3HDVA

Crystal structure of response regulator receiver protein from pseudomonas putida
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
120
structure length
120
Chain Sequence
RPLVLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLMITDLRMQPESGLDLIRTIRASERAALSIIVVSGDTDVEEAVDVMHLGVVDFLLKPVDLGKLLELVNKELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of response regulator receiver protein from Pseudomonas putida
rcsb
source organism Pseudomonas putida
molecule tags Transcription regulator
molecule keywords Response regulator
total genus 41
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hdvA00
1YK1A 4MR8B 4YS6A 2PUCA 1P8AA 3CFYA 4G97A 4KFCA 1BAPA 3HK2A 3OMWA 3TX6A 3BILA 3JVDA 2X7XA 7ABPA 4EYOA 4RU1A 4XAQA 4KK4A 3B2NA 5C5EA 5B3JC 3C3WA 3SNKA 4RY9A 3RVRA 1DZ3A 3NBMA 2JVJA 1FFSA 2L2QA 2ZWMA 3Q7SA 4MQEA 1NXPA 1ZAYA 2HJ9A 2ID7A 1M5UA 2RJNA 1TVMA 3H1GA 3OMXA 2ZAYA 3CLKA 4MLDA 2VUIB 3CKMA 1QMPA 2QU7A 3N53A 1RXIA 1YMVA 3QLVC 3M6MD 3KTOA 4KVFA 5EWMA 3IP7A 4M88A 3H5WA 4ZPJA 4KREA 4P1ZA 4WXEA 1H9CA 1ZDMA 4FE4A 2L17A 4JP1A 1QP0A 1ISSA 3OLZA 4XASA 3RVQA 1JFTA 1M5TA 2MYNA 1C4WA 4S04A 2I6FA 4LDAA 5IUJC 2LPMA 5BR1A 4MR9A 2HSGA 1JYFA 4NCAA 3F6CA 4YR7A 3E61A 4WT7A 3HEBA 4WWHA 2PMCA 5JNWA 1W9HA 5IC5A 1JH9A 4GNRA 3HO1A 1ZH4A 3LUCA 4Z4EA 5FBKA 1P6QA 4KRFA 4O1IA 2P9HA 4ZYLA 4RKQA 1JFSA 1JYEA 1CHNA 4JB2A 2QW1A 4HNRA 2H3HA 1OXKB 5DTEA 5HQJA 1ZHHA 4EVQA 5CNMA 5E3JA 5KC8A 4N03A 5TQ2A 1T34A 2FMIA 2PJUA 2CHEA 9ABPA 4TMYA 3KLNA 5FWYA 1KGSA 1BDHA 3NHMA 3OO1A 3JY6A 2GBPA 3A0UA 4EGSA 4PE5B 1J56A 1NXTA 2NT3A 3C6QA 4G0QA 3H5IA 4PICA 3H5VA 3FFTA 3RVOA 4UHJA 3MM4A 4W5OA 4LE1A 2F8SA 3Q7RA 3SAJA 4NCBA 3KHTA 3N0XA 1MB0A 4W5NA 3QEMA 1K66A 2M98A 3I5AA 1DRJA 3A10A 3NNDA 3CRNA 3QELB 2LP4Y 4OBBA 3HUTA 3LUAA 8ABPA 2N9UA 2GI4A 4O1HA 3OQNA 5IULC 3S99A 2PKXA 3T6KA 1FFWA 4WXMA 2QXYA 5B3JA 2L18A 2TMYA 4Z99A 1SXIA 3O2SB 1UDRA 3JVIA 2PLNA 3KCNA 3H1FA 3CHYA 5ED4A 2LUOA 1YS6A 1R8JA 3Q7TA 4MRMA 2LBPA 4N0QA 4MYRA 4Q6WA 1PNRA 1DBPA 4FE7A 2E4WA 2FW0A 3GWGA 3CG4A 4MAAA 3M9XA 1QO0D 1USKA 2MYTA 4RK4A 3LUJA 1DRKA 1NXOA 5EWJB 1DBQA 3EAFA 5TQ2B 1L5ZA 2PUAA 3KYIB 3JTEA 5PNTA 4DN6A 2A9OA 4YWHA 2IYNA 1TLFA 1IIBA 4IF4A 4TLMB 5EWJA 5KQLA 4N41A 4IMIB 5D2CA 2QVCA 2AYZA 4MQFB 5CNIA 2LIVA 4YCSA 4KPYA 4RZSA 5JNVA 4G0YA 1SRRA 4RWEA 1DBWA 4NQRA 4MS4A 2GWRA 2PL1A 5JS1A 2FQYA 4MS3A 1A0OA 2QV0A 3K9CA 1MIHA 3VNAA 4D74A 1S8NA 2GKGA 4MLCA 1XHEA 2R47A 4LZLA 4Z9AA 1RNLA 2JBAB 5EWLB 3OLWA 1ZVVA 3EDCA 4RS3A 4RK6A 3QX8A 1NXWA 3I09A 2WRZA 2OQRA 3GT7A 5IEJA 5JNTA 4MQEB 3GYBA 1Z18A 3H5OA 4N47A 1DC7A 1AB5A 3QEMB 4ETIA 1XHFA 3NNNA 5IUKC 1QQBA 5EWMB 3MQ4A 1AB6A 2R4QA 2NT4A 2WMYA 1ISRA 1Z17A 1Y1LA 3MYYA 4MS1A 1YIOA 4H3HB 1QP7A 3Q15C 2FSPA 1RZRA 2M1ZA 3O75A 4Q6BA 5TQJA 3RVMA 3W9SA 4XFKA 1SXGA 3C3MA 3KJXA 4B09A 4UHKA 1DCMA 3D8UA 2JCGA 1JWLA 3P9YA 2PUFA 4MR8A 1GCAA 4Z4HA 5JNSA 3HCWA 3O21A 3EODA 1GLGA 5DLEA 3LMKA 1A2OA 2RGYA 3R0JA 3N8IA 1QKKA 1JFVA 1DCKA 1GUDA 5JNRA 3HVRA 2VUHB 2QR3A 3MIZA 2JRLA 1QQAA 1U2PA 2PUDA 4G0XA 3LTEA 4RXUA 2WB4A 3O1JC 5CNJA 2PL9A 3LKBA 2FQXA 3N75A 3Q9SA 4G0ZA 4MS4B 3GV0A 5JNUA 3ILHA 3URMA 5KQMA 2IPNA 4OATA 1VPWA 3C97A 4MR7A 3ROFA 1YTUA 4RXTA 1BDJA 4CBVA 2KYRA 3OLXA 1D1QA 2J48A 3EQ2A 2QZJA 3FDFA 3OM0A 3O2QB 4DQDA 3EQZA 4PZ0A 1ZY2A 2W42A 3O1IC 1KMIY 4W5TA 1ZGGA 4EY3A 3LUHA 3CZ5A 1ZN2A 3FGZA 1RXEA 1DG9A 4LX8A 4ZMRA 3H75A 3BRQA 3RVLA 5KI6A 1HEYA 3BRSA 1NXXA 1D4ZA 2QVGA 3N0RA 1TM2A 5HM6A 3T38A 4YP9A 4NICA 4ETMA 2GX6A 2PAFA 2VYCA 4QYMA 5IUNC 4OLAA 2IKSA 5TPZD 1JX6A 1URPA 2PE5A 3FFXA 2PUEA 2A9QA 1JF8A 4RKRA 1APBA 2A9RA 3BREA 1Z26A 3G1WA 1MB3A 2E4UA 3GBPA 1DJMA 1VLZA 3RH0A 2RDMA 6ABPA 4MS1B 3KLOA 3RVKA 2CD7A 4G0OA 4QPJC 5ABPA 3OO0A 1E6LA 4RV5A 4LE2A 3TD9A 1JBEA 4YLEA 4Z4CA 4MGEA 2NUBA 2E4YA 3KS9A 3L6UA 1EWKA 4KK3A 3UKJA 1QPZA 4EYGA 2IPAB 4ML3A 4Z9BA 5DGCA 1VRVA 1PEYA 2ID9A 1Z2EA 4LE0A 4D6YA 3I45A 4F3TA 4QICA 1QO0A 3ROTA 1E2BA 1ZESA 1DP4A 2YHAA 5TPWA 3HXMA 1U2QA 4TN5A 4GPAA 1U04A 4KZKA 1I3CA 3CU5A 2MSWA 3LFTA 5C5CA 3LUKA 1Z15A 4G0MA 1K68A 1EWTA 3FFWA 4EUKA 3O2JA 3HS3A 1SXHA 3NNSA 1NATA 1PHRA 4IGAA 3GRCA 1M2EA 4YRZA 4F06A 5CHYA 4IILA 4RSMA 1QNLA 2E4ZA 4NV3A 1YVUA 2HQOA 2JK1A 2Q5CA 2H0AA 4PYRA 1D5WA 3LUDA 3I42A 2FN8A 4MR9B 3TB6A 1ZH2A 1U0SY 2AYXA 3QLUA 4JASB 5BQ3A 3CS3A 3L49A 5GQSA 4LRQA 2FLKA 3TO5A 1L5YA 2R25B 1P2FA 2A9PA 3OQMA 3E3MA 3IPCA 1NXVA 1C0EA 2HQBA 5TPWB 2OENG 3HJFA 2FQWA 2O20A 5TPZA 5I4CA 4Q7EA 3A3KA 3OM1A 4EVSA 4S05A 1CYEA 4YV7A 3DBIA 4N0PA 3H6HA 1YK0A 1B00A 1W25A 3UK0A 3LOPA 4D6XA 3QLUC 3F73A 2FMKA 2MYPA 3HZHA 2FLWA 2F8TA 2WJAA 3VNBA 4N76A 2E4VA 1SD5A 3KSMA 2RJOA 2JBAA 3HSYA 2CHFA 1D2AA 3F6PA 2IOYA 3QLVA 5IEBA 3SY8A 4MPTA 4RK0A 3H6GA 4JAVC 6CHYA 3JPYA 4E7OA 4Y9TA 5FWXA 2L19A 3O1HB 1DC8A 4XXHA 3EULA 1JDNA 4LDZA 2FEKA 1LJUA 4MQFA 1YMUA 4ZMSA 1EHCA 1ZGZA 2V0NA 3ILYA 1LJLA 1E6MA 2XDYA 3CZCA 1A04A 4KV7A 4MR7B 5HSGA 1KRWA 4E7PA 2CWDA 1FQWA 2JB9A 3FMVA 2FEWB 2YHBA 1Z12A 3LUGA 3RVSA 2B1JA 1OXBB 1MVOA 1VKRA 3T8YA 1YS7A 3CTPA 1NY5A 5FBHA 1TMYA 5DCLA 5GOTA 4JOQA 1JL3A 4L85A 2HPHA 2NZVG 1P6UA 1ABEA 3JPWA 