3HDTA

Crystal structure of putative kinase from clostridium symbiosum atcc 14940
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
169
Chain Sequence
NKNLIITIEREYGSGGRIVGKKLAEELGIHFYDDDILKLASEKSPENLFKFQSEVMRELAESEPCIFVGRAAGYVLDQDEDIERLIRIFVYTDKVKKVQRVMEVDCIDEERAKRRIKKIEKERKEYYKYFTGSEWHSMKNYDLPINTTKLTLEETAELIKAYIRLKGFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative kinase from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
molecule tags Structural genomics, unknown function
molecule keywords putative kinase
total genus 65
structure length 169
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hdtA00
1N0WA 1AQUA 5BYJA 1JPNA 1XEXB 1XB2A 3QPUA 1E6CA 4C30A 4GOKA 2NO6A 2ZRBA 3L82B 4PPFA 4LCBA 4ZCMA 4K46A 4LY6A 3LQRA 4Z8YA 4E07A 3N2EA 2P5SA 5GJCA 4NDZA 3D7MA 3W6NA 4LI0A 3U3KA 3LBIA 5FUWA 4BFYA 1P5ZB 821PA 2ZI6A 4MRSA 2OE2A 2OM2A 4LBZA 2VSFA 3CR7A 2IYZA 3ADDA 4Q4AA 3ND9A 2ZVPX 1E0SA 1US8A 3VAAA 2X2EA 1OYWA 4TQ9A 1CF4A 4GPTA 1CIPA 1EK0A 1NNEA 1K6MA 3FB4A 1OIXA 2EU8A 2XTMA 4UXIA 1T91A 1SVMA 4OHZA 5E3HA 2IYRA 3MWYW 4A82A 5DSZA 2EVWX 2EFHB 4KO8A 5B57C 1QHHA 4M21A 2WJVA 3TMKA 2QROA 4A36A 1E1QD 2HCJB 2QEQA 4II7A 3TBKA 2FSGA 2GBLC 3AKCA 1PV4A 1RVDA 2CVFA 4PPGA 3PUWA 4XOIA 4WVFA 4D0LB 4Z51A 4ITRC 1Z2AA 4LSGA 1XNJA 4A15A 4UXHA 3CH5A 3B6EA 2XOKD 4JLKA 3RLFA 4FD2A 4A4DA 4LJ8A 3RS5A 3BB3A 4YDSA 1DAEA 4LV8B 2GWHA 2J0UB 4LUCA 5FTNA 5JS7A 2KBFA 1UBCA 4EJSB 4QNRA 1FP6A 4IDNA 1F6BA 1RZ3A 2KE5A 3BRWD 1F5NA 3MWKA 1R0YA 1JBKA 4IEEA 4X8OA 1FQJA 3VMFA 1E2JA 2FPMA 1YZLA 5F9HA 5FUXA 1SKYE 1OKKA 1OPXA 1TF5A 2ZR7A 4ZPXA 1G3UA 2ZRMA 4QRHA 3NWJA 3TKLA 2BM0A 2ZRDA 2GXAA 5CM9C 1XTIA 2AKYA 4G5OA 3QY0A 2IL1A 2NO7A 3W6OA 1PUIA 5J40A 1KKLA 1Q3HA 1YR9A 1M74A 2OSBA 2QSZA 1NLYA 3K0AA 2VYFA 4UNQA 5FI0B 1OXVA 3EIEA 1N5KA 3JZMA 4PAQA 3LY5A 5JZVA 1V5WA 3KXIA 4KSBA 1FFHA 2D3WA 2J5XA 1Q1ZA 2CMKA 2BMJA 3B60A 4GP7A 1TUEA 3SU8A 3SR0A 2QMHA 4YXWD 3T5DA 4A0HA 2IYQA 1NG1A 2X2FA 1DO0A 3BS4A 4IEIA 4AY2A 1Z0DA 1SVSA 1YKSA 1HH4A 1Q1EA 2G0TA 4C3ZA 4ZKEA 1VCIA 4TMTA 3U2QA 2JCSA 1TPZA 5JFGA 4NCJA 4W5WA 2NG1A 1ZC4A 2YWHA 3TSZA 4XWOA 1KDRA 2ZR9A 4DRZA 2BEJA 1E9DA 2GEDA 4N0EA 1OH6A 4Q48A 3ZZ0A 2E1RA 2CNWD 4PZYA 3TR5A 2ANBA 3W90A 3IHWA 4ESVA 2RGNC 4BLTA 1E2IA 1OIWA 1Q0UA 1AIPA 3W8NA 3UMSA 1Z0JA 1X3SA 2IK8A 3R20A 1TX4B 3ZJYA 2W2VA 2O8CB 2A78A 4L15A 3CH4B 5GJVC 4MDFA 2GJSA 4HAVA 1E99A 5HPYB 1E3MA 3DMDA 4EPTA 3L0IB 2NMVA 1X8LA 5J4LA 5GJWC 3RS3A 1WMSA 3W34A 2ZR0A 1ZBDA 3PVSA 3RNLA 3UKDA 5HTKA 1Z6AA 4M4SA 5TV2A 3OE7D 4QGFA 3Q7PA 4O0MA 4JL5A 4WZAE 4XSGA 5FTKA 3MJHA 5EP4A 4YQFA 4URYR 3DEFA 3CX8A 4QJ3A 1KYIA 2FZLA 3TK1A 3BC1A 3PENA 4IDPA 4JLNA 2IS1A 1IOZA 4RSGA 3QXXA 4WA7A 4LJ4A 3H4MA 1C1YA 2GDJA 2Z5FA 2UZIR 3WYAA 1TTTA 1Q1QA 3D6TB 2DYKA 2G9NA 1E69A 3L43A 1E2NA 1H8ED 3EZFA 2N46A 3CRQA 1ZIPA 2X1VA 1KAOA 4KYIB 2FSFA 1E4VA 1KSFX 3KKNA 1Q22A 3HP1A 2C2HA 2ZJBA 1ZM3A 1TQDA 2KBEA 3AKYA 4IDOA 5CB8A 4KXFB 2JLYA 5EJEA 2JJ8A 2EFGA 1NN5A 1ZU5A 2JDID 4Q1FA 2VSOA 3BE4A 3VKHA 2HJVA 4AG5A 1KMHA 1UM8A 4M1SA 3U3JA 4HLDA 4L9WA 5DI9A 1P9WA 5KDOA 5KNCA 2F43B 3NBZC 4ACBA 5IRCD 3ZZUA 4KSCA 4HLUA 3K9NA 1J99A 4GOJA 2ZRIA 4M9SA 2WVJA 5DNYB 2WMOB 2YOHA 3D31A 4LC0A 4O25A 1U99A 1DAHA 2G0NA 4W7SA 2ZQ5A 3BGWA 4DJTA 4HATA 5TARA 3THYA 2P5TB 4B3GA 1KK3A 5L3QA 1GTVA 3IGFA 2FE4A 5FPKA 2YZ2A 1JB1A 1P2UA 2QTFA 2VO1A 1VIYA 1EESA 2O0HA 4A8JA 3PEYA 1GL7A 4DSUA 3THWA 3QUSA 2XNDD 4FXPA 5BWMA 3BERA 3KTAA 3OAAD 2PZFA 4M1WA 4CEHA 5EUMA 1X1RA 1ZNYA 1FP7A 1KNXA 2PMKA 5JHHB 1FX0B 2OAQ1 1DADA 4IOJA 2NTYC 1AS3A 2PH1A 1IONA 1N6LA 1FZQA 2DBYA 1A82A 1Y3AA 3T15A 1MO4A 2JLSA 4G5SA 4TTPA 4PHGA 1RE0A 3KXKA 1AZTA 3GJ7A 3CONA 1VG8A 1BMFD 1R0XA 1XXHB 4ZCLA 5TB5A 1CBUA 5M04A 3PR1A 1Z22A 1A2KC 4BLPA 5KO2A 3SN6A 4AKEA 2BMEA 1S3GA 3KXLA 2RMKA 2HUPA 2ZI9A 2WKPA 2XEXA 4M9ZA 2DFNA 3GLHB 4C7OB 2GCOB 5KNBA 3CX7A 3DPUA 1YR6A 1AZSC 1GITA 2KI5A 3GPLA 2CDNA 3DL0A 4LK2A 1GNQA 2KSQA 4NPHA 5F98A 2ONJA 2BC9A 3HDTA 4MKIA 1HE1C 3HYRA 4F38A 2KJQA 2JLUA 3EZ7A 2W58A 4I99A 4QBIA 1P2VA 3EW9A 1S1CA 3K0AB 1Z0KA 2JAQA 2JIZA 4CYMA 1SHKA 2XTNA 3KDSE 2GXSA 3NC0C 1E2QA 5G41A 5BQ5A 4HAXA 4JSYA 1ZM2A 1QVAA 2AR7A 1E98A 1G16A 1ONBA 4BFXA 1U9IA 1YZNA 2REBA 3FVQA 3HU2A 1NBME 1BYIA 2IYLD 3ONWA 1F48A 1OH5A 3AVOA 1DPFA 4ON9A 5C18A 1R10A 1YR8A 2IEZA 2V6IA 1Z2CA 1AA9A 3AVYA 4DKXA 4CEJA 2XNDA 4PQYA 1XX6A 4RD6A 3BBPA 1JXMA 4QL3A 3LVRE 2AD1A 3W6PA 1T9HA 3ZLJA 4KBFA 3D8BA 4TLBA 4ZCIA 1NLFA 2WICA 1ZM9A 5AUPB 3GEEA 1S1MA 1UKVY 1OE0A 2AXPA 3AB3A 4LHYA 4LV6A 1R2QA 2VIIA 2XB4A 2YJTD 3LBHA 1I4DD 3W5JA 5BN3A 3FDIA 1NMZA 3K0FB 4F93B 3FMFA 3Q5EA 1HQCA 4OJQA 1YZQA 2CCJA 4I81A 4P4SB 4LHZA 2Q9AA 3B2EA 4D4KA 2H16A 4CEIB 4KJZA 3W3ZB 3GLIA 1G8PA 4B48A 4OQFA 3TVDA 4K8OA 1QHYA 3AQ4A 4DSOA 4UKDA 3AV0B 3AP1A 1LVGA 3KFXA 2A5FA 3A1WA 1Q21A 2Z83A 1JR6A 2Q3FA 4A8JC 4L4UA 5GJBA 2MSEB 2PLFA 4GNKA 1W7AA 2V6JA 2WJYA 2YWGA 3FHTA 1F60A 3CM0A 4M8NE 1HUQA 2BV3A 1P2TA 1HV8A 3TAHA 3FFAA 3P26A 4JT2A 1TMKA 2JGNA 3OEHA 4YMUA 3FYHA 2GJ8A 4OJKA 5KTYA 3NVAA 3UG7A 1XEWX 5JEDA 4ZDKA 3SQXA 1N6IA 4MH0R 4LYHA 1KK1A 3RSOA 3C8UA 4UNRA 4CEJB 2NPIA 