3HDTA

Crystal structure of putative kinase from clostridium symbiosum atcc 14940
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
211
structure length
169
Chain Sequence
NKNLIITIEREYGSGGRIVGKKLAEELGIHFYDDDILKLASEKSPENLFKFQSEVMRELAESEPCIFVGRAAGYVLDQDEDIERLIRIFVYTDKVKKVQRVMEVDCIDEERAKRRIKKIEKERKEYYKYFTGSEWHSMKNYDLPINTTKLTLEETAELIKAYIRLKGFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative kinase
publication title Crystal structure of putative kinase from Clostridium symbiosum ATCC 14940
rcsb
source organism Clostridium symbiosum atcc 14940
molecule tags Structural genomics, unknown function
total genus 65
structure length 169
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3hdtA00
5AUOB 3X1WA 5JJIA 5BYJA 4HEJA 4OI4A 1NLFA 3CX8A 3KZ1E 4PQYA 3U3KA 1E2MA 2CXXA 4DXAA 3NBZC 2QRNA 4ZCLA 3CRW1 3C14C 1FFHA 4FMCF 2WPDD 4MGIR 1VKJA 5G3ZA 2P5SA 4XD7D 2HT1A 1COWD 3B78A 3RS4A 4B33A 2O8BB 3U3JA 2ZITA 4TQAA 2YKGA 1II8B 1SVSA 2W0MA 3GLHA 3D3QA 1L4YA 2F43A 2WWHA 3QXJA 3EZ9A 4FCTA 4PPQA 5HKKD 1P72A 1NSFA 3WYFA 1P2UA 1VG0B 5KNBA 3CUEF 3JVVA 5FR2A 3RAPR 1KGDA 4V03A 2XGJA 1OB5A 3FKQA 5A4JA 4EPWA 5IRCD 1A2KC 1RVDA 1G3QA 4KO8A 2VO1A 4EPYA 2MMGA 4ZO4A 2GDJA 1QHNA 3KQKA 2O8FA 4GBMA 4B3GA 2FSIA 3NWJA 1XCGB 3AVVA 1T0HB 1JB1A 1Q1BA 5DGXA 5HCNA 3UK6A 3ZS8A 2ZI6A 2VSOA 2NO9A 2GXAA 2Q9CA 3RANA 1ETUA 1FUUA 4A9AA 1D9XA 3QY0A 1KSHA 1XBTA 1EXMA 2OO7A 5C1BA 3DPUA 1AS0A 1IY1A 3LBHA 5L3RA 1AJEA 2R6GA 1X3SA 3NDPA 3R7WB 1VYVA 2PT5A 3T12A 5CM8B 4YXWA 4F38A 1NKTA 1ZCBA 4FCVA 2XTMA 4G1UC 2BJVA 4E07A 4TYNA 3F8TA 521PA 1N2CE 3KKNA 3OIVA 2VH5R 2JLUA 3FYHA 4MA4A 4XVRA 3W3ZB 2CMKA 4RKEA 3AB3A 1KK0A 4UNSA 1CRQA 1YZUA 4LHZA 2PMDA 3A4NA 2QSZA 2HYDA 1PVOA 1CJMA 2CBZA 5EE9A 3VR5A 3ADDA 1R10A 2ODEA 4B43A 2R9VA 3I5YA 2O8FB 3KKPA 2CEAA 4U00A 4YXWD 4TLBA 4MKIA 3UG6A 3RS0A 1PLLA 1H8EA 1JI0A 1HEIA 1KY2A 1G20E 1UBFA 1YZGA 4KFSA 2WOJA 4RD0A 3VR1A 1R8SA 3SE0A 4ZCMA 1RC8A 4Q19A 3KB2A 3SFVA 1EFHA 4C0KA 4DSUA 3VR3A 3SDZA 2QROA 2ZJOA 3L0IB 4JLDA 4EKDA 2H57A 4A2QA 1J99A 3SS8A 3UPUA 4Q4AB 3C4JA 3GQBA 1AA9A 1XDBA 3C16C 4IOLA 4B71A 4TN1A 3K1JA 1UKEA 2W0SA 4RCYA 4Q9HA 4JBYA 1XMJA 1ZRHA 2GEVA 2BMDA 2WHXA 1G16A 3SJAA 3GEIA 3ICEA 1SQ5A 1NMYA 2JGNA 4G5OA 3MG9A 4JLKA 1P6XA 3LO5A 3BJIC 4MGYR 2IYXA 5LD2C 4JMPA 4G0NA 3SI7A 2ZI5A 2XZLA 1DO2A 2FV8A 1OW3B 3KUDA 3SNHA 1KYIA 3CWQA 2PX0A 3O47A 1GRRA 3QVVA 5EP1A 4D82A 1OB2A 1CTQA 4BFUA 2IT1A 1W2HA 1U99A 4B3DA 3A36A 3DDCA 4KYIB 4OQXA 3P32A 3QXCA 1CJUC 1KSGA 3QSYA 1JPNA 3L43A 5K8IA 3ZVNA 4DBLC 2Q3HA 5KYKA 4DLVA 5CITA 4QC2A 4ZDJA 1OPXA 2E9SA 1AZTA 1CS4C 4UXIA 2V1UA 3QKRA 2IC5A 3AVWA 3IBYA 4JJZA 2W00A 1NJGA 1EX7A 1CR4A 1A2BA 3TQCA 1OXSC 3PCRB 3IO5A 2ZANA 5F3WB 1ZINA 4QBGB 2FZLA 5AJWA 3RS2A 4JYCA 3A1SA 2C98A 1QRAA 4NYMQ 1XRJA 2J0SA 4PC3A 1M7GA 1Z83A 2OZEA 2RGGA 5LD2B 1DE0A 4WAUA 2JLXA 3MWKA 4W5JA 2A7QA 2IUUA 1T8UA 5FTJA 1FQJA 1TADA 5K8TA 2BV3A 2BCGY 3EC2A 5EE0A 4ZDKA 3U4QA 1GRQA 5CYPA 1OH7A 1NRJB 1VG9B 1QG4A 1DAKA 4JVSB 4QHYA 5CJ2A 4B3FX 1XEWY 4EJSB 5FR1A 1UFQA 2VYFA 2ZI9A 4BLTA 1QF9A 1L2TA 2IUTA 3L2OB 3L82B 5FPYA 3QBTA 2JLRA 3WP0A 1EFTA 2ZI7A 5G40A 2AXNA 4R2HA 3QKRB 2JASA 3SJBA 1F2TA 3Q7QA 4KYUA 1BYIA 1R8QA 4HSEA 4B35A 2HYIC 4NCIA 3K0FB 1ZP6A 3FHCB 2ONJA 4BFSA 2G1JA 1E1RD 4M8NE 4B3BA 2V3CC 4UKDA 4HZUA 4HAXA 4P4TA 4C0JA 2OESA 4JLJA 3B7GA 4BUJA 4JYBA 4B2PA 1FW6A 3WNCA 4KITB 1L7VC 2YOHA 2G9NA 4HYYA 1U90A 3U6KA 1G7CA 3RC3A 5B64A 2GF0A 2IS1A 1I4TD 5AJXA 1OH5A 4PX9A 4BECA 2X19A 5GVRA 2KBFA 3TBKA 2FJUA 4DSTA 3A1TA 4QBFA 2NOAA 2LWIA 1IN7A 1HA3A 3TIFA 1QHHA 4DDWA 1ZNZA 4M4SA 1YZKA 1E2LA 3MRSA 5FOUA 1JXMA 2CNWA 1MR3F 3DVLA 3SBDA 5EXPA 4URXR 1N25A 1QZXA 1Q22A 2VQSA 4PO1A 5CJPA 1YZQA 4DHEA 4MDEA 1U98A 3F5FA 2MSEB 1GUAA 2ZYUX 1VG1A 1U8YA 3C5HA 3IO3A 3W3AA 4IDPA 3VKGA 3PENA 3GCGA 2WV9A 2GCOB 5TMPA 2QQEA 3RDPA 2A78A 2IS6A 3E1SA 4ON9A 5BN3A 4TYWA 1KI9A 5EZ6B 2QBYB 1DTSA 3NIBA 2ZEJA 3OIYA 4ASUA 2CNWD 2AXPA 2X1VA 1S1CA 4JIMA 1N6RA 2W58A 4JKYA 4S35A 1NNEA 3FFAA 1TL7C 2OFWA 3K0AA 1UF9A 2F1HA 3TW4A 1RW4A 1TEVA 2WWGA 4L5BA 3HYTA 4AK9A 2CCGA 3QKUA 3QXHA 4DEYA 4TMZA 4TMKA 1E3MA 4BLQA 2CCJA 3K0EA 4KBGA 4WIAA 4URZR 4JSYA 5LB4A 1E9SA 1MABA 4NPHA 4ASUD 1M7HA 3EZ2A 3AGQA 5DN6A 1G7TA 1OFTA 1YR6A 2ZIAA 3KUCA 3Q9LA 3KJGA 4Q4JA 4GDFA 1HE8B 3B8HA 1NG9A 3BAFA 4JT4A 1E9AA 4C2TA 2AKYA 3QPUA 1V43A 2FPMA 4WA7A 1IJFA 1DO0A 2AHOA 2PJRA 4ACAA 2FG5A 4G5QA 4Q21A 1M34E 3RWOA 4M9SA 4BLPA 5KNCA 3MWLA 4CDGA 4E5UA 2IYSA 1LVGA 3AP2A 3M4YA 2CL0X 1F2UA 2J0UB 5DN6D 2D2FA 5KSYA 1UKZA 1Z0IA 4JBWA 4JL5A 1A82A 2A2ZA 1SVIA 1LNZA 2J41A 3KQLA 4Q4HA 3K0AB 2FWRA 3HWSA 1KMHB 2FPKA 2Z6VA 4WXRA 1UJ2A 2ZR0A 3CONA 2WAXA 2WOOA 2C95A 2ZVQX 3E70C 5CK4A 5FPSA 4Y0VA 1A4RA 2BJWA 1S4QA 1D2NA 2W6JA 3FMIA 4C2UA 5F9HA 1G1MA 1NF3A 4CEHA 1Z22A 4BZPA 4NYJR 4ZPXA 4XOIA 5DLQC 1P60A 2W2TA 5CLLA 5HZHA 2V6JA 4RJLA 4W7SA 3LBNA 4Z54A 4HLCA 5G53C 4JL8A 3BERA 4YMUA 3EZ6A 3HU3A 4JKIA 2AX4A 2W6JD 4X8HA 2OLKA 4AC9A 3I5XA 1E0JA 1LW7A 1Z0FA 3NDBB 5E4FA 1SZPA 1KNXA 2FX3A 2YOGA 2XJ9A 5DI9A 2CE2X 1D5CA 2NTYC 3GJXC 5ANRB 1UEJA 3B1XA 3U7GA 4FN5A 4PPFA 1GOTA 3T35A 3TH5A 2EFEB 