2HQRA 3EGCA 4KMRA 4KQ9A 3O74A 4EVRA 3H5TA 3HDGA 3OLYA 4OLBA 3M9WA 2FEPA 3TMYA 5FWXB 4HNQA 2DRIA 3GBVA 2FTKE 3QEKA 2P4UA 4WUTA 1DCFA 3GA5A 3H5LA 1USIA 1FFGA 4OTZA 4RK5A 5T3YA 1F51E 2IPLA 4KQCA 3RQIA 4H3KB 4ETNA 3IDOA 3RVPA 1D1PA 3DGFC 3QX9A 4EYKA 2FN9A 1F4VA 1NTRA 3KKEA 5TQ0B 3SM9A 1Z25A 3QELA 1EFAA 2FKAA 3DGEC 4OG2A 3SG0A 4XARA 3SQNA 2PUGA 3GL9A 4RY0A 3D02A 1ZITA 1GUBA 1PUXA 3MA0A 5BRJA 3N0WA 2PUBA 1ABFA 3K4HA 4DADA 3RVNA 3HUUA 3HM9A 3OLVA 4RK7A 4MRMB 3A0RB 2WWVD 1GCGA 1NXSA 3JS5A 4QYWA 4XLTA 5EWLA 4F8JA 5FWYB 3MF4A 4TLLB 1M2FA 4EYQA 5HKOA 3IP6A 2E4XA 5TE9A 1E6KA 4ZJPA 3DLBA 5KQPA 4JA2A 4F12A 1USGA 5KQGA 4WZZA 2WJWA 4KNYA 4L4UA 2NZUG 4HYEA 4W5QA 3G85A 4PEVA 5TQ0A 1FSPA 5KC9A 3OQOA 3N6VA 3QK7A 1JDPA 1LBIA 3C3KA 3IP9A 4G86A 1JLKA 4Z4FA 3H1EA 2R48A 3BBLA 2FVYA 3KYJB 4YGXB 5F64A 3CG0A 4G0PA 5JS2A 4O5AA 1XWWA 3MMNA 4Z4IA 3IP5A 1BA2A 4MS3B 4IRXA 4RK1A 1BDIA 4YO7A 1U8TA 2IPMA 4RDCA 1EWVA 4H60A 5T7BA 1CEYA 2MSLA 1TJYA 1LBHA 2IDMA 5DKFA 2FMHA 3DZDA 3CNBA 3QLTA 4W5RA 3LUFA 5BRAA 5IBQA 1RZRD 1Z16A 1WETA 3NHZA 3Q41A 1Z13A 3EJWA 5CNKA 1QP4A 2MYUA 4RXMA 1KRXA 4FB4A 1Z2DA 3HV2A 1PNTA 3DLHA 1PEAA 1RPJA 4IMJB 4Z0NA 2BGGA 4P98A 4HNSA 4JB0A 2FXIA 4Z4GA 3RVJA 3F7NA 2JVKA 1LK0A 2QSJA 3T95A 4F11A 2VK2A 5IX8A 1JHZA 2B4AA 2MSKA 5KWSA 3LKVA 1EAYA 1BVHA 4RY8A 2FMFA 2JVIA 3IPAA 3HDVA 3UUGA 1MAVA 3KG2A 2WY2D
chains in the Genus database with same CATH superfamily
2IHZA 1M6EX 2V5AA 4EL5A 3D3WB 5ALLA 3MMPA 2PG3A 3OMWA 4Q1CA 4J4TA 3BILA 2X7XA 4HDKA 621PA 3EMBA 4EOGA 3X1MA 1Z0IA 3C3WA 3Q6NA 5A1JA 3QM1A 4ND4A 5B3JC 1QRSA 3K9QO 4MPRA 3RYFA 2JGDB 4EAQA 3RODA 4KBFA 2VCEA 4A1OA 1NXPA 5F51A 2JANA 1LXCA 1Z34A 2PA0A 3KWLA 3EC7A 4QVGA 1D2CA 3KE8A 1TYCA 4MOWA 3EQ9A 4KVZA 3VI4B 3U4QA 1DKRA 4YB8A 4BNDA 2V7UA 4UHHA 3QA3E 3KX2A 1EK2A 1EXDA 3HGQA 3NT5A 1XXLA 3BF8A 2G88A 2PZMA 1FDWA 2ZB3A 5K8CA 5KOYA 4AKHA 1XMJA 4Z9YA 2G77B 5J5VA 4M9QA 3GCXA 3IKVA 3I58A 1RYDA 2OFWA 1C4WA 3M1LA 1M34E 3O7WA 2QT9A 5J4LA 4WNAA 5IUJC 2B9EA 1NW9B 2C7QA 3E48A 2NV2B 1K75A 4R2IA 1ORRA 1VC2A 5A4AA 1MXFA 2GCOA 1OOEA 3I9MA 4HH3C 4UD6A 5I9IA 5KO2A 1SCIA 1W94A 2XJ9A 1Y9ZA 3NGXA 4K1LA 1EGQA 5HWSA 1HDRA 2DY0A 3LJKA 3IQXA 1NYQA 2H52A 3HPRA 3K0CC 2RB5A 4Q4HA 4QVKA 1FLVA 1ONPA 2NP7A 4CMJA 1LI7A 1QX4A 3M6VA 3OPYI 5H70A 1LKZA 1TB4A 2PO5A 1L4FA 1RRVA 1XCBA 1O6FA 2QL9A 3GJ0A 3NG1A 3Q0EA 4L51A 4ZYLA 1JFSA 4PN7A 1J23A 4PQRA 2H4YA 5KSWB 1VXRA 1P2GA 2Q2QA 3V42A 1C9NA 2X14A 1ZHHA 2NSLA 5KYXB 3NEAA 1EQ2A 3PGA1 5FBRB 3ZIAD 4HWTA 4Q7JB 1FFYA 1RC8A 1UFOA 3DR5A 3M6WA 5EJ6A 1DC3A 2EZ8A 4N12A 4BMCA 4B4WA 3M8KA 2DZDA 3LP5A 3V2GA 1GPYA 1J8YF 2QGFA 1NR5A 5KYWA 3D2AA 4WE3A 5FWDA 4D99A 1N7GA 4LXHA 5LQMA 2IXEA 3C6QA 1F2TB 4Q3KA 4WVFA 2DFKB 4IDHA 1QR2A 3VZBA 4YLYA 1WXIA 2WD9A 4E3ZA 5JXWA 4M37A 5AKXA 2F8SA 3I4LA 4YAWA 2P5YA 2QS9A 1F2DA 3K0CA 2UXDB 3FE2A 4I3GA 4N5LA 3UBMA 5LA6F 3AO0B 2QPTA 2YNMA 3OIVA 3JWPA 4ZMBA 4QFMA 1OC4A 2AG1A 4C4RA 2E21A 3NH6A 4PLFA 4TUYA 1FTSA 4ZJPA 5A4IS 2J45A 2PUJA 1UBMS 4YROA 4UCWA 1B6SA 3VAAA 2IYXA 2QXYA 3ANMA 3PEEA 3JD0A 4YCAA 4DHEA 1E69A 4H7DA 1F1BA 2G28A 2WM9B 4OLFA 3HFSA 2IU6A 3FCSB 3HJTA 1KH1A 1ZBDA 2B2XA 4XRRA 3V1LA 3Q7TA 4TYNA 2ZUCA 1PNRA 1Z7BA 4TWAA 5I7WA 4WIAA 4BGVA 2AUNA 3DTYA 3TN7A 1F8YA 1X8LA 3KZOA 1H4VB 3Q3CA 3WLLA 1Q0SA 4J29A 1EFLA 4DMLA 4ESHA 4RK4A 1RJWA 2HMVA 2QVLA 2VJAA 3MWEB 3OZSA 5JMPA 2X8AA 5AW6A 5JJ5A 4DG5A 4H0FA 2WJZB 3NRBA 3P0RA 4EFMA 2EW2A 2YJGA 3I5XA 2CV0A 3G89A 4C6RA 2AMVA 3INNA 1NP3A 3CH6A 1RABA 2ERCA 2IYFA 1M3SA 2H1RA 2NQ2C 2Q27A 3NW9A 4LZOA 3OPYA 1BJKA 1MX3A 2YY6A 5A2QA 1DTWA 3DO8A 1R4NB 1CETA 3KELA 4MV9A 3DAOA 3P2JA 4ENSA 5C8ZA 5DYYA 4CKEA 1Z0SA 1KQGA 2PL1A 1UT6A 4G24A 5CX4A 2P9YA 3CINA 3TX2A 4P8RA 1E60A 3AFIA 4W5JA 3IUPA 1Q77A 5B53A 1U4NA 1GZ7A 2R8BA 2ZRNA 1F6BA 3LQRA 4IAOA 4J90A 3TLAA 1BD3A 1H05A 4WKPA 1UJCA 2AR0A 3VAYA 4EUNA 2QENA 5JFOA 2XRYA 5H8WA 1E7QA 2ZRLA 4A5SA 4E46A 5K09A 5IPFA 3GRRA 1OGIA 1N3YA 3E1KA 2QXUA 3P32A 2C84A 3G7NA 3M3DA 4E1BA 4LPKA 4ETIA 2WYIA 5IUKC 2W7TA 2RGEA 1GILA 3LYLA 1NI3A 2WMYA 1EM8A 4P3XA 5CM9C 3RK0A 4A23A 1AKQA 4ZU1X 5IF3A 2ZI5A 5BUCA 3ITNA 3R3VA 3JZFA 4EFLA 3H19A 4TXNA 1ZK4A 4DIEA 2FSPA 3LQFA 1U8YA 2I71A 5L3SB 4RPJA 1LPSA 3TINA 3FM9A 3QLEA 4ZDIA 4J3NA 3U56A 5ETJA 4LGVA 1YR3A 2MCFA 2QN8A 4PONA 2ADOA 2FX2A 2R5WA 2XUKA 3D8NA 3I05A 4IUDS 2ZB2A 4Q7LA 2XRMA 1HKHA 2DKFA 3BMXA 1C0PA 2IHJA 4WACA 3UMRA 4XOIA 1LQTA 3MJSA 3MQFA 3ZVKA 1NMEA 2O1EA 3LQYA 3PYLA 1YQUA 4UAVA 1EHIA 1EVYA 5DLEA 3IEMA 3W0LB 3BEDA 3PWTA 3UW1A 4J1QA 2ZB4A 4NAUA 1GUDA 1DCKA 1O4VA 3PQ2A 4N65A 2ZTUA 1WZUA 3CW9A 2GQ0A 1BGXT 2XAUA 1FJXA 1H8ED 1EJ6A 5AXAA 1CKEA 4F8EA 2VPZA 1PT5A 2C8KA 3ZWBA 1D03A 2BY4A 4RPIA 4DCJA 1ZAKA 3L6RA 3LKBA 1GRCA 1IB6A 3M1AA 5SZIA 4D41A 1A5BB 1UMDA 2NZXA 4UD2A 4YRSA 1LDGA 2WF6A 1U3GA 3KWJA 4I50F 3X3HA 3D5EA 2CJXA 5F1PA 1KE1A 4C01A 1PFKA 4EB8A 1VPWA 1V8FA 2B1GA 3N0TA 4IJMA 2HT6A 5TVKA 3L7AA 4KR0A 1YS1X 2JHAA 4C04A 2JGNA 4CU2A 3GUHA 2ZUBA 3OESA 1J5PA 4O4JF 4QC2A 4GM1A 4BLSA 4GKBA 1FQJA 3VKWA 2HRZA 3D3QA 1L2TA 3PXCX 4TTAA 1NL3A 4L8GA 3M1YA 2I1VB 3QKUA 4Z8YA 1Y9DA 2OD2A 4ZPXA 1J70A 5KI6A 