 1D4FA 4HWGA 3ZVRA 4UE2A 1DQPA 4CM4A 1UM9A 1Y33E 2Q41A 3D02A 1CQIB 2EZ4A 3LRXA 3CRZA 1I1OA 4FFPA 3WQRA 4HQOA 3BZBA 2J8ZA 1T9ZA 1UWKA 3JASA 5HF6A 2WSIA 3RWMB 3S8MA 4DEXA 4OI4A 2VK2A 1YIDA 5DCLA 1SC9A 2W2LD 3KEGA 2QL9A 2WKRA 3BX1A 3OZWA 3PT5A 1HURA 4HX9A 1AO0A 2JHAA 1Z5WA 3C39A 3S2GA 5EJ9A 3GG9A 4CMCA 1EGQA 3QTLA 2EFYA 3KEMA 4NE7A 2CJWB 2WT9A 3M4XA 5IBRA 4PAWA 3ZHCA 3L1HA 4DZTA 1V95A 3CUUA 3RRFA 4BO9A 1JIIA 3RTDA 1Y9JA 3WS7A 2IH4A 4O63O 1RP1A 1V8FA 3O1IC 1MIHA 1UWCA 2RI0A 5EJAA 3GVPA 4MI9A 2X58A 3NHUA 3WP0A 3BH7A 5K0SA 3AY0A 3FPGA 3AEYA 4A5SA 3GRZA 2HSWA 4HX5A 2FQYA 4IL5A 4IIGA 1H93A 5B6IA 1G8FA 3TLMA 3PUZA 5G4KB 4LMPA 4ALNA 4ACAA 2AKYA 3FROA 4N18A 5B64A 1E64A 1PHRA 1TJPB 2RONA 1BEZA 4ZHQA 1MHTA 5FB3A 5BN4B 1CNMA 4F2WA 3PFWO 1XALA 1IQRA 5A4MS 2ILTA 3GROA 2QUJA 1OD6A 5L7TA 5TJ9A 1I4WA 2MSCB 3LCVB 2VRNA 5A5VA 3AVYA 4FQ7A 1GGNA 4K86A 4ARVA 4YLYA 4E2FA 4DDUA 5ES4B 1G6KA 5CUQA 3VHRA 4YONB 1LEHA 3DUFB 4C2TA 2QRQA 3SZGA 1DQZA 2GA8A 3SR3A 4CM3A 4NAVA 4L8WB 3O2JA 1P19A 1SZCA 3RIYA 1XTUA 3BAZA 3RVNA 1Z6YA 1VIVA 3F49S 3ZDCA 1BKDR 1NNUA 4U7HA 2IF2A 4UEOA 3GRFA 1THGA 5BR1A 3ANSA 2X6QA 3F5DA 2Q8QA 3G0GA 4G86A 1XZ8A 5AOVA 5HE9A 4Q1CA 4JZYA 1LK0A 2B4RO 5KSOA 1E3MA 3BIJA 1BHSA 2VRWA 5IVPA 4NU0A 1FMLA 5DTMA 5EE0A 3N58A 3RUAA 1B0PA 1ZUNA 2GZ3A 4P3OA 5KU1A 4KZKA 1FTWA 4OYYA 2HHAA 4KH0A 2AFHB 4JJKA 2ZBRA 4Z2YA 2VXYA 2G83A 2BOVA 2H11A 4OAQA 4ETNA 5K0CA 4KJZA 3PGVA 2XWBF 4PIPA 5AXBA 3L4BA 2O1XA 3IDAA 1ZGGA 3NG1A 1SU7A 3ROFA 1REQA 4F3RA 4IRUB 2IKQA 2GSDA 4YHBA 1IPFA 4HI0E 1KR5A 1Z73A 4MGZR 3AZPA 2DMRA 2P5YA 3MYRA 2AYXA 2VBGA 3IPCA 3RSFA 4NZPA 2QLBA 4QPPA 4YRNA 3OQNA 3PK0A 5CT6A 4P5DA 1C14A 1COWD 1G3QA 2I2XB 