2J7PD 4TQ9A 4JLAA 2IHYA 1H65A 1ZCAA 2C78A 4C3ZA 1CKEA 2AN9A 2ZJ5A 4MDFA 4UXHA 2IYRA 2CLCX 2J0VA 1Z29A 3BE4A 5J47A 1E9DA 1D6JA 2XEXA 1NVXQ 4LJ6A 2XAUA 2AKAB 4AI6A 4NCHA 1UAAA 3QNUA 5CDFA 2R6DA 2UZ3A 4I99A 1XEXB 1ZNYA 4NMMA 4FMBB 5DHAA 4WW0A 4CEHB 3PUYA 4H1UA 4CT4B 1TU3A 4PC1A 1U8ZA 2ONKA 4C0BA 5FL7A 4KLNA 1B0UA 1YJ5A 2O52A 2ZVPX 3L8YA 1SKYB 2HJGA 3IHWA 1QHIA 1S1MA 4NKRA 1E2FA 2IWHA 5JRJA 3M0EA 4TWZA 3CF6R 5EXSA 1KAOA 2H1LA 4PSAA 2EVWX 1VCOA 1XCPA 4QG7A 4HAVA 1AQYA 1GNQA 2QTVB 1JXOA 3TKLA 2ZRJA 4LV5B 4A2WA 2IEZA 2V7QA 2QGNA 3PITA 4NP6A 3T06B 1XWIA 5FL7D 2P6UA 3VR6A 2XZOA 4AYWA 1TTTA 2O0JA 1RE0A 2J59A 4P4SA 3AQ4A 5F98A 1JQLB 1HQCA 4AKGA 4LWZA 3QKSB 2V7QD 3BGWA 1X8KA 2D62A 2WIAA 1PV4A 1ZD9A 1NVVR 2OAQ1 2V55B 4MYCA 5K8UA 1RZ3A 3GD7A 1X8LA 4IHQA 1Q57A 2B92A 1HV8A 3N5CA 5DSZA 4B73A 5B58C 2ERYA 2IHBA 3CR7A 2ZXUA 3B1WA 3SYLA 1M7BA 1CIPA 4C0AC 1W0KA 3SC3A 4BEJA 4D81A 4WBSA 2O8DB 1DOAA 3SQWA 3PEYA 1IHUA 4EUNA 2EYUA 4OBEA 5JZVA 4LK2A 2GKSA 2KWIA 2QE7A 1OHHA 1OIVA 3LX5A 4FW9A 4GOJA 2XB2A 2IF0A 4TT3A 5JEDA 3NBYC 4LJYA 4P4UA 4EAQA 3QF7A 1YKSA 2VHUA 1VYUA 3THYB 2YOFA 1W0KD 1T4GA 1GP2A 4KAXA 4P4SB 4HI0E 3BD9A 4N3NA 4LJ7A 2F3RA 1Z28A 2RH5A 4B6EA 4EQ6B 2ODWA 2QE7D 2RB4A 2BHRA 3DL0A 4QBIA 1OHHD 2ZS9A 1JAIA 2A5JA 3H86A 3ZYCA 1DELA 4TT3D 2R6CA 2CVFA 3IHLA 4A2PA 1E6CA 1NN3A 3CM0A 2QP9X 2C2HA 3QI2A 1KMQA 4I1VA 1OFIA 2DY1A 1SKYE 3BXZA 5DYIA 3SYNA 2QAGA 2ZE8A 5C46F 3A58B 2GZDA 2O0HA 2VP2A 3K9NA 1AGPA 1AKEA 1JBKA 2GESA 3CNOA 1IM2A 1FP7A 1YE8A 1KOFA 2BBWA 2JLQA 2OG2A 2ZS7A 4PAQA 5DIFA 2QP4A 3SYKA 1EFUA 4QKQA 1E69A 2QAGC 4DLYA 3K70C 1NMZA 4NH0A 5EJEA 5JHGB 1WRBA 1E2DA 3T15A 4Q7MB 1KZ7B 4FIDA 4WVFA 3O8RA 2CHVA 4QJ4A 4M1OA 1KI4A 1TF5A 2F9LA 1ZNXA 5FBQB 3LRPA 3K70D 1I4LD 3MWJA 1GVNB 4AYTA 4E22A 2ZSFA 5TV2A 4AKIA 1J2JA 1KO7A 1M74A 3PQCA 3MFYA 3UWOA 4H9GA 2Q9BA 4D4LA 3ADBA 2AD1A 5JSZA 3HU2A 4MGKR 1OXTA 2GK7A 2NPIA 2WMNB 4KHZA 4DLRA 2CLSA 2L0XA 3CRRA 4PSKA 2DFLA 5KDDA 2QAGB 3OFND 4TMWA 2QORA 2ZJ2A 1SXJA 1X1SA 2XITA 1XFAA 4MQBA 2VHCA 2XOKA 4ZIRB 5JS7A 1XTKA 4ESHA 2D3WA 1Q20A 1E99A 2I4IA 3QF4B 2DFTA 4A0RA 3QQ5A 1CRPA 4B47A 2C9OA 3ZDQA 3AKDA 1LY1A 1OYYA 3HP1A 1SXJC 3X1YA 3ASYA 4C4PA 1G41A 1MO3A 1GWNA 4PXAA 1G6HA 1VCNA 2IW3A 4DT1A 1SXJD 4G3XA 4P33A 4U5XA 5CIWA 2XOKD 3KXLA 1R0WA 3K9LA 1T5LA 2V1XA 3ASZA 3BFKA 3RVBA 5CYOA 4A0GA 3EG5A 5H68A 2MMCA 1ZVQA 4FINA 2W83A 1RKBA 3KDSE 3M6AA 5DE3A 1KZGB 4BFVA 2C99A 4W9MC 5L3SB 2W6IA 5EP3A 5HE9A 4HUTA 1TAGA 1TX4B 4IVQA 2D2EA 621PA 5JI3E 3EPKA 5JSZB 4RY2A 3NBFA 3PUZA 5AR1A 1E96A 3K9GA 1G3RA 3QOFA 2OXCA 3DOEA 2KI5A 2YVUA 4KLZA 3WHKA 3QPVA 3KFVA 1KTVA 2QY9A 1GIAA 4PAOA 1SXJB 2VHJA 1ELOA 3DMNA 4OQMA 421PA 1M8PA 3ETLA 5J4LA 4HAWA 1TQ4A 3CIOA 2VEDA 4EFMA 2Q9AA 2LKCA 4D0NA 2BEJA 2P3SA 4HAZA 1H8HA 4TMVA 2W6ID 3BH6A 2OCYC 2PL3A 3TVTA 2CJWB 1SVOA 3LFUA 1DG1G 4A1FA 1U9IA 1TQ6A 3OEHA 3RLFA 1E2IA 4XD7A 1NVWQ 1ZM2A 1OKKA 2I3BA 1KI7A 4AG5A 3TSOA 4D4JA 3W34A 1U9IC 4MUAA 1H8HD 1CEEA 4G5GA 1KKLA 5HKKA 5E7IA 2BBSA 1FOEB 1XXHB 2NZ8A 2QMHA 3B13B 3ZVRA 2ZM5A 4Q7JB 1E32A 2WWYA 4QFMA 1W4CA 3OEHD 3G0HA 1RRPA 3U6BA 1C1YA 1OKKD 4V0OA 4R71A 3KX2A 4Q1FA 1FUKA 1JEEA 3QEOA 1Z6AA 5JFGA 3LLMA 1S8FA 5KHOC 3R7WA 2I1VB 4QBHA 3TUZC 2VRWA 4B76A 2ZE7A 2QMEA 4B74A 5KOYA 3N70A 5FTKA 1EESA 1F48A 3MWYW 2IX3A 4EPXA 2JCSA 2JJ1A 1W1WA 3EASA 2CVHA 3WXMA 4LBWA 2FN4A 4PHTA 4KVGA 1NY6A 4QGFA 4UQOA 4CRWB 1YZTA 1QHXA 2R65A 3M1IA 4Z8XA 3EWSA 3CZPA 2VP4A 3C41J 4IDOA 5FFMA 5CIQA 3AF4A 4OJQA 1OJLA 4PPNA 2WWIA 4XH9B 2PH1A 3ADKA 3PVSA 3AF1A 4M53A 2H16A 1GSIA 4HDCA 2JJ1D 3ONWA 4PHHA 1XF9A 4Q4AA 2IEYA 5FI1B 1HQYE 2GVDC 3AV0B 1GKUB 4F91B 1MKYA 1SXJE 1R5NA 1LF5A 2EYQA 4JZKA 1G3UA 4C9BA 4CEIA 2UZIR 1IN5A 4OHVA 1CJTC 3BFVA 4BLRA 1YRBA 1NBMA 2XZPA 2ORVA 4FWIB 4MKGA 3VTKA 4B3CA 4RKFA 1ZD1A 3AVPA 2ZRPA 1G8GA 2I1QA 1AS3A 3A1VA 2ZJ8A 1OIWA 3IQWA 1T3HA 3AF2A 2ODBA 2H18A 3T61A 1C4OA 4UNQA 1Q3HA 1TF7A 3X1XA 3SZRA 1F6BA 1N6IA 5EXTA 4Y0AA 1G17A 3LXXA 3EIEA 5J5CA 1OXVA 5UKDA 1NBMD 1N6LA 1WDTA 4EPTA 1S3SA 5JBQA 2ZROA 3PUVA 2HF8A 4LJ8A 1KI6B 1P2TA 3I72A 4G01B 1OLOA 1XXHE 4FI3C 2RCNA 3LQQA 1CLUA 1ZW6A 1P2SA 1SHKA 1VIAA 5ELXA 1GDDA 4DC9A 4WZBE 4U02A 2QMUA 3D6TB 3GEEA 4N1AA 1GM5A 2R8RA 4DLXA 4CEIB 1Q1ZA 2H17A 4QHTA 1HH4A 4DDUA 2IS4A 5KTYA 4QOSA 1ZMXA 4W5HA 4B32A 4LDJA 1XTRA 1E2JA 3AUXA 1N6KA 2WKQA 2EFGA 1GILA 4M22A 4UNNA 4B44A 3CKLA 1Z0DA 2PCJA 4B34A 4TLAA 3I92A 2ODNA 1N6HA 1W5TA 1ZUHA 3NC0C 4IDHA 1OXUA 4WOPA 4Q4LA 2WSSA 3FPAA 3VU9A 5SZJA 4EJSA 2OSBA 1ZNWA 5FTMA 1HY3A 5E7JA 3B2EA 4HLUC 1OH8A 3QE0A 5J40A 3RWMB 4A0HA 3LD9A 4UJ3A 4M21A 3TK1A 4DCVA 2RAPA 1YR7A 2ZRFA 3D7MA 3KTAA 1PLKA 4RD3A 4V0LA 5EE5B 4AKEA 1EWRA 1UBGA 4NYMR 4EJSC 5F9FA 1SULA 5JWRA 3Q72A 2RGBA 3BB4A 4OJKA 3THWA 3Q3JB 3L8ZA 3JZAA 3ZZUA 4DWJA 2WSSD 1OFUX 3FGNA 2FZ4A 1GTVA 2ZI4A 3K0FA 4OHZA 3W6PA 4GP6A 2BKUA 4XWOA 1P7CA 3KKQA 1R2QA 1ZC3A 3J81k 4LI0A 4ABYA 1KDRA 5CB6A 1S0UA 3QXSA 2GRJA 1PUJA 1GKYA 4PQRA 4LPKA 4URWR 1FNMA 5D3MA 2PMKA 3X1ZA 4NCKA 2PZFA 4NYIQ 4ZDWA 4AD8A 4ZDIA 3EWAA 5TXGA 1CP2A 2FFQA 3B9PA 4QGGA 4DLZA 5C2JB 1NN5A 2GJAA 5FUXA 2ZREA 1IN8A 1CJVC 2CK3A 2FFAA 3HU1A 