3PXDA 3FYUC 4RORA 1D4ZA 4EFNA 4X8MA 3GLFA 3CRMA 3AESA 3AF2A 3OIWA 3UUWA 5C53B 4NH0A 1QVVA 4KXUA 2GGSA 5I7UA 2C2BA 4OLAA 3ZBQA 2GERA 4Z3KA 1CP2A 1Y1RA 4OGLA 5CDFA 4C0QC 4E09A 3UMJA 3PLAE 2V8OA 5KNDD 4N5IX 2V54A 2FZEA 1PFQA 1MW9X 3PQ6A 1DJMA 2OLEA 3FOBA 2QRVA 4O2AB 4RSGA 1V16A 1Z6GA 2KLHA 2G70A 4JS0A 2VJMA 3VSDA 2BUAA 1IN8A 1R27A 1WEHA 2G9ZA 2KWIA 2X9VA 3KLOA 4L7QA 4DBLE 5HVNA 1AF7A 1M54A 3FBGA 2E89A 3OO0A 3KQWA 1S0UA 3HFJA 1JBEA 4GKVA 3T7EA 1W35A 2GZAA 5CEJA 3UKJA 2XUFA 3DPUA 3KQTA 4PYKA 1OH6A 4LI0A 2PMKA 3QNUA 4L2IA 4CETA 4CQMD 1LPBB 4KMOA 4UZFA 1WPQA 2C5BA 1JALA 1X80A 2YZMA 3LF1A 4FKZA 3P0HA 1XKQA 3COZA 3MN1A 4ER6A 2QTVB 3BHNA 4HH1A 2PIAA 1WPRA 1ZSVA 2W00A 4ZVRA 2OBBA 2FXVA 5EKXA 1U04A 3A9CA 4QWWA 4O4LF 4L0QA 4YYZA 1TW3A 3MNFA 3LUKA 4MITA 4UQOA 3SYTA 3V2HA 2AFRA 3G23A 1YMQA 1Z39A 5F73A 4OIFA 2WYWA 4ZJZA 4RD4A 1DJLA 1KAEA 2DKNA 3YASA 4DCCA 3M9LA 4HJRA 4OB8A 4OK3A 4TMFA 5BQXA 3G0IA 3TZBA 2BJVA 3F6EX 5TRTA 4L9RA 1DAOA 1PHRA 1M2EA 2D0DA 3PJGA 3WK7A 4LSMA 3I62A 1B1CA 2OORA 1L5KA 2W58A 3T06B 2MSCB 4J4BA 3EC1A 3BORA 2WD7A 3PD0A 1L5HA 4E22A 4Y7DA 2VAXA 5EMKA 1NQ5A 1QH0A 1JAXA 2WA1A 3MYRA 2ZIXB 1TNDA 3L49A 4EKDA 1SHKA 4FN5A 1IXZA 1N3IA 2F2TA 2WHXA 4PSKA 4PZEA 3ROKA 5EP4A 2CK3D 3G9ZA 4F6LA 3T5AA 5CEFA 3G9QA 3UPTA 1ZCZA 4DBVO 1PQYA 4UQLA 1E98A 4BQRA 1E4EA 3R9IA 4RE5A 2X8JA 2ONYA 1EGMB 1ZL2A 3JR3A 3S2UA 4G8JA 5LQCA 3OPQA 4D3ZA 1TQDA 2Q2OA 4MWGA 2OO7A 3QFTA 2BM9A 2ZJ4A 1V7CA 1Y3BE 3FN4A 2QUKA 3O91A 5GVRA 2H2WA 3KQUA 2C9BA 1KZHA 3VC7A 4CIYA 4PGMA 4ALMA 2ZQYA 1U7WA 1EP9A 3OICA 2OV2A 2D3WA 1RMTA 2WWGA 3EQ6A 6CHYA 1P0IA 5BN3A 2GCIA 2OHJA 4PCAA 4D25A 1RZUA 2Z1DA 3DPIA 2ZSKA 4E7OA 5KNBD 3SI7A 1AZLA 1OH7A 5D8DA 2FWPA 4P32A 1D4OA 1GT91 1Z4IA 1EIWA 4DQ0A 1KERA 3LQ1A 3DOIA 1N77A 3C5CA 1H2AS 1NURA 4BV9A 1C14A 3ELDA 4OBXA 1YQDA 4GVLA 2BR5A 4AZ3B 1P81A 1K3TA 1V4BA 2IF0A 1M2VA 3H8VA 2YHBA 2AG5A 1LPMA 3PP8A 3ZXUB 4CMGA 4LCBA 5K0NA 5HUJA 4QL3A 5JY6A 1Z36A 1ZUIA 2OMEA 3LM8A 3N74A 2P6RA 1JL3A 1G4HA 1G5QA 1KMHB 1LWNA 1PJZA 1T26A 2AFIA 2HPHA 1DIRA 3GD7A 5HFJA 1IN1A 3N7UA 3OQIB 2DAPA 3KPVA 3TJZA 5LBUA 3PITA 4IXDA 1T1IA 3L05A 1X8JA 3EISA 2R00C 4FGWA 4A2QA 2I8LA 3K4QA 3NGLA 4JKIA 1U7XA 2MHCA 4FUTA 4DCGA 4KFTA 1PL8A 2BR3A 4JGIA 1IN5A 4KWEA 4HQNA 4MW0A 1BG6A 4U7DA 3DONA 1CNEA 4JVLA 5JQGA 1MG5A 2UUAB 2A1UA 4WXPA 1RIFA 4CCYA 3P9NA 1JEJA 3K5WA 2OECA 1CULC 3SYMA 3OQPA 1PX2A 1LI5A 3W34A 2PV7A 4BMZA 3GNTA 2ZYAA 3L7YA 1I7QB 1JHOA 2XVXA 4LVOA 5DMHA 1UKEA 4O4HA 3KXPA 4LUCA 3SEFA 3UUFA 3WWEA 4D0RA 2R00A 3TBHA 2BE7A 3X0DA 3MLAA 5B7GA 5JXGA 5LLTA 1L5WA 3WK4A 1UPXA 3DGEC 3Q6MA 2O06A 5E1OA 4GVPA 1GDDA 1II9A 1E2NA 2IBMA 3I9FA 1CR6A 3KVVA 2AL7A 5TDHA 1L3CA 3GT3A 1PYGA 2HADA 3BSFA 2R62A 3GJ5A 2P69A 2W83A 4FWBA 3DCYA 4KO4S 4MZXA 4W9NC 3WWDA 1E79A 3R24A 3LXMA 4IHQA 1T8SA 1W19A 3SIPA 4D4IA 3KJQA 3A9RA 1DWOA 2DQ4A 3KTAB 2XUIA 2UV8A 3A9SA 2XLBA 4GXNA 4JVOA 2BBSA 4WFKA 5FFMA 5C52B 5K8UA 2IYEA 3HYNA 3JWIA 3L43A 2PQ0A 4M54A 4AQDA 3CCCA 5DTJA 4OYRA 3ON5A 3NDRA 5CH3A 1SHZA 3NAQA 4PLTA 3EAQA 1TM4E 1Z73A 4GMXA 1G5FA 3UY4A 5CFOA 2A1UB 3IP6A 5ALUA 1YZHA 5LZ7A 3TZKA 1JMVA 3DHEA 2B25A 4GMFA 3AG6A 2EKLA 3ETCA 1RSZA 5FORA 1UDWA 2P65A 4URFA 3S3TA 3B1YA 1PTKA 5HZKA 1YR6A 3TUIC 2RHGB 2GAIA 3W6NA 3GRAA 1AKMA 4U5QA 1NUHA 1Q0RA 3OP4A 3D7SA 3SZLA 3REQB 2ZDQA 1V3VA 2A86A 2AXQA 4UBLA 1L5OA 3BGWA 4CCSA 4Q7KA 3EXHA 4DF3A 4X84A 3V7NA 1XZFA 1GGNA 2OC9A 1QF6A 3ZKAA 1Z3CA 3RKSA 5HMLA 3CN9A 4YHHB 2EXXA 3SGLA 5GIPE 3FHOA 1WDMA 3LX8A 1O87A 4JYZA 1B43A 1YFZA 2WTAA 2AC4A 2GA9A 3MHTA 3UG6A 2IUSA 5ESWA 5CCEA 3HM2A 5I6DA 4RMIA 5BRAA 3VZDA 2I3BA 3EY9A 3OECA 4IIEA 4ZAZA 2I9KA 5D1HA 4O2RA 5FTKA 4D8VA 3LPCA 4ESVA 2QJOA 3EJWA 1TO1E 5CNKA 4RVHA 4H1TA 2C5GA 5A71A 2IU0A 2P9TA 4JUBA 4EF5A 1QC5B 1ES9A 4ZCLA 5COBA 1MPXA 1WS6A 4G56A 4XSVA 4Q1DA 3Q12A 4OO3A 4DT1B 4ZC1A 3HJAA 5D85A 4R7GA 1J21A 3VR1A 3N39C 2OXIA 2PVPA 4ZVLA 4DYHA 1SCDA 4MYHA 2WT8A 3IAUA 4P35A 2QE6A 5KWSA 1SCKA 4FFOA 3PR2B 1P9LA 1MEJA 1VPEA 2ID8A 3EEFA 4YCNA 1TZCA 4AMUA 1OZ0A 4GXTA 1HYGA 1G6HA 3IERA 4G3XA 4YC7A 3IE2A 2JI8A 3IJPA 1I10A 1F60A 3KPYA 4LVUA 3WK5A 4CM7A 1LF5A 1NNUA 4MWCA 1B0AA 4WLEA 3AETB 4RU1A 3IUNA 1IUOA 4XAQA 4PV7A 3WYBA 3B2NA 1VRWA 1Z62A 2O7SA 3OUZA 3V1NA 3HH8A 3NHJA 2DFPA 4PRLA 3RAGA 3HJGA 3N86A 2G0NA 4Q93A 4NMWA 3GP3A 3C8HA 4O4LA 4B9AA 5BQPA 1X7WA 2ID7A 3CW2A 2LTAA 2ZTSA 1ETUA 4BO3A 4NBUA 1U0RA 1YGPA 3HU2A 2EBHX 4EPWA 5CYOA 1K4MA 1PJRA 2B4RO 4X00A 1PFGA 2OC4A 3IP7A 3S40A 2BRUC 4YEDA 2KB0A 2WWFA 1GGVA 3RV4A 2C1EA 2ZSJA 4QLBA 1H9CA 4R69A 4R98A 2BOVA 3QVJA 3JYQA 3SK0A 4ZEMA 2C98A 3M49A 3TOSA 5SYMA 2PLRA 4L72A 2LCIA 2BFCB 3RAPR 3PQCA 3EARA 3F4BA 1JNYA 4XUGB 4AM8A 5JRDS 5EJ7A 4C87A 4PHHA 2SKEA 5DTQA 4DRZA 3D0OA 2ZSUA 1G3UA 4YFVA 1IIRA 3ADDA 2DVMA 4JI0B 5HRAA 3OIFA 5DM1A 2WYVA 1FA9A 1W9HA 2AB0A 2D7CA 2PGNA 4DLLA 1KFEB 5LR6A 3GEMA 5GZ3A 2Q8NA 4Q4JB 4BMVA 4CN8A 2PTHA 1S8OA 1Y8AA 5DJ5A 2B5WA 2VHVA 1TKRA 4GFDA 4N7JA 4OQXA 1OI2A 4JYAB 2DY1A 2AQ8A 4Y2XA 1CHNA 3GLIB 2BSQA 1UBGA 1CYDA 1X1EA 5DXAA 3HG7A 4NBVA 4NXNB 1S2MA 4ZAWA 2CXHA 5AI8A 3TSYA 5KSYA 4I19A 2HA7A 5CNMA 5LDGA 