3ANTA 3UKJA 2A5JA 1P2TA 4BZQA 4CM7A 1E62A 4WDQA 5KYWA 3RYCB 2NQ2C 1H1DA 4OIFA 3R7DA 3TZ6A 2ZVQX 3TEMA 4LYYA 5JMPA 3OM8A 1BXKA 3MCWA 3TN7A 2JKZA 2IHYA 1IULA 2WFMA 3Q11A 1A0OA 2E82A 2OBLA 2IYUA 4U7GA 3L8EA 3CJRA 4WXEA 4DILA 3OOHA 4J16A 3QKUA 2WJYA 1M2VB 3VC7A 4PZYA 2WYWA 4UVIA 4V0OA 4IH1A 5J5VA 2OLKA 3TB6A 2C4HA 1TO1E 2HBQA 4D0SA 4RD3A 4JVOA 2W48A 3KEFA 5JVDF 1U7XA 4HYYA 3D0KA 5M34A 4DLNA 5T6MA 3NTVA 3GJ5A 1XA3A 3FUVA 4NIMA 5TQJA 1A95A 2RG1A 3C7KA 3W5CA 1U8CB 2GKSA 2IBMA 2QW1A 3AI2A 3EPPA 3BL5A 3KL4A 3OJLA 3R0VA 4L72A 4NBNA 4URHA 2GI4A 2Y0EA 2VI5A 4DE5A 2RE8A 1Z45A 1L8LA 4BO1A 5I48A 1LPNA 4M1OA 2GTPA 1VE6A 2W9XA 3T3EA 1I30A 4V1CB 1I9GA 1RJFA 1WS6A 2E1PA 1Z4IA 3MT0A 1PKEA 4CVNA 1K75A 1ISJA 2FETA 2XA9A 1JJFA 3WWYA 3ABZA 3DBRB 4DWWA 5E1MA 1OZHA 2BSXA 2FR8C 3Q7QA 1DFIA 4YO7A 1TJ3A 3B1JA 2F43A 1KIAA 3FCAA 4FJ1A 2YHIB 1Q91A 3PHGA 3Q4GA 1PFKA 3WB9A 4RTJA 5LKRA 2F8LA 1YL5A 3T3DA 4FYXA 3AUSA 1U1GA 1D2CA 4OHWA 1IRXA 3PIDA 5FPHA 3D6HA 4KQ2A 1UBLS 4KODA 3KVYA 3B1VA 2XMZA 3BD7A 4TN1A 3VZRA 1X94A 4FDMA 4LGVA 3VSEA 3DAOA 1M74A 2IPAB 1C30A 3USCS 4GZ5A 3B9QA 2ZITA 3NX4A 2AIRA 1NULA 2WB4A 4GKVA 1QGYA 3SQMA 3ADOA 1NJ8A 2G8NA 2Q3LA 3KKOA 1H6BA 3BF8A 1SOMA 3D7LA 3JQAB 2CF6A 2OHOA 4YAJA 5CFPA 2IEZA 4IJMA 3KQUA 1U7HA 1ZXBA 1V2GA 1YRQA 1IUOA 3VHXB 2W4MA 2QMYA 3VBCA 1KEEB 2CYCA 1Q50A 2OCPA 3KBOA 1XL1A 1IDOA 3PFBA 1VLQA 4DAOA 1M1YE 5AHKA 4ZFNA 4DNFA 4F7DA 5BW6B 1UM8A 2HEGA 3JY6A 5IYZB 5ALVA 4L5AA 3Q7SA 2FRVA 3LCJA 4MQ6A 3KZKA 1U5AA 1XD2A 1W5FA 3PGXA 1QNLA 2BFCB 4ZYTA 5J4LA 4B0OA 4QBIA 3WE7A 2G4CA 1F6WA 1E6LA 4QRHA 4EJ0A 2R68A 4KRXA 5BORA 1ZA2A 5DTJA 4ZT7A 5M5BA 4XGRA 3O94A 1EH5A 2OYCA 1JF8A 1XZFA 1X7ZB 