4TMXA 3VU9B 3K9HA 1W36B 2GJSA 1J70A 5FUYA 1T0JB 1E1RA 2J3EA 2WJGA 2BWJA 3R20A 5LBIA 2ERXA 2GEUA 2Y8EA 4LUCA 4JLBA 2H92A 2RMKA 1E9FA 3KTAB 4AKHA 3I62A 4YONB 2J87A 4Z51A 1D8TA 3TVDA 3IEUA 1F60A 1XU4A 1XNJA 3A1UA 1FZQA 4GZMA 3THWB 1LS6A 1S96A 1E2NA 4Q02A 2CK3D 3WRYC 2R2AA 3HPQA 2GCOA 2IYZA 4KSCA 4IEEA 3CRVA 4LSGA 1RPZA 4ARZB 3R8CA 4KSBA 2R6FA 4RZXA 3ADCA 1A1VA 2QBYA 2QG6A 4A0FA 4H1VA 1P62B 1IXZA 2XSZA 1IQPA 1CULC 1NBME 4LHVA 3U2QA 5GJVC 2O8CB 4PQFA 4TL7A 5D3MB 3DOFA 4R2IA 4US0R 2JLSA 3WNDA 1PZNA 2V6IA 821PA 1N0UA 4YMWA 2GNOA 4MKHA 1NL3A 3AKCA 1KK2A 1UDWA 4HUQB 1AK2A 3HJNA 3ND8A 3VHXA 3W8RA 4NHOA 4NCJA 1OIXA 2DB3A 2X77A 3VFDA 2XSZD 5HZKA 5TVKA 1KJWA 4X8OA 2H8KA 4RD4A 2BCJQ 4Q7KA 5FPTA 3V9PA 1Z0JA 5JI2E 5LPNA 1E9RA 2GAAA 2Z5FA 2WWXA 3EA0A 4GOKA 2F1JA 2WJHA 3AVYA 2A9KA 4Q1BA 4LBZA 4RCZA 4GSYA 2ZETA 3K0CA 1DADA 1G19A 3LA6A 3TUIC 5EXXA 1Q0UA 2ZE6A 3MGCA 4L15A 1Z6GA 2HT6A 4KJZA 2CLDX 3EX7C 2J0UA 4LYFA 3ZS9A 2QAJA 3L0OA 1X8JA 3K0CC 3MCAA 4KFRA 3WMGA 2IYQA 5AUQA 1A7JA 2Q3FA 4MKFA 2IYLD 2E87A 1UADA 3P4YA 3U44B 1KMHA 3GJ0A 2OE2A 1JEDA 1G7SA 3GFPA 2AK3A 2ZJBA 1WA5A 3FDIA 2JLYA 4D4MA 4IRUB 4P0TA 2GCPA 3FMOB 2GVZC 3DM5A 1G291 2RGEA 4LHWA 4PO9A 2BM0A 1VYTA 4X8MA 4J0QA 2FA9A 1JECA 2DBYA 2R44A 5EP2A 1KSJA 1G3MA 1BYUA 3MLEA 2HLDA 3OEEA 5AJZA 3IILA 1GL7A 1TF2A 2OCPA 5GJWC 5EP4A 3GJ6A 4L16A 2VL7A 3H84A 3OHMA 3N2IA 2OBNA 1FMJA 1KHTA 4P3YA 4MYTA 3CB4A 1WE2A 2BM1A 3R9IA 3VX4A 3OIUA 1XTSA 2Q21A 5J4YA 2JLVA 3CF2A 2ZE5A 2D7DA 2P67A 2PCLA 1YVDA 1T6NA 1XZQA 4XSHA 1EFCA 3BH0A 4DCTA 2DFKB 2HLDD 3OEED 4OK3A 3S1AB 5J4VA 2ZUCA 4A36A 2NMVA 2VP6A 4KBFA 4DLUA 3WMEA 2A30A 1EG7A 2J9RA 4II7A 4DCSA 2DFNA 1V5WA 1PUIA 3CRQA 1XJCA 3BK7A 2A3RA 4JS0A 4F4CA 4URUR 2BDTA 1RJ9A 1D9ZA 3BB1A 1XEXA 4PFSA 1ZM9A 4AIIA 2X8AA 2HXYA 4PC6A 2JAQA 4MRPA 1KI2A 2EFCB 1E2KA 4C30A 3DZ8A 1LFDB 2J7PA 4HB4A 3VHLB 5BXQC 3A6PC 4PSVA 5FOSA 3TMKA 4LPSA 3CBQA 3GJ3A 3MJRA 5FUWA 2WTUA 1G4AE 1TNDA 2DHRA 3AF3A 5KDOA 4RD6A 3VMFA 1VHLA 1Z07A 4FMDF 5GJCA 2OLJA 2NG1A 3Q7PA 4EPVA 2FE4A 5E7MA 1JR3E 4B2LA 1S9HA 3NH9A 3VAAA 4C7OB 2YYZA 2GZAA 3A37A 2C9YA 4D25A 2AFHE 4G5SA 1WXQA 1IAQA 2VHTA 4MYHA 4GNKA 4RVCA 3SJCA 1RRFA 3F0TA 5EE1A 1CU1A 1Q44A 4C0QC 5JRZA 3VNUA 3BOSA 3PEUA 3TLXA 5L3VA 1XMSA 3H4MA 5TARA 2A5FA 2P0EA 4LBVA 4BFXA 2WJVA 4N0EA 4QRHA 4RFVA 1XPUA 4TYPA 1XTIA 1Q3TA 1RJ9B 2ZRNA 3KJEA 1WF3A 3QKSA 5JWHA 1WBBA 1KAGA 1D2MA 2ZU6A 4IDQA 3E2IA 5JWOA 1O87A 2EW1A 3IQXA 2EQBA 3NVAA 5FBLB 2QP3A 2FGJA 2CHGA 2F6RA 5JECA 4CGZA 3DEFA 1N5JA 5H8WA 3VKWA 3D8BA 4MH0R 2O8DA 2DWOA 4D6PA 1G18A 3UKDA 5LDDC 2GA8A 1G5TA 3NXSA 5AJVB 1VMAA 4BRWA 5TY0A 1NN0A 2G1KA 4AYXA 4ZV4A 4GFDA 3X1DA 3T1OA 1DAFA 1MRSA 4MRRA 3UG7A 1KSFX 1ZAKA 2A5DA 4KI0A 4L9SA 1G3IA 4ERNA 2AFIE 1FX0B 3R8FA 1NN1A 3CX6A 1JPJA 2IYVA 4BZXA 3THYA 3ICQB 1VDZA 2YJTD 3GLIB 3SHWA 1G8HA 3T1TA 5HTKA 2IYYA 3THXA 2B6HA 2RKOA 3I8XA 4RZ3A 3C15C 4WZAE 1I2DA 3T5DA 4EDHA 3DKPA 3EPLA 4BFWA 1AM4D 3ZD7A 4YC7A 3DZDA 3TSZA 3W5JA 1RIFA 4EQ6A 1E2EA 3PEVA 3VKHA 1XEWX 3KKOA 5JMTA 3R9WA 1CBUA 2VP5A 4KFUA 3VQTA 4M1KA 2F3TA 5KSZA 2DPXA 1LV7A 3GEHA 3V00A 4LJ9A 4HB3A 3CF0A 3MAAC 3VR2A 1MV5A 2VP0A 3I73A 5FBVB 1D2EA 3LQRA 4IKEA 4M9XA 4Q9IA 1JNYA 2FNAA 3CWZA 3I8SA 1IONA 5BW8A 2E1RA 3GP8A 4BWYA 2QPTA 4UJ5A 1Z06A 4I1SA 4EFLA 2F55A 3PG5A 3RSOA 3CPJB 1N5LA 1DS6A 2ZJAA 3FWYA 4XJXA 2BOVA 3P4XA 2QUZA 1EWQA 4JLOA 3MSXA 4URYR 5AJYA 3ZQ6A 3K8YA 4PTLA 3CH4B 1T5IA 2GJ9A 3FB4A 1BMFA 1Y63A 3THXB 2NIPA 4BFTA 2XXAA 2MSCB 1AQUA 2G83A 4RZ2A 1E2PA 2AD5A 4IOJA 1XCMA 2Z4SA 1ANKA 3LNCA 1A5TA 4PZLA 5IDVA 3RHFA 1ESMA 1NY5A 2QSYA 2GJKA 1E4VA 3B85A 4I1OA 1J8MF 5H70A 1ZJ6A 3ZZTA 1BMFD 1FL9A 4ILEA 1E94E 5EQTA 2JA1A 1UPTA 2R62A 4KFTA 4CZ2A 3LV8A 4F4JA 4F7WA 1US8A 4NE2A 3AKEA 4DUGD 3UMSA 1Z2AA 4D4KA 1UM8A 5KNDA 4ZIRA 4JLNA 3W5IA 3A8TA 5FH9A 3ZQJA 3QF4A 1ZM3A 3K09A 3RRYA 3MUFA 2V54A 3ZVMA 2OM2A 4D80A 2WICA 5EUQB 3W90A 1GAJA 4LGMA 1G5PA 3WBKA 4RD2A 4W5WA 1O3YA 4R9UC 2QPAA 4DCUA 3GLIE 2R6AA 5FBWB 4YLGA 3K09C 3ZZ0A 2XXAB 1QG2A 1XJQA 2REOA 1ZU5A 2PLFA 1VHTA 5EZ5A 2QRZA 3OFNA 5FTNA 1KKMA 4ZI2A 2A5YB 4DKXA 1DAHA 3BRWD 3BORA 1K6MA 3LDAA 4KU4A 4PO8A 5IHPA 4OK6A 5BWMA 2NQ2C 4TQUS 4P32A 4MRVA 5L3SA 1NLYA 2ZQ5A 1ZIOA 1XX6A 1ZIPA 3JVUA 3IPYA 4A15A 3LVRE 1WMSA 2H5EA 2OXRA 1SVKA 2FSFA 4FMCB 5J4HA 2JLWA 1Q1QA 1US8B 2EU8A 4L4UA 3WYAA 4IOKA 3ZLJA 3AH8A 2NZJA 3H0KA 3U60B 1ONBA 3IIMA 1OV4A 3WHLA 3LH5A 4QJ3A 3RYTC 1XEFA 4MYUA 4O25A 1Q12A 4M1TA 1R7RA 1HT2E 4L8GA 2NO0A 2PZEA 1SKQA 1W46A 2K5UA 1ZC4A 2A5GA 2QZ4A 5AK0A 5DNYB 1G8FA 4XVQA 3LAWA 3TAHA 2CJWA 5E3HA 2XB4A 4LV6A 2N1BA 2D06A 5SZKB 2WJJA 4UNPA 4XTCS 2OILA 3C8UA 4JVNA 4OKSA 1LB1B 2P2LA 4OI0A 2B7BA 5FPKA 3PUWA 1NLZA 4A4DA 1QBKC 1XXHA 2DR3A 4D2IA 4BE7B 1OFHA 3OZXA 4QXAA 3EZ7A 4HAYA 3IDQA 3CNNA 5KPJA 4DB4A 2VP9A 1MO5A 2VIIA 2J7KA 5P21A 1J90A 2NPFA 2GXUA 3KQHA 2QEQA 5LB2A 3QIAA 2HXSA 2ZR9A 4B6FA 221PA 2X2EA 4PAMA 1WP9A 2J45A 5A0FA 1NP6A 3ECCA 3K0SA 1GNRA 3ZJYA 2O8EA 4NDZA 2VTKA 3A4LA 3T34A 1XD2A 4HB0A 1GL6A 2HUPA 4AURA 2C5LA 3RSLA 3UWKA 2OFOA 2OCAA 3O8BA 4FCWA 1KO5A 1ZUIA 4LYJA 3FMFA 3U7HB 1MOZA 3IIJA 4BLSA 1XJ0A 1WBDA 3GLGA 