2VJLA 2EVWX 3F3MA 1ZFNA 4EATA 4A0SA 3FYHA 2FMIA 2ZG6A 4C3ZA 5G4KA 2HR1A 2OV4A 2FDRA 2XCLA 4YQYA 3VTKA 1NSYA 2EV9A 1QZ3A 2IIBA 5EHNA 3SC6A 1CD5A 1M7BA 1N2EA 2D1SA 1TQHA 4DOMA 4EGSA 4HG2A 1M2GA 3HNOA 2NT3A 3BB1A 1PBNA 2OCLA 3GLRA 3FF1A 3C4VA 1XD8A 3EXHB 2YH2A 4NCBA 1AS0A 3N0XA 5EJMA 4I46A 3SIRA 4W5NA 3I6YA 2B7CA 2R2AA 4Q1VA 3ROZA 3SX4A 3O7MA 2A1IA 2ZYTX 3OU7A 4JSTA 3F2VA 4BP1A 5TMPA 3CRNA 1V35A 5P8WA 4LXUA 4IZOA 4ZN6A 1RYHA 4G8CA 2VZLA 3NKFA 1UJNA 5CXXA 3OQNA 2GZRA 3CLTD 4NJMB 1H93A 1CUDA 2TMYA 3PUWA 4QUEA 1QHEA 3LQQA 1GUZA 1BCRB 1CJVC 2XMRA 1SPBS 3QI2A 3IUQA 4WXHA 4XIGS 4DLVA 4EEXA 4YV1A 1EDZA 1KH3A 1IOVA 3OCXA 1R8JA 4XJTA 1XQ6A 2GJSA 3FJOA 3BXGA 2PZJA 3HR8A 3OCCA 2IU4A 1W36C 4PY2A 1IYZA 1ST2A 3EVCA 3NHRA 1PJQA 1VA4A 4P93A 1UEIA 3HZZA 3HKCA 3JTEA 5ALGA 3WNQA 1YF3A 1OYYA 2ZJ2A 4PXYA 4RIIA 3FI9A 3K5IA 2HRBA 4PGAA 4WHMA 1WXGA 1HY3A 2Q1TA 3W4KA 3U6BA 4TLMB 1JN0A 1C9DB 3ZTYA 3TUZC 4E33A 3QYPA 5IWCA 1AF4A 4ZQBA 1R0RE 4OQNA 3FCOA 2DFLA 1KDZA 2JFNA 3V6MA 1C7EA 4M1MA 3SHQA 3MCUA 1IEVA 1QLHA 4G0YA 3RT9A 4I8DA 2ASVA 1XCPA 5AKIA 1E7SA 3WGOA 4B2IA 3QUSA 1U2TA 1X7DA 3ECCA 1RXUA 2QV0A 3F6SA 4QU5A 3VR4A 4EJ6A 3EVBA 2V7XA 3LLCA 3PRJA 3JW8A 4A2CA 1Y98A 1YDHA 3WGJA 3HJNA 3ADOA 3M33A 4MW5A 3X1JA 3PCTA 3FWYA 3R5JA 4WQMA 3DL4A 3RYHA 5K05A 5KJFA 1NVTA 3DYVA 4P7KA 1NJ8A 1LSUA 5KNCA 1DKOA 1E3EA 4M9SA 4QPPA 4YPFA 2I80A 3KU4A 1MH1A 5KCZA 1E8MA 1RKUA 3LY5A 5IDYA 4N47A 2OLKA 4R3UC 4UNRA 4RFSA 5KOJA 5EWMB 1UCFA 2ACVA 5LQKA 2JHFA 3GR6A 3ZE0B 1XG5A 2ZGVA 1ISRA 1Z17A 5FPQA 2AI1A 1DO0A 1I0LA 2H3EA 4NZNA 1R9JA 5E4JA 1BKDR 1M8JA 4NIMA 5LB2A 1RI4A 1KYQA 4RWZA 4MDEA 3WTBA 1WMSA 1LPNA 1PFVA 3SEZA 5FWNA 5K0ZA 3WLQA 2QM7A 2Y68A 3IDQA 1SULA 2R79A 4YJ2B 3UH1A 3V32A 4BJ1A 3CF4A 1Z33A 1TJNA 1DCMA 2BGMA 2JEZA 2A4MA 1AQUA 3D8UA 3LW8A 4MQUA 3B1FA 5E8JA 4HUQB 1OWPA 1RLTA 2QUHA 2PFSA 4LRUA 4XCXA 3SR3A 3NXKA 1KJ8A 2PUFA 1KY3A 1OROA 3CUYA 3EXIB 3HJCA 4BNTA 4LYAA 1VFNA 1YOVB 4E12A 5DE3A 4O2LA 3OTHA 3MAAC 5AW9A 5KZMB 1NNSA 3HVRA 1M75A 2ZFUA 3L5KA 1CUEA 2XTJA 4WH0A 3T1TA 4I1IA 1VSUA 1ISPA 5C3UA 2ZDHA 4L5CA 1EDEA 3R7FA 2ZREA 3W8DA 1SA0B 4TXMA 4R9VA 1KDRA 4BRUA 3N75A 3V33A 2FQXA 3Q9SA 5ISMA 2IQ5A 5C8VA 3TBFA 1EP2B 4IOKA 1MD9A 1JGTA 4BLOA 5DHSA 1CNFA 1ODSA 1RKBA 3URMA 5IS2A 1T5SA 3WSVA 2WJGA 1UBKS 3C97A 1XX6A 3EWIA 4MR7A 5EJEA 4J75A 1JHDA 3DHVA 3E5RA 1PCXA 1W93A 2BFDA 3BMQA 1CR1A 1KQ3A 3HLKA 4K2AA 4Y2HA 4DQDA 5AXDA 1ZJ5A 1L6RA 1VYVA 2VK8A 4S0XA 2DULA 3MBIA 4HTAA 1CQJB 1L7QA 1MU0A 4M76B 2XQVA 4ZOAA 3PT5A 2QPAA 3IX7A 3FTQA 3D4NA 2C03A 1TU4A 5B7NA 4H15A 4OJKA 5IAEA 4ZMRA 4KWIA 7YASA 3AEXA 3I2YX 1M2HA 3GRPA 4RVGA 2ZTVA 3G7UA 3DA8A 2ZWIA 2QVGA 3GN1A 4M2LA 4D2IA 5LMCA 1VE5A 4NMXB 1N75A 4ZXFA 1Z5WA 1UEXC 4PG5A 4LZAA 5LQSA 5LU9A 2QBYB 2W11A 3UOWA 4B6JA 5EJ4A 1JX6A 1URPA 2BF4A 3QVVA 3PD7A 1JF8A 1L3IA 3PNBA 5HBRA 1DBVO 3G1WA 4LF6B 4LY9A 4DT1A 3U3JA 1DTSA 1ZOOA 2R97A 5ICGA 1GZVA 2IXBA 2EU8A 2IV2X 1P19A 2XB9A 1OI7A 1T9GR 3Q8KA 2LDBA 4I36A 4Y9DA 1NW5A 3OIDA 2P3OA 1PQPA 2DSNA 1AUQA 1Q11A 3I2KA 4UCQA 4D8XA 3EZGA 4KIFA 1YJBA 4LE2A 5ED0A 2OM6A 5EUQB 1LK7A 4DTIA 2VZ0A 1G1AA 4FFBA 3AZPA 1H3EA 2UZ1A 1KVRA 2VYFA 2GHRA 4Q19A 4YT2A 4E13A 1QG0A 1XQ9A 2HZBA 1JKMA 4KQ6A 1YB4A 2HPAA 3D0KA 5H9VA 1RBQA 2RJ3A 1JVSA 2IYWA 4AC9A 4DA8A 3ZHQA 5JMOA 5IARA 2X2PA 4F3TA 4GHWA 1D0IA 2FFAA 3TTTA 1E6EA 1DIHA 1HFJA 2MJLA 1YAHA 4WGFA 4ZKDA 3JD1A 3W6ZA 5L40A 2DH6A 2PA3A 2XWQA 1XMVA 1Y1SA 1E2LA 4TN5A 5F1YA 4G1MB 2IXDA 5EIBD 3ZDFA 5C81A 1TTPB 3IILA 3WYFA 3EFBA 3BJEA 3UK6A 1QBGA 4EYSA 3HKDA 1WXHA 4G26A 1MT3A 1NR1A 4F3KA 2UYCA 1CS0A 2HSEA 4R1NA 5HX7A 4N40A 3TH5A 2C31A 4WESA 1Y5RA 4ZVKA 4J3JA 4PR3A 3SOPA 3SVTA 3R9XA 1H1TA 1C3JA 4RTRA 2BVNA 1S2GA 2QX7A 1RQPA 3TIGA 1YUBA 2ZBPA 3P7MA 4KIUA 1TLTA 1ATIA 4J76A 2DTDA 3GRFA 5D00A 1ZD5A 4MCHA 3K1AA 1FMTA 1NRIA 9LDBA 3V1MA 3RF7A 4HS4A 4DMKA 3KTAA 5LU8A 2IY7A 4X7BA 1LTKA 1G8GA 1R8SA 2CLHB 2G1JA 3VPSA 1MQ8B 5H81A 3ZHSA 1JHRA 2X0NA 5CYGA 3I1IA 1QOQB 3SHTA 2QY9A 2WUFA 4OI1A 4R16A 4OYHA 4YMIA 5AW5A 1IUNA 3RABA 3IA7A 2RG1A 1KBOA 2R68A 1POXA 5LM3A 1NLUA 4JLDA 5CB4A 2L42A 3K92A 3F73A 5ALRA 4R6XA 4HDRB 3BVPA 2W93A 1SEVA 2OBNA 3U7IA 3HCDA 4GWLA 1E2KA 5ELLA 3V2UA 2F3TA 2I4RA 4C4AA 3KJEA 5CBPA 2IOYA 4DCOA 1UT8A 1V41E 2EG5A 3H1BA 1PYOA 1RP7A 4WKCA 3QWIA 4JI6B 3S29A 1X8XA 4NL4H 3ILSA 3FZQA 3VBEA 3ZXYA 4B7CA 1GUAA 2ODQA 3LPAA 1QDUA 1CK4A 1DC8A 4XXHA 1OAAA 3ZEAA 4MQFA 3ZV5A 1QNFA 4M53A 1RYFA 1A2BA 2QP3A 1NF2A 1KHTA 3E1SA 3PUKA 1R4AA 4MEJA 3ZR4B 3S1LA 3I2FA 1SK8A 4U2DA 4Q15A 5A7GA 4BJHB 4BNIA 1VE1A 1WHSB 4UTXA 5IHXA 1MV5A 3EMVA 3GVHA 1JIKA 3WWOA 5CURA 2ZRCA 2IEBA 3C2QA 3RVSA 4N6OA 2J7PD 2B1JA 4ZJUA 3AEKB 1L8AA 3R3XA 2X2EA 1G8HA 2X86A 4Z1MA 4YMSA 1GQQA 2FP4A 2QRPA 3K2EA 3L6DA 4R83A 4KL8S 4OI4A 3F8WA 1DBSA 3V4LA 2JH3A 5KTNA 2FPXA 2DUUA 2VHCA 4J49A 4JQOA 5IJAA 5EINA 2VWGA 4DG8A 1OVGA 2VHZA 3A6PC 2ZIXA 1JKFA 1RM0A 1P3JA 2H4JA 3RS4A 3QKSA 4ZTUB 4JL8A 1N3LA 1JIIA 2G5PA 1YBFA 3M5DA 4KFSA 2P2LA 1U9IC 3TVYA 2R8OA 1UMKA 4FNGA 4AMZA 5JDCC 1PZHA 2JCYA 4A27A 2VHJA 4YRLA 4P4SB 1TIBA 3VR5H 1R0LA 4KGVA 4DJTA 2QZSA 3GLHB 4B47A 5DNDA 1BGWA 