3IBYA 1UPTA 4AD8A 1LF0A 1NKSA 5KU1A 4BLSA 1IN5A 2OLKA 2JIZD 4EIWA 4RZUA 4Q9JA 1KI8A 1E1RD 1JQLB 2GJKA 1CS4C 2W0SA 3SFVA 3UMRA 3VR5A 1KI4A 3K0CA 3EAQA 1SVIA 2P3SA 4AURA 4PZLA 5AUNB 5AJYA 4DDTA 1NVUQ 5CLQA 3VU9A 5G40A 3KB2A 2CLSA 3EXAA 5FUVA 3U4QA 3ZQ6A 4O3MA 3IQXA 1ODFA 2BKEA 2OFWA 4AC9A 1UKYA 3DKPA 3THXA 2DWPA 1E2PA 2QPAA 1MO5A 1VCOA 2XJ4A 4LDJA 3EARA 2A9KA 2WSMA 4HB0A 2GA8A 2HYDA 5JLJA 5K8IA 2CEAA 3QENA 4G5QA 3VQTA 1XRJA 5JWOA 1JNYA 2FFAA 3GLFE 3AH8A 1VG0B 2JASA 3BIFA 3Q8XB 4TZ6A 5FH9A 4HYYA 3N2IA 4DLSA 2WKRA 3H0KA 4MA4A 1G5TA 4BFTA 1KK0A 3VR1A 1IXRC 4KU4A 1JR3E 2QAGA 2OHFA 2ZAOA 4DCUA 3NHBA 2R6CA 3OEEA 3FMPB 4MRNA 2CCGA 1LNZA 2VTKA 1VIAA 4JBWA 3UATA 2FJUA 2W00A 2GZDA 1YJ5A 1KIMA 2CHGA 2WJHA 4B2LA 3A1SA 5EZ6B 2NOAA 3B1WA 3P32A 5TMPA 4GDFA 2CVHA 1DBSA 2DFLA 1Z07A 2ZYTX 3E2IA 4B6EA 1U81A 1ESMA 4LJ5A 4DCNA 2O8DA 3B7GA 4PC6A 221PA 4RKFA 4RCYA 1Z8FA 3ZQJA 1E9FA 1KZ7B 1XTQA 3QBVA 2EFEB 1XPUA 1ZU4A 3WMGA 2JLWA 1E9EA 2WSSA 2ZI3A 4Q19A 4KHZA 2CLDX 3K0CC 1G9XA 2ZS9A 1L4YA 3THWB 1X1SA 1OSNA 2EYUA 4LHWA 2AWOA 2ATVA 4MGYR 2BDTA 2VHTA 1U94A 2FU5C 2YINC 1PLJA 2Z6VA 4OHVA 2LKDA 3DHWC 4XSHA 5J5CA 2G77B 2IT1A 2QI9C 4A92A 5C4GB 4KLNA 1G4AE 5CK4A 1T4GA 3R9XA 1E1RA 1Q3TA 2WWWA 1DVRA 3T35A 2VHJA 5FBVB 3O8DA 4BPBA 2JLVA 4LHXA 2V4ZA 2ZE6A 2BBWA 2ZPTX 1VKJA 1U98A 3GMTA 4V0NA 4AI6A 1E2GA 1NF3A 3GJ4A 2GETA 2N1BA 4NYMQ 3U44A 1NMYA 2IF2A 1O87A 4DDVA 5EP2A 1WCV1 4Z54A 5FPTA 5JWHA 1P60A 1G1MA 5L3QB 2GCOA 3B1ZA 1OLOA 1G5RA 5HKKA 4A9AA 3IPXA 1O3YA 3ZD7A 1K5DA 2CJWA 4MYCA 1E2HA 3GLGA 4Q5IA 1EFCA 1NI3A 1UDXA 4FMDF 4NCIA 2BEKA 3C15C 3SYNA 3KQLA 3RWMB 1CR0A 4QGGA 4XH9B 5KNDA 4IOLA 2J7PD 3OIYA 3BORA 3SHFA 1U8YA 3LQQA 2F6RA 1Z6TA 3S1AB 3A8TA 5L3SB 4ACAA 4EJSA 4TTQA 5KDLA 4URVR 1GUAA 3C7KA 3AKDA 3PCRB 5KYKA 4HZUB 4Y0VA 5KUTA 2XJ9A 3TQCA 4B3BA 3QI2A 3NH9A 5EQTA 3CWQA 2V55B 4V03A 1GKYA 4QOSA 3A4NA 2RGEA 3FPAA 4JLMA 1U8ZA 1ZD8A 2HLDA 2V8OA 3DZ8A 4EPRA 2HDNB 4N0DA 4NH0A 1C9KA 4M0LA 3PUVA 2LCFA 2WWFA 1AN0A 1W0JD 4IHQA 4CW7A 1OB2A 3A36A 2EYQA 4GBMA 4A2WA 2QRNA 3LA6A 4D4LA 4BZPA 4ZO4A 5K8LA 4QFMA 1I2MA 1X8JA 4G01B 2WWYA 2BJVA 1HQYE 2MMGA 1D2NA 3QKSB 4LBVA 3C41J 2RGXA 3SNHA 1S9DA 4DUGA 4QM6A 3AF2A 4GZMA 4A6XA 2NZ8A 3VX3A 1RRGA 4WZBE 1P9RA 3BAFA 3MWJA 3QG5A 5KPJA 3QEJA 1OXXK 1W0KA 3T5GA 3QSYA 4Q7KA 4AKGA 2ZRAA 2HT6A 3E5HA 2IHYA 2ZITA 4NTZA 3K0EA 3T1QA 3FOZA 4C0LA 3WP1B 1AM4D 4D0GA 3O8CA 3NBXX 1W48A 1AS2A 4BFWA 2QY9A 1XTKA 1SXJC 5JI2E 1W5SA 1XZPA 2BMDA 2XITA 3LDAA 4O2LA 1ZNZA 2WKQA 4G0NA 1UKZA 1JECA 2WJGA 3LBNA 4IVRA 3PJRA 1M1YE 3GCGA 3SBDA 1GDDA 3Q9LA 2RHDA 1E79A 4DB4A 2A3RA 1SGWA 2IXGA 4F7WA 2ZI4A 1AQYA 2GK6A 4LPSA 3GLGE 3RRNA 2IWHA 2FFQA 3FKSD 4Y0AA 3B1YA 3ND8A 1JQJC 3AGPA 1GL9B 2GJ9A 3OFND 1UADA 1ZJ6A 4TL8A 5IHPA 4Z1MA 1T3SA 4G5RA 1IM2A 3EZ9A 4AYTA 3QOFA 3QEOA 1W0JA 2FX3A 4D26A 2VH5R 4D6PA 3OAAA 2C9YA 2GHIA 5FOSA 3RC8A 4TMVA 4TYPA 2O8CA 1NJGA 1OB5A 4HUQA 2FV8A 5FBQB 1P61B 3LH5A 4OHWA 3R7WB 3C5HA 4D0NA 5L3VA 1AJEA 1M7BA 3UK6A 2EFCB 4N1AA 1B23P 3LW8A 3HPQA 3MG9A 3I92A 3MUFA 4PZZA 3CNLA 3KFVA 3WP0A 1ZW6A 4DEXA 3PIRA 5L3RA 1WBBA 4EPWA 4ESHA 721PA 2P2LA 5DI3B 3GFOA 4DZZA 5B64A 4F4CA 2Q9CA 3T12A 4TSFA 1HA3A 1CKEA 1I2DA 2FSHA 1J70A 1VCMA 5TVKA 3ICEA 5JJLA 3M6AA 5FR1A 1DELA 2J7PA 1HEIA 3QKRA 4BFSA 1N6NA 2HJGA 2IXFA 1E4YA 1VPLA 4JBXA 1GVNB 4HSEA 4NZYA 3TSOA 2VP6A 1WA5A 1Z6GA 3NIBA 1N0VC 3X1DA 5JJIA 1P72A 4C9BA 1HT1E 4QNMA 2ZYUX 5CYOA 3TNFA 5HE9A 4C4PA 3U44B 3MAAC 4OQNA 3T1VA 2H57A 3KJEA 5FL3A 5C4MA 4QHSA 5EP3A 3ICQB 1E9CA 4QGHA 1WXQA 4M53A 3C5CA 4PSVA 1XCMA 2EWWA 3MFYA 5AWFC 4ASUD 2QPOA 3UIEA 1G8HA 3CO5A 3A6PC 4R98A 5EXXA 1N5LA 2W6JA 2V3CC 4TYQA 3VX4A 3FKQA 1VG9B 1OXSC 2OG2A 1ZUIA 2O8BB 4NCNA 3G5UA 3QVVA 4P4SA 2YHSA 5AJVB 2JJ1A 3PXGA 4MRRA 2GJAA 5E95A 4EPXA 1W4CA 2MMCA 2ZUCA 2FGKA 1OHHA 3VHLB 4TLEA 2F55A 3GJXC 1D2EA 1QHSA 3TRFA 2FOLA 2HCBA 4HDCA 4ZDIA 5TY0A 2WSSD 3HU1A 4PX9A 4ZKDA 4DCVA 3WHKA 4JVSB 1FTSA 1EWRA 3THOA 4H9GA 5CIQA 4DLYA 1GWNA 4TZ0A 3P4XA 4FMDB 5KSPA 3DOEA 5JS8A 4LX0A 4BZXA 3HR7A 4QXAA 1XPRA 3THYB 3BWDD 2J41A 4BLOA 1ZINA 5EE1A 1COWD 1EXMA 1LV7A 4ASUA 1G3MA 4G3XA 1K8RA 3ZS8A 3TQFA 1SXJD 4BUJA 3FE2A 3QKUA 2C96A 2XAUA 2WM9B 4Q18A 5DHFA 5FTJA 1S4QA 1W47A 1QBKC 2ZROA 3PG5A 4TTRA 3IILA 3UANA 2V7QA 1Z6XA 1QHXA 1XEXA 2O0KA 5LB2A 4D25A 3A37A 1UJ2A 1NJFA 3ZD6A 1DARA 3CB4A 4NYIQ 1Z0AA 1EG7A 1R5BA 4XVRA 4HZIA 3TW8B 1L8QA 2R62A 2J0QA 1XDBA 1XMJA 2B92A 3B8HA 4MKGA 4M1TA 4PC3A 3I73A 2QORA 2O8BA 1ZD1A 4HLUC 1G18A 2NZJA 2ZE5A 4TT3A 1UAAA 3OZXA 4Q02A 1SVKA 1UFQA 1VHLA 3K9HA 1KI1A 3ASYA 3EA5A 2RGBA 2WMNB 1OKKD 1KSGA 1GAJA 1GIAA 3NC1C 4OI4A 2OBNA 4Q4LA 3DM5A 2OZEA 2C03A 2NIPA 4KFUA 2JEOA 3GLIB 4V0KA 1R8QA 1D8TA 2J45A 4KITB 4HLQB 4Q7MB 1XFAA 1S96A 1XF9A 2EWVA 4TLDA 1FNNA 2GBLA 3F5FA 1TU3A 1ZRHA 3AKEA 3ECCA 4NBSA 4EDHA 4OBEA 1KO8A 1FMJA 3I1FA 4U5XA 2XZLA 1ZM4A 2GTPA 1U90A 1FQKA 2FFBA 3QE0A 3A1TA 2FF7A 3OEHD 4MITA 4UJ3A 4C0KA 1NVVQ 1OFTA 2VF8A 3KKQA 4KVGA 4QJ4A 3NTUA 5EE9A 1EWQA 3IIJA 3U7EB 3EPKA 1BYUA 2ZUDA 4IJMA 2BCGY 2J1LA 1TQ4A 1QG2A 3CPEA 3H1TA 3OIVA 4AIIA 3T34A 2J59A 4U00A 1XD2B 3HJNA 4YMSA 1V43A 3C16C 