1W4AA 2IXFA 2X2FA 5BN4A 1GITA 4Q9KA 4PZYA 3SJZA 2F9MA 2VHQA 3CH5A 3SOPA 2B7CA 2VSXA 2C77A 2YWGA 3B1VA 3RS5A 3UMFA 2BIFA 2RGDA 4ZCIA 2ZUBA 1SVLA 4LY6A 4TL6A 2WVJA 2W2XA 1BOFA 3WYGA 2ECKA 2VLIA 4MUBA 2P65A 2ZSAA 2O0KA 5FOVA 3GFTA 1BKDR 2RGXA 4YDSA 4DIDA 3B6EA 2NO7A 2WJYA 4UNRA 5B30A 3P1JA 3Q85A 1CR0A 4KODA 1E9CA 1S9DA 1TMKA 1G8YA 2OT3B 1UDXA 2IYUA 2ZRAA 3CX7A 2O8EB 1GG2A 1II9A 4BLOA 4DVGA 3ND9A 4IVRA 1GKIA 1XD2B 2WMOB 3BBPA 5KU1A 2ZUDA 4PHFA 1W4BA 4BQSA 1C9KA 5DI3B 4JL6A 1R6BX 5GVSA 2KBEA 3WNBA 3H2YA 4QHSA 1N5IA 4BRUA 1QVAA 2ZPTX 2KJQA 2JJ8A 3GLGB 5C4MA 4TZ0A 4IVPA 1KI6A 2HV8A 2ZRIA 4DRZA 1WB9A 2G88A 5B2ZA 5FBRB 1HE1C 1S2MA 2FOLA 1NI3A 2F7SA 1NVUQ 4GPTA 1RRGA 1XTJA 3FE2A 3IEVA 4Q1AA 3UMRA 5EUMA 3BWDD 4PZZA 3U61B 5KSPA 3QENA 4XVUA 4IXNA 5FI0B 1G4UR 1TQDA 2PX3A 1Q21A 2JJ2A 3KKMA 3SQXA 1YU9A 2GJ8A 1E0AA 2KSQA 1WCV1 4Q1EA 5C18A 5M04A 2ZRKA 1AIPA 1LS1A 1W44A 1Y3AA 2GEDA 3BS4A 4BASA 1Z2CA 1U94A 4HATA 4YMVA 2G0NA 1KO8A 2CL6X 3KQNA 4BFYA 4X8LA 1E0KA 3I1FA 1P73A 1RYFA 3FOZA 1FTSA 2QGZA 3PR1A 2QTFA 4OHYA 2ZS8A 2GF9A 2G6BA 4DJTA 4NBSA 1OF1A 1N6NA 8OHMA 4QJ5A 2JJ2D 4LJ5A 1YR8A 4LOAA 1QHYA 5AWFC 2WWWA 4HDQB 4Q00A 5HPYB 1YR9A 3GLHB 2FU5C 2F43B 3QKTA 4XWAA 3ZIAA 2MSDB 5JJKA 4M2LA 1R0YA 4JJKA 1E2QA 3I4LA 1R5OA 4JSTA 5DISB 2UKDA 3B1YA 3REFA 1SGWA 3PJRA 1YZNA 2HDNB 1ZD8A 3EPHA 1NJFA 3L0SA 5JCPA 1F3OA 1KI3A 3AVTA 1JJVA 3Q5EA 1VIYA 3T1QA 4ZKEA 1Z6YA 3ZIAD 2BBOA 1GL9B 1E98A 1HUQA 5GJBA 4YQFA 4WXPA 2P6NA 1T3LA 3DMDA 2NGRA 2FMXA 2GBLA 3GFOA 4HLUA 2DCUA 2GK6A 4I81A 4CYMA 5FTLA 1XB2A 1P2VA 3HYRA 5H1YA 4IFBA 2C04A 1SVWA 2PEZA 3CO5A 2DWQA 4OK5A 3THOA 2Q0HA 4GT1A 3K53A 4K81B 3N2EA 1W2GA 2GBLC 2OBLA 2CE7A 1W5SA 4A92A 5AUPB 1VECA 1H8ED 1Z63A 1KDTA 4PC7A 3GLGE 1OH6A 1IY0A 2HEIA 3B5JA 3WY9A 3BH7A 4HB2A 3WRXC 1FP6A 1HTWA 4WZ6A 2EWWA 4G5RA 3NHAA 1W36C 1FPMA 4LRWA 2D4HA 3CZQA 4Q9LA 2IA5A 4NCNA 4NL4H 3AVQA 1P9NA 3OESA 4YMTA 4CW7A 3U5ZB 1W36D 1KK3A 4TSFA 1T9HA 2XTZA 4NYIR 1KK1A 4F92B 4ARZA 1K5GA 4FXPA 2G3YA 4O0MA 4Q18A 4KCGA 1YZLA 3CW2A 4A8JA 2C8VA 4TZ6A 5JS8A 2WBLC 1IXSB 4GOXA 2O8CA 1CF4A 3A4MA 1FTNA 3EPJA 3IGFA 1DEKA 4PANA 3EW9A 2P5TB 1W4RA 3ZH9B 3H1TA 1G8PA 2J1LA 2PJZA 4A8JC 3FKSA 2ATXA 4HUQA 2FEMA 2JDIA 1W7AA 2ZJZA 2ZR7A 4OQNA 2YHSA 4TSFD 3U7FB 2QL6A 3RRMA 4DDVA 2RGAA 2ZRDA 2VBCA 3GLHE 2ZRHA 2GHIA 2KE5A 4HDOB 2ZI3A 3V4FA 3UIEA 4S2EA 1R4AA 1YHNA 4CVNA 2ANBA 1XZPA 2QM8A 3AEZA 3LW8A 3A1WA 4LCBA 3TE6A 1U0JA 1Z5ZA 3FKSD 1N0WA 1MRNA 2F1RA 3BIFA 1F5NA 3C7KA 2JDID 3AP1A 3CNLA 1VCMA 4I1UA 1CR2A 2QTHA 2AK2A 2HF9A 4GRAA 4M9QA 3B60A 4V0KA 4Z1MA 4CF7A 3EIQA 1JR3A 4DB2A 4A8JB 1Q1EA 5BN5A 4A6PA 1TUIA 2YC2C 2BMEA 3FHTA 2FF7A 4GL2A 4O2RA 5KUTA 4LHXA 2GETA 2ORWA 2RHMA 4OL0A 4OI1A 3U44A 4D0LB 3VNVA 4CT5A 5KDLA 4YDHB 1K5DA 1AGRA 1KY3A 2DWPA 4RSGA 3EC1A 3AKYA 1N5KA 3MMPA 3EXAA 2C96A 4OHWA 2AL7A 3U3MA 2J0QA 4Z1MD 3QG5A 1XPRA 1JR3D 2QM7A 4TLDA 1XTQA 4M1MA 2JEOA 2YZ2A 3PEWA 1G5RA 1P9WA 4Q47A 4XSGA 1DAMA 3U3OA 2BBTA 3EARA 3PIRA 2Z83A 3QG1A 4C0SA 5HR5A 2ZYTX 3B82A 4ESVA 3PXGA 1EFRA 2OCBA 5EE3A 3U4QB 1AZSC 5DO9A 1J7KA 4AG6A 4TTRA 1FNNA 5BYKA 4LX0A 4D26A 4K8OA 3FVQA 4FMDB 4LZZA 2WM9B 3AVOA 2WKPA 1ZYUA 3AF0A 4KV9A 4ZKDA 1EK0A 4AWXA 1NG1A 1TQ2A 1U2RA 3NH6A 2GCNA 2XX3A 1MH1A 3ZGXA 5JHHB 1JR6A 4B3XA 2QENA 2FGKA 2BKEA 4OYHA 3S1AA 3TUJC 2OEPA 1EFRD 4PR0A 5C4GB 4L9WA 5TB5A 4M1WA 1NIJA 1F2TB 1Z3IX 3IKJA 2LCFA 3LBIA 1U8AA 2PBRA 4QNRA 2VF8A 2ZAMA 5G41A 4BZQA 1N6PA 1R5BA 4LJAA 4A82A 2RGCA 1E1QA 3SBEA 4Z8YA 4HZUB 3W9YA 3BC1A 2FDCA 3TJZA 2WWFA 1G64A 3KXIA 2QU8A 5JCZA 3NEJA 1QHSA 2PEYA 1W47A 1B23P 1KDPA 1ZU4A 5GADl 2WZQA 3TSWA 3RS3A 2ZRMA 1M6NA 4M0LA 2IYTA 2ATVA 2ZSEA 4QNMA 2NO1A 1AS2A 3CR8A 1RYHA 5SZHB 2WKRA 4DDTA 1SHZA 1E1QD 4NONA 1TU4A 4TL9A 4GI7A 5F2EA 1IN6A 1QHHB 4M1SA 2QPOA 4C7OA 3KQUA 3LX8A 1P3JA 4PPGA 3RABA 4EPRA 3L0PA 5D3QA 2HCBA 1NIPA 2IBMA 1I4DD 2QNRA 4R98A 2C9CA 5L3QA 2WJIA 3NBXX 1L8QA 4Q1CA 2EFHB 4RZUA 5CLQA 5CB8A 3AVXA 2QI9C 3TQFA 2FPLA 2YWEA 4LYHA 1G7RA 3LWNA 3HR8A 3UANA 1Z8FA 4QM7A 2Z4RA 2REXB 1AKYA 2N42A 3KFXA 4E03A 4IFEA 2FSHA 1PLJA 1E4YA 4GMXA 1FMLA 1JQJC 3FTQA 3WP1B 1P75A 1BS1A 1QHGA 1YRAA 1MO6A 3VX3A 1BIFA 2EWVA 4FWTA 4RFSA 1Z0KA 2D7CA 3BB3A 4DLWA 1TEXA 4TL8A 2O5VA 1DBSA 1DVRA 1MT0A 1E9EA 3SU8A 5KSOA 1KO1A 3WBJA 2NO6A 1U81A 3PFIA 1UBEA 2YWHA 2YINC 2IWRA 5BQ5A 1MABB 5JJLA 2LKDA 2ORIA 2YWFA 5E95A 4TLEA 1UBCA 5FUVA 3D31A 1BH2A 1P4SA 1Z47A 4Q4JB 4URVR 3G5UA 1FX0A 4MITA 3AM1A 2YV5A 5B57C 1XD8A 5J4KA 3UXMA 5L3QB 3GLIA 3TR5A 1W48A 1YQTA 3F3YA 5L8VA 2YNMA 4QGHA 5TDHA 4NYJQ 1ZUNB 1OXXK 1JALA 2YC4C 3CPHA 3DKVA 3QBVA 5IK2A 1GNPA 1VCIA 3C5CA 2QT0A 2IXGA 1N6OA 2FH5B 1F2UB 4Q48A 4KVAA 1K8RA 1MO4A 3B9QA 3W8NA 2IL1A 4BPBA 1ESNA 2AWNA 3KB1A 4Q4HB 2V4ZA 5JEEA 4HAUA 2BMFA 4NTZA 2Q3MA 3P26A 1VTKA 4RFSB 4M9ZA 4POAA 1NSTA 2ASEA 5IK2D 4AY2A 4MRNA 1RFLA 4IEIA 4JLVA 4V0MA 1UEIA 2B8TA 1UKVY 2D74A 2HJVA 4BEBA 2JLZA 1DG3A 3RRNA 4OI2A 2XNDA 1IJEA 2VPPA 3O8DA 5FL3A 2FEOA 5CM9C 4TYYA 4NZYA 3VR4A 1DAGA 2C03A 5KPDA 1SVMA 2VF7A 2RHDA 5HE8A 4JLMA 1W0JA 2IXEA 1LF0A 4N0DA 4QGAA 4DZZA 4JVMA 2WAYA 2RGNA 3Q8XB 1T8TA 2DYKA 2GXSA 2SHKA 4DEXA 1IN4A 3X2SA 