1D1PA 5IJZA 1R4NA 1GPAA 1WCXA 3D4IA 1EDOA 3DGFC 3ZCTA 3FLBA 4XGQA 1GTJ1 1R88A 4LWPA 4M1OA 4HT3B 5YASA 3CVYA 1HMPA 1JSCA 5ES4B 2I2FA 1M6VA 2QR5A 3E2IA 4F56A 2BFFA 4RLFA 4TRRA 4MJXA 4ZZ0A 1ZITA 1DRVA 3MA0A 4B44A 1W1UA 4DJEC 3I9KA 4TV9F 1VDMA 1ODKA 4N3GA 3RVNA 1ZPDA 1OSNA 3TRJA 1KI1A 1NDQA 3CZRA 1ESNA 3OZAA 4IUBS 4JNKA 4WASA 4BVGA 1X7WB 2X4DA 2WR8A 1SOVA 3AR4A 1P77A 3ID6C 1PWHA 2ISQA 2FEAA 4CT4B 2EKPA 3U40A 3FIUA 5ITSA 1AIPA 2J07A 2CYBA 5DSTA 2ZSAA 4AZ0B 1L1QA 2XECA 4CMEC 3HY6A 3R0IA 4HEHA 3LL4A 5EIEA 3OF3A 4QLOA 3SCZA 1SEPA 5KOHB 3MRTA 2RMKA 1Y9EA 3LWNA 3Q85A 2H2DA 1WF6A 1O1YA 1MC1A 1P39A 3D2CA 4EKNB 5KU1A 1VJDA 4NAVA 5DIFA 5SY4A 4MVCA 1H8HD 4KQMA 5CFZA 4JHLA 5E9WA 1OV6A 2FJPA 4FHCA 4RKEA 4CV0A 4TYYA 2R48A 3BBLA 2FVYA 1XZEA 2NO1A 3OJEA 4AY2A 3R40A 5CU7A 3M81A 3ZZ1A 5DHQA 2J0EA 4BB6A 2C5HA 1FP2A 3D3EA 1YZYA 1OX6A 3JQ8A 3T3NA 2FWJA 2COEA 1E5TA 2C5LA 1SUWA 3JASB 4H4DA 4YGYA 3RK4A 3WLIA 4BCBA 4LDPA 1F0YA 2B4KA 1DBIA 3DOFA 2Q5LA 1UZLA 2P1DA 4LXGA 4ZVOA 5B1YA 4P7BA 1FDIA 4RMHA 2AOTB 1V1MA 1JYSA 3QLTA 3A1WA 4W5RA 2ST1A 3IRUA 2I7VA 2R1TA 2HU2A 2YV4A 3M6XA 5B30A 5EAIA 4H31A 5DPMA 4Q9KA 4OFZA 1ESMA 2O1SA 3SU8A 1U1EA 4LZPA 3VSCA 3VU9B 4NBTA 2OTCA 3O2NA 3GN2A 3L41A 3IULA 4UNSA 1PNTA 1CPYA 2HM7A 1PLJA 2QPLA 4NFYA 2BZGA 4YMLA 2WTMA 2KBFA 1Z6QA 4JB0A 4LQ4A 1ISIA 5KBYA 5JARA 3GGCA 4ASUA 2OBXA 2JA1A 4ZGBA 2XGSA 4F11A 1C9YA 2ZT5A 5KAPA 4I5DA 5LL6P 2GFHA 2J6IA 1E1YA 3SS9X 2DMRA 2VYQA 1UWKA 2OFOA 2V9ZA 3LDFA 1DNPA 3Q1LA 1Z2AA 4RTPA 4OHRA 1JA9A 4MR8B 3KVRA 3IBTA 4B4UA 3UT6A 2BFPA 2PRIA 5A4JA 1BAPA 4MWEA 3LW7A 1NW3A 5IJWA 2GKSA 4RZ2A 1SCQA 3CF6R 4D4JA 1PT9A 3I2HA 4GX0A 4B3DA 1GQYA 2QGNA 4ID3A 3G2MA 4M22A 1Z8DA 3DMTC 3T3PB 2RI6A 3ZIDA 4BVHA 2E4AA 4L8LA 3TYXA 4HDRA 4W1PA 3WZ2A 3ZGZA 1WL8A 3E7DA 1GO2A 2WT4A 4K9MA 4MP6A 1ZR4A 1DDGA 3BIOA 4YFYA 3LK7A 4NYIR 2O2XA 2IT1A 3PVZA 4ZU3A 2BZSA 3H42B 4PZDA 1ECBA 3G68A 2PGJA 5G2OA 1TJPB 4HPWA 1F4PA 1XEAA 1D07A 3HDTA 3DFUA 5EE1A 5KPJA 3HJRA 3UIEA 4BO1A 1JPUA 2PYIA 2C7OA 1P2SA 4KN8A 1R8QA 2VN8A 3IAXA 4OL0A 1M5TA 2IXGA 1QYVA 2MYNA 3PCXA 2XGMA 2HCTA 1XMSA 3PNPA 4XYEA 5TMEA 1NQOA 2LPMA 3CT6A 2HF7A 4MR9A 5EIHA 2J6BA 1V1JA 3LT1A 4HMPA 1NN3A 4L6CA 2Z30A 2ZULA 1A69A 3CZ9A 3D0RA 3KXIA 5JCZA 2RGRA 1XTSA 3ZDXB 1X2EA 1XMXA 4K28A 3ND7A 1ZH4A 2R5FA 4G5XA 5BWMA 2PR7A 1TAQA 3FUCA 5K51A 4IHJA 4J1TA 5FBKA 4HNUA 2CVZA 2DFTA 2RGBA 2FUNB 1AUOA 2I62A 3OC0A 1YFJA 4DSNA 3P9PA 3ZX4A 1CJSA 4CM9A 3H84A 1FYFA 1LTQA 2J5KA 1FY2A 2PH3A 3WLPA 2GF2A 1OTXA 3AF1A 4E4YA 2IYTA 3QSYA 2BHSA 1RQGA 4S12A 3W5DA 3KLNA 2IZ6A 4NK4A 3IP3A 2DT8A 3PICA 1T15A 2VC2B 4ND2A 4C1BA 3KHSA 5LLSA 4QOSA 1GSAA 4HGRA 1JR3E 1J56A 3UC5A 3TQOA 3U2QA 4LOIA 3UMBA 3LX4A 1XDWA 3W5CA 2OQ2A 3JU3A 1OQAA 4FFLA 1XJWA 4JP3A 1FNNA 1YACA 2EGHA 2BUCA 2A5DA 2GPSA 2NU9A 3DOUA 2VJPA 4M9CA 2GJKA 3RSSA 3EA4A 5DU2A 4FKBA 4US1R 1MB0A 4LQCA 5G0UA 4DV1B 2CVQA 3QEMA 4ND1A 1T1EA 5J3JA 2JDID 4KRGA 5CM8B 4F2HA 2NTYC 5IYZB 2XD9A 3O4RA 5CMLA 3AMVA 4MEAA 3Q8MA 2LW7A 3JVEA 4HX5A 3HQ4O 1VKZA 3QEAZ 1XLVA 3T6KA 3OZEA 2EJBA 4YPVA 1XKLA 5KUTA 1EJBA 1JZQA 4IRUB 1OFIA 4E5YA 2PLNA 2CLDX 4NS4A 3QKRA 1DAIA 4RTNA 3IAS1 4BLWA 1BMQA 4G6ZA 4OHFA 4Q6WA 4TV9A 3WNZA 1T0HB 1JG3A 4YH1A 4X6LA 1QRTA 2FW0A 1X7GA 2Q7XA 2HTFA 4ZT4A 3D6FA 2MYTA 2NW6A 1CQJA 4LTNA 4QPCA 2O8DA 4M8NE 1TU0A 3TTWA 5A1TA 2I4MA 4D8YA 2XB2A 2N1MA 1AV6A 3SHWA 4ZVUA 1MO3A 4BTVA 3JYNA 3TPFA 2C3YA 3VZQA 2JLWA 4G1EB 3ZWYA 4AW9A 3FH0A 5FR1A 4PBRA 2V3VA 1C1YA 3HVIA 4C7OB 5K0CA 1NPYA 4QIHA 4BLPA 2NSYA 1EWQA 13PKA 4CLDA 1K3UB 3Q10A 2D2VA 1Q0QA 3BGDA 1FL9A 2XHEA 3F3KA 1EUDB 2GPYA 4N5DA 4BNGA 4C2AA 1KI6A 2AN5A 3GFTA 4RJIA 4I66A 3KLBA 1F7UA 3R23A 4QOGA 3WGNA 4LZLA 1LBTA 2JBAB 2RONA 3OLWA 3QVLA 4B6QA 4M36A 4BGIA 2QTCA 4BLQA 2O8CB 4OJQA 1RKVA 3MD0A 4UFNA 2J3DA 3TG8A 1U9ZA 1EXNA 2WPNA 3RASA 3BQMB 2WRZA 3U9TA 1XFAA 1G55A 3NOXA 5AKEA 4UUNA 4ZK2A 3OE5A 1VG9B 1CLUA 4DA4A 1U5BA 3FTCA 4XQCA 5JQGF 2CB9A 4H77A 4Y1EA 4G81A 4QXRA 2D1TA 1ORDA 4HAXA 5DX8A 1BGVA 5BMVB 2OHIA 4U2GA 1CJTC 4XCQA 2GZ1A 2NT4A 1ENPA 2A9JA 2NZ8A 4L73A 4PFSA 5AKJA 5H4HA 3FOAA 2XB4A 2XUDA 1QP7A 4FYHA 3M83A 4AJEA 4S2UA 3DEZA 2H57A 1GU7A 5FJIA 3RVMA 4L8VA 1AOXA 4YECA 3GZNA 1VI2A 5JRZA 1EVEA 1WXXA 4A0FA 4ZYTA 4ZI7F 1K27A 3JQAB 4D4MA 4DEYA 2BYTA 4KN6A 3HCCA 1SUSA 4AS1A 1T3SA 4LKRA 5EN4A 4K9DA 2IH5A 1N6RA 4MW2A 5ALJA 4MR8A 1AN9A 2WWYA 3EG9A 1GVHA 4HDAA 3G49A 4RF3A 1TKCA 2HA4A 3KOZA 3NHYA 1UZAA 3ZWNA 4Q03A 3PXGA 5HJ7A 3WGHA 3JARA 5DISB 1ZNWA 3B85A 3Q7EA 3WSWA 1ZVMA 1KZ1A 3ED1A 2YFYA 3VKVA 3AF3A 2MSNA 3GAZA 1CUHA 3K8YA 2C78A 4MCJA 5I7VA 1RCUA 3R0ZA 3I04A 1AT1A 3L01A 3REGA 2PL9A 4Y30A 1XXHA 1QONA 2G8NA 4LDRA 1T4DA 4Q9AA 4BQIA 4BC1A 1G2OA 4ER3A 5KQMA 3TGPA 1Y34E 2XH8A 3GLKA 5U1PA 3ROFA 5JXJA 2W2XA 3HJBA 3L8FA 5LYJB 1JLLA 1R3DA 4UBNA 3UGJA 3IQIX 4A03A 1N5MA 4EUSA 2Y2UA 2ZAGA 3PTZA 4CKWA 4EQ6A 2GZMA 4II2A 1QOPB 3HHPA 4IH4A 1CUCA 1UWCA 3MZ0A 4TGLA 4AP9A 4EVIA 4KR7A 4PO8A 1GTMA 4H1UA 4R1SA 4DGSA 2XOEA 4OQDA 1IM2A 3QFSA 3PPIA 1O0BA 3TQSA 3NB0A 3PQ3A 4YRBA 4J6EA 2G3YA 3TI7A 2VDKB 4ARZA 5D3KA 1W581 3NBUA 5BP7A 4D0SA 3MTDA 5IKEA 1TO2E 2QVXX 