3M0EA 4OKSA 3IEVA 1N6PA 2YOGA 1R0WA 1J8MF 2CE2X 3BD9A 3IO5A 4NMMA 3CUEF 3WHLA 1CJMA 2D2FA 1D6JA 3TUIC 1G21E 3A4MA 4E03A 4RZ3A 1CR4A 3V00A 4Q4HB 2QM8A 4C0HA 2WWIA 4DLUA 1OF1A 1W0KD 3NBFA 5CIWA 1J8YF 1RW4A 1VMAA 3Q85A 1FMLA 1U0HC 4A8JB 1QG4A 2Q3MA 3QKRB 3R8FA 5JMTA 5LD2C 4ZIRA 1Z6YA 3WBJA 2YC2C 2ASEA 4HEJA 4C2UA 4F4JA 2VP4A 1G5PA 5SZIA 1Z0FA 5SZKB 3LWNA 1DG1G 1CJVC 3I4LA 1TNDA 5JSZA 1MKYA 2QUZA 3P1JA 3W3AA 3K8YA 5HCIA 5P21A 1NBMD 1S9HA 3EWSA 4W5JA 3QF4B 5LDDC 5GVSA 3PQCA 4OK3A 2VEDA 4LBWA 4DLXA 2NO1A 3RVBA 4EQ6B 2OFXA 3QXHA 2FFHA 5EXSA 1X86B 4URXR 4QBHA 1XD9A 1FPMA 4NHOA 1YHNA 3SHWA 5DE3A 1ZIOA 3HPRA 4UXJA 3VR3A 2K5UA 1D5CA 2YOFA 3FGNA 5J4YA 4JLBA 4TLCA 1EGAA 4GFDA 1BIFA 5KSZA 3EG5A 2REXB 1UBFA 3ADBA 4JKIA 4EAQA 4NCHA 3U7FB 3FMIA 3LLMA 2W2TA 2F9MA 2IC5A 1T5IA 3ADCA 4M1MA 5JWRA 2R6DA 4RD1A 1QHHB 1E96A 3WXMA 1FNMA 2F9LA 2G1JA 5EE3A 1RRCA 1R4AA 4UJ5A 4Q21A 3AVUA 4M2LA 5KDDA 5DLQC 1XTRA 1DTSA 2QE7A 4Q1CA 4FCTA 4RCZA 1I4TD 1W46A 3X1WA 1XTJA 3IDQA 4FCWA 5DN6A 4ILEA 2FMXA 1E2MA 4ERNA 5HKKD 4JLDA 3MJRA 4PQRA 5CDFE 2QT1A 2AKAB 3EIHA 4IRUB 4OHXA 5G53C 1M7GA 3L0OA 1SZPA 2A5JA 3ZGXA 3FMOB 1G8GA 1OJLA 1U0LA 4I1SA 2H18A 1YE8A 3T06B 3C4JA 4PC7A 5K8UA 2J87A 4JBYA 4HDOB 1P4SA 2H92A 2CLCX 2O52A 4OQXA 3DDCA 4Q1AA 2E9SA 2H5EA 2ZREA 1BO6A 4MUBA 2AFHE 4M22A 5JRJA 1ZM7A 5BXQC 2FSIA 2JJ2D 2WOJA 5A5GA 4CF7A 4PO9A 4P4UA 3AF3A 2VBCA 1CRQA 1BH2A 2ORWA 1B0UA 1KDTA 2ZRKA 3GLGB 1KHTA 4A6PA 1MABB 3U60B 1EFRD 3CF2A 1ZMXA 3X1YA 1W2GA 1OYYA 2R65A 4KFSA 4A2PA 3UWKA 3IEUA 2RAPA 2OFOA 4RFSA 2B7CA 2C77A 1WB9A 5LBIA 1CJUC 3MMPA 2KB0A 2WTUA 2PEYA 3QIAA 4JJZA 1FW6A 1TU4A 3UPUA 1Z63A 1FL9A 2PX3A 1R7RA 4FMCF 2ZSFA 3D3QA 4JLOA 1SXJA 3LV8A 4DEYA 1P2SA 2GCNA 1GFIA 1GILA 4QHTA 4TQUS 4US1R 1MV5A 4CDGA 1G8YA 3EASA 1COWA 1PLLA 4A1FA 4B33A 1MOZA 4BWYA 3U7HB 4MDEA 2XSZD 3I32A 2VRWA 3S1AA 3I61A 4EPVA 1M6NA 2BKUA 2FA9A 5DHAA 4ZDWA 4TYWA 2X19A 1U9IC 3QKSA 4A0RA 2GVZC 3GP8A 1R5OA 1NN1A 5FPSA 4ZV4A 3H84A 2XNSA 1UEIA 3RWOA 2J9RA 1OFHA 1R0ZA 1TEVA 1Z08A 2CK3A 5DYGA 2J0UA 2WWHA 4TQAA 2I1QA 1DEKA 2C95A 4M1KA 4B75A 1OHHD 4GL2A 4JLAA 3I72A 1IN8A 3VNUA 5JEEA 3BFKA 1M8PA 3ZIAA 2EFDB 4WIAA 1GP2A 2WWXA 4DSNA 2B8TA 2FGJA 1KSJA 4BLQA 3EWAA 4D80A 4O2RA 1EFTA 2CK3D 3QF4A 2ZTSA 2IHBA 4TN1A 1OW3B 3K09A 5JBQA 3NHAA 4PPNA 2FG5A 3QNUA 3UWOA 3U4QB 2BIFA 3KX2A 3RRYA 1ANKA 2AN9A 1K5GA 2FWRA 4POAA 1NVVR 3VR2A 1N5IA 3KQUA 2P6NA 4V0OA 1GRQA 4OK5A 5FOUA 2O8EB 1QDEA 3EZ2A 4Q47A 1S8FA 2HF8A 4LV5B 2Q21A 4PAOA 4CZ2A 1JR3A 5EUQB 3RRZA 4FWTA 4B2PA 2RGAA 1N6HA 2DFTA 5E7JA 1AKEA 3V4RA 2UVQA 1H8HA 2GEVA 3GLFA 2QMOA 2RKOA 1AS0A 3C14C 3CRW1 3KJIA 4BEJA 3L2OB 2X77A 1W2HA 2ERXA 4JLJA 4KLZA 1JAHA 4M9QA 4B73A 5CJ2A 4DLVA 5JCPA 5FUYA 2RCNA 2QBYB 5F9FA 1ZAKA 4XIGS 3MGCA 4EQ6A 1KDPA 1Z29A 2BWJA 5SZHB 4MYTA 2ZRJA 2ZI7A 4Z8XA 1DG3A 3L8ZA 2QENA 3REFA 4C0JA 3GJ3A 1EFRA 4B3DA 2ZETA 3SJZA 1OFIA 1G8FA 2PJRA 5G3YA 2ODBA 2Q3HA 4I4LA 1A2BA 1E2DA 4JS0A 2IS2A 4KYUA 4TLAA 3IBGA 3W9YA 421PA 1XU4A 4V0MA 4FINA 2YWEA 2PCLA 1TQ6A 3SS8A 1ESNA 3BK7A 1II9A 1I4LD 2Q9BA 2WAXA 4RD2A 1F2TB 1MRSA 5JCZA 2IYVA 2FDCA 2B6HA 4US0R 1IXZA 3AM1A 3NDPA 5FBLB 3SC3A 4Z1MD 3TUJC 1W4RA 2ZSDA 2HXYA 3PUYA 3WYGA 1Z83A 4NYJR 2UKDA 1RC8A 3J81k 2ZAMA 2FEOA 3Q3JB 4Q7LA 4GRAA 4IFBA 4BGDA 3U6KA 4KV9A 3F3YA 2IUSA 4BFVA 1W44A 4PR0A 1XZQA 2DCUA 2GRJA 1NSFA 2QE7D 4PFSA 3TJZA 4YDHB 6Q21A 4V0ME 4LWZA 4CGZA 2EQBA 3CNNA 3ZYCA 2AFIE 1JEDA 1SHZA 2IEYA 4OI2A 4PO8A 4LBYA 1AGRA 3R7WA 3AUYA 1TF2A 3VR4A 3GLIE 2GCPA 1UBGA 3AGQA 1OFUX 2OXCA 2C04A 3SE0A 1RKBA 1SXJB 2V1XA 4GT1A 5IDVA 3GJ5A 3HR8A 1F3OA 5H68A 1IAQA 1KTVA 2DPXA 1P7CA 2ZU0C 4F92B 3ZVMA 1JAIA 5GVRA 1SVOA 2FZ4A 1GNPA 3MRSA 4NONA 5FTMA 3LXXA 4IVPA 2RGNA 2GKSA 1Q44A 2VF7A 2ZJAA 2V7QD 4Q4JA 4K81B 2QP3A 2AK2A 2C5LA 3X1XA 3VU9B 1GKUB 2ZJ8A 1Q20A 4KI0A 3U3RA 2PCJA 2Z4SA 3F0TA 1P62B 2PZGA 4LPKA 1KI3A 4URUR 5HCNA 4CIDA 2WPDA 1KY2A 5E7IA 2FN4A 3IKJA 4FMBB 2IS4A 4L8GA 1G20E 3WMFA 4R7ZA 5IK2A 1Q12A 3L0PA 1RJ9B 1WE2A 2F43A 4DWJA 1WRBA 1EFHA 2OILA 1VECA 3T1OA 1NY5A 2VP2A 3SEAA 2VHQA 1OH7A 3QPVA 1KI7A 2BJWA 2G6BA 3SJBA 3X1ZA 1FUUA 1UBEA 3ZH9B 2J0VA 4W9MC 2YYZA 4FWIB 2O8DB 2JA1A 4TMZA 4DDUA 4YMVA 3GLFB 1FTNA 4DLTA 1YU9A 3NEJA 4HUQB 2OESA 1TEXA 1KI9A 4GMXA 4D81A 2HV8A 1X6VA 3REGA 1MRNA 1R5NA 3AVPA 3EPJA 4OL0A 1QZXA 2QAGC 4J0QA 2HT1A 2ZRFA 1G3RA 2RHMA 2QQEA 5CM8B 3CRMA 4NYMR 1N0UA 4PAMA 4G1UC 1GNRA 4TL7A 3OHMA 1D9ZA 4PSKA 2W83A 2A5DA 1ZUNB 2Q0HA 1IJFA 3WYFA 1CTQA 4LGMA 1S2MA 2ERYA 2L0XA 4NL4H 3GFTA 1NL3A 2R2AA 2J7KA 1C4OA 1NRJB 5ELXA 3G0HA 1IBRA 1IN4A 4LJYA 5IT5A 3SJAA 2XXAB 1G6OA 4DLRA 4PC2A 3AVQA 3VKGA 2QG6A 4ZDJA 4RJLA 2H17A 3X2SA 3BH6A 4Q66C 1N2CE 2JLXA 3KUCA 4HAYA 5FOTA 2D2EA 2AD5A 2ORIA 3VHXA 3BFVA 1DAIA 1HE8B 3IPYA 4AK9A 4JMPA 1AGPA 3SI7A 1QHGA 1N3BA 1G64A 2AHOA 2YV5A 2ZANA 5HZHA 1KOFA 2WIBA 3NDBB 1GOTA 5J47A 4A2QA 1F2UA 2OBMA 2FNAA 3VKWA 3AVVA 5A4JA 3TAUA 4EPYA 2YC4C 4M9XA 1YRBA 1W4BA 2QQ0A 2N42A 3EPLA 3P27A 2ECKA 3Q72A 3T61A 4RKEA 5FBRB 2WV9A 5C2JB 4DB2A 4AYWA 3LXRA 5HE8A 5B30A 2CL7X 1LW7A 1E9AA 2BMFA 2QMEA 3IIKA 5AJXA 2GILA 4KVAA 4OI1A 2B21A 3EPHA 2OBLA 