1RRCA 1AN0A 1CXZA 2OV2A 5IT5A 2CL7X 2AR7A 2J46A 2OUKA 4LBYA 4Q9JA 3QXXA 4GMDA 2REBA 4Q01A 1QVRA 2XNDD 1CR1A 3R9XA 2RGNC 1XPOA 4GP7A 2GTPA 3LW7A 3OF5A 1DAEA 3P27A 1W0JD 2BEKA 3LXRA 1P61B 3PV0A 3HPRA 4MRSA 1R0ZA 3EAQA 4BFZA 4NU0A 3TW8B 4JT2A 2OAP1 721PA 4FD2A 2QN6A 4XIGS 2BVNA 4GZLA 3RRZA 3GLFA 1JJ7A 3QUSA 3GJ4A 3G82C 3MJHA 5DHFA 3CLVA 1KI8A 1JAHA 4TTPA 2ZAOA 3TR0A 4CIDA 2ZRGA 121PA 2WSMA 4IDNA 4P31A 3SR0A 2XJ4A 3U7EB 3E5HA 3TGPA 1E2GA 1Z6TA 4CEJA 2IUSA 1E79A 3GMTA 4I4LA 2W2VA 6Q21A 4DUGA 4JBXA 3EA5A 1NVVQ 2JATA 1E2HA 1XMIA 1TUEA 3GPLA 5FPHA 4XWKA 2KB0A 2BMJA 2IYWA 4B2IA 1GFIA 2IK8A 5KO2A 1G9XA 4JLPA 4B48A 3U3RA 2V8OA 4LC0A 2ZRLA 4Q5IA 1NKSA 3DO6A 4MGZR 4ACBA 4A6XA 5JLJA 3BFXA 3UATA 2VSFA 3NHBA 4Q03A 2B8WA 4OQLA 2HCJB 1E79D 3SEAA 2IF2A 3LVQE 4ZI3A 3AP3A 4HLQB 3JZMA 2GZHA 1ZBDA 1XD9A 3KL4A 5AUNB 1KJZA 4Q7LA 2GAOA 5DYGA 1KI1A 3KJIA 3T5GA 4U7DA 3GLFB 1X6VA 3GJ5A 2ZTSA 2ZSBA 2CHQA 3LLUA 1HURA 2QMOA 1KIMA 3OE7A 2IS2A 2ZRBA 4Q1DA 4RD1A 2TMKA 1II0A 3QPWA 1L4UA 1OYWA 2FFHA 2OFXA 4K46A 1IY2A 2FSGA 3CRMA 3Q5DA 3NEYA 4LC1A 4D0GA 1WQ1R 3B1ZA 4CEJB 1KDOA 5IF9A 2ANCA 2XNSA 2G77B 1EX6A 3IIKA 1Z6XA 3NG1A 3FHOA 2V9PA 4QL3A 4TMTA 3IUYA 3I61A 4Q66C 2CDNA 1DAIA 5CK5A 4DCNA 1G6OA 3RS7A 4BGDA 3OE7D 2F1IA 4YMSA 1PJRA 4TLCA 3SHFA 4DIEA 4O3MA 2FFBA 2G0TA 3RC8A 4DLSA 3P20A 4UXJA 1VPLA 3I32A 1N3BA 4F93B 1U0LA 2ZU0C 4B75A 5FOTA 4XTRA 2PZGA 4DSNA 2ZYWX 4OHXA 1S3GA 4F4IA 4V0ME 1KJYA 4US1R 3O8CA 4E09A 5CDFE 3EIHA 2BC9A 4V02A 2ZYVX 3NKVA 4US2R 3V4RA 2PT7A 4TTQA 5A5GA 1KNQA 4DSOA 3TRFA 3OIWA 4PC2A 1ODFA 1Z08A 4LV8B 5DH9A 3TAUA 1DPFA 1IXRC 1ZM4A 4HLDA 1HYQA 3AUYA 1DARA 2PLRA 1VG8A 1X86B 5FOXA 1XMVA 3W6OA 3K70B 4O2LA 2JIZA 4IOMA 1R0XA 1QDEA 3EZFA 3DM9B 1E0SA 5K8LA 3KXKA 3LY5A 2ZRCA 2EFDB 2H7VA 1GRNA 4LHYA 3AGPA 4PHGA 3NC1C 2N46A 1CJKC 1LTQA 3QVUA 2UVQA 1OT3A 4OQFA 4V0NA 4EIWA 3REGA 2QQ0A 2Q6TA 2ZSDA 1T3SA 2Z43A 2QT1A 1E9BA 3IBGA 3QEJA 2WIBA 2P6RA 2ZJYA 3AVUA 3HDTA 4QM6A 3HR7A 3ZVLA 3IPXA 3FFBA 2J5XA 2JIZD 1I2MA 1M2OB 1BO6A 3FMPB 5FOWA 4IW3B 3SFZA 3GLFE 2QA5A 2GILA 1UKYA 3SN6A 2OHFA 1IOZA 3DHWC 3KJHA 4C0HA 3NTUA 4JVLA 1X1RA 4IJMA 1FQKA 1IBRA 3QJYA 1EGAA 1NMXA 1N0VC 4M1YA 1T91A 1OE0A 3GJ7A 3W6NA 2CCKA 5DI3A 4ITRC 3CPEA 3PUXA 3GJ8A 3ZD6A 3MD0A 3OAAA 1GZSA 1ZM7A 5SZIA 2O8BA 4HZIA 1U0HC 4LJ4A 1II8A 1HT1E 4KXFB 4EFNA 2Z0MA 4C0LA 3T1VA 3I3SR 1TPZA 1G21E 1P5ZB 1W49A 2XTNA 1Z0AA 4DLTA 4LYAA 4TYQA 1M1YE 1XP8A 2GWHA 1OSNA 4R7ZA 2GXQA 5HCIA 5G3YA 2B21A 2WPDA 1P9RA 2VA8A 3TNFA 3OAAD 3RNLA 1COWA 2OBMA 2AWOA 4DT1B 1J8YF 4IXMA 3WMFA 1KO4A
chains in the Genus database with same CATH superfamily
1AV6A 1WCIB 2VZ9A 3X1WA 2C83A 1Y1KE 5C8VA 5HUQA 4S12A 3A9UA 1SAYA 2CMFA 1CQXA 2OV1A 2GN9A 2D0OB 3H83A 4G09A 4OI4A 5FNVB 5T64A 5C8ZA 2AH5A 2FEKA 5HJ5A 3JRNA 4KIJA 4U7FA 2PQ6A 1D03A 2QMQA 3HBMA 2QRNA 1H2EA 1JDBB 5KYVA 1DRVA 3CRW1 2EHDA 1FFHA 4WZAB 3ZN2A 1HE5A 4O4HB 3RVQA 4MGIR 5G3ZA 2P5SA 2HT1A 3BHNA 2MSNA 5IAJA 3B78A 3C6MA 2QKYA 3AJEA 3DUFA 3W2FA 1Y1TA 4TQAA 1II8B 1PL7A 1SVSA 1UCFA 2HJSA 4JI1B 2W0MA 4UVDA 3C1OA 3D3QA 1L4YA 2RGRA 1MMFB 1E0DA 4WK6A 4FCTA 4HRAA 4PPQA 2IHNA 3WYFA 4K7JA 4HDNA 1CEQA 2PV7A 2FMHA 3CX3A 3JVVA 2FPXA 2V74B 3AFIA 4U3JA 5JYEA 3G2IA 4AZ3B 3PI6A 2WLTA 4LDAA 5HJ7A 2AW3A 1A2KC 1ZK2A 2JHPA 2Z95A 4AJ1A 2VBGA 1V8ZA 2CBXA 2VO1A 4HO1X 4MWGA 1SBQA 1YGYA 4R05A 1T3GA 2MMGA 5JSFA 3RARA 2GDJA 2YHAA 1Z0UA 3IV6A 1EX1A 3KQKA 4GBMA 1YZVA 3E9QA 4B3GA 1XCJA 4NLLA 1DG9A 2PVCA 4I55F 1T0HB 4P3KA 2EX0A 3RUFA 2H5LA 5HCNA 3UK6A 3UK0A 4EJMA 3KD3A 3OKFA 4R31A 1EA5A 5FPQA 5I7VA 2NXNA 1UC8A 3GNQA 1RWQA 3HV0A 1R0BA 5J43A 3KEMA 1YVPA 1FUUA 4HFMA 4CR6A 4IGEA 4CFSA 1W4ZA 5EN4A 5T3YA 4MVJH 4H2DA 4C05A 4YLYA 4IHJF 1FIUA 1JFSA 1AJEA 1T6XA 5BQ3A 4YIHA 5H0IA 1VYVA 2VHEA 1N57A 4TKUB 1FFXA 4FEEA 2F8SA 1TJ4A 2Z3WA 4FCVA 2XTMA 1AE1A 1G1AA 4UEWA 3F8TA 4ZXPA 2O7RA 1QV7A 4PZUA 4D9CA 3UJNA 3W3ZB 4B79A 1F8GA 2D0IA 2WA1A 1ACJA 4HLNA 2GN6A 4RKEA 4LYDA 2I8CA 4N39A 3JQBC 2PMDA 3OWOA 5J5VA 3ZK7A 4L8VA 4GEKA 4RA9A 4GXRA 2VYQA 5EMHA 4Y9DA 3KQQA 1NQTA 3SIWA 5ICMA 4RM3A 3ADDA 3LYAA 2Q46A 2ODEA 3R7DA 4B43A 5KYNA 3HEBA 1UPFA 4P3XA 4YIKA 1SRRA 2D59A 3ZHYA 4TLBA 4AZ0B 3K4HA 4MKRA 3UPDA 1H8EA 1HEIA 5EKUA 2X0DA 1PBNA 4RD0A 3TINA 4ZCMA 3KB2A 1JIXA 3SFVA 4DV6B 1EFHA 4KH0A 4KN9S 3VR3A 1EUQA 1XAJA 3V8QA 4E51A 4D45A 2KYRA 4FOSA 5FD8A 1J99A 1YCFA 2BFWA 1UBNA 3R09A 1NU6A 2VH2A 3C4JA 5GP1A 3PIDA 4PZCA 5H02A 1JLHA 1AA9A 3K9BA 3P9XA 1VL2A 1KYXA 4H7IA 4GM4A 3LM8A 4IOLA 4LXQA 1QHFA 4QODA 3OCYA 5IXJA 2W0SA 2WM2A 4RNCA 4AL4A 2YZ7A 2D5BA 1ZRHA 2PKXA 3N7UA 3CEPB 4MQ4A 3KYCB 3PRKE 3BE6A 1SCBA 2IE0A 3V55A 1CQZA 2OORA 3BF7A 3HMQA 2IPNA 3LT0A 5HYVA 2R7KA 5H59A 9GPBA 5IT9A 1LRJA 1WG8A 3FZYA 3KU4A 3EFBA 4IGIA 1MW8X 2G8NA 3RR2A 3VNQA 1YS7A 5DGIA 5IJ9A 3SI7A 4BNWA 1DO2A 1OW3B 1W4LA 3KUDA 4R1LA 4YO7A 5BNZA 1O95A 1HLPA 1XNGA 3GOHA 3O0DA 3CWQA 5EP1A 4BMXA 1GRRA 4D82A 5A4IS 1GQQA 4JA2A 4AF6A 5DNAA 3V4VB 1ZJ5A 3N1UA 4OSEA 7GPBA 1JSXA 2J07A 2QJOA 4OQZA 1E63A 3ZE2B 3URKA 4KYIB 2GSDA 3L43A 3MS2A 4H6WA 4QOFA 4IVNA 2Q3HA 4WESA 3KPVA 4Q4DA 5E6RB 3ZXXA 3CCCA 3LFHA 1OPXA 2IU0A 4TS3A 2VZEA 1AZTA 