2JFQA 1IY2A 3IVXA 4TWRA 3VYWA 4CCAA 4YDQA 3BHNA 1YQTA 2ZJZA 3MCAA 4KIJA 3TAUA 4NCIA 3TINA 4X7BA 4AF7A 4NOMA 4RVHA 4REOA 4JA2A 5KYXA 2QNBA 2WF7A 1YE8A 5FTJA 2I2CA 1EGMB 2JFFA 3EUWA 3REGA 3TLBA 1F38A 1JU4A 3H99A 1KOGA 2DJIA 3JU3A 3ROGA 2O6HA 4OKSA 4ANFA 3A70A 1V9LA 4L3OA 3O8CA 5SYNA 3ZXYA 2IS2A 3KJGA 3IOMA 1EG7A 1Q1AA 4KK4A 4UBNA 2AHRA 2Y1GA 3DBVO 4W7SA 3Q72A 2JI8A 4LNHA 4B34A 1I33A 1T6XA 1PTJA 2EDAA 1V5IA 2RGCA 2XQFA 1J99A 2P7HA 3QU9A 2GZ2A 1IMJA 2XDWA 1VKOA 1GGEA 3H2IA 4OYLA 3UQYS 4L7VA 4L9RA 3U0VA 5KHAA 3A3OA 2X40A 3Q9NA 4WOJA 1P1FA 3BICA 4EENA 4JEUA 3D6UA 4HQ6A 1Y3FE 4OOEA 3QJGA 1KVTA 2ATCA 4BCCA 1DS6A 2ZKIA 1R5NA 2XNKA 1FFCA 1OKKD 4OHPA 2RHOA 4CN9A 2GFHA 4ZHSA 4OXQA 1NF2A 3IKMB 4YROA 4CDRA 3P2OA 2OKCA 4B7AA 2BE9A 2L69A 1UT6A 2QWXA 1QU3A 1EUDA 3OPNA 4EB8A 1YIAA 2YWXA 4GF5A 4PYMA 3HCCA 4R2MA 2HT1A 4XZ3A 2VQSA 3V46A 2WMOB 1YRWA 1QK5A 3JQDA 3UJ8A 1LBQA 2AXEA 3KALA 2CKDA 3MPUA 3PS9A 5FOQA 1XB2A 2ZRMA 1P2BA 1E2DA 1IEWA 2I29A 3JXEA 1OIVA 1NBOA 4KL8S 1VCMA 4Q9NA 1CEQA 3QVKA 1RLOA 3KSBC 4P33A 3U3JA 1R27A 4WRRA 4GM4A 5T4EA 4JSTA 3RARA 5J5CA 3U4GA 3AEXA 3CKKA 1W5SA 3KUXA 3LLMA 2JBAA 3TZKA 4RH3A 1TT5A 2WTAA 1EP9A 5PNTA 4CMBA 4X20A 4AWBA 4KAFA 4XOUA 4J4HA 4H6WA 2Q6IA 1PRYA 3WDSA 3CX8A 3UENA 1VJGA 1B8OA 1NFFA 2QMZA 4JT4A 2P4UA 4HUTA 1XPUA 1AZTA 2ZPTX 4AWAA 2GJ4A 2JCYA 1QLJA 5FBHA 2Z6UA 1DT5A 1ZK3A 2W6ID 2AN3A 2CXQA 3DOFA 3Q98A 5CB0A 1U3TA 1L4GA 2C98A 3HMQA 1C3LA 3V2HA 4BN5A 5BNTA 5HE8A 3W0LB 4F2PA 2CNNA 3IVAA 3GJTA 4ZKDA 4JH0A 4UREA 1FRVA 1ZCJA 1JHPA 1XK7A 4U9HS 1GL3A 1GNRA 3HCFA 2O2SA 2P2NA 4BLTA 1ULSA 4DLXA 1NQ5A 4IGAA 3NHJA 5LBUA 1XQYA 4L6AA 5C7OO 2SKCA 2P9TA 4P7JA 5IRCD 4PTYA 3W7AA 1VMAA 