1DS6A 1S0UA 3ZVNA 5BW8A 4UQOA 1CU1A 3CF0A 3RS2A 2ORVA 4B43A 2ZVQX 3E1SA 5J4KA 4DIDA 3KKMA 4QG7A 2REOA 1U8AA 2QP9X 1L2TA 4HZUA 3N5CA 3G82C 5DI3A 5CDFA 1E0KA 2QZ4A 1G3IA 3BH7A 3WNDA 4BRWA 1JPJA 1W5TA 1Z3IX 3FKSA 3M4YA 1SXJE 1Z28A 4XWAA 1ZVQA 4C0BA 5L8VA 1G41A 2BHRA 5TXGA 2O8FA 1GSIA 3KKOA 2DR3A 4NYIR 1LF5A 2V54A 1S3SA 2F1HA 4C0SA 3B13B 3FWYA 5BN4A 3Q5DA 4MKHA 3V9PA 4DIEA 8OHMA 2ATXA 2R6GA 2ODNA 4RFVA 4YXWA 3VTKA 1GL6A 4PHTA 5FPYA 4QGAA 3CZQA 2QL6A 2OEPA 2DFKB 2KWIA 4R2IA 1E2EA 1CULC 5AUQA 3M1IA 3I8SA 4L16A 1LY1A 4JLPA 4R71A 5GADl 2GXUA 3GEHA 1WF3A 1EX7A 1RFLA 1ZCBA 4NYJQ 1DAMA 3KQKA 4LYAA 1TL7C 2Z4RA 3WMEA 2DB3A 2HF9A 2JATA 5AR1A 5E7MA 3CR8A 1ZP6A 2CE7A 2IYYA 2OXRA 4B47A 2O8FB 2ZJZA 1KSHA 1NVWQ 5IF9A 4OHYA 4BFZA 3I5XA 2QAGB 4IDHA 4MGIR 4BECA 5KOYA 3SBEA 3QXSA 4HUTA 5FL7D 1M7HA 1NMXA 4DBLC 3A1UA 2G3YA 2Z43A 3DO6A 1G4UR 2WBLC 5L3SA 3BB4A 1QVRA 5SZJA 2F1JA 1ZNWA 2SHKA 3GEIA 1XWIA 1BKDR 4YLGA 1US8B 2J0SA 4Q4JB 2BM1A 4ZI3A 2WHXA 4NCKA 3CKLA 1E9BA 1FUKA 4DT1B 2BVNA 2PL3A 2R8RA 2W2XA 3B85A 4BRUA 2ZEJA 4DHEA 1Q1BA 1G7SA 1E1QA 2CCKA 2D7CA 3LFUA 4JKYA 1W1WA 3PEWA 2FEMA 2A2ZA 5FI1B 5DGXA 3DZDA 2HLDD 3KUDA 4JL6A 4AKHA 3CX6A 4KCGA 3CWZA 4C0QC 4GZLA 2PEZA 2C9OA 5G3ZA 4NKRA 1VCNA 4CT4B 1XPOA 2OT3B 4B34A 1E9RA 3QVUA 3CRRA 3BH0A 4WZ6A 4RY2A 2F3TA 1VDZA 4PPQA 2XZOA 1J7KA 2MSDB 1IN6A 4TSFD 2ZJOA 1T0JB 3VFDA 1PVOA 5AJWA 2XB2A 4L5BA 2RGGA 3SZRA 3AEZA 3QF7A 1GG2A 1KO7A 4EKDA 4I1OA 3H86A 1PLKA 3B9PA 2BCJQ 1KJZA 4RFSB 5DIFA 3VR6A 3JVVA 1D9XA 3P4YA 3K70D 2G83A 2RGCA 4XVQA 1NVXQ 5D3QA 4GSYA 3OESA 1XBTA 2OCYC 5BN5A 5IK2D 3O8RA 4KAXA 1Z5ZA 3CW2A 5CLLA 1II8A 4ARZA 3TLXA 4LHVA 5FR2A 3NG1A 4ABYA 1A1VA 3OFNA 1G291 2ZE8A 4H1UA 4FIDA 3CRVA 5UKDA 1LS6A 3QKTA 4LYFA 2BBOA 4BQSA 4JYBA 2IYSA 1KNQA 1PJRA 3TH5A 1DOAA 2ODEA 5J4VA 5FL7A 3AP2A 3RANA 1ETUA 3WBKA 3RAPR 4B74A 1XJ0A 1AKYA 4D82A 4P33A 3EX7C 1LB1B 4BLRA 2CL0X 4M1OA 2OV2A 3BJIC 4DVGA 5H70A 4ARZB 2YNMA 4WOPA 2IW3A 2XX3A 3KKPA 2G88A 1NIPA 4X8HA 2P6UA 3AUXA 4R9UC 2C9CA 1KMQA 1N25A 2VSXA 2WIAA 4URZR 4UNPA 4R2HA 2I3BA 1W49A 3EIQA 4A0FA 4XVUA 1X8KA 5FTLA 1E2KA 1NN3A 4V0LA 1NN0A 1TADA 1JJVA 2WWGA 4WBSA 5CITA 1NP6A 2XSZA 1EFUA 4TMWA 3T1TA 2OLJA 3RS7A 2ZRGA 2VL7A 3LLUA 1P73A 2NPFA 4DUGD 4RVCA 4US2R 1NKTA 4PQFA 2ONKA 1ZD9A 4BEBA 3TIFA 3PEVA 1T3HA 1JJ7A 2AXNA 1F2UB 5JRZA 1E2FA 2QSYA 2VP0A 2W6IA 2ZRPA 2H1LA 2IX3A 2YWFA 5EE0A 2NO0A 1E94E 2GAAA 5FFMA 2ANCA 1IQPA 1CLUA 2CJWB 1MT0A 2A30A 3PITA 1CJKC 2OO7A 3QXJA 3FTQA 1CRPA 2A5GA 1KI2A 1N5JA 2IYTA 4DDWA 4HB3A 4LZZA 3FFBA 1DAKA 1DO2A 2QRZA 5F2EA 4LJ9A 2HYIC 1W36D 5FOWA 4E22A 1RJ9A 1JEEA 4Q00A 4MGKR 1RRPA 1TF7A 2QPTA 3TVTA 3QG1A 3K9GA 1U2RA 4IOMA 4FI3C 4B6FA 5H1YA 3F8TA 5EP1A 1JI0A 5EZ5A 4P3YA 1FOEB 1VYTA 3EC1A 2RB4A 5DH9A 2YKGA 4OK6A 4TL6A 3EC2A 4PTLA 4QC2A 3IUYA 5CYPA 4RZXA 1ELOA 1QF9A 2CBZA 2CHVA 3MCAA 4JLVA 4HB4A 4DCTA 2A5YB 2W0MA 1YRAA 1XMSA 3U61B 3R9WA 3LAWA 2JDIA 1KGDA 2QM7A 4MQBA 1HYQA 3GLHE 5D3MB 3IO3A 2OCAA 4CRWB 1AK2A 1H8HD 3TW4A 2EW1A 2VPPA 4B76A 2GEUA 4JIMA 1H65A 5ANRB 1UF9A 5CB6A 1IY0A 1JR3D 1CXZA 4HB2A 1XCGB 3JZAA 1H8EA 3MLEA 3UG6A 1W36B 3AVXA 1LFDB 1KZGB 4F4IA 1QRAA 2GF0A 2HXSA 2XTZA 3I8XA 5LPNA 2VQSA 3I62A 1J90A 2JLZA 2H8KA 3TSWA 3KJGA 3GJ6A 3OIUA 2IA5A 2MSCB 2QMUA 3MWLA 3LNCA 2CHQA 3RHFA 2O8EA 4KFTA 1TUIA 2B8WA 4LJAA 4Q9IA 3GJ8A 2ZJYA 2ZRCA 3OE7A 2F1IA 3HU3A 1TQ2A 3ZIAD 2R9VA 4S35A 4BFUA 4BZQA 1FX0A 521PA 1NY6A 1XMIA 1II8B 2P67A 5DISB 2BBTA 4CVNA 5AJZA 3EZ6A 4XTRA 4Q7JB 3B82A 1N6KA 2IYXA 3LD9A 1XTSA 2ZYVX 3KJHA 1OIVA 3KZ1E 2ZSAA 1DAFA 4JSTA 4UNNA 4JL8A 4LJ6A 4XJXA 2OCBA 2ZSEA 4U02A 4XD7D 2DY1A 5LD2B 1Z47A 1E0AA 3NBYC 3NEYA 3QJYA 1G7CA 3ZDQA 4FN5A 4E09A 3VNVA 3OEED 5FOXA 2H7VA 2PZEA 2QN6A 2I4IA 2WPDD 3OIWA 2P65A 1OT3A 4B35A 1CP2A 4I1VA 4D4MA 1VTKA 4BE7B 5EE5B 3RC3A 4A0GA 2ZRLA 3NKVA 5KSOA 4IXMA 4DLWA 5FBWB 2ZE7A 2WZQA 4Q9LA 2C78A 5FOVA 3BFXA 4AKIA 4GMDA 3PV0A 1NG9A 4PHFA 2ZI5A 1HURA 1KDOA 3W8RA 2GZHA 4QBGB 3ZZTA 3TR0A 2QGNA 3DM9B 4RZ2A 4PC1A 2Q6TA 3EA0A 4EUNA 1IY1A 1E9SA 3PUXA 2JJ2A 2XXAA 2HEIA 1M34E 4TYYA 2PT5A 2OUKA 2ZXUA 5H8WA 3I3SR 4W5HA 2J3EA 3B9QA 1XMVA 3IHLA 4IW3B 4IOKA 1PUJA 1Q57A 3V4FA 2LKCA 4RD0A 1KJWA 2PMDA 1BMFA 1XXHE 3KQHA 2PBRA 3CLVA 4PSAA 4UNSA 3TUZC 2DHRA 4DXAA 4LRWA 3BOSA 4F91B 3K0FA 1VYUA 2V9PA 2VHUA 3O47A 1XJCA 2ZJ2A 5K8TA 1L4UA 1UEJA 3A58B 2C99A 4HDQB 3U5ZB 2P0EA 1M2OB 4Q03A 4MYHA 2C98A 3RABA 3IIMA 3QXCA 1LTQA 2VP5A 5DN6D 1NSTA 5BYKA 3GQBA 1YZGA 1HY3A 1XD8A 2RH5A 2FPLA 2QNRA 3AF0A 3H2YA 4MYUA 1GRRA 4OYHA 5AUOB 4PANA 2B7BA 4OQLA 3R9IA 4JZKA 4B3CA 3SOPA 3SYLA 4U7DA 4KBGA 1UDWA 1P3JA 4TT3D 1KO1A 2PT7A 3LX8A 2QU8A 3SDZA 4EJSC 4B3FX 4TYNA 3RS4A 1NLZA 3QPWA 2ZRHA 4JVMA 1T6NA 1XCPA 2ZS7A 1T3LA 3ETLA 4Q9HA 1XEWY 3QQ5A 4AYXA 5KPDA 3AP3A 3GJ0A 4CEHB 4Q9KA 3KTAB 4B32A 1VG1A 1N6RA 2E87A 2R44A 4RD4A 2JLRA 4ZIRB 2ZM5A 2AL7A 1DAGA 4IFEA 3WY9A 4C2TA 4DT1A 2P6RA 1ZNXA 3KL4A 2CL6X 1KO5A 2ZRNA 1J2JA 4LYJA 4Q4HA 2WJJA 3ADKA 1SKYB 5KHOC 2QGZA 5AK0A 3SYKA 1MABA 1XEFA 2OCPA 4S2EA 3CBQA 3L8YA 3A4LA 4EFNA 2WJIA 2O0JA 3BB1A 2IS6A 2IUUA 3U3MA 4XD7A 3B78A 4JJKA 2RGDA 3ZVRA 1T8UA 1OH8A 1XXHA 