3HDXA

Crystal structure of susd superfamily protein (np_809182.1) from bacteroides thetaiotaomicron vpi-5482 at 1.50 a resolution
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
474
structure length
456
Chain Sequence
TQQWKTLEDTRSALMGVYGLTRAALADNNTHWICGDLRKGDFTVYKRSDLQAVSDNELNKPYDLLKKVSNWRRFYAVINAASVFMEKAPRTVELDRSYSEQNLKYDIAQVRALRAFAYFYMVRIWGDVPLVTYSYDNGTFPSMPRTDAQTVLSYAKAELLTAIEDLPYQYGTQTNLYYGSYGAQWQGKLFNKLSAYSVLAHICAWQGNYAEAETYSAFIIDHASEINAKYTSIADLTSETGLFYSNASVKGSRILGFNFAGHLEQLTLAYPLVQKSYPEIYISKDSLFSIFTNFDDLRFGIIDTIKYSSYYVQNLNEETPVFSKIKIIQGVFGSSIVFTRLEDITLLRAEALCALNRSTEAVSYLNMIRTNRGLREVSFKKDFGNNRESLIAEIFEERRRELMGEGWRWYDLVRRQKLMKDNEAFLRLISSGGIYWPVSEDIITANSQIEQNEFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SusD superfamily protein (NP_809182.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.50 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Polysaccharide binding protein
molecule keywords SusD superfamily protein
total genus 175
structure length 456
sequence length 474
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hdxA00
3IV0A 3L22A 3FDHA 3NQPA 3SGHA 4LERA 3OTNA 5J90A 3JQ1A 3JYSA 3EJNA 5FQ4A 5T4YA 3KEZA 3I4GA 5E75A 3EHMA 3SNXA 3MYVA 3HDXA 3CK9A 4F53A 3CGHA 5FQ7A 4PUCA 3QNKA 5FQ6A 3LEWA 3MX3A 4MRUA 4F7AA 5LX8A 3CKBA 3CK8A 3JQ0A 3CK7A 3GZSA 3CKCA 3MCXA 5T3RA 3P1UA 5E76A 5FQ8A 4Q69A 4L7TA 3EHNA
chains in the Genus database with same CATH superfamily
2E0IA 2IJGX 2KZTA 1Z3XA 4G2VA 3ESKA 1JWGA 4M3OA 3SBSA 4C0MA 4R7LA 3FEYA 3FWVA 4B89A 3UMVA 3FEXA 1E8XA 3Q4AB 4LG6A 4GCOA 5CMYA 3UM0A 4AJWA 4J7WA 3FU3A 2XRZA 2XCBA 3ZKJA 4DPRA 2OEWA 4GPMA 4I6JA 4DLQA 3WG7E 2ZGGA 2GRPB 3TAXA 5D66A 3PZDA 1OCOE 4NQ0A 2V4HC 5G2NA 3AG2E 2XENA 3BG0B 3SY2A 3MKQA 5EKQD 4Q96A 5CMWA 3G2VA 3FUKA 4ANXA 1GW6A 5BUZA 3CVQA 4GTSA 1ELWA 4C0EA 3UX4A 3NQPA 2L6BA 3Q9NC 3LVRE 5EYLA 1ELKA 3FTSA 2B6CA 2ETAA 3E32A 3LS8A 4FHKA 3FHEA 2Q7FA 2IEJA 1WAO1 3PDNA 5AQ7A 3QK0A 2HR2A 2ZISA 5ENTD 4YDWA 3TWTA 1FT2A 2ETBA 2X6FA 4GPKA 1O1SA 4DUIA 4OAVB 2L6JA 5B1BE 3D9HA 4A1SA 3SNXA 2E2EA 3VLDA 3FU5A 4WWOA 4ILGA 4JHKA 2R59A 2DBAA 3OAWA 1NA3A 2XS1A 1E8ZA 4P29A 1MHQA 1XNFA 5LFAA 4G8KA 4Q69A 4N2QA 2V5QC 1U2VG 