3G2QA 2WMNB 3GDFA 4TZKA 1X14A 2CUKA 3AJDA 3R8CA 1NAIA 2ISCA 3THSA 1DU4A 2ZIXA 2XQKA 4ZEWA 2FZVA 2NQTA 3BCSA 3LV8A 1JMVA 3QEMB 4LZZA 1X7WA 4RZSA 4TQAA 5EZ6B 2PWAA 3FXAA 5C8YA 1QIHA 1A4XA 3E7WA 3RSOA 1FU8A 5BUCA 4IWXA 4OU4A 1YQDA 3NW9A 4DA6A 2QQGA 2C4UA 5FI3A 2P1DA 1NFRA 4RYDA 5AM2A 3TQOA 2XUIA 3HCNA 4W5NA 5F78A 3A6HA 3IRVA 4IDBA 1RJ9A 1XV5A 2W2PA 2WJ6A 4PIMA 4QT4A 4DUYB 4QATA 2ZIZA 5DXFA 1LJUA 1B0ZA 4FYPA 1IN8A 1E1DA 2GEDA 2NPIA 1DXYA 5EJEA 5JBIA 5EL0A 3UAXA 4KMSA 4BVAA 5LLTA 4MV1A 3GIDA 2TS1A 2VFAA 1AHPA 1E0DA 2H4WA 3NBKA 1J97A 2CCKA 1DAGA 4XRRA 5JNRA 4Y18A 4HCJA 1ZUWA 3RW9A 2V7VA 3UWKA 1SG6A 2C95A 1ETHA 2VUTA 3K94A 3M4ZA 3MG9A 4B4UA 4KIFA 2OC4A 4QYIA 3AG6A 3HYSA 3FHTA 3CNOA 1YZTA 1NXPA 5I4IA 4LJ9A 5HCIA 4D3SA 4DCMA 2WHXA 2VYVD 3C5VA 3JD1A 4JC8A 4L6CA 3LQFA 1UDRA 1C41A 3PX7A 1XLVA 4D4KA 4CCYB 3V3KA 2X1VA 3WZLA 2NSDA 4DA0A 5B7PA 1AKVA 1NVXQ 1VL1A 4RVOA 4CM9D 2GPNA 3HO1A 2ZTHA 4BFSA 4KRGA 1A9YA 1MJFA 4IYRA 1Z47A 2ONKA 2X8JB 4JJFA 4LXHA 5CPBA 5EMHA 1N6IA 3U5ZB 5IUJC 2YV1A 1GG8A 3EXIB 3WGIA 1W85B 1ODLA 3EDQA 3LUJA 2XUPA 1F0YA 3PVCA 4JP8A 4Q7MB 1P8JA 3LCRA 4KFTA 1JMYA 3SJUA 3TR0A 2XD9A 1Z62A 4BXOA 2PFGA 2F90A 4QSMA 1GYQA 1CR2A 3CVXA 3PTAA 3CNQS 3C3CA 1S3FA 5AM1A 2X86A 2H16A 4KQCA 1JFLA 1YUMA 3TXYA 13PKA 3P45A 1NQWA 3E9YA 3KJIA 4H7FA 4X6UA 3SC3A 3CMMA 4YUWA 2R6HA 2AG5A 4HAZA 4K6HA 2R47A 2KE5A 3ROKA 3EGWA 3C48A 4EKDA 1K0UA 2FW7A 3AJRA 5L3SA 4JHXA 1N5LA 2VJCA 1RHRA 4D9NA 2XGOA 5ESWA 1LCIA 1ECLA 2WILA 2X9LA 1GAQA 4ZU1X 3U3OA 3WWDA 5BSFA 1ZN8A 1Z63A 3M2PA 1T2UA 3JD4A 4MUJA 3C3PA 3RI3A 1XZEA 2XW6A 4LBWA 4B85A 2QJFA 4M87A 1H0SA 4CNBA 1C3JA 1C0EA 3QBEA 3AINA 1U99A 1V6SA 2ISQA 1T1IA 2FFJA 3COZA 