1XD2A 3AVTA 1UKEA 3GFPA 2UZ3A 4XWKA 1SVWA 3CIOA 2VHCA 2AK3A 1KMHB 4IXNA 4P0TA 1OXUA 1P75A 2QA5A 3BXZA 2LWIA 4MRPA 1XJQA 3SFZA 5B2ZA 4B3XA 2IF0A 2J46A 2QTVB 2ZYWX 4Q1EA 4DC9A 5C1BA 1MH1A 2TMKA 1CJTC 1RPZA 2DWQA 2IWRA 4TMXA 3ZS9A 4DCSA 1KI6B 3K1JA 2BOVA 3OF5A 1QHNA 4C0AC 1KKMA 3L0SA 1JALA 3I5YA 4Q1BA 3GD7A 4P4TA 3LVQE 5KSYA 3UMFA 4YONB 5LB4A 4HAWA 2GAOA 5C46F 3CF6R 1L7VC 4V02A 1CR1A 2QBYA 1RYHA 2ODWA 3RDPA 2JJ1D 3KQNA 2NGRA 2FPKA 1CR2A 1R8SA 2X8AA 1NIJA 1Z0IA 2XZPA 4JVLA 4MKFA 4MRVA 4PXAA 1MO6A 5JSZB 1CEEA 4QHYA 1RIFA 4YMTA 1KJYA 2W6JD 3CNOA 3Q7QA 3WNCA 2R6FA 2CNWA 1VYVA 3U6BA 2D62A 1DE0A 1Y63A 3TGPA 3B1XA 1IXSB 4HLCA 5TDHA 1G19A 1P9NA 4N3NA 1OXTA 4FCVA 3RYTC 1N6OA 3U3OA 3CPJB 1YQTA 1YZTA 1P6XA 3A1VA 4WAUA 1ZC3A 4EFLA 1KI6A 3K53A 3DOFA 4X8MA 1OV4A 4I1UA 2BBSA 1EX6A 2PJZA 3IQWA 5JJKA 4CT5A 2GXQA 3ASZA 2GNOA 4LOAA 2D7DA 1ZUHA 1W36C 1IN7A 1GZSA 4B44A 2IBMA 2ZJ5A 4X8LA 1KK2A 4P31A 1IY2A 3NXSA 2QT0A 1VHTA 3AF4A 1E32A 2GZAA 3K70B 4TL9A 5D3MA 4DSTA 3AF1A 1GKIA 4DLZA 2NO9A 1XP8A 4IKEA 1R6BX 5EXTA 1Z06A 2Y8EA 2ZS8A 4HI0E 1HT2E 1BS1A 4JYCA 4LC1A 3N70A 3O8BA 1E0JA 2NQ2C 5JI3E 4H1VA 4OQMA 4MUAA 3HYTA 3RS0A 4LJ7A 4TWZA 1T0HB 5HR5A 3DKVA 1G6HA 5B58C 4IDQA 2PX0A 3LO5A 3PEUA 4RD3A 2AX4A 4QKQA 4QM7A 2PLRA 1PZNA 4HAUA 4NU0A 3P20A 5DYIA 4BASA 2D06A 3KB1A 5JECA 2C8VA 3B5JA 3AVWA 1KAGA 2V1UA 4TMKA 1KY3A 3QBTA 1F2TA 3DVLA 1E2LA 2G1KA 2OAP1 3RRMA 4URWR 2XOKA 4E5UA 2GK7A 2R6AA 2CXXA 2W6ID 3E70C 2IYUA 3NH6A 2O5VA 3THXB 1WBDA 3LX5A 1T8TA 1MR3F 5E4FA 2ZSBA 4KFRA 1YZUA 5A0FA 2DWOA 3ZVLA 1II0A 4G5GA 4Q1DA 3HWSA 3R8CA 3UXMA 3GLHA 4C7OA 1GRNA 3WRXC 1E79D 4YMWA 2IYWA 2QP4A 2WAYA 4FW9A 4KODA 2I1VB 3MSXA 3PUZA 3CPHA 1G17A 4Q4AB 5FPHA 3WNBA 4NE2A 3K70C 1GM5A 5DO9A 4NP6A 2XGJA 1SQ5A 1W4AA 3PFIA 4QJ5A 3W5IA 4P32A 4GP6A 5JHGB 1G7TA 1MO3A 3FHCB 2QAJA 3WRYC 4PHHA 2QTHA 4AG6A 4YC7A 1YVDA 2VP9A 1WDTA 5HZKA 2IXEA 1BOFA 3MD0A 5J4HA 2D4HA 2GVDC 3K9LA 1IHUA 2ZU6A 4EFMA 1SULA 1SVLA 5CJPA 4B2IA 1G3QA 3SQWA 4ZI2A 3FHOA 1JXOA 4MGZR 4QBFA 2FH5B 4JVNA 4WXRA 121PA 1LS1A 4Q01A 2ZUBA 1A5TA 1RYFA 1WQ1R 2D74A 2ZIAA 1T5LA 4JT4A 3U7GA 4B71A 3B1VA 4WXPA 1RRFA 2JLQA 2AWNA 2YVUA 1QHIA 1YR7A 1A4RA 2IUTA 1ZYUA 2A7QA 4D4JA 3JVUA 1TAGA 3LRPA 4XTCS 3K0SA 2F3RA 3LW7A 4HAZA 3TE6A 2VLIA 3SJCA 1HTWA 3RSLA 4OI0A 1U0JA 1ZCAA 3K09C 4GOXA 3CZPA 5EXPA 2VA8A 4IVQA 4M1YA 1KO4A 4WW0A 2F1RA 4L9SA 4PO1A 4AWXA 1YZKA 2F7SA 4D2IA 4CEIA 1NBMA 5CK5A 1D2MA 1WP9A 4FMCB 2GF9A 2GESA 2Z0MA 4GI7A 621PA 5F3WB 2WOOA 1IJEA 1SKQA 1A7JA 1G7RA 3DMNA
chains in the Genus database with same CATH superfamily
1N0WA 4TLLB 2IRWA 4DG9A 1YQQA 4WDQA 3BULA 2GEKA 4GOKA 3F6CA 4C30A 4JDPA 2ZRBA 4PPFA 4LCBA 4X61A 3W7BA 5BUZA 2CB0A 2HPVA 2GHQA 3I9NA 4K46A 1Y33E 1GM5A 3N2EA 3FLMA 2WM3A 4UTPA 1TJ3A 4I9NA 4JT9A 1BCSB 3DMPA 3GLUA 5FUWA 1V35A 4BFYA 1L8LA 1R8JA 1V8BA 3BTSA 1CP3A 2P9QA 4M8IA 5DX0A 3ZWKA 4DMGA 2VSFA 3CR7A 1NYQA 2IYZA 3V6LA 1WQ4A 3OZVA 4Q4AA 1I5EA 1MX5A 3J80A 1OVGA 4UM8B 1TA4A 3IURA 4BCCA 2ZVPX 4LXIA 3BJZA 3VAAA 4CG1A 2A0UA 1OOEA 1ARZA 1CIPA 1YJCA 3P0JA 1K6MA 2X3UA 3FB4A 3GLQA 3V34A 4OHZA 4R9SA 1T91A 1SVMA 5I51A 3WAJA 5CNIA 2BKXA 4HRXA 4YT8A 2G7MC 1SKBA 2SICE 1VP3A 3U40A 3AEKA 4BVGA 5DSZA 4ZVTA 1RZUA 4BVJA 1LI7A 1KYXA 2EFHB 4KO8A 4P7KA 5ESWA 5B55A 2R8EA 4WKCA 2YY6A 4RQAA 5LA6B 2WJVA 1FVOA 2QROA 1YL5A 4YXFA 3S29A 1IG0A 1CUWA 1OZAA 2OCIA 2HCJB 3DBRB 2Y4NA 4DLPA 1TJ4A 3QVSA 1V1MB 3QLVA 4J8PA 4Y1RB 4BMZA 7MHTA 4P82A 5BPFA 2CVFA 4D0LB 4PPGA 3PUWA 4A15A 2R8ZA 1FTGA 1Z2AA 4WXEA 3OLWA 1P5JA 3CH5A 1Y3BE 1LWNA 4UXHA 3DVAB 5EA2A 2BFCB 2DUMA 3RS5A 4LV8B 4E46A 2GWHA 4G0XA 2J0UB 4L3OA 1T5TA 2KBFA 1MTZA 1G1AA 5FADA 4IDNA 4XA8A 2XVAA 3D59A 4N5IX 2KE5A 3L8MA 5KIAA 4OYYA 5TT0A 4PR3A 1FQJA 3UOWA 1Q0PA 3NT5A 1JAXA 1E2JA 3G1WA 4RGVA 1J0BA 2GAJA 2ZUWA 1YZLA 5IJ9A 2X41A 5K4GA 5F9HA 1OKKA 1TF5A 3K4HA 4QAQA 5F77A 1NW5A 3LKZA 2OBFA 4DV6B 2ILTA 1Z0ZA 1TO2E 2Q2VA 2ZRMA 3BEDA 4PONA 2P68A 4JA2A 4P3OA 3ETCA 4H7PA 5FNZA 2B2CA 3QY0A 2IL1A 4JNCA 7YASA 5CFMA 3W6OA 3ZNPA 1ODJA 2J48A 3LXUX 3NHYA 4ZANA 3R7DA 4K6HA 4J7CA 1JG1A 2AI3A 2WUFA 2QSZA 1NLYA 3K0AA 1O94A 2VYFA 1UPAA 1OXVA 1N5KA 3JZMA 4HY3A 4PAQA 2XRZA 4MP8A 1O9BA 4YMLA 5C8DA 3SU8A 2AMJA 3LPCA 3PFNA 2KHZA 2XKKA 5GQSA 3WFZA 1Q19A 2Q7DA 5K20A 4IFIA 2PKWA 1FRZA 1DO0A 1HOTA 3IP9A 1IBLB 1R66A 3JVDA 4YAFA 1XZMA 3W7AA 2EGUA 1Q1EA 3IAAA 4ER5A 3Q7EA 1U0RA 1W19A 1GZHB 1IOLA 2BISA 2JCSA 3ESRA 1O6ZA 1SU6A 3ICWA 5CXQA 3LUJA 2M6KA 3W6UA 1Q6ZA 1YC5A 3CLSD 1HNNA 1Y1PA 2DPMA 3IAM6 4XWOA 2DTDA 2HMWA 2PUVA 2RH9B 2XE4A 3KAPA 3RJ5A 4D8XA 4DRZA 4N4AA 3KLMX 4DF3A 1H2ZA 3IAEA 3ZZ0A 3ETNA 4BBJA 5LM3A 1L1FA 1P8JA 3W90A 2ANBA 4TTSA 1MAWA 2QRGA 5KZMB 3L40A 1J0XO 2FR0A 4BAUA 4B81A 1E2IA 1MD9A 2A35A 3IE1A 2GT1A 2XV1A 3LHSA 2C5HA 4DM3A 1XNRB 1YASA 1PNVA 3UMSA 5LLDA 2YVKA 4TM8A 2O5EA 1P39A 1S8AA 5LZ8A 4B84A 3R20A 1KC1A 1LQTA 4YJ2A 4RC9A 2FYTA 1D04A 1U6KA 1WV0A 5GJVC 2GJSA 1OVMA 1OFVA 4WZAA 4BQFA 3C6BA 1G8JA 4FLMA 4LISA 1XFDA 3L0IB 5K8CA 1X8LA 3DLTA 1FYWA 4FFPA 4JBIA 5GJWC 3RS3A 3RU7A 1QOZA 3WL7A 3HRIA 3R76A 2JIRA 3TPCA 1L4HA 1YUMA 2JGKA 4COOA 2XLCA 4EG6A 1NVTA 3ENWA 