4DLPA 4CLOA 1SKYB 1SCAA 4G5RA 1Z4LA 4YP9A 4NICA 5BR8B 3GPLA 2Z2YA 1MOPA 2A4KA 4V24A 2VUSA 5CDSA 3I8XA 4GPTA 3VC1A 1I2DA 4RULA 1IH8A 2BWJA 4GT1A 4IIGA 2PE5A 3U3KA 1T6BY 3MJEA 2Z9BA 1O08A 1TPYA 5AM0A 4D1YA 1UUFA 4W5WA 4ZKEA 4JT8A 1U9YA 3AILA 4D7AA 4XTCS 3KBOA 4OY3A 2P4EA 5TT0A 4XB2A 2QORA 2NTEA 3OLQA 1YVEI 4PFKA 2HSZA 1FS5A 2JAXA 3IOCA 2UVDA 2E4YA 2QUAA 4GBMA 4Q37A 4MKIA 3AP2A 3M2TA 1U1GA 3VNSA 3OTQA 2FGKA 3CKLA 2ID9A 5ALHA 3MFYA 4LJSA 1KETA 1PYDA 1YV9A 3OKCA 1I01A 3G2QA 1O95C 2HKIA 3HR4A 3O9VA 4QICA 3RIEA 4RENA 1XP5A 1QO0A 2H1WA 5BV2P 1HDIA 1CUUA 3L8MA 2JIPA 5K0EA 2HCJB 4MSUA 5TPWA 1GG5A 1NQWA 3RFVA 1FW8A 2WBLC 3ZVLA 1J8QA 4OUDB 2XQIA 1I3CA 1HG1A 4EGQA 5K99A 4NG5A 4G0MA 2GK7A 2PMDA 3I9V1 3QI7A 1C8BA 3DWFA 2PT6A 4FUQA 1UXHA 3LY7A 5FRDA 1SU8A 1K88A 3A32A 4UHCA 1XCMA 1PK7A 3ZS9A 4Q9DA 3ICOA 1A4UA 1RJEA 2D5CA 4H6XA 2I66A 3ZQ4A 1A7UA 2XMDA 1J2YA 1HFKA 4Y7CA 3NEYA 3I37X 1QZUA 2EJVA 1X1BA 1AUVA 3VNUA 1XAHA 1D5WA 4X8LA 4ES6A 4FYMA 3RKRA 4F3YA 5KREA 2W90A 4B82A 3U7RA 3RWOA 4IQ4A 1DLJA 4IIBA 1PF7E 5ALMA 4OK6A 1Y42X 4ABTA 1P2FA 5COQA 1Z06A 2YIJA 2UZAA 4YP1A 3WFZA 3PVSA 4X1IB 4RF4A 4FCTA 4EJSA 3VU8A 3GDFA 2J5XA 1COWA 2JFZA 3OM1A 3B1KA 1E5XA 1CVLA 4AJJA 1A9TA 1M1UA 3HACA 1W25A 4F92B 2WMOB 2ZUUA 3NQ41 3EXFA 1P6XA 1GTL1 1Z3IX 2HJSA 2COKA 1AVTA 2O3SA 2X40A 3HCOA 3LZ6A 4KLCA 1N9GB 2GLXA 4YJKA 3VNBA 3PXUA 2XDQA 4CTMA 3FAZA 3LBNA 5FDFA 1Y7LA 2CZQA 4R41A 1QS0B 1VZ2A 4XZ3A 2FSVC 2W6ID 3SF0A 1Q5PA 4DQVA 4P4SA 4ITUA 4C6HA 1W5BA 5LDDC 3L0YA 4TKVA 2YJ3A 3EXAA 3V3KA 5AXCA 4EY4A 1RJFA 3O8NA 4Y2RA 2YC2C 4JQZA 1GG8A 1W30A 3EULA 3UO8B 5JYDA 1KP3A 4FW9A 4JFRA 3ZJ5A 3N2YA 4QU9A 2HUPA 1P29A 4HAIA 4R68A 3ADCA 3EIFA 4BZWA 1WABA 3CUTA 3DQZA 4YALA 1Y3AA 3DKIA 4HRAA 4R81A 1K8ZB 1Q0HA 2HSWA 2WJPA 2IEIA 3CYFA 4I1PA 1A97A 4YUYA 1OXBB 1VKRA 3THXB 2E48A 1KEUA 1YZLA 2QEQA 3RRNA 1B42A 3QF7A 5FBHA 3LHSA 1UF9A 4TTVA 3EUFA 4EY6A 1XP8A 5C2JB 1QJCA 4QGAA 4AMBA 4CL3A 1B26A 2WWWA 1NZJA 4M6WB 3JPWA 2D00A 3FB1A 4KLZA 3B1VA 1JHYA 4EVRA 1EEXB 4C7MA 4MRVA 2C4TA 3C8MA 4CCWA 2F17A 2F1OA 1TVEA 3LO5A 4YT5A 3C7AA 2ZJOA 3NI2A 3P4UA 4HLCA 4Y0VA 2ZBEA 5I45A 1IL0A 2J30A 1OYVA 1S2LA 2JCXA 4X91A 1O94D 2D5AA 3PA8A 2FTKE 1P0MA 2WA2A 4IVRA 1QH8B 4WUTA 2XNKA 1VL0A 1YOBA 5F2NA 1NONA 1A2QA 2WM8A 2VHWA 3QPDA 2AI2A 3MAGA 2CFSA 4Y0AA 5IW8A 4ZGWA 1OJ7A 4JBHA 2F1RA 3PRHA 4OTZA 3A6HA 5FOVA 3AVWA 2AN9A 4A0QA 2DH5A 1EDDA 4QVIA 3JD4A 3D6TB 3RS3A 3TTYA 1RD4A 1FIUA 1RBZA 2XUAA 1R6DA 3BUSA 4W8OA 1DO2A 3SM9A 3HA5A 2IYZA 4H4CA 1HKUA 1JVNA 1HM5A 4LHEA 2VSOA 3WGQA 3VJMA 3TCKA 1EVQA 3ZU6A 1H8HA 4EKYA 1P7CA 3WY9A 5AICA 4R84A 3VSAA 5JO0A 2IUYA 2RSLA 4ALJA 1ZOSA 1XDUA 2EHDA 1FZQA 2X6TA 1L5NA 4MI1A 121PA 2UZ1B 3CRW1 2WD8A 3A0RB 5HE9A 1FDVA 1G5RA 4QYWA 2Q1YA 1QSGA 2PM8A 2VBGA 5AJVB 5HCIA 3EF1A 4Y2YA 5H83A 1WSDA 4P36A 4B40A 1C3EA 4Q18A 1G7SA 5BN5A 3LLUA 4RJLA 3ANNA 1H2ZA 2JIZA 1RPTA 2GZ2A 2O2ZA 3BMOA 4GYJA 3EVFA 4FCWA 4B31A 5KQGA 4DUPA 2BP7B 1YZNA 5B1SA 5T67A 4RL6A 4I4LA 4PEVA 1QVRA 3K1AB 2WMDA 5IABA 2CLEB 4Z54A 3WLAA 5KSOA 3BULA 5JJLA 2COUA 3Q88A 1JLKA 1XI2A 1O5IA 2HRRA 2UYGA 1VKHA 4JU8A 3UXEA 4PANA 3ZN2A 3P4XA 1CZHA 4IQFA 1RQ7A 4TM7A 5LYJA 3TLGA 4H4EA 1BA2A 2AQIA 1FBTA 2NADA 3ANLA 4BDSA 4I5FA 2NO9A 1ZH0A 3TRFA 3LBIA 3WYGA 2HWYA 2K6GA 5E9QA 2ODEA 2QLLA 2VH1A 4I08A 1YR8A 2ZJ7A 4KH1A 3SZGA 1PR3A 2I6SA 1Q7CA 5DKFA 2XA2A 2HGSA 3LLMA 4FZRA 1PV4A 2VBCA 2D1YA 3EZ7A 3B13B 3OCJA 2YFQA 4MQLA 5BT9A 3ZHUA 1JQKA 1L4NA 1Q1ZA 3UA3A 1GCUA 5AXBA 3OTIA 1OU4A 1QP4A 3IT1A 1X39A 4WZ6A 4D46A 4X7MA 1KRXA 2BGIA 3CQ9A 2BFFB 4TT3A 4DQUA 5BRNA 1Z2DA 3STYA 3VC2A 2OB2A 1CUAA 2C07A 4HRVA 1ZXXA 4HWRA 3TZCA 2BRUA 4L4SA 4E2FA 1DQZA 3WVNA 3MD9A 2I7CA 3JQ7B 4ISCA 4KE8A 2OYSA 1NFFA 4QDTA 3F7NA 4TVKA 4BPRA 5JWOA 1LK0A 3LQKA 2J3QA 3G79A 3JQAA 2FOLA 4WOPA 5IX8A 2QJWA 1BVHA 1EAYA 1Z7YA 2JFGA 2HBRA 2XHZA 1YZFA 5C35A 1H85A 4YJ3B 3RS7A 3FNEA 3DO6A 3V9AA 2ZRGA 4C4ZA 4F9TA 5BUSA 2OT3B 1LV8A 2FYTA 1QIEA 1WMBA 5JVDB 3T4EA 4NV1A 5GJVC 5ILGA 1FU8A 1ZI6A 3VHXB 2FPMA 4F3RA 1DQNA 1KVTA 5JD3A 3BCUA 3G88A 1WU8A 4N0MA 1O96A 4I4TB 1FXSA 3S2FA 3SNKA 4E5DA 2ORVA 1RJ9A 2DF8A 4L5AA 4C43A 3MWJA 2XLCA 2ZWMA 3T52A 4C7BA 1QG6A 3QEJA 3U44B 1KJIA 2BEWB 2BTQB 1N4DA 1JFRA 3FX2A 3H6KA 4P3YA 3RSFA 2AZ4A 5KSPA 4BVBA 3VYSB 5FEUA 3AEKA 2VUIB 3FTPA 4QUKA 2QU7A 3IEKA 1FP4A 5AD1A 5DGDA 2ON6A 3HNRA 2EP5A 1A4XA 2CDAA 4O0LA 1YB2A 5IMSA 2HDOA 1TXGA 1KYXA 2AN4A 3T1HB 3NKVA 3KEOA 3IOEA 1G8PA 2BBOA 1C4OA 1KI6B 3O0TA 3AFHA 4XIJA 5AJYA 3A6ZA 1JFTA 2C9ZA 1PR5A 3OJFA 1QYCA 2I6FA 4S1PA 3IOMA 5KVQA 4RPKA 1PD1A 4S0ZA 1I32A 2ZBVA 4GZLA 5EESA 3TQIA 3DDHA 4M1KA 4YDSA 3WOHA 5HUQA 1QYXA 1Z56C 4D9JA 3KFVA 4NCAA 5K3FB 4DANA 2ZAIA 1A9XA 1HUQA 2QZ4A 1JH9A 3B82A 3HE3A 2UAGA 1O8BA 2JJ2D 4J7UA 4Z4EA 3TS1A 1G3IA 3SXJA 4KRFA 4K6OA 3PQEA 4GSKA 3Q3GE 1XVTA 5ALDA 1FTQA 3M82A 5A6SB 1W76A 4WXRA 3VUEA 2I5PO 2JJ1D 2JLCA 4IKEA 5BSGA 4MIYA 1XR3A 2WF9A 3HBNA 1QQ5A 4CM9D 5CJ2A 5JEEA 1QPBA 2FFRA 2AXPA 1ZXLA 1GKKA 1HG0A 2RG7A 4LHXA 1IQUA 1PWYE 3HUEA 4KPUA 1LBQA 3PENA 4KXWA 1W6UA 3K0AB 2HQ1A 2J3HA 3AV3A 1U0EA 2J6CA 3D3KA 3D6VA 3H9JA 4LK2A 4XSHA 4KVAA 