3O31A 5F4ZA 2IV7A 5BOSB 4E2WA 2QVZX 2AEEA 3OZCA 2YWEA 2XB8A 3G9XA 1YR8A 1OTYA 2A6PA 1P4SA 4AY3A 3KQKA 2J0SA 4RD2A 2FW1A 3LUPA 3PA8A 4LRSB 4ON9A 1W7AA 5D6OA 4G65A 5ECWA 1F20A 5JNWA 4O4JB 1SD2A 4DBVO 4PCVA 1C4XA 2NT3A 1ZWLA 3S2ZA 4JLOA 2O54A 2W2MA 2Y0CA 1DO0A 2UZ4A 4KW7A 2B98A 1H4QA 4WUVA 1R6DA 4IHJB 1ZIXA 4JJZA 1E2HA 3NFYA 1XQXA 2JI7A 2VQ6A 4L8GA 5IDXA 4ZQGA 3V8BA 4YDHB 1PT6A 2I4IA 2QGZA 1EX1A 1KRXA 4BNVA 3H3XA 1UIMA 4HDNA 1NPTO 3IIKA 1ANKA 3ZNPA 3RGWS 4UOEA 4LPKA 4MKFA 5K8UA 4R1QA 4I1SA 2UVPB 2B78A 3TEJA 5IAOA 4QDXA 3MELA 3IKTA 3N7AA 3PEVA 5DXAA 2EBWA 1TGYA 3F6CA 4BFZA 3R9IA 2EU8A 1NUUA 4I1VA 1FJGB 5JECA 3PFFA 3VZBA 3STTA 4IUYA 4XJSA 1GUBA 4V0RA 3WRVA 1UMKA 2ZB3A 2CLFB 1JAIA 3IEPA 3JCZA 5DDIP 5KQSA 1QDUA 1V7ZA 4X60A 3RKUA 2H54A 4YI5A 1LJLA 4HP8A 3EWAA 1VKNA 1X74A 2SKEA 2JFZA 4WXHA 5C35A 2Z6AA 1FVHA 1QZTA 3AR9A 3KR2A 1YBVA 3M6FA 2GTHA 4GYJA 1DRVA 3KPUA 3ZBUA 2I22A 1Q0PA 1WZIA 3QY0A 4PC7A 3IDSA 3T6KA 3VH3A 2C58A 1FLAA 1WETA 4RL4A 3VNSA 5HSGA 3FUWA 4IGIA 4LZAA 3PGKA 3BMOB 1CZRA 3G6KA 4N54A 4QGGA 2A9PA 4UHKA 4RTKA 3AERB 2D1TA 1FTSA 1O5OA 4L22A 3L8DA 1NURA 1YQEA 4HAVA 5DOVA 1UBTS 4UM9B 4L4ZA 2RGUA 2CMKA 1YZKA 2FPUA 3ZWBA 3N2YA 3OM1A 4TMVA 2VJQA 5AW6A 3QFHA 6YASA 5JQGF 3TBFA 1F8XA 4HNQA 1H4VB 1GCUA 3H83A 1ZJJA 3WBBA 1T9GS 4FB4A 2YV5A 5CDUA 2X7XA 2RH4A 1QPZA 3LBNA 1F6BA 3BXFA 2R1VB 1ENYA 2FUG1 1ZVVA 3MUEA 2P77A 2ZDGA 4NZYA 4I1IA 2XYPA 3ORQA 2CNWA 2D1RA 1X8JA 1X1CA 1LX6A 2HO5A 2VYCA 4JD5A 1A9QA 1AQYA 2QYHA 3W6NA 1QRTA 2YY6A 4P5EA 5DIZA 1UC5B 2VAXA 2NZVG 4A03A 3ICVA 4B74A 1SQGA 1JV2B 3OE5A 1HE1C 5B3AA 2Y1OA 1U2ZA 4N0DA 1HDEA 4LHEA 1MAVA 3MS7A 1R8QA 4Y2TA 1XU7A 4NULA 1PNTA 1GVNB 4J0HA 