1N33B 1KQ3A 4O0MA 5TQ2B 2QX4A 1YVRA 5LQMA 3NYRA 2E4ZA 1JHQA 2PXAA 4URYR 2GKGA 2OMKA 3OTIA 4EYGA 1NP7A 1IZ8A 1Q1NA 2BT4A 1YUNA 3FZNA 2VK4A 4QJ3A 2FZLA 2H52A 3TK1A 4YAKA 4NARA 4JLNA 1F8GA 3C43A 1IOZA 3B20A 5LC1A 1ZH6A 2IS1A 1B6RA 3R40A 3QXXA 4WA7A 3WWEA 1G5FA 5JVDF 1C1YA 1WUHS 2GDJA 4J29A 2IQ5A 2V9ZA 4ZYXA 1Q0SA 3OM8A 1TTTA 3D6TB 3PK0A 3E6AA 3EEQA 1PDOA 4Q15A 3DMGA 3RUFA 2YJZA 1TKCA 4KYIB 3PGMA 1PEAA 4G1MB 3IE2A 3KKNA 2R8PA 3Q6MA 2GZRA 3FVTA 5ECDA 3LKBA 4DSZA 5K6TA 2YWRA 3QTLA 4I9GA 1YDWA 4F97A 4BBZA 3EB9A 4IMRA 2F8SA 3W5CA 1L1EA 1SMKA 3K96A 1L5ZA 1T43A 5CB8A 3AL2A 5AVXA 2IOFA 3SKYA 4EUEA 5IDXA 1VE1A 2WHPB 5IYZB 3UQZA 2EFGA 4TV8F 3IOMA 3G5LA 2ZSKA 4I3GA 1LZKA 1JMVA 2BRUC 2JDID 3BE4A 3G2JA 4N3BA 4Q1FA 3NX4A 1A9ZA 2EJWA 2HJVA 3RM3A 4BP3A 3VKHA 1UM8A 4M1SA 3PC6A 3WMXA 3K72B 5J23A 1VI5A 1U11A 4W6QA 1LFAA 3U7QB 3L77A 3ROEA 3ZY2A 1DCFA 5CT8A 2R2GA 4B31A 1QK3A 2OGWA 3KQQA 5LNK1 4MVJM 2WSBA 3QWBA 5J1TB 3KS9A 3OU7A 5E1MA 1F1JA 4KSCA 2QD3A 2DFVA 1WCWA 5JANA 1KWKA 4G0UA 2EARA 3ON5A 1OUMA 2H1FA 3D2AA 4M9SA 1JSZA 4Z3KA 5DNYB 2A7XA 2B2NA 2RE8A 1GAEO 2YOHA 4LC0A 3WG9A 1M6EX 4EKGA 1TDJA 2JFQA 3KV1A 3BWEA 2YN0A 3FDFA 1P1FA 4ZZ0A 3VBEA 2ZZKA 1H2WA 5L3QA 4XGQA 4W5RA 2JFOA 4PBSA 3MB8A 4W1PA 3FOEC 2JB9A 3N2NA 2GD6A 3LOPA 3ZGVA 2IY9A 1A1SA 2QTFA 2VO1A 3ZEAA 2QRMA 1BXGB 3V2HA 1P91A 1EBBA 2X9QA 3MGKA 3E9CA 2WU4A 2B0JA 3DF9A 4BO2A 2PGJA 1EFKA 4FXPA 5B4UA 3TNYA 3TQRA 2IHTA 13PKA 2PZFA 1E92A 4AMZA 1GLGA 1NJ5A 3IKLA 4RTNA 2VNHA 3I6ZA 2NYVA 5F5XA 1KNXA 2PMKA 3L6RA 5JHHB 3M5PA 3I4FA 4RQTA 5EIEA 1P1HA 2H11A 1JMKC 2JK0A 1A7UA 2P8SA 1MIHA 1FZQA 3RAFC 2W4MA 5LQUA 4Y98A 1Y3AA 5IM4F 3ZE2B 2CLMB 3KXKA 4YRBA 2OOSA 1AZTA 3HCNA 3Q0EA 3C8HA 1VLVA 5J5VA 1TM7E 3TNJA 3VDNB 3QMWA 3DBOB 1BMFD 1R0XA 1XXHB 4ZCLA 4D3FA 1CBUA 5ECYA 3GDHA 1Z22A 3PR1A 1A2KC 1RBMA 1T1IA 2P90A 3LCVB 4HG2A 4C7MA 1KZYC 3SN6A 3R6TA 4KXQA 1GD1O 3DOOA 1NXPA 3QTTA 3GDGA 2HUPA 4M9ZA 2VS1A 5DXJA 1KOLA 2CFIA 2QL7A 3N86A 5FFFA 5JXWA 1FVHA 1MGPA 1TUBB 5B4TA 3PB3A 4Q3BA 4MP3A 1GR1A 2XA2A 3A10A 3DPUA 5HZMA 1X7ZA 1F38A 2W2NA 4NK4A 1YR6A 1AZSC 1MW9X 2BFEB 2W4IA 1JWAB 1GNQA 1Y34E 2IY8A 2PT9A 2ONJA 1EX9A 2HWYA 1ECCA 2AYYA 4Q9NA 4E5VA 2KJQA 1YSCA 4Z0NA 4F38A 3L41A 4WNAB 1M6VA 4REOA 4NJOA 2AT1A 3EUAA 3H9QA 1S1CA 1Z0KA 1QH1A 2JAQA 2JIZA 4CYMA 4KWTA 4E13A 1SHKA 1UBSB 2XTNA 4KH1A 1M83A 1B1AA 1PT7A 3UC5A 4BB6A 4JSYA 1ZM2A 3LKVA 5HHTA 2Q3CA 4FQ7A 1XLTA 2OXFA 2AR7A 2PSJA 3KZXA 3P9PA 4NENB 1G16A 1MBZA 1WZUA 1ZUNA 4QARA 4TM7A 2Y2UA 1U9IA 1ZI6A 3FVQA 3BDVA 3AR5A 3MWEB 4UFPA 5ELLA 4UE6A 2O57A 4N8DA 1ZGHA 3D1VA 1BYIA 2FW8A 4MW2A 2VTBB 1DPFA 1WCIB 4EHBA 5EERA 2DY0A 2WTAA 1XRRA 2XMDA 3KT0A 4CEJA 1UZUA 1NQAO 3H1FA 1XC7A 3NOVA 3ZHQA 4RD6A 3EXFB 4BKPA 1SQ6A 3W6PA 2AD1A 1T9HA 2UVDA 3C3CA 1SCAA 4JK3A 4UDOA 2QDXA 3GEEA 3FFWA 1UKVY 2FZCA 3OOHA 1VL8A 2DWCA 3SEQA 3VKUA 2ZSJA 4Z7NB 2BI4A 2VNAA 4OF4A 5AKJA 2VIIA 4G86A 2P2NA 3ZY6A 5DHTA 3L7MA 5IUKC 3FMFA 1ENPA 4OJQA 1BWPA 1N7JA 4ZYYA 5CH3A 4D4KA 3SX2A 3VBCA 3W3ZB 4DSAA 5TF4A 3SQOA 4B48A 2VTBA 4OQFA 3GXOA 4K8OA 1L5YA 3IPLA 4Q39A 3C5EA 3EK2A 1XEAA 3AG5A 5BSUA 1EA5A 1V96A 2D5AA 2VRNA 3EEFA 3KFXA 4NHEA 3J81A 1QGDA 2Z83A 2D1RA 3LQKA 4NENA 1JR6A 4RXMA 3SXJA 3Q8MA 1DV2A 2H65A 1FYDA 3A2MA 3OLYA 4A8JC 1E20A 1RWMA 2MSEB 2VWQA 5GJBA 4RA9A 4EG0A 3PFKA 4RWZA 1BA2A 4HNGA 2P7IA 1W7AA 3ZD8A 1PKEA 4M8NE 1Q7BA 3DMTA 4NXMB 4D44A 1OX4A 3LT0A 3PZBA 1TMKA 1L7NA 3OEHA 1DUVG 4U2CA 4WJZA 1Q0HA 1A98A 2GJ8A 1PW7A 1BZYA 3JWGA 3NAMA 3KEFA 4HTAA 5AK5A 1B76A 4NCBA 3H2SA 2DJIA 3DGEC 5B1HA 1LD3A 1T5HX 3H97A 3EW7A 4H31A 5GZ6A 4IMJB 1V0JA 4LMPA 1O0SA 1UIRA 4Q3AA 4XUEA 2BHTA 2VUHB 1VSBA 2NPIA 2PUAA 4AMUA 3G0OA 2CUTA 3QMVA 5AOVA 5KU1A 3TLEA 5FEUA 2JIZD 4YYZA 4DUZB 4RZUA 2WG2A 3K7EA 1U5AA 3CSSA 3IMFA 4Q9JA 1KI8A 4EMUA 5FWYA 1JQEA 3ZJTA 3DEYX 2VA9A 3IHKA 1SAYA 4GWLA 5EWJB 4ZJUA 2J4CA 5TPWA 3UMRA 2ZRQA 3KSBC 2P3SA 4AURA 4IL5A 4KRGA 2I29A 2XUOA 1NVUQ 3JRWA 4DDTA 1DCKA 1GN8A 2FY8A 3KB2A 2Z3VA 3KB8A 3PDUA 4WASA 5TX7A 1L5HA 4UM9D 3ZQ6A 4MUMA 1T34A 4YJFA 2C5FA 3IQXA 2YQ4A 3VYRB 4O4JF 1KMIY 5C31A 3IMKA 1E2PA 2XUJA 4BAZA 4HAIA 4ARIA 1MO5A 2IU0A 4HGRA 1AQJA 1ND6A 1PFYA 2W48A 3EISA 3OE5A 2YN4A 3KE8A 2FN7A 3V9AA 4F5ZA 3KQSA 3L7DA 2GA8A 3OFKA 3CW9A 3RIGA 4B5KA 5K8IA 1XRJA 4HDSA 1V1JA 1S3FA 3ECAA 1HMPA 1MHPA 3A06A 3E3OA 3Q11A 3AH8A 4TVBA 4JD5A 5E1BA 3NPMA 3T41A 4Z99A 3LBYA 2IEIA 1MORA 3MT7A 5KVSA 1LDGA 1SH7A 3DZGA 3VR1A 4B87A 4D97A 1IXRC 1JR3E 2CDCA 3SICE 1JXQA 1JZSA 4K9KA 1AT1A 1XMPA 4XB6B 3TRJA 3OEEA 4DM4A 5BSWA 1GFZA 3LC7O 2VTKA 4JBWA 4BZZA 2Q6KA 3WRXA 3M6UA 3UUGA 3EQ8A 3AX6A 2BFPA 4OATA 5JS2A 3A2NA 5I9SA 1UZAA 3DAFA 4ZZ2A 1BAPA 4BNDA 2ZYTX 3R1IA 4UREA 3ROFA 1ESMA 3F9IA 4DCNA 1RPJA 4PC6A 4OQQA 1LQUA 4RKFA 3IESA 3MOSA 1E9FA 3MMSA 3QBVA 2EFEB 2HXGA 4YCSA 1UUFA 5SY6A 3TEFA 1XPUA 3OZWA 4QUKA 1SQFA 1KL7A 1OYOA 3P0FA 3F78A 4LTMA 3ZCRA 2AMYA 3K0CC 4IV8A 2ZS9A 4CKWA 2PX4A 2EYUA 2PIAA 4P84A 4MRMB 5KQSA 3EIOA 5TJ9A 2IEBA 4S1VA 3KM0A 2AWOA 2H1CA 1KGSA 4MGYR 2I55A 1U94A 3AONB 5JQGB 1JLLB 1QUEA 2DH6A 2LKDA 3DHWC 1KORA 2GZ2A 4IHKA 4XSHA 5J5CA 1D8AA 3VR4H 1VMKA 3KKLA 