3TPZA 5GZ1A 3QG5A 3VZSA 1FFAA 4TMTA 3RSHA 4LDJA 3VQTA 2P6NA 3QBJA 1V96A 2GBPA 2VBIA 3A0UA 3OIGA 3K94A 4H9GA 1NXTA 1P4JA 1EFKA 5EQJB 1MFPA 1Z0FA 1PGPA 4P3NA 1WP4A 3MUEA 1VJRA 4QXAA 4UHJA 5T4BA 1FCJA 1HEUA 3U7QA 2IHTA 2IHBA 2A1TS 4Q4HB 2GNPA 3VZPA 4EPTA 1N0HA 4QQKA 3HXOA 1E99A 3QA9A 4B43A 2B1IA 4WZAA 2BBWA 4TQGA 1GDTA 5E2AA 3GRKA 1RRCA 1CRLA 5EMMA 6AT1A 4M0EA 1AXRA 1MQSA 3AYZB 2N9UA 3C39A 1PJ4A 2A5FA 4MJ7A 4YAOA 2IBSA 2I22A 3GWZA 2Q4EA 1E9FA 1HURA 5H4GA 4BWFB 2GTHA 1LFAA 2EC5A 2EIXA 1VBFA 2H4HA 2ZBRA 1RZ3A 3JWHA 1OD6A 3SHOA 3X1YA 2GAJA 2JD2A 1FP1D 4YNBA 2Q50A 2Q2NA 3A1TA 3TE7A 3WRYA 1J8DA 1N2CA 1PJ2A 4HC4A 4QUJA 3T4UA 5HM8A 3TQQA 2IITA 4ACAA 3BYZA 1PWXA 1YZTA 3LGAA 3JQFA 4HR7A 4DV4B 2V1UA 2H29A 2XVAA 3RWMB 3BXZA 5B7QA 1ZGBA 1IWBB 2R7LA 1BMFD 3R7WA 3REFA 1DRKA 2XVZA 2FK7A 1RWQA 3K1YA 1ONNA 3NBZC 1O9GA 5EZ6B 2HJGA 3H2SA 1AU9A 1JDZA 4JXJA 1KI9A 2QD3A 2Q29A 3AHJA 3AVUA 1PZFA 2GYVA 3L06A 3MG9A 3OBIA 4URVR 4R2XA 4WX2B 3UHJA 3ZW9A 5IXYA 2X6QA 2CZGA 1L7PA 4PPFA 4HVCA 1ZK3A 1U7TA 4EKEA 5DNCA 2IX3A 3HRKA 3O8OB 5CNIA 2V97A 2JIBA 3DP7A 3MWDB 4CEHA 3LC1O 3PHJA 4Q4JA 1C7QA 1RBYA 2GWRA 4KG7A 2V3WA 4HDCA 2XCTB 3N58A 5FQOA 2FA9A 3H2IA 5BV8A 4LMBA 1JBKA 5IZCC 1XQ1A 3EMKA 4KI0A 1J0BA 3VDNB 5IAJA 4DV2B 4KQWA 3U4HA 4RJKA 1SXJA 3NHWA 2EL7A 4EW1A 5JR3A 2SCUA 3DV0A 3CZMA 1HH4A 1E9DA 2EZ9A 2Q7OE 3L3BA 5ARCA 4KOEC 1H2XA 1G1MA 5JRJA 1T9CA 2Z43A 1TFUA 3JATA 3Q3IA 3B9BA 4RIFA 4IR7A 2PX6A 1WKCA 1WY7A 4QWMA 3LL7A 1QV6A 3AB7A 1BXRA 1ESEA 1NBME 4XD7D 3UFXA 4E08A 1YIOA 1K6JA 5CCDA 5JAZA 3OFKA 3VNVA 2O2SA 2QSUA 3RGGA 2B0JA 3FR7A 4ZANA 2EEZA 1GZ4A 3TWOA 1UQRA 2AYYA 4DUGD 1GZDA 4IJQA 4GE0A 3H11B 1IY9A 3FPFA 1RYNA 1WCV1 2ZRHA 4YJGB 4FFMA 4ACBA 3BT7A 4A2PA 4QOJA 2XGJA 3A1VA 5L95A 3P9YA 4E70A 4ARIA 2MOKA 3JQGB 3R7DA 5JZSA 4RV9A 1V3UA 4FONA 2Z3ZA 4F60A 2QX4A 4CL8A 4ENUA 3W06A 2QJTA 4FCVA 5AKZA 2VNJA 2R7MA 2F8MA 3UMGA 4C5BA 5IKXA 3AHIA 2P8SA 2HNBA 3T4XA 2M6RA 4IKOA 1PJLA 2QROA 3AH8A 1XUOA 2YDYA 3MIZA 4FILA 4CGYA 4K9QA 1QQAA 4I1UA 2A35A 1ULZA 1WPGA 4G0XA 2PUDA 4LYEA 3AVYA 4CTOA 5E0KB 5BSTA 1U8AA 1EP1B 2BM8A 3QENA 5SY9A 1WUIS 1I5EA 1EUDA 2WWXA 4U6QA 3GV0A 5K5EA 3FPGA 5KTYA 4G0NA 1M6HA 1HRKA 3D64A 5K3BA 5AVYA 5CXQA 1IVSA 3GFRA 4CKBB 2Q3DA 1QB8A 4NJEB 3ZDDA 2YCLA 3UT5B 5D3ZA 1U99A 2R8YA 4GYKA 1NQUA 3OQIA 3U3DA 3UTDA 5IBCA 3ABRB 3U1BA 2OCKA 1XSEA 1J09A 3BRCA 4V0LA 4AP5A 2IGTA 1FLNA 5BNTA 3VTZA 4EY3A 5A6SA 2BJHA 5GM1A 4Y98A 2ODWA 3TSAA 3CXRA 5E4YA 2W2OA 4WN9A 4HN9A 2OGSA 1RXEA 4LX8A 3D8RA 4FYYA 4A8JA 2E1RA 1F48A 4IQ0A 4DMUB 5IDXA 1C2YA 1UC8A 3ILXA 1Z6YA 3W2FA 1B1AA 2C92A 1XU4A 2HX1A 1L1FA 2B35A 3PTLA 3NIGB 2X0KA 1DMSA 3TEMA 2BKXA 2IKSA 4MA0A 3COJA 2QRHA 3GVIA 3VPDA 4DXDA 1YDEA 2E37A 1GUYA 2QK4A 5FR2A 1R0BA 2NP6A 2XMQA 2HHLA 3ICPA 1KSHA 1SHTX 2C8VA 2Q9AA 2VVTA 4JU9A 4MRNA 1EFRA 2PD6A 3MWDA 4HVAA 2QUJA 2VDPB 3P2MA 2HDHA 2W4MA 2CD7A 3U9LA 2GFIA 4D5GA 1T4BA 2WJHA 2HV9A 4EITA 1KK3A 3WBBA 3WMFA 2GCGA 2H5EA 5GPBA 3T41A 5IDQA 5LOVA 2DGDA 2GO1A 4GPD1 1JU4A 2OYRA 1NVEA 5FUBA 2DUWA 4RLQA 5DGCA 3KV3O 2SCUB 1H1LA 3BL6A 4MPDA 1IHPA 2DPMA 3WYEA 2XCSB 3T5DA 2ZZNA 1W49A 4I4TA 2P1RA 3SIXA 4DL9A 1T25A 3H3JA 5JH7B 5LUAA 3MMZA 3AZQA 3HB5X 2NTVA 5C1PA 1KSFX 4P0QB 1K4YA 2Y1CA 4HPXB 1PTJC 5FUYA 1JMKC 4EX7A 1DKLA 3KWMA 1OAOA 3CT4A 5H59A 5A5VA 4ND8B 2GK3A 4J91A 5EJAA 1JG1A 2H5LA 3CPHA 2PFGA 2B1RA 3B6MA 3GD5A 1JJ7A 3LVFO 5I4IA 3BGIA 5DP2A 4P7FA 3GGOA 1RWVA 2TMGA 4FDMA 3SJBA 1VI5A 4YXFA 5KMGA 1MUUA 3N5KA 3FOZA 2P3LA 1IFXA 3G0BA 3C1AA 1Y1KE 1WA5A 2NV0A 3MMXA 1DJNA 4RPGA 3I1FA 4OXYA 3NJRA 2ZBDA 3E0QA 2ILVA 4YI5A 5ULLA 3WS7A 2JK1A 2JFWA 4PPNA 3TQFA 2GHTA 5EUBA 4J1SA 4OM8A 4WEQA 5LQUA 3QLUA 3R9WA 3SJUA 3F74A 1NASA 1QB7A 5E3IA 3PUYA 1L5YA 2CUTA 2R25B 4XDZA 2XKJE 3CLRC 2IF2A 3VDQA 1C0EA 2D54A 3E70C 3U4MA 2FRDA 3B12A 3KKLA 5AT1A 1J20A 1Z5GA 1GL7A 1AJEA 5DEIA 4ZRMA 4Q7EA 2AEMA 2WPDD 2YJTD 4C0XA 4DIDA 1YXMA 1J2RA 1V2HE 4N8EA 2YJZA 2AG0A 1B00A 4DLYA 2NZ2A 3LWBA 3ZWPA 4DV6B 5E2IA 3HZHA 2BGJA 3DS8A 4CMEA 1HPLA 2ZW9A 4GRIA 4NBRA 2XXBA 4FFWA 5BN1A 1OY1A 2PX3A 3HA7A 1X86B 2WTNA 2F6RA 3HSYA 4WLNA 5B3LA 3QLVA 3AC0A 4EA8A 3HCEA 2XXAB 2O8FA 1ZJ4A 1BIFA 1X7HA 4RY2A 4KR6A 1EGAA 2ODAA 4H3VA 2WVJA 4DDVA 4I1SA 3TPCA 2J5QA 3AUXA 3JTMA 5D5PA 5A9SA 3BMOB 4W8GA 1JDNA 3O9MA 2FEKA 3MINB 4IP0A 3K70B 2O8BA 4DNPA 2OWDA 1ZD8A 5BSRA 1E6MA 1KAQA 1CUZA 1COZA 2RB4A 3QE3A 4AS2A 3TZLA 4TVBA 3PPYA 4XQEA 1XMIA 3UQYS 1NIJA 1FQWA 1OWOA 2GZSA 2JI6A 1TLLA 2B78A 2DBVO 2WZQA 4HATA 4RD2A 4A92A 4CG3A 2QW8A 2C9YA 5EZYA 4JJFA 4GO1A 4KDFA 4QG3A 4TMVA 1MC4A 2VO1A 2FR0A 4PLGA 1YGYA 4F5EA 4JYMA 3INRA 4RH1A 2VTBA 1SWWA 3VX4A 2NZVG 1L1EA 1UPBA 1U0HC 3O3MB 5J9FA 3UWPA 1Y5LA 4KQ9A 5G0WA 3S2GA 3DO5A 4QASA 1EVJA 4KO8A 3ESCA 1GADO 3V8RA 5C18A 2FEMA 3LT2A 1HYHA 3NWJA 3B48A 4QDXA 5D7NA 4F4IA 4M49A 3EY4A 2CVHA 5C7IO 3T1YB 4U3JA 1T8YA 3UXHA 3FTNA 2UKDA 2CHUA 5FQNA 5JBIA 3MJRA 2XMPA 1MZPA 5KTRA 4B3HA 2DTEA 2HYDA 1NWHA 4OB7A 2VKQA 3PYXA 4BQSA 4O4HF 5JYCA 4L0DA 3B2QA 1Z07A 2C4UA 1IZZA 2IPXA 3F6YA 3IL2A 3PHLA 2YFKA 4OREX 4IIJB 3UJ3X 4FW8A 1IM8A 4YCLA 2H1VA 1E2FA 1G291 4IIFA 2REQB 2OVBA 