3HA5A 4NMLA 4JJ4A 3EVAA 5JZBA 3VAAA 4PE5B 1U8AA 4X93A 4JP2A 2JIZA 2V5UA 4ND8A 5G1NA 2BFBB 5DHFA 3M6VA 4D4LA 1LX7A 1M33A 4AW9A 1ML4A 2ZM6B 4XD7D 2MIIA 2NSLA 5JBNA 3DQPA 4Y3UA 1YDMA 2X5NA 3GFQA 4JITA 3KTDA 5FADA 2JVIA 1SVNA 4KOEC 3M3DA 4KLCA 1KDYA 4AAYA 4EB0A 4QDZA 3RTGA 3IPRA 4F3CA 1LZLA 2A0FA 2WUVA 4CGYA 3T61A 2R0QC 2WVHA 2IYVA 2HBYA 3HNOA 1GG5A 3WB2A 1RM3A 4EHFA 3ORRA 3R0ZA 3M6WA 1Y4DE 1M2NA 4C3UA 1E7MA 2QA5A 5JI2E 3L1IA 4RSHA 2I1VB 4IINA 2W6NA 3O4GA 4KQ1A 3B9RA 4DL9A 3ZV3A 3QKWA 3BFVA 1XRPA 2BN4A 3C3AA 4BYMA 3IIMA 1RPZA 4MWOA 1Q0QA 4G36A 2ZYDA 4J43A 1NJGA 4UDNA 3T7TA 1B4DA 4HYEA 4ZC1A 1T5SA 1Z6TA 5EKSA 2FUEA 3CXRA 3NNNA 1MQ9A 4C04A 4YWJA 5BN3B 3UTDA 4F1JA 1E1CA 1JPVA 4Y98A 3R3VA 2Q0QA 3CNEA 1HRDA 2CMGA 4BTEA 1AGPA 1DEAA 1JKIA 3Q7TA 1MLDA 3ZK9A 2O0JA 2VSNA 4HDRA 5DYWA 3EW9A 1E59A 2YOHA 3HWWA 3SXUA 1ICIA 2CK3A 5CA0A 2AWOA 2DECA 1EFVB 2ESRA 1HT1E 2OUKA 3H2JA 4E4YA 2PRZA 4DA4A 5HZGA 1KI9A 3PUXA 4QJIA 4DLLA 4HDKA 4ROSA 1JEJA 3GCDA 2B8WA 1YFKA 2AI1A 3KOMA 3OQPA 4OD0A 1AZLA 3SYRA 5FO1A 3SSMA 2M98A 3TX6A 2QN7A 5EIFA 4B8WA 2I66A 4BU0A 3DG9A 5FV7A 1LDBA 3NXSA 4PC6A 5H80A 3PXUA 5KS2A 3PXEA 3C6KA 3QG5A 2IYAA 2ZTVA 2VHVA 2ACKA 3ZU4A 3N5CA 1LBTA 2GZSA 4YH1A 1ZZGA 3ZJ4A 4AYWA 4KREA 4X24A 5EPOA 3DP9A 2QSUA 4E2XA 1CT9A 3CBGA 3FGZA 1JG7A 3GDWA 3KAKA 3BQMB 3H65A 3OJCA 3AKDA 3OTGA 3QZUA 3QWFA 4B80A 1GUYA 4WBNA 5FI5A 1L5YA 1U8YA 2NQ8A 3DT9A 5J2TB 3T0GA 1E2QA 4HSGA 1F9AA 1O0SA 3K53A 4HQNA 5J3JA 1TPZA 1M2GA 2EX1A 1IN5A 2I4OA 5HKLA 3U7EB 3VU1A 1NRJB 4K6OA 3ZWPA 2E5LB 1H9AA 4ZXFA 1INLA 3H13A 4MI6A 1V16A 1HDOA 1NIPA 1NYRA 3PJGA 1DV2A 1JT9A 4OHZA 4AG5A 4BJ3A 2ZE8A 3HBFA 5A0VA 2FUKA 3F7MA 3FA2A 2IGTA 3BFJA 