3MC1A 3OFJA 4A92A 1M76A 1ZQ1A 3DDZX 3RVQA 4FS8A 4HH3C 4NESA 5F52A 4B7ZA 3L0ZA 3VVCA 3R4VA 2QL5A 2GCGA 2WWWA 3HB4X 4C06A 1R3DA 1RABA 1EIZA 2AQ8A 3QLEA 5FBVB 1SD1A 1JE1A 2O1EA 1IUKA 1OA0A 1T2DA 4BNZA 4CKBB 4ZU6X 1DBVO 1KJNA 3OP4A 2R5FA 4KMRA 4DMMA 1YNOA 4OMCA 1U98A 3GMTA 5HX7A 5FLXA 3I42A 3OQVA 3TX6A 4AI6A 2CLEB 3R5KA 3U44A 1KE2A 2XCUA 3FPFA 1O87A 4F3NA 1EVYA 5HS6A 3M1AA 5EP2A 4Z54A 1JEOA 1UODA 2WSIA 1NSYA 1RR6A 2XA1A 3I2FA 4CMIA 4GEGA 5HRCA 1C3OA 3L06A 1OI7A 2EQAA 1DFGA 1D1QA 1P0CA 2CJYA 1JZQA 3FD8A 4YJ3A 3L5OA 4KG7A 3QFCA 1JFVA 3L93A 1K5DA 4ZYWA 1VHJA 3SPXA 1W6RA 1SPXA 1IU9A 4Y9SA 4KUGA 4UD2A 4P4GA 3C0KA 3H5VA 3BHNA 3JQRA 3QOXA 1T1JA 3SEZA 1UDXA 4S1PA 2P2DA 1E5VA 2HSZA 1A8PA 2ZDGA 3RWMB 3KQLA 3I1JA 4YI5A 3ZN2A 4IICA 1EQ2A 2WJ6A 3GDFA 4XH9B 2PDAA 5FQNA 3ZDXB 5KNDA 4K9NA 2D7JA 2QD5A 4W1SA 1WNTA 3RFTA 3B7WA 3LQQA 3PT9A 4EJFA 5K6AA 2GEFA 4J16C 4J2OA 3UY4A 5L3SB 2V7GA 2XB6A 1JA1A 2V7VA 1FFAA 3KYCB 1M2VA 3HRKA 4HQKA 1GUAA 1KKUA 3C7KA 4C7JA 4URVR 4EHIA 2HTEA 4DMKA 4HZUB 4Y0VA 3F6EX 1JLHA 3TQCA 2Q29A 3QI2A 4WZBB 3R7BA 4B3BA 3EDOA 3OT1B 4XAQA 2DUUA 3OTOB 3SHOA 4BTLA 1XK6A 2IUEA 2QJOA 2RGEA 3ENZA 4WHMA 2YUIA 1TVKB 2HM7A 2HD4A 4N0DA 4R1QA 3KV3O 3SYTA 1WWKA 3G7NA 1DJPA 4I4NA 4M0LA 3PUVA 4RHEA 1UJMA 1CDDA 5ABPA 1SA0B 1VPDA 3ML1A 5CPFA 1CVRA 3TTSA 5K45A 1QZ3A 4A2WA 3H0CA 4RVOA 1KAQA 1TYAE 3HUDA 4ZO4A 3CLSC 1Y7HA 3T1YB 2DT5A 1X8JA 4G8JA 4G01B 2WWYA 3T9DA 1FB5A 4NBKA 4FD3A 1D2NA 1H4QA 3PHJA 1JYFA 3QU2A 5HK8A 4MHTA 4C4TA 4ZI7B 3AF2A 4GZMA 5IAAA 1LLDA 2IXAA 3F46A 1P9RA 3PHBE 5FULA 5T3UA 9GPBA 4JHLA 3TD9A 3QEJA 3I2JA 5KPJA 1O0CA 1G6Q1 3WGYA 1W0KA 2HJSA 4L28A 4Q7KA 1X13A 1R4NA 2C5EA 1NTRA 3IELA 4NTZA 4N3CA 2G17A 4R2JA 1V71A 5CTJA 3JD0A 4HQ6A 4EQZA 1ABBA 5J2TA 3ZUPA 3JRNA 3TW6A 3V8RA 1AS2A 3B12A 3L8FA 5E1DA 4BFWA 1E7MA 1XTKA 5C80A 5CT4A 3I37X 3V5NA 2JJYA 2DPGA 4LG1A 3LDAA 4DV2B 3BCHA 2HF2A 2OXTA 3ILXA 1BVUA 4LZWA 4ZQFA 5I7WA 3A32A 3BWVA 1PYDA 1ZHOA 2XDYA 4B6SA 2R85A 1O6FA 1KQNA 1LWOA 2Q2QA 4KHPB 4ME6A 1JV2B 1L7OA 4QYXA 4EUFA 1B6TA 1GDDA 4BPRA 3Q9LA 1QRTA 5JZ9A 2A3RA 2SECE 2IXGA 4P5EA 4URHA 2ZI4A 4DWOA 4G89A 5CCXA 4E7OA 3GLGE 4HX5A 2HR1A 3HTXA 2XE6A 4Y0AA 1QVZA 3M6LA 2UXDB 1S2OA 1G5QA 2GJ9A 5DGCA 3ABQB 4GNRA 4TL8A 2EV9A 2NYUA 2I2BA 3PI6A 4NBWA 3ZI7A 4AX8A 1IM2A 1DTEA 4AYTA 1W0JA 2FX3A 4QFDA 4WD3A 3VKVA 4UFOA 3RC1A 4FFNA 1GG8A 4LVOA 3NDJA 2FV8A 3SMVA 2QTVA 1P61B 2V7TA 4B6QA 3LH5A 2WJZB 4OHWA 3KFLA 2D0OB 4HP8A 1AJEA 3HA2A 1M7BA 4TQGA 5D86A 3DO8A 4UHJA 2EFCB 5GOTA 3LW8A 1DQYA 3NDIA 3HPQA 3MUFA 3G8YA 3OOWA 4PZZA 3BL6A 3KFVA 2VK1A 2I67A 3Q8WA 1DX9A 4GAEA 4LVCA 5GV8A 3TL3A 1NONA 3TRIA 3WKEA 4CLRA 4F4CA 3KLNA 4IQGA 4LSMA 2B4AA 2E5FA 5IMBA 4HS4A 1I2DA 1RYYA 3BCUA 4U6NA 1YTUA 1O58A 3ICEA 5TVKA 3AL0C 4O2AA 4OGLA 5JJLA 2X22A 3B3AA 3NHMA 3QOWA 4OUDA 2JG3A 1RI4A 1QYWA 4IHJF 4EI9A 2HEGA 1SBHA 2Z5LA 2HJGA 2ZTVA 4F46A 3HBJA 4JBXA 1GVNB 4I50A 2ZFUA 2YW9A 3NIBA 1OWOA 1N0VC 4IKOA 1OQAA 3X1DA 3QE9Y 3OLCX 5CYOA 4AJJA 5JJIA 2W98A 1RXUA 1XTVA 2CXTA 5E6UA 5HE9A 3UCFA 1KRHA 1NR7A 2FQXA 3HQ4O 5D5PA 3T1VA 3KOZA 2H57A 3Q7TA 2F59A 4LS3A 4REQA 3KJEA 3QEMA 5DNWA 5ICMA 1Z6QA 3OETA 3DE7X 5KYGA 2PUWA 3WSTA 9ABPA 4WXMA 1LI5A 5C1IA 1TO1E 2P1RA 1JRLA 4QDKA 2X6QA 5ARBA 2EWWA 3MFYA 3SBXA 4DJ5X 5AWFC 5IVHA 2G63A 3AEUA 1CYEA 2OV4A 1GLNA 3EZYA 5CX1A 4NFSA 1OAOA 3SSAA 3EOAI 2IUYA 1AV7A 1VG9B 3FKQA 1W5FA 1A96A 1XRSB 2YHIB 3BXFA 3QRWA 3SKXA 5IZ4A 4DCGA 1QTRA 4NCNA 4QFBA 3VH1A 1J6UA 2O8BB 2V7UA 5ILOA 1VKOA 2BR3A 3QVVA 4J75A 2BGTA 2JJ1A 2QD1A 3QUBA 4K03A 4MRRA 3AJRA 2WHRA 3RSGA 1XZHA 1YMQA 1FTYA 1BFDA 2DOKA 4WKPA 4XW2A 4Z2YA 1UT6A 5E95A 3CJRA 4EPXA 3A6EA 3BSYA 3R3JA 1I9GA 2YNMC 5B7QA 2MMCA 5CFNA 1OHHA 4FFWA 2WAMA 3NAQA 5DNUA 4ROTA 1D2EA 4XYMA 1D2CA 2CHUA 4BFCA 5HM6A 3DEHA 3LBFA 5ICEA 2LUOA 1XYYA 4U39A 2FOLA 2HCBA 4O4HF 3HU1A 4ZKDA 4G24A 4OMUA 1FTSA 1G42A 4B82A 3IUNA 5CIQA 3I04M 4DPLA 4TZ0A 1Q0ZA 1M0TA 3TIGA 5KSPA 4FFRA 1MO2A 1ULSA 3LYAA 4LX0A 4QXAA 4BZXA 3GGOA 2J9GA 4CDMA 4IH9A 4N6OA 2Z1DA 4OXIA 4ARSA 4X00A 2XADA 5EE1A 1FU7A 1COWD 4NFYA 2GA9A 5D85A 5E6SA 2G6TA 4PBTA 5A02A 4OFXA 3TQFA 1FS5A 3EH1A 3PXDA 5LKAA 4QATA 2AIRA 3QKUA 2XCIA 1T24A 1WMFA 1EDDA 4KZKA 2OP0A 5HIMA 5JT1A 3DTVB 5DHFA 4R7TA 2PUGA 3ZIUA 1W47A 2GSWA 3W4KA 4WBNF 4O0LA 1SUPA 1QBKC 4I7EA 5AIAA 2ZROA 2NNWB 3JW8A 3IILA 4ADSG 1ZA2A 3UANA 2V7QA 4BQNA 1BWSA 3J7AC 3LUPA 2OENG 1QHXA 2O0KA 4LGCA 1EU1A 4CQMD 4LF7B 5EZYA 3D6NB 4H3SA 3E61A 4MQUA 4HRAA 3VPAA 5J58A 3ZD6A 3NT2A 2FCAA 1HDXA 3G9QA 4C01A 3TW8B 1F9AA 2IIQA 2VUUA 1VC2A 2R62A 3DE5X 2E21A 4NC9A 4QQFA 3FHJA 5DNCA 4WESA 3WGZA 2AOXA 1U7ZA 2PV0A 3IDSA 2FQQA 1Z36A 3MFQA 4RSMA 1X7WB 3JAWA 5FUQA 3GVCA 2A4KA 2H7YA 3QEBZ 2NZJA 4TT3A 3C39A 3L1JA 4BB0A 4FYYA 2VYNA 3TRHA 1ISHA 3BQMB 1KI1A 1N1MA 3TBFA 1PRYA 1FFGA 3EA5A 3UMCA 4J2HA 3MS7A 1GTJ1 2WMNB 1U6JA 3L7KA 1PT6A 1GIAA 1Y9AA 2LTAA 1E4OA 3RLIA 4Q4LA 4S24A 2C03A 3DTVD 1EEXB 3C2QA 2YIVX 1TZ2A 2I2FA 1R8QA 3EBLA 4ILKA 3RTGA 1FFDA 3OA2A 2OQVA 2VZ0A 1NQVA 1D7OA 4B3TB 2I91A 3DHNA 1XF9A 1XR3A 4QRDA 2NSLA 3DNPA 1FNNA 2ES4A 3GAAA 7REQB 3QEAZ 1DV1A 2GBLA 2NZWA 1EUCB 2YASA 3CZRA 