4M0CA 4UXIA 2X7XA 3QKRA 4ZAXA 2I6XA 4RAOA 3IBYA 4JJZA 4UTPA 2ZJ1A 3AVWA 1FQOA 2JIBA 4ZYZA 1CR4A 1A2BA 1CUGA 1PJ2A 2GHRA 2HTEA 4AXXA 5HA5A 4DQUA 4PBTA 3IBSA 1Z18A 3N2GA 4EY7A 4R3WA 5KYWB 1QRAA 1XRJA 2ZTHA 4PC3A 1Z2DA 2OZEA 4G23A 4XX1A 4X64B 3RAGA 2H07A 2C00A 4RACA 4ZHQF 2E4AA 4OLHA 1XZFA 1SCAA 1GL3A 4WAUA 2CWWA 3EBLA 1QVWA 3QPAA 1RHQA 1KSGA 1YU6A 3IXMA 2IZ5A 5CA0F 3L7KA 3VZRA 2BI4A 4Z4GA 1GAXA 1IXYA 3JWJA 4BMDA 5C51B 1OH7A 2D6FA 1FVFA 3LP6A 2WTNA 3GLVA 3ZCRA 4C29A 1J42A 1O6BA 1ZBQA 3RGWS 4EM6A 2D2VA 4KAAA 4ZOQI 3KWFA 3AHDA 3IURA 3N0VA 3FWPA 3A31A 5FR1A 4AJ2A 5LQRA 4RF5A 1I5RA 5AW7A 3B52X 2O54A 1LQ2A 2WT4A 4XGQA 4AICA 3K5IA 4R8RA 2HPVA 1IQRA 1QF9A 2JGIA 5FWDA 2ZTMA 3QBTA 2ZIZA 3WP0A 2Z3ZA 5EUCA 1EFTA 2ZI7A 2IPMA 1LPAB 3JR7A 1VKRA 3FRJA 2JASA 3SJBA 3Q7QA 3R3YA 4KYUA 3FUTA 3H3FA 2NO4A 2DQKA 5HK8A 3PNYA 3UK2A 1M34B 1QH9A 3FHCB 1RWMA 4FYVA 3BQMB 3U40A 5DASA 1E1RD 4M8NE 4MQLA 2W4MA 1K9SA 4HZUA 3ZY4A 2D1FA 1M5TA 1K0FA 2X5XA 4JLJA 5I9TA 1CY0A 3CH7A 2BEWA 3EOAI 3AEXA 4JYBA 1FW6A 3W7BA 4Z7QB 1FVHA 3TNDA 4KITB 1WBJB 1ZOOA 4HQNA 1Z7GA 3FGOA 4WEQA 2XYPA 3PJGA 2O7QA 3KTOA 5ENVA 4DF3A 1I4TD 1Z82A 1O94D 1W30A 4UAJA 4WOKA 1FU8A 1AUQA 4IKOA 2WAMA 2P30A 2GARA 4Y7CA 2EJCA 2JFPA 4U8HA 1IN7A 3P2IA 1PW7A 2WUGA 1TAQA 3EJWA 2WTMA 4M4SA 1E2LA 2OAEA 3R5XA 1MR3F 5KQRA 4IR7A 5EXPA 3ESDA 3C5VA 1KR2A 4UHHA 1BA2A 1QE5A 3D5QA 4FYYA 4WFIA 1Q22A 1EINA 2P6OA 2VQSA 1BTOA 2XQJA 1YZQA 3QVXA 4GM0A 1JVNA 1IIBA 1U98A 4MW9A 4RETA 3TL2A 4MDEA 1GUAA 2ZYUX 1E1YA 2WFZA 4TRRA 3WSTA 1Q50A 3VKGA 4MPTA 5AK3A 3R0XA 1PJBA 3SQNA 1GT6A 3A10A 5TMPA 2QQEA 5ALIA 5U4QA 1FP4B 4JX8A 3RDPA 3ZWBA 4BDTA 1AF4A 5BN3A 4CG2A 2A14A 1PGQA 2ICAA 2DPLA 4ASUA 3CZRA 1S1CA 4HHEA 4HMOA 3SWWA 2W58A 3MB8A 1EE2A 4P82A 4ZVSA 4CLDA 1TL7C 2H0AA 2OFWA 3C6YA 1UXJA 1NUTA 2DFDA 4S1NA 3K0AA 1UF9A 1UMDA 1VJ1A 3EEBA 3CPSA 1TEVA 2JCVA 2C4HA 2PR7A 4D41A 2YASA 1P4JA 3WO0A 5CLJA 1N1DA 3QKUA 1JDZA 3FCUB 4V1CB 3HRIA 2CCJA 2W6NA 2EZ8A 2LTAA 1YCDA 1ZJYA 4WIAA 4LQCA 1GZ4A 1NULA 5ALYA 4G8BA 3ZU5A 3KHTA 1CB0A 5D5QA 2YDYA 1YAHA 2EEPA 2I4LA 2PRYA 4Y9UA 5DN6A 5LA6A 4HTFB 4BP3A 3W2GA 4HH3C 3KUCA 1K9VF 4I66A 4OP2A 3WOVA 3QRWA 1HE8B 2X8BA 4GLLA 1XT6A 3GNLA 3V97A 5FV4A 5IAOA 1XF1A 4PYQA 2B1IA 3QPUA 1FZTA 3WS7A 2JGDB 3EDMA 3U0VA 1P1BA 2BELA 4XFJA 1RVV1 4WA7A 4CV2A 4UOZA 1GZ6A 4GE3A 2FG5A 1W73A 2C8KA 1M34E 3E1KA 4Q21A 3H42B 3RUDA 3LDFA 1UPBA 2X4GA 1CUUA 3GIDA 3GRZA 3MWLA 3Q7RA 4HGOA 4TM7A 4WJZA 1AGXA 4BNIA 2Q0SA 1PWEA 2CL0X 2BM9A 1GGVA 2D2FA 1UKZA 2C97A 3FKJA 2GEKA 4JBWA 1A82A 1BMDA 4MS3A 4OB7A 2D1YA 3IQHX 2QDKA 2O2DA 1I8TA 3EZGA 2A4KA 2FWRA 2Z5VA 1G6KA 3G8AA 4WOJA 3DDOA 4CG3A 1OGIA 1RYBA 2ZR0A 3CONA 4LOHA 3FI0A 6ABPA 1XNRB 2WOOA 2C95A 2DUMA 3I9V1 4DA6A 3E70C 5CK4A 2XIQA 4V1CI 1A4RA 4ND1A 1S4QA 2C3PA 1EWKA 3L1UA 3THSA 1RQLA 4CLEA 1TRKA 2W6JA 2ZDQA 5DLYA 3FMIA 3WC4A 4D9MA 5ICEA 2AZDA 2L42A 2Y1EA 5F9HA 4E1AA 4F5EA 1NF3A 4CEHA 2DJ5A 2VOEA 5CX1A 4WBNA 2EP7A 2C42A 3R41A 4OV6B 1YMUA 4BKMA 1Y8AA 5HZHA 4N8DA 2XKAA 3DHEA 3E6AA 4O4JB 1QF6A 2BN4A 4URHA 1EBUA 4HLCA 4KQFA 1FC0A 3TRHA 2V0NA 5JPDA 1T5SA 3RASA 3H65A 2IP1A 3GZNB 3RVOA 5EYPB 4AC9A 3DE1X 2HN9A 3U39A 1T0PA 4PYMA 3ZCPA 3NDBB 4RTPA 1T9BA 1RNLA 1SZPA 2AN3A 3DDHA 3PPYA 4LS3A 5DI9A 5MGBA 4M7RA 1D5CA 1UEJA 3Q2KA 4PPFA 3K4QA 3T35A 1LJ8A 4FKZA 3LFTA 2CUZA 4JYMA 3QE4A 3TH5A 5I51A 3EDCA 2C78A 4C76A 2JPDA 4MDFA 2JZCA 2J0VA 4LHSA 1I6WA 4PPYA 1KEEB 1YJAA 2H1HA 4D9BA 2Y05A 5A9SA 4OF4A 1D6JA 1NVXQ 1XZBA 2B3TA 4AI6A 3JQ8A 4F5DA 2R4TA 5H80A 1E5QA 1OZ0A 4R2KA 1B4DA 3R75A 2C0PA 1BU5A 3S2GA 1U0SY 2R6DA 1JGTA 3PX2A 3WLPA 2UZ3A 4DWWA 4N12A 1ZNYA 3KSDO 1IVSA 3CEJA 4D79A 3R3XA 4NPCA 4WCFC 5CB4A 3MEQA 3BMQA 1ONNA 3HYCA 3PUYA 1A5SB 2W37A 4LKOA 4WSOA 3VYWA 2UUCB 2AA3A 5CX4A 3KEQA 4P92A 1B0UA 1JH8A 3DFKA 3L8YA 1BU8A 1EE1A 3BJZA 5EFZA 3HV2A 4P81A 1L5VA 4NKRA 2I4RA 1T2AA 3HMKA 4TKZA 3Q4GA 1KAOA 4PSAA 4QDJA 3F1KA 4YRLA 3WWOA 1KZ9A 1JG4A 4I9NA 3OMWA 4KGDA 4BTLA 1AQYA 3R6WA 2OHGA 2PFSA 3RTDA 3T3GA 3TKLA 2ZRJA 1O8CA 4A2WA 2IEZA 2BP7A 2VRBA 3H04A 3RYCA 1NFQA 2AZMA 4I5FA 1XWIA 4IX1A 5FL7D 3ZWMA 4Q7QA 4UUMA 3SBOA 1NVKA 1L7PA 4AYWA 2O0JA 4MS4A 3IT2A 2QUBA 4R0NA 5DNWA 5SV2A 4EGSA 2ADMA 4RFLA 2J59A 1GG8A 3C48A 1IY9A 1WULS 5KYXA 4BNMA 5F98A 4QOIA 3EDQA 3TBHA 2BFBA 2E21A 2M6RA 3IAAA 5CFRA 3R8XA 3R0IA 3E05A 3N8DA 3R9KA 3E35A 3FFTA 4PTZA 3D8TA 3GFQA 4Z4CA 5AVWA 1ZHOA 1X8KA 4RK7A 2D62A 1Z2PX 3T52A 2ZIWB 1ZD9A 4WXYB 4KXYA 1F9EA 1G5QA 2WSLA 4DZTA 2V55B 3GUHA 4MYCA 5I9IA 2X3FA 2PYDA 2VWPA 1Q57A 2B92A 1HV8A 2QN9A 5B58C 5AVQA 5AXAA 1Y1PA 4G4JA 4OFXA 4TVSA 2P62A 3P71T 3SYLA 1ADBA 4I0WB 5GV7A 3UAWA 3L0YA 4WERA 5KI6A 3WLQA 3SC3A 1SG9A 4WBSA 4D81A 5KINB 2YV3A 1B7GO 2D1SA 3B36A 1Z4JA 3R8FA 1MB9A 2EYUA 5JZVA 1BXRB 1PFVA 1QIEA 2H54A 4MV4A 4PINA 3W2TA 2GKSA 2KWIA 1YDWA 4LA4A 3MVEA 1Q6YA 4FW9A 2YMMA 4GOJA 4JOQA 3AT1A 2J9YB 3IVMA 4PYKA 4LJYA 4R2XA 4TT8A 1MGOA 3SQMA 2P0YA 3QF7A 4EYEA 1HRKA 2VHUA 2CJFA 4H27A 4GKVA 3TPCA 1GPMA 3C8MA 4N82A 3UUWA 1FFEA 2Q0XA 4Z86A 1XNQB 1T4GA 5HWSA 2P8SA 1TKCA 4P4SB 3PSHA 3TCKA 4EHNA 1U8UA 2ZIUB 2NAPA 4EKNB 1R4MA 4PCAA 2F3RA 3M1LA 1M83A 1NUPA 