3LTNC 4DV6B 4RMIA 4C9BA 5CYOA 1GG2A 2ID9A 2D5BA 3AYXB 3KOOA 3UC5A 1CHNA 1OASA 3ANYB 5BWNA 2HHJA 4K87A 4AWXA 2C97A 1XAHA 1CRPA 1SC3A 3OWXA 4H0NA 2PZBA 2DP4E 1JP7A 2HWXA 1SOVA 2I4RA 2Y2UA 2X9QA 4OXXA 3TKAA 4YHHB 3Q7RA 5LBTA 3RK1A 3IEXA 4RL6A 1C3VA 2FUCA 3ANMA 3K9NA 1PI3A 4BEWA 1IY8A 1DSSG 1SPXA 3DOHA 5DMXA 5TNXA 2XZLA 2QRMA 3EY4A 3GDHA 3U56A 1P7CA 5LU8A 1KYXA 2AUMA 3EZNA 4IVPA 2I3DA 4L76A 3LHFA 3TE6A 4MARA 2YC2C 1UMDB 1V25A 4HGRA 2E4WA 2REQB 4MQUA 2Q3JA 2EG5A 5B1YA 4JDUA 5CT8A 3VNQA 1UFRA 2O23A 1H2AS 1NVVQ 4BMSA 4QU0A 4S04A 1YCGA 1N2CE 3LQYA 1J8VA 1K3TA 2E4VA 4YFVA 1IN7A 1CQXA 1CUAA 2PXCA 1V0JA 4OIMA 3P5BA 1PJAA 2J1LA 1RXWA 3K05A 2A1TR 2CXHA 2F48A 3RS4A 3EC2A 3VVCA 4EELA 3TSAA 1TM5E 1E2IA 2XKJE 1E99A 3BXXA 2E4XA 4GMFA 1NC3A 3WAKA 4Q21A 1D0IA 3UGQA 1ND6A 4BTVA 1ATIA 3U81A 1M2EA 3GRPA 3GLTA 3FPKA 1DFGA 1ZHFA 3FRHA 4DM3A 1V5FA 2OFPA 1L5GB 3ZWVA 4GH5A 4C6TA 3OBBA 1E20A 2B6NA 4UNQA 2IBSA 3NT5A 1ABFA 5BSVA 5FNZA 3SZLA 3O8DA 4I4TF 3DW3X 2P78A 3ORHA 3RBVA 2PZKA 4ENTA 1HGXA 3L4BC 4BTLA 3HY3A 3U13A 1XA0A 4HAOA 2YRWA 4NMWA 1J07A 1DDGA 1CZNA 1NBIA 1MJ5A 4FMPA 1AKEA 1MFPA 1N6LA 4GP9A 1YMVA 3W9YA 3OLQA 2BFDB 4R7TA 4ZDIA 1O6CA 4X65B 1O97D 1SOWA 2C4TA 3L6BA 3HSSA 4ZYZA 1O94D 1SELA 2ZBFA 1MRSA 4C4TA 3N2GB 1FNDA 4RGYA 1L7MA 1OOEA 3ESRA 4Q7JB 721PA 5KZMB 3UGJA 4LYAA 4QULA 2G28A 5FOVA 3T7IA 1ORWA 5DLYA 1SVIA 3QLTA 221PA 7AT1A 2DQSA 3PUWA 4YRSA 4AJIA 2QR2A 5DJ5A 5GJWC 4PF1A 2I6UA 4KVFA 2EHDA 1EXNA 1Y8ZA 1EIWA 1Q0SA 2ID7A 2IT1A 3KKKA 3NDPA 1WB5A 1SPBS 4J16C 3EYWA 4JL8A 4L2IA 5CX1A 3ZWKA 3GL9A 5LQUA 3A4IA 4DCPA 1AKUA 2JD0A 4TTJA 4CT4B 1T2VA 2IYLD 3LPAA 3RJ9A 1RKVA 5DHAA 4DLAA 4RPLA 1W0JA 5BPFA 5HRCA 4UHFA 