3QYAA 3K6SB 3KSUA 4EDHA 5HK9A 1U1EA 2ACKA 2VZ8A 4P93A 5C3MA 1DINA 4WNYA 3RUHA 3VUEA 4MO9A 1FQKA 3EAGA 5JATA 2BFBB 3QE0A 3A1TA 2UDPA 4MITA 4UJ3A 1I8TA 4C22A 1CT9A 1NVVQ 3FB1A 1J09A 4S2UA 4UEQA 5EKXA 5BOSA 1V4BA 4QA9A 2JFFA 2ZUDA 3EPKA 2BCGY 2WE8A 4M6WB 2GD1O 4OGKA 4XOUA 1D3AA 1XKQA 3TTWA 3CPEA 1X74A 2JW5A 1ONOA 1CC1S 4JYMA 4CTOA 5GM1A 3ENNA 1C7JA 4GR4A 2EBFX 1E6MA 3C16C 1N6PA 3VNAA 3KYJB 1JIXA 2ET6A 3CZMA 3MGGA 1T8PA 2MYPA 2CE2X 2MDTA 2SKEA 3IO5A 1CUHA 1N9KA 3F8SA 2V59A 1VI6A 3Q40A 4OXKA 1IWPB 3DWGA 4E21A 1IE3A 1Y5MA 1Z3CA 4RZSA 3AU9A 4C0HA 4FOSA 4AXBA 3BUSA 3ZHOA 2Q5OA 4ETIA 3ER8A 1Q0LA 1P29A 3PD7A 1NJ2A 1J8YF 1FDWA 2QTWB 1GARA 2ID9A 4OXQA 1DB3A 3O1HB 2NWQA 3MRTA 4KGXA 6CHYA 5JMTA 1Y82A 5JRJA 4MEAA 2GYWA 4IJKA 4IZIA 4D5EA 5H82A 5SZIA 4HNSA 1Q11A 1RU3A 4I5FA 1ZJYA 4YREA 1DG1G 1CJVC 4NV3A 3W1EA 1QQAA 3I4LA 1TNDA 4QT0A 1MKYA 4PGMA 1U2GC 2FP3A 3GLTA 1MQ9A 1SXHA 1QTQA 1UOPA 1Z88A 4OK3A 4UBKA 3C3JA 4LBWA 4WNAA 2FWMX 1BE6A 4K9MA 2PGDA 4EQ6B 3IVXA 3VZQA 2VK8A 3OX1A 1GKKA 2BFEA 1Z34A 1ZMOA 5EEGA 3TECE 1J2EA 2HHHB 2P75A 1U31A 1CDOA 4NHOA 2A1UB 2O7VA 3NUGA 1DFIA 3NYIA 1RAIA 4YK7A 2CMDA 3GRAA 4FM9A 1J9EA 3FGNA 3PA8A 4GX5A 2C8JA 4EYSA 5J4YA 1P1RA 1EGAA 5K3BA 1WOMA 2PBFA 2XGGA 4N48A 5CFRA 5JYEA 2VPTA 4OSPA 4IVNA 2REXB 3AIKA 1Q7RA 5DNEA 5TQVA 2UZ4A 1SIWA 2CBGA 4OM8A 1CUGA 3NM4A 2QLJA 2X5NA 3LLMA 5FNVA 3TRKA 5A9TA 1VKHA 3TLJA 3ANMA 4N7BA 4M1MA 4IDEA 3PPIA 4XQGA 1MX3A 1TQ8A 1X2EA 2AG6A 1QHHB 1E96A 2HQ1A 4UPEA 5JWRA 3HI6A 3OCUA 2WKWA 2W6ZA 1V95A 4CGYA 2OGZA 1IM8A 3MLBA 3EUFA 5KDDA 5DLQC 4BWFB 4Q1CA 4FCTA 4YAEA 3IMGA 3GRRA 1C2TA 5HIJA 4GOLD 2H0QA 1OH5A 2FMXA 3COYA 4G67A 4KIJA 6ABPA 4U3JA 3GFGA 4Q9DA 4DXHA 2Q5HA 2QTBA 4W82A 2X0EA 1YOBA 2AKAB 3DBHA 1U0FA 3DEKA 1D4AA 2JI4A 1LLFA 4LE0A 1SQ0A 4LMAA 3QP9A 3OX4A 1EZ4A 3RYCA 1OJLA 1U0LA 2E48A 1PT8A 2ZQZA 5K8JB 1SJ9A 1QV6A 5K8UA 3IB3A 1BDMA 1P4SA 4KQHA 1NYTA 1YRQA 2RI6A 4WKOA 4G37A 3A7EA 4IHAA 2AJTA 2CLCX 2IQIA 3IBSA 5HF9A 1XO1A 1TB4A 3GBVA 4AZ0B 3DDCA 8ABPA 1X19A 2ZREA 4DW8A 3FRHA 4U9IS 2HCRA 3JWJA 5CGZA 4BO3A 5AW2A 4U3JB 1V3TA 2GPAA 3FYUB 4KLRA 2JJ2D 4Y2QA 4CMAA 4PO9A 1A9XA 2DG2A 2K2WA 4MS3B 1V45E 2VBCA 1BH2A 2ORWA 1HSZA 1U7WA 3EWNA 2K2QB 4HGNA 2FMHA 2ZRKA 4P2GA 3R7LA 3IUMA 4AL4A 3GLGB 2C7BA 4A6PA 3ELBA 4BQEA 4QEZA 5BQFA 4IQ8A 1H5UA 3CF2A 2I65A 4BVKA 4QASA 3CHYA 3W7VA 3BXHA 4A2PA 3UWKA 1NI4B 1TJYA 3IEUA 1VE3A 5FWXB 5JXHA 2A0YA 2B7CA 2C77A 3PC2A 4X6YA 4L72A 3BF7A 4EI2A 2WTUA 2V8BA 3FZEA 1PV2A 1DQRA 2CEKA 3FPCA 1EUYA 2GARA 3PQ3A 4X1IA 2AEJA 3NS7A 3HKEB 3L05A 1E1MA 2DGDA 4FMCF 1EFPA 1LGYA 2EHJA 2XWJI 1YR2A 4D8VA 4DV5B 1JH8A 3D3QA 5BMOA 3A9SA 1VE9A 2BW0A 3GARA 5JZMA 2C94A 5ITZA 4YJFB 1MG5A 1P2SA 1GFIA 2GCNA 4QHTA 1VA4A 4US1R 1AXEA 1FPQA 2W93A 2FFRA 4BWYA 1MOZA 2FWBA 4MDEA 1FY2A 2W6OA 3WZMA 3I61A 1GQSA 1SUIA 3F8WA 3EUWA 1U28C 5DHAA 4ZCSA 2X19A 2YUTA 1H6AA 3QKSA 1Z82A 5FYQA 1PVDA 1JIJA 2GVZC 1YTLA 3IR5A 3DXFA 3GP8A 2D54A 3D7KA 4V24A 5FPSA 4OQDA 2UUOA 4ZV4A 3WYEA 4UAUA 1UEIA 1TQHA 5IC6A 5K2OA 4NE7A 2IH2A 4H35A 2HQRA 4JQYA 4QYMA 1PQWA 2OD2A 4IS3A 1C3VA 2C4VA 3HYLA 2C95A 5J3JA 2XTAA 4JLAA 5G4KA 3KTDA 1T8SA 1AUPA 1M1NA 2G82A 1GP2A 3W9SA 2QWXA 3L7OA 4TS4A 1HRDA 3DMRA 4BLQA 4FPXA 1NF9A 2AJ8A 4L9AA 1A3CA 1IK6A 1EFTA 1UDRA 2PT6A 3QU9A 3QF4A 4L08A 5BR1A 2DEUA 1OW3B 3K09A 3P2EA 4HDRA 2SKDA 3FLBA 2EP8A 1T6YA 3QNUA 3QUQA 2IIVA 4FLFA 3T7TA 3UWOA 1GNLA 3JD1A 3EDRA 1SQGA 2QMZA 3P0EA 4LOJA 4E30A 2D0IA 2QL9A 4MCAA 1LW6E 2Q3EA 1NVVR 3VR2A 5K3EA 3M3PA 2OQIA 2P6NA 1MAVA 1N92A 4KIUA 3NHZA 2CFSA 3EZ2A 5A7HA 1VA5A 1HWYA 2AC7A 3TLCA 4RTLA 2HF8A 3VRHA 2XGOA 3N53A 1HXHA 5I8ZA 4EAAA 2E4WA 3L5KA 4B2PA 3ZWYA 3HSSA 3KOXA 1YCFA 2NVWA 2ZZNA 2BEUB 3OIFA 2BGGA 4QG3A 2FX5A 4QLBA 4X41A 4KGVA 3L9XA 1AKEA 3GT3A 5E7JA 1H2FA 2GEVA 3KQVA 4Q3OA 4EELA 2QMOA 5BUSA 1AS0A 1ZQ9A 3C14C 3E2MA 3Q9UA 3CRW1 4ENWA 3JV7A 4P34A 3RKSA 5ES4B 5JJBA 2I6TA 3JVEA 1V1RB 4BO0A 5HRUA 2P0YA 2AF4C 2XGMA 3K5PA 2FWAA 5EY5B 3UO8B 3VYVA 4DCMA 1HMYA 2GUWA 3BBLA 2RCNA 3RADC 3GP3A 4C2BA 2QJTA 4ESEA 5B5SA 5F9FA 1K7SN 1KDPA 4YCDA 1RLOA 4D9MA 1I3MA 2ZCUA 1RQ2A 4X3OA 2WZBA 4Z8XA 1QE5A 4F6RB 1VL5A 1DG3A 4FYVA 1WPQA 3W2FA 3ZK9A 2I71A 5AK4A 4D9BA 1SG6A 3BILA 3S8YA 2NZVG 1CEQA 1RWBA 4KAFA 4B3DA 4EJ0A 3IQFA 2IZ1A 4DQVA 3A11A 1OFIA 3B5EA 4KK4A 1M73E 1NBHA 3OBBA 2H1RA 4YV7A 4AUKA 2ODBA 3HKBA 2UYCA 1UBLS 3R77A 4X97A 4JS0A 4YCCA 2IS2A 2ECOA 5EUBA 4MROA 3IBGA 4TLAA 1IPEA 3AF6A 3EVTA 2ZSUA 1GPUA 2B4TO 3WTCA 2ZLBA 4V0MA 3G9UA 1TCCA 2YWEA 1AHIA 4EFDA 5TEVA 5IJZA 2HAEA 1NR5A 2GFHA 3FGPA 3NATA 4JB0A 3AXSA 3NXKA 3LRTA 1JG6A 2Y92A 5ER6A 4RD2A 1PS0A 3ILHA 3TOVA 5JCZA 1K1EA 1ZGCA 3BSWA 4US0R 3WFIA 5HP4A 1W75A 2WNIA 4PG7A 1SUDA 1OBOA 1O2DA 4WLNA 2CV1A 4R1MA 1DP4A 2ZSDA 4L5IA 3KUKA 3PUYA 1FQWA 4EH1A 1JNXX 2DFPA 5EFOA 4NYJR 2MSLA 1WABA 1G20A 1RC8A 3P9XA 3F90A 2AJCA 3TFWA 4HN9A 5JSFA 2FEOA 3BIOA 4Q7LA 1PE0A 4CLEA 3GDWA 2HSGA 4TXNA 4KV9A 4U7GA 3F3YA 4IIDA 4PXSA 2Z6QA 1JA9A 4PR0A 1XZQA 2GRJA 4PG8A 1KEKA 4ZRDA 3TJZA 4PFSA 4ZAZA 3WQBA 3UN1A 4V0ME 4NECA 3PEFA 1GU1A 4XPIB 3ZDYB 4J94A 3F7NA 1NBAA 1HNXB 3TZHA 2IEYA 2IZ6A 3M5DA 4EKEA