3PNLA 5DCLA 1SK8A 2ODWA 2ZAYA 4JZYA 4G67A 5C34B 1IUKA 1PHRA 4RSHA 5AKXA 1JAIA 2A5JA 3ZYCA 2L2QA 2WM8A 4EYGA 2R6CA 4YHBA 3M82A 3CVYA 1SXHA 4A2PA 1JP7A 1PR9A 1GAWA 3DYVA 2Q1XA 4QUHA 1KMQA 4HQFA 3K8OE 3IS3A 4I1VA 5DYNA 2DY1A 2FSVC 1GJRA 1NR1A 4B09A 2JI6A 3SIPA 1QH1A 1CJBA 1M2VB 5IMBA 2XPCA 2XRYA 3A58B 4BB9A 5BNWA 3HB0A 2NXWA 3RF7A 3REQB 1ST3A 3W5HA 3ZCQA 1JBKA 3IJEB 2IEIA 2Z2IA 1W19A 4FYWA 1YE8A 4NBVA 3GG2A 2BBWA 2ZS7A 3UJ3X 5HIKA 1FBTA 5FYDA 4FW8A 3QE3A 3E3MA 4WADA 4CKXA 2QAGC 4U9UA 3BHIA 1KBZA 1EFAA 5EJEA 3T9FA 1WRBA 2I0FA 3LXUX 4Q7MB 1H94A 3HA7A 1RLTA 1D4AA 3EGIA 3W9SA 1DKOA 3T5AA 5KAPA 1U7WA 5JNWA 1GPLA 3AWIA 5K9ZA 2ZAGA 3U09A 1IM8A 1M2OA 3MWJA 3IC5A 3MCUA 3WNVA 5IAEA 4JN6B 1RXWA 4AKIA 4C01A 1I7NA 3BTVA 4X6UA 2H5IA 3HA3A 4J9VA 4EWLA 4J91A 1X7ZB 3LLSA 1CQJA 4H9GA 5JAQA 5E4YA 3ESZA 1GGFA 5KYTA 3ADBA 4I4TB 4O4LF 4MGKR 3VPCA 2Z8XA 1RI4A 3D2CA 5FT9A 5ENDA 4KHZA 3VH3A 4GKJB 2XR1A 2A1IA 2HJHA 4PSKA 3ULKA 4DLLA 4DMLA 2QAGB 4TMWA 2QORA 2P9QA 2Q49A 4D3ZA 1X1SA 2XITA 4F04A 1XFAA 1AXRA 4ZIRB 4PNHA 1U31A 2V97A 1X0VA 1BN6A 4TRMA 2D3WA 3ETCA 2GO1A 2I4IA 3NUGA 1YH3A 2DFTA 2ZBDA 3QQ5A 4QDUA 3GJSA 3U7QB 4A0RA 1QRDA 5EEGA 1CZKA 3F2VA 2PX6A 5C8DA 3ZDQA 1O7JA 3AKDA 3AEQA 2XRZA 3DAHA 3HP1A 1SXJC 3BDAA 3C6ZA 4GXQA 4I6EA 1SBNE 3RS8A 1O0CA 5F3RA 4UHBA 2B5WA 4JP5A 2YTZA 5HVNA 4EHFA 4DT1A 3M7IA 1J49A 4TS1A 4P33A 4G3XA 4JXKA 5JC8A 2I55A 4XPIB 4KMMA 3L1VA 6YASA 1EHIA 1T3TA 4C22A 4M7PA 1NOKA 3TOZA 4P8RA 2EW8A 4FINA 3KDSE 1RKBA 4KQCA 3M6AA 5IAGA 4NX2A 3RUPA 4W9MC 1T0UA 2HNKA 3RYIA 1JSZA 5JI3E 5K0ZA 3LNTA 2D2EA 3Q0IA 4PM4A 3LE8A 2AG0A 3MN1A 3NBFA 2NZ2A 3IODA 1NQXA 2PBZA 2BGLA 3CWCA 3HJGA 1G3RA 3ABZA 4PGGA 4D1YA 3FPSA 1UMCB 1KTVA 5ALLA 4GBGA 4PX3A 4AG3A 2Q6IA 4CUJA 4ZCTA 1SXJB 3DMNA 5J4LA 3ZDEA 4GUDA 2FETA 4HAWA 1R74A 2BW0A 2NZYA 3CTPA 3P45A 4NAUA 4B8WA 4C4TA 3UUEA 2Q9AA 1HWYA 6PFKA 4IV8A 2BEJA 4I3HA 1QYRA 1G2PA 4TMVA 3VDQA 2W6ID 2J3JA 3H5WA 2A86A 3BH6A 3FPLA 4EH1A 1T15A 3FUXA 1BROA 4TPKA 2WDZA 3Q3VA 1NVMB 1EVZA 4DKJA 2Z3VA 3G2OA 1VPEA 4RHXA 4A1FA 1I4WA 1AHPA 3EY9A 3K32A 3OEHA 5BR4A 1JKJA 1LSSA 3ZY2A 1ZM2A 2KHZA 2EHJA 2IKSA 4UBJA 2I3BA 1F6WA 1KI7A 1UZLA 2D1TA 4FJ0A 1W0CA 4MQFA 4PLYA 3TSOA 2WF6A 3MPOA 4WI1A 1Z5VA 2J08A 4A8TA 4ERXA 3WIVA 5JXJA 2I8AA 1OTYA 1ZVKA 2BFDB 4J0JA 1H8HD 1AB5A 2B1RA 2WY2D 1REQA 1HXHA 2I6GA 3GW8A 3NS7A 3R3VA 3D1JA 4UTXA 1XN4A 3KAPA 3GGPA 5FKJA 1WW8A 1C41A 1FSZA 2HZBA 1PRYA 3VSAA 3B13B 1UDBA 1N2IA 1TDJA 2F17A 1IHDA 1E32A 3ZVRA 4F4FA 4TUYF 3OOHA 3L05A 1VHDA 2G1PA 1TC2A 1VLQA 4RZHA 2DXIA 1DIRA 4WZBB 5AW1A 1JEEA 1PUXA 4FXOA 3LLMA 4M76B 1RU3A 4ISBA 1TXGA 2VC2B 4CTKA 5GTDA 2I1VB 4KO1S 3JYHA 1I3KA 4QBHA 4L51A 3MHTA 1BDJA 2DQSA 5KWSA 4KAJA 4BJHB 2ZE7A 4IQGA 1HDXA 3CN7A 4R8VA 2XVAA 3IXLA 4RJTA 1J21A 4X1IB 1EESA 1AX9A 4BNKA 2I62A 4Y2VA 1TZMA 4RHFA 4XQ0A 3T5PA 4WQMA 2NZUG 2IX3A 1K6XA 2UZ1A 1ZUWA 1YKFA 2HBQA 3WXMA 1W1WA 3CLTD 4GYWA 2RIPA 3OPMA 1BOOA 1BS9A 1DLIA 2FN4A 2XOXA 2B0CA 3WKCA 1Y5IA 4QGFA 4DHWA 4QPPA 3SDSA 2R3SA 5JV5A 4CRWB 1YZTA 3SHOA 2I4NA 4DJ5X 3EAGA 2B1QA 2R48A 2VP4A 4YP7A 4CV0A 3BBLA 1B93A 3MWDB 4HSGA 1W6UA 4K9NA 4PZ9A 3AF4A 1KYQA 4KJXA 3TJRA 1YJQA 1EIZA 1OJLA 4EKYA 2PU5A 4NULA 3SMVA 4B8YA 3ADKA 1EFVB 2XUAA 1AO3A 1NZFA 3PVSA 4JR2A 1GKKA 5ARBA 4U63A 4W4TA 4Q4AA 3K6RA 4DAOA 1IN1A 4X1KA 2GVDC 4BZZA 1RYEA 4G2NA 1P7ZA 1D07A 3DV0A 3GUUA 2M98A 1U2DA 1SXJE 4MJ3A 5TVGA 1LF5A 4L5CA 2A1UA 3B12A 3UAXA 2D54A 3IAEA 5TJHA 3DEHA 2ZT6A 1CJTC 1PV2A 3WBFA 3AR3A 1RDFA 4FWIB 1NBMA 5CD9A 4IH4A 5HGJA 3PPVA 5T6BA 1TYZA 3IDFA 3Q1LA 4ID3A 4K88A 3A25A 3PI7A 4KN8A 1ZD1A 1EA7A 4MR8B 3WGQA 2OAGA 2C7RA 4C21A 1G8GA 4RPIA 1CUWA 3IQWA 1RI3A 2VVTA 3U9TA 4EY8A 3OJOA 3OUUA 4H6XA 2B6NA 1K2VN 4QX6A 1DT3A 4UNQA 4WGGA 2O2JA 4G8DA 2AYXA 4Y2JA 1F6BA 3TB6A 2BZSA 4BKUA 1DTWB 1IAVA 3EIEA 4E5NA 5UKDA 3FSRA 4MP3A 1EQAA 5JBQA 2FN7A 2CNDA 3NAMA 2ZROA 4ZALA 1KI6B 3OEYA 4OLAA 1Y5MA 5T67A 1UOPA 3L7OA 5DHQA 1K27A 2WJ6A 5AHOA 4OXYA 3V7WA 5ESRA 5JTUA 1SBHA 1V8FA 3LQQA 3MXOA 4NCXA 1B26A 2BFOA 2YICA 1L4LA 5ELXA 4N3CA 4WZBE 4DXDA 2I9KA 5K6TA 4ARBA 1C0EA 1U1GA 2BT4A 5EMMA 3GEEA 3S2FA 3ZX5A 2R8RA 3K9CA 5HW0A 1GM5A 1FX1A 4DLXA 4JWTA 4GDMA 3HS3A 1CX9B 5BV2P 1Y6GA 1J0EA 3HGMA 3KE9A 3OQIA 4QGBA 5G0VA 4BGIA 4QOSA 5JFOA 1X7YA 1FDIA 1GARA 4LDJA 2YMLA 3KCQA 1XTRA 3P9KA 4DJDC 5TJ9A 4R71A 2AE2A 2MU1A 3QSGA 5FLKA 4D9KA 1GILA 4JMLA 4LXGA 3USCS 1JYEA 1HM5A 2BGRA 4B44A 2PCJA 3UWDA 4TLAA 3I92A 4V39A 1I7DA 1YQ9A 4XCXA 3VU8A 1P2FA 4IDHA 2NO5A 1OXUA 3MNFA 4BVKA 4M87A 4Q4LA 5HFAA 1L5RA 2WSSA 3BIWA 3RFXA 1QE0A 2J32A 3FPAA 5ES3A 3C6KA 4GMGA 2OSBA 1KAEA 1A5BB 3GFBA 3OZSA 1JB9A 8LDHA 1GLNA 2P78A 1OH8A 2A9JA 4ZAZA 3RWMB 2CXRA 1PIWA 2O6LA 1L8LA 2Q9UA 3R6LA 4ND4A 4UJ3A 4DCVA 3AHHA 4KGZA 1ISIA 4UUNA 4V0LA 4EJSC 2OOKA 1UBGA 4NYMR 2ACWA 1MENA 1I7LA 3L4BC 2RGBA 4HFJA 3F6YA 4Y9RA 4S24A 1L5WA 3M6IA 4L0CA 4OJKA 1NA5A 4QXOA 5A5DA 2IPXA 2QY6A 2XVZA 3OKAA 3FGNA 3NT4A 4HXFB 3K0FA 2BM8A 3X2FA 5IJ0A 1KOLA 4C7KA 3TZ6A 2BKUA 4V24A 2JVKA 5AM1A 3WAGA 4L08A 5JARA 1CLEA 1R2QA 2IHZA 2Y27A 3PDCA 5DV9A 5CB6A 3J81k 3JTMA 4WCDA 3QXSA 4D6XA 3LPCA 2VJMA 4GOND 1EH5A 4PQRA 