2WZQA 2I0FA 1T1EA 1HYBA 1WF3A 2NWQA 3O83A 1UFOA 3Q3GE 3LC0A 2RHWA 2C2OA 2H5LA 4I5EA 4P4TA 5FL7A 5IJAA 2OV6A 3KLMX 4JOSA 4S05A 2CVHA 3ZGOA 1KBZA 1VFPA 4UTRA 4YRBA 1JQDA 4I6EA 2A5FA 4ZI2A 2HQBA 5JAIA 2Y0BA 4K2AA 4C5CA 4IDDA 1PFQA 1TKBA 3NIFB 2PXAA 4MIYA 4BMVA 4Z4QA 3BL6A 4RSGA 4Y0VA 4X66B 4P0QB 3PX2A 1QXSA 4HHEA 4Y6GB 5AXCA 3VKHA 1N92A 4CTOA 2QI9C 4JI1B 3O95A 3KKEA 4O2BF 2PUDA 3SLRA 5K09A 4W82A 4H2DA 2C7VA 3ODGA 5J2UB 5KKCA 1K8RA 1Z2EA 3FI0A 4CV1A 1HNXB 2H18A 5A4IS 3GJ4A 3WK8A 4D44A 4DUPA 4PHHA 4HWKA 4LNAA 1OWMA 1QHHA 3BD9A 4DJFC 2PJZA 1L5RA 4Z4CA 4ND2A 3T1YB 1NMQA 5EZYF 5J40A 2QRKA 3H5OA 1A72A 2GAAA 4IAOA 2CFCA 1H0RA 4M9UA 3ZIDA 5EIOA 1WABA 4HGYA 1WSWA 5FBQB 4YUAA 2YYSA 4M1TA 4R1OA 4ZPXA 2VDNB 4AN4A 4KWIA 5AKEA 2PNFA 3V97A 5E7JA 4DEVA 2CWWA 3NONA 1FSSA 1ISGA 1C1HA 3PL1A 4HLUA 1ZOSA 1KJQA 2E48A 1EKXA 2QTRA 3BE6A 4M9ZA 1AK2A 1TVKA 4NYIQ 1A5AB 2JFVA 2ZRBA 4OHUA 4PEVA 4DNOA 5CLFA 5JAHA 3SQWA 3QYJA 4AKGA 4I81A 3IJ5A 4WZBB 3JPYA 3BWCA 4RTLA 4ZI7F 2CKMA 2R25B 1XL0A 2IDMA 3F47A 1WP9A 3E5HA 3F4LA 4R01A 4DLZA 5JZSA 3FMOB 1VPDA 2BLNA 4MLZA 4LBVA 1L5LA 3DS8A 1NJSA 1XU4A 3G5LA 3RTAA 2VDQB 3HGMA 1E2NA 3ZHBA 3Q8LA 2BYTA 2ZT5A 4FT2A 3COVA 4OREX 3ZHOA 2M6KA 4DMGA 3A4MA 3ETNA 2VWHA 1U04A 3TSZA 2AFHE 2B4TO 1HZZA 3QK7A 3RJMA 2DXIA 5KJCA 1KI6A 1U9CA 2ZCVA 2IXBA 4AKSA 2YJ3A 2QNIA 3V2IA 4RQUA 1O1YA 2J32A 3KEQA 3R9KA 1MEEA 3AVOA 3RSGA 3TZCA 4A5OA 2XAUA 4AIRA 4FCVA 5JNVA 3G2HA 4I9HA 2VZ9A 2WIKA 3BM5A 1AE1A 2PBLA 4FGUA 4QODA 2VDUE 1CR4A 5DX1A 2O2HA 9LDBA 4PGGA 3F9CA 3OLYA 2BFFA 2WWYA 2EIXA 3RU2A 5CBPB 3VR3D 3QVOA 5L40A 4D97A 3S55A 1KRHA 1VYVA 5FBVB 5A6SA 4G37A 1NLYA 5HDQA 4AJ1A 2DYKA 1I1QB 4TYYA 5A5GA 3N39