2CMKA 2QTVA 4H18A 4PZCA 3A6FA 1RXSA 3LECA 2Y66A 2NXEA 4NPHA 4U7FA 3GJSA 5HQTA 1JE1A 1ODLA 2HMTA 3N0WA 3OX1A 4WLUA 2IYAA 3GLIE 1H2FA 3VOAA 3HUUA 1V5IA 1JUDA 1F6WA 1HRDA 2VIIA 4HFNA 4MKGA 4WCFC 4BE7B 1STOA 2QL6A 5L3ZA 3I9OA 4ZTZB 4EHHA 1Z28A 4H7IA 2WTUA 3L1IA 1V8ZA 1Y7HA 2ZVQX 1CUGA 1P31A 3KSAC 1XRRA 3SP1A 1KA9H 2PXCA 1DI0A 2ZIEA 2HJRA 1R6VA 5HKOA 1BHJA 2E4XA 2G80A 2QTLA 3D6UA 3JQ7A 4BLRA 4AG5A 3KB8A 4QU8A 4QYXA 3LVQE 8LDHA 1HETA 2PT9A 1LJ8A 3EYWA 5SV2A 1ZD9A 4LEIA 1YH3A 1DDOA 3ZHYA 4LW8A 1RVV1 2RE8A 1KAHA 5HGXA 3CR8A 3OQOA 1FUIA 1KOLA 3S7TA 4EG7A 2RH9B 4G86A 4DABA 4Z4FA 3B7PA 4TS1A 4UATA 4GBED 2RGWA 3DMHA 4W99A 1YTLA 1M2OB 3ZW7A 1XWWA 3AT1A 1IVYA 4IWXA 5IANA 3CMCO 1RW4A 4PO9A 1Y8RB 3IIMA 4HQOA 3S6JA 2JEYA 1BA3A 1TQ2A 2O7VA 3HYLA 2PIDA 3Q3HA 4DJ5X 1PN3A 1XYGA 4PPGA 3KAQA 4TSRA 3SZOA 1LBHA 1SUBA 5BSWA 4YLGA 3LXRA 3LA8A 3AFNA 3FDXA 4KX5A 3CNBA 3OUTA 2DBZA 3AHFA 4KKXB 4XD2A 1WZ2A 3SC4A 5FOUA 1RZRD 1OI3A 1TIPA 1QGUA 2NPOA 1H4SA 2OV1A 2AE2A 3QU7A 2LCFA 3QVMA 1L4LA 3NR2A 4WW0A 3STVA 4CM6A 2FPIB 5C3MA 5AVWA 2VHEA 5EZSA 4Z2YA 4YUVA 2G04A 1L4MA 1RLJA 3GJTA 5EOVA 5I7RA 3U61B 4G01B 4AUNA 1M1YE 3PR1A 4FGUA 5DTIA 3B36A 1XAJA 4WCFA 2TECE 2FWIA 5CA0B 3EHEA 4Y9RA 1CT9A 1UBHS 4L0MA 1J0XO 1K7FB 2XB6A 3BGVA 2YFHA 4KQ1A 5JWHA 4D3YA 3EVGA 4DAOA 3THXA 4XPIB 2B61A 4UPEA 4DREA 3OZ7A 2C1XA 1M2WA 1R18A 1V9LA 5I5GA 5JI3E 3AF6A 1Q0ZA 4RSMA 4Q3AA 4NNJA 3ZDQA 1GLVA 4Q00A 4ZAFA 1YR9A 1RYEA 2ONZA 1G60A 1G8FA 2IPOA 2JHGA 1RWNA 3OJWA 4JUFA 1CEXA 4MUFA 2HI0A 3VYRB 4ENTA 3HYSA 4ZIRB 5K0BA 2SNIE 4R51A 4UPVA 3W3AD 4PC7A 2FH5B 5BYBA 4DDKA 1B6GA 2ETVA 2ZZKA 1R9MA 3NYQA 3T99A 3E2PA 2AXNA 2O48X 3OPVA 4WNCA 3AOEC 1M5UA 3H2JA 2OPBA 4KN5A 1TVMA 3TR5A 3KXDA 2ZAYA 3MCTA 2YJ4A 5FPTA 1BC5A 4IGFA 2Q3HA 4EHLA 1Q2UA 3CURA 4I99A 5AMXA 3SQDA 4KVFA 5J5AA 1NSFA 3M4ZA 3IPXA 3JRWA 3ZWKA 1KO4A 2A8YA 2R7KA 2CBGA 1NBOA 1M8GA 5EZYF 4ZDWA 1E7RA 1U8FO 2JAWA 3AERA 3TW6A 5BSMA 1CIPA 4LMRA 5L3QA 4GMHA 4QXPA 5B58T 4J0JA 4DM4A 4LRXA 2DHCA 4GR9A 2B5OA 4NQZA 4XGNA 2JFBA 4ARSA 4Z9XA 1UMDB 3D4PA 3CZAA 4BVAA 4PSAA 3T4PA 3H2BA 3ZCRA 3H4MA 1XRLA 4HEA1 5HQ3B 1OC2A 2H18A 2O2GA 2R96A 3QOXA 2WNHA 4LJRA 5JVDA 1TTQB 4G23A 4ZVVA 1A88A 4GP9A 4UBOA 2IW3A 4ZI5A 2FP3A 3PBKA 3OD5A 2DPXA 2IFTA 5DN6D 5M7EA 3NH9A 3IHKA 2DSTA 1K8QA 3CEAA 3NJ8A 3T35A 7MHTA 1RMYA 2J9ZB 2YWJA 1A9SA 4QTZA 3CLTC 3LBFA 1TMGE 3O4IA 4OHKA 4P84A 2R6DA 4PN3A 4X60A 4CU5A 5E3JA 1NTOA 5K2OA 1ZK1A 4BN4A 4TLEA 5TQ2A 1Q19A 1TF7A 4IOMA 4OMCA 4ZV9A 4KEAA 4HAYA 4TMYA 5ARBA 5FH9A 3C3JA 4A8TA 3BOSA 2P2YA 3QWBA 1Y8RA 3U7JA 2C54A 2Q62A 2ZVDA 1G64A 1H6BA 4TMWA 1G21B 4DLNA 4PZUA 1W4AA 3SDSA 3WB9A 3OZDA 3UV7A 3DKRA 3RYFB 2K7FA 4UXHA 2NXCA 1QK4A 2QVBA 2VJYA 3EW7A 3I9V6 3WX0A 2NLOA 4L02A 1IHYA 2EHJA 3FSEA 1LI4A 3O0DA 3L07A 4ODIA 1SU7A 1OHHD 2H0QA 3G17A 5U4XA 3TRIA 4K9RA 3ZUPA 3LRTA 3HNPA 2ZTMA 2Q99A 4MUHA 5T4FA 4GOJA 1QHGA 1Y3FE 4R2JA 1Q6YA 3WLSA 1RKQA 1S89A 3HUFA 5GTDA 5A0VA 1UDRA 3EGDB 1E0KA 2VOEA 2QLTA 3RC7A 1ZM3A 2XYHA 2VQDA 3H1FA 4RH0A 3DZFA 5JCPA 2Q6IA 1X1CA 3O26A 2RKWA 1GKUB 4LZZA 2LUOA 1YJAA 2I4TA 2CFCA 1IPHA 3PQFA 5KJCA 4YP7A 3KSUA 4BZXA 5DHAA 4MJLA 4ZZ2A 2P2CA 3NOQA 4FE3A 3EWAA 4PRYA 4MQ6A 4U6NA 1WWKA 3FBWA 5G41A 2VA9A 3N7AA 2F1IA 1DCTA 1BO6A 3M34A 3E1GA 1L5ZA 3R6LA 4OHPA 5PNTA 4CIXA 2Q4OA 1B8NA 2GD0A 3ABIA 4A26A 3NAZA 4N41A 5JO9A 1YB1A 3ROGA 1DG1G 1CG6A 1CVIA 5CVCA 3W2HA 4KQ2A 3WMRA 4A4DA 3HY4A 4O2AA 3LF2A 4JROA 3W1VA 2ZRAA 1W52X 2W2KA 3BD9A 4MQMA 1V7PC 4DMGA 1GZSA 1SELA 3L7LA 2AMLA 4YJGA 3VNAA 2F3PA 3L2OB 4U39A 4RVCA 2WM2A 1PO7A 4BASA 2C7RA 2R47A 3P0IA 1EU1A 4B32A 5I9NA 3TNFA 2ZT7A 3I0NA 2J85A 4DDUA 2WDPA 3UWDA 3P9ZA 4HQRA 4PC2A 4AMVA 5IVKA 2V0CA 1A3CA 1NMXA 2RBEA 1NHGA 3TLZA 4MQEB 1TUBB 4ED9A 4ZZ1A 2VHQA 3OFNA 3UJ8A 5EHGA 2XPCA 3CPEA 3EGOA 4PPYA 1Z29A 2IP2A 5H16A 1I4EB 3N2KA 3DTNA 4B7AA 1Y1LA 2VTVA 1ZW6A 2Q9CA 1RAFA 3KKKA 4MS1A 4U7TB 3MWKA 3RREA 1EXMA 1XDDA 4Y2UA 5BQOA 3WRVA 5CB4B 4HHEA 4BMOB 3WLMA 3WJ1A 1JNXX 1II8B 5SYNA 3CWCA 4EHNA 3U7FB 1T0UA 2HAEA 4BNWA 1NBMD 3VH4A 1ZM9A 3SS7X 4EHFA 3GK3A 3LPLA 2J0UB 3R77A 1QCYA 4B7UA 3LNCA 2PKWA 2CFOA 5TGDA 3ESXA 3O21A 3B53X 5JNSA 2OBLA 5KTTA 3E0XA 3PQ7A 1O58A 3UNXA 4NWIA 1TCUA 2I8AA 1PW5A 3O94A 1Y7PA 2HPZA 4BQPA 4NCKA 5CX1A 2JHPA 3Q1KA 1CV2A 2BGTA 2AFHE 2J33A 3GQVA 3WC4A 5IRCD 2JAOA 6LDHA 1U7HA 4JGGA 2VWPA 4CHGA 1H4QA 3CM0A 4EELA 2CCGA 2IGBA 3ISTA 4ALKA 1TIKA 2DQZA 3AJ8A 3B51X 3ZDAA 3ZY6A 4HRYA 1UC5B 4HD8A 1OXMA 2XZTA 4C2TA 3ILHA 4OATA 1R0YA 4JC4A 1E3JA 4JWKA 4MUAA 4A82A 4CIVA 4WDRA 2R6HA 4ER5A 1SKUA 5KWIA 1ZUHA 2QMEA 1RHUA 2Z56A 1RQNA 2ZB8A 3TNLA 4B5LA 4CBVA 1KEPA 2I67A 3D6JA 4D8WA 4IICA 2GVNA 4DGQA 1ZD3A 2VCHA 5IHPA 2V7GA 1UK9A 3ASZA 4X3PA 4AG6A 2FR8C 4CUJA 1D6JA 4OOEA 2HNAA 2II6A 4YUWA 1BDMA 2R84A 4JDUA 1L8QA 2C2HA 1BQ4A 1DXHA 1OLSA 1ZUWA 2JBHA 4B45A 4MV6A 5EKDA 3T38A 4DC0A 4ZEVA 4QYMA 3TR0A 2IBTA 1LEHA 2C0PA 1OLSB 2H0RA 1CZNA 2W6MA 1QK5A 1V45E 2YWFA 3LBHA 2PUEA 2IWHA 1UQTA 1FFCA 1MO2A 2I3DA 3C24A 3KR9A 2EX0A 4TT8A 5DM0A 3I61A 4DLKA 4XVCA 4ZV4A 5E6RA 3Q2KA 1YHNA 1Q7RA 5SZJA 4JJEA 5D7BA 3BTUA 4QPJC 5IAAA 5ABPA 2XTAA 4LOAA