3STXA 4UQLA 3EGXA 4R1QA 1BXGA 5D3MA 4FB5A 4FSDA 4NCKA 3QW2A 2VDJA 3OWXA 1FFSA 2X0IA 3P9SA 4AD8A 3EWAA 2O3SA 1TCCA 4XI9A 4OM8A 3U4MA 1ZRMA 3M9WA 3QVGA 2H8GA 3B9PA 4DIFA 2NQTA 4P84A 1NN5A 1KXZA 2GJAA 3NHWA 3DE4X 4CM7A 4TMXA 4ZAYA 4X24A 4XYLA 2Y0DA 3W5AA 4HH0A 5GOZA 2VZ8A 3N0XA 5FUYA 3BTOA 4FFBA 1E1RA 1PZEA 2J3EA 3I39X 4MQEB 1DQPA 5T8KA 3TOSA 3V6MA 1I9GA 1NW5A 1ISHA 1NXPA 3TW0A 5JOQA 5ALKA 4LUCA 4MUNA 3IMCA 3CMMA 2CLFB 4E30A 2IOFK 3KTAB 4AKHA 3SY8A 1Q7TA 1PGNA 2J87A 1JNXX 1FTYA 1DKUA 4FR5A 4Z51A 3HN6A 5THXA 1F60A 1XU4A 1L7EA 1Z56C 1XNJA 1ZD5A 4FGWA 1VM6A 2OB2A 4NOMA 5AJUA 1E2NA 4I19A 4MVWA 4BUCA 1KWKA 3VV2A 5B4VA 3BK1A 4FZJA 1K3TA 3CX4A 4REQB 4ANFA 5INTA 3R8CA 4YHHB 5L9AA 2V7VA 3KPUA 4NZ9A 3NBMA 1A1VA 3FNRA 4BE9A 3WXBA 3OF2A 2UYCA 1N36B 1IXZA 1IQPA 1VZ3A 1TO2E 3KZNA 3E5NA 4B82A 2XRFA 3DMHA 2O8CB 4PQFA 4TL7A 3DOFA 3NPAA 4G1FA 1JT9A 2JLSA 2ZUFA 1VLLA 3DFFA 4GMFA 4N76A 3EEFA 2G82A 3PX7A 4G4IA 4YMWA 2O8NA 2YYYA 3MBKA 3WKDA 3UYLA 5JDIA 4BVLA 1JEQA 1IPEA 1U7DA 5FLXA 3QLTA 1QPGA 4DCGA 3VHXA 5D3KA 1Z5GA 1XGKA 4DADA 5KYYB 5AKHA 3HUFA 1F9AA 1KJWA 2VDUE 4CKWB 2H8KA 1JWBB 1XMPA 2BCJQ 4Q7KA 4BO6A 1WCXA 4E31A 5LPNA 6REQA 1U65A 2GAAA 2Z5FA 2ES4A 2X58A 4QYIB 1NNI1 3HO8A 3N53A 1RPTA 5JSYA 2QVXX 2ZETA 1QGAA 4GSKA 1DADA 5K0LA 4AO6A 1B00A 3W5VA 2H2FA 2OV4A 3PR2B 3ZHSA 4YB8A 2Y1OA 1X7WB 2WI8A 3W8DA 2VBFA 3AR2A 4BC0A 3KYDA 2CYBA 1EJ0A 4MTLA 4N3GA 3EG9A 1S3IA 4LYFA 3ZD9A 1ZEJA 3ZS9A 2QTNA 2R6ZA 1X8JA 3KS9A 1Q2XA 3MCAA 3RFVA 2IYQA 1WD7A 1WETA 3DVRX 2IYLD 3JQ6A 2EL9A 3FPEA 2DFPA 5M34A 2C7PA 1UADA 3GJZA 1XJ5A 4N0MA 3WB9A 1VGQA 3QELA 1B3RA 1E7SA 3I9LA 3GJ0A 4O63O 3KO8A 1BCSA 1VBNA 4CQJA 1R66A 3ZDCA 1Q95A 4K2HA 3FDIA 5EJ7A 3L4SO 1OX4A 2HA0A 1RQXA 3NDIA 4Q3KA 4WV3A 1SUIA 3VO9A 4D4MA 1ETHA 3DM5A 1YA6A 1GPNA 2NYRA 3KWJA 4LHWA 1ND5A 2BM0A 4PO9A 1V25A 3IUQA 4R4JA 3RTBA 3A6KA 1HYBA 2EBFX 1ORTA 3IDSA 4U2DA 1JECA 5AK5A 2QLTA 2X3YA 3C8DA 3OD5A 2C29D 3E9RA 1KSJA 1EGVB 4UHDA 2WIJA 2Z58A 1ZR2A 2DLCX 4ZVMA 1P2GA 4ARUA 3IILA 1GL7A 2Y1LA 1RWNA 1QDLB 1N5OX 1TJPB 4INJA 2YMPA 2B2XA 5EP4A 3GJ6A 2B37A 3SE7A 1LGYA 4I8IA 3QEAZ 4NZZA 3SOPA 2OBNA 2H4YA 1H6CA 1LK0A 1O2DA 1QX3A 2BM1A 2I33A 5DEIA 1BG6A 4JHLA 3VC7A 5LQSA 1T1IA 5C1PA 3OIUA 2Q21A 2QUKA 3I9OA 2FR8A 3BQNB 5LOVB 2N0SA 2IHJA 3WLJA 3G1WA 1T6NA 4UU0A 3B3FA 3PU6A 2AFIB 4UUQA 5LBUA 1NKVA 2F2TA 2DFKB 1GXSB 2HLDD 2W6QA 3OEED 2NMVA 2ZUCA 1X1BA 4KBFA 1S8OA 2A30A 4DCSA 1E3DA 1THTA 4YJFB 2WMDA 4KRGA 3PVZA 1QGYA 2BGUA 1PT7A 3RREA 4DMRA 1XJCA 3HDYA 1K7XB 4CM8A 5ALHA 3BK7A 4JS0A 2ZIEA 1ZVJA 1O89A 3PWKA 5JU6A 3BB1A 4Q39A 4P38A 1RMYA 1XEXA 2PUVA 1XROA 3UJDA 3I9FA 4ND6A 1U4OA 1WUYA 3D3WB 3E2MA 2EFCB 3ONVA 1KE1A 3DZ8A 4DCJA 1OZAA 2XUHA 3RODA 1IK6A 5FX2A 3C7CB 3M8KA 1L5OA 5EPOA 3TMKA 3CBQA 2FW7A 4JVOA 1CUAA 1VE7A 3OQ6A 3JATB 1TNDA 2GD0A 1KE2A 2WTUA 1B6TA 3VTZA 5C4IA 3VMFA 1VHLA 3OX4A 3RBVA 1UBMS 4UNIA 4CNBA 1DFGA 1Z4IA 2R96A 1CYEA 4KEAA 2FE4A 2NN3C 5TGZA 1EMDA 1S9HA 3LBAA 1NUUA 3N6VA 4FYHA 4WFJA 4TS4A 1SZJG 3VAAA 2VWGA 4L73A 2Q4RA 2XDWA 4PG5A 3M5WA 4QULA 5IEBA 3KOZA 2C9YA 2O2IA 2VDWB 3WRVA 4ZEMA 1NVFA 3QX7A 3T4XA 1JA1A 3G0OA 4MYHA 1HZZA 5CPFA 4ZEVA 2ZSUA 4GNKA 5AVXA 2AI1A 3FCYA 1JUDA 3TQRA 4CODB 2OR3A 3BOSA 3BMCA 5L3VA 3H4MA 2XVYA 2P0EA 4BBZA 3Q8KA 2R66A 4EKEA 3K2IA 4KR6A 4N0EA 3GP5A 4OFZA 3NHLA 3CC8A 1NQWA 1Q3TA 1RJ9B 2ZRNA 2XCLA 1OX6A 3HB1A 3SK0A 1M1XB 5LDGA 1KAGA 1WBBA 1D2MA 3WZLA 2ZU6A 5JH7A 5JWOA 5K8IA 3MJEA 2EW1A 1BGXT 4RK5A 2IZZA 4MR7B 4OG2A 3H9BA 1NMQA 3GUZA 2ETVA 3MC1A 3NETA 2QYOA 2QPLA 1V8OA 2QJWA 3H2IA 5AKEA 1QB8A 1OLXB 4M9RA 5J1TB 5H8WA 4P08A 5B1DA 1KOJA 3HM9A 2QTGA 1MFZA 2WPNA 4MH0R 4PXSA 5CJPA 3V1YA 2UU9B 1N2BA 2BGKA 4BQFA 1XRMA 2FB9A 1ESZA 1NN0A 1RLMA 1ZGCA 4WY8A 1CZRA 2AMFA 4P54A 3VU1A 4GFDA 3PC8C 2R87A 4BFLA 1DAFA 3TFOA 3RUHA 4IHAA 4UD6A 3AFNA 3UG7A 1LFAA 1O6CA 1XR3A 4L9AA 4MQMA 1J1IA 3JARA 5CM2Z 2CB0A 3ZU2A 1G3IA 1TQHA 2AFIE 2DG2A 1JPJA 4EZIA 1K7CA 4EGJA 4TTIA 1GTSA 1QIJA 1RI2A 2B6HA 1L5GB 2C7GA 1VLZA 3EPLA 1F4LA 1UAGA 3KYIB 2ECFA 2Z8ZA 1EDBA 1RIFA 1E2EA 1F0YA 3EIOA 3EBPA 3L7AA 3KKOA 1A4IA 2ZSIA 2VP5A 3VQTA 2F3TA 3QWFA 4NJOA 3RG2A 4ZQCB 3OP1A 1A1SA 1LH0A 1T13A 4LJ9A 3V00A 3MAAC 3I73A 4X6XA 3NP9A 3PL5A 1VE5A 4K6HA 3ZGYA 1TYDE 1D2EA 1JLMA 3GFRA 3LQRA 5LYJA 3U37A 3H9JA 5KHLB 5CEJA 3FM9A 3QNWA 1TA4A 1C7IA 3I8SA 4HQ6A 1BWRA 1JU4A 2QPTA 1Y9ZA 1KAHA 3IDZA 3JQAD 1DCFA 4A23A 1PGOA 3EXHC 2C1ZA 3IEXA 2Q4EA 3AX6A 4TV8B 4F85A 1TM1E 1M67A 1ULSA 3AJAA 2HCRA 2VAMA 3MJTA 5LA6F 4Y6GB 3A2LA 4HDMB 5C9ZA 1N34B 2C07A 1MVLA 1LDMA 5BMVA 3CGWA 4OCZA 4JJAA 3T7KA 5FA8A 3MLAA 1KVQA 2GJ9A 3C85A 2QTTA 1BMFA 1X87A 1FNBA 2J3KA 3DPSA 1U7ZA 3F5QA 4MVJI 4HX2A 4RKWA 5E1DA 4UVHA 4BKOA 2Q2QA 1U0EA 3G5AA 1Y81A 2H51A 2CGEA 4HMPA 4UM9D 2OCXA 3JQDA 3LQKA 1KEUA 3IAM1 2Z2XA 3ANMA 3BGDA 4AMZA 1Y8RB 2QG4A 4HS4A 2Z4SA 4RMJA 1DFHA 1EJBA 2YN0A 3HN7A 5IDVA 1Z2OX 4CT0A 2QSYA 2GBGA 4RIIA 3UQZA 1TUBA 4K9RA 3ZI7A 1E4VA 1LSOA 5A04A 1QQBA 3G2JA 4MV1A 2CVZA 3PFCA 4EEZA 2PUAA 1SC6A 1FL9A 3PDUA 1GADO 1I6KA 2Q5CA 4KYVA 4WNAA 1BSVA 2I6QA 4KFTA 4CZ2A 3LV8A 3M6WA 4F4JA 4CF3A 5ABPA 3QPDA 2IGBA 3CG0A 2R1TB 3LT1A 4XEUA