4GYYA 4CYMD 4ANVA 3AS4A 5FIOA 3TWUA 2EIKE 3L6AA 3RAUA 3SO8A 5B1AE 3IHVA 3L22A 4FA6A 4BESA 3HIZA 3FUEA 4JW1A 1UG3A 3P2BA 3ZYLA 2FO1E 3T5VA 3UM1A 3GZ1A 2I2OA 4C9BB 5G55A 4N3CA 3B13A 4LNGA 3DSUA 3IKOB 1AP7A 3UT7A 2WXRA 2LXLA 4N5QA 3CK9A 1H0AA 2H6FA 3LEWA 2C0LA 3ASDA 2XS8A 1KZPA 1S64A 2KXPC 1NI1A 2F0YA 1TEZA 4LEUA 3ABKE 4XEIG 4ACLA 3W9GA 2AXUA 2P9LG 3B7SA 1N95A 3L08A 5KNGA 1RW2A 3U4TA 3R7RA 4GZ5A 2XPZA 3SZ7A 3D9JA 4BERA 3MV2B 3HVEA 1DVPA 3UINC 3ZHEA 3E34A 5FQ4A 1DCQA 2WQ7A 4TXPA 1BI7B 3R9AB 1NL4A 2PZIA 4GA1A 4UQYA 3J5PA 3JXIA 3LY9A 3W9FA 2WQ6A 1N4QA 4A3VA 4HI8A 1N0RA 2WXJA 3LDZA 2GRLA 2XCCA 1E96B 4DI4A 1K8KG 4LSZE 1QBQA 5LOZA 2QZAA 3V31A 2XRYA 5BXUA 3HXFA 3MX3A 4WAFA 4K03A 2XEEA 1PY1A 4UQXA 4I1OB 3G2SA 4FADA 2LAIA 2FBNA 3EDTB 4JA9A 4L2YA 4QFVA 2HM8A 2ZGDA 5BW8C 3KEZA 3E33A 4CRWA 4N3AA 5EILA 3UM3A 2GRQB 4Z68A 4M7CA 4F3VA 1V54E 4CCAA 3APFA 3VTXA 3DSXA 2LUHA 4HS2A 1BPOA 1UOHA 2VGEA 3MJWA 4Q94A 4HNAD 1WDYA 4TRQA 1HG5A 2RFMA 3AAAC 3PUJA 1JPLA 2PQRA 3CKBA 3FTXA 5T8IA 3CQCB 5FQ8A 4A63B 5CHEE 1H2UA 1A17A 1QNFA 1H6OA 3NOGD 1E8WA 4AEZC 2C2LA 3ABME 1HF8A 1SA4A 1HZ4A 3E37A 1DCEA 4Y6CA 2DZNA 2OCCE 2F8YA 2R03A 1IQRA 5C1DA 3S7DA 2Y69E 3LVQE 2AJAA 4O1OA 2J08A 3QJZA 1TN6A 1TR4A 1S0PA 3CK7A 4DX6D 3QDNA 3BQOA 4DK5A 2J4BA 3LJ3A 4UI9C 3V2XA 2V0PA 1SZ9A 2VSNA 4G23A 4BTBA 3HRAA 2EIJE 4AV7A 4FLBA 3FUDA 4J8YA 4JEUA 3D9MA 3BEEA 4U8HA 3MKQB 3LCAA 4BWRA 2UY1A 3ML8A 4HLLA 2X38A 1IHBA 5ANLA 4F6RD 3UTMA 4HOUA 3TWVA 3EIJA 2WXNA 4OVUA 3RO3A 4GTRA 1HFAA 5EX0A 1UN9A 2Y0BG 3ZIMA 4KBQA 4BT9A 2A5EA 2VTBB 5CEAA 4HOTA 2AVPA 1YYHA 4JHRA 2NC9A 2R5SA 5KJNA 1OCRE 2I6HA 4KXKB 2WMOA 1H6KA 4L2LA 4TUMA 4DX7D 5AENA 1OXJA 5JHBA 1LTXA 2DVWA 3FUMA 1FCHA 3DPDA 2VSXE 2VGYA 3ZRHA 4FC8A 3I4RB 4I1AA 3CVPA 1D9SA 3FTYA 3QWWA 4JD2G 1VDYA 3U3WA 3R7QA 3JQ1A 2VGXA 4WWNA 3T8MA 2VJ8A 4YDOA 3PNTB 4I17A 2FF4A 2WPVA 3SFXA 3ZPJA 2BUGA 1KT0A 4U7EB 4FJZA 3Q15A 3CR3A 3C3QA 1UJKA 1XGWA 5ITZF 2P9NG 4EHMA 1IQUA 1JCSA 3B7UX 2Y4UA 3EU5A 4RG6A 1ZB1A 1HG2A 3RRNB 3BG1B 4AIFA 4GTQA 2KATA 3NB2A 4XI0A 2YINA 3UXGA 2YHEA 4BSZB 3CQGB 4IULA 4HORA 4B93B 2J4DA 2RD0A 2EIME 4BX8A 1LD7A 4C48B 1QQEA 4KZ0A 3UPVA 3D9OA 3ONLA 4LNUD 4KT6B 3X2QE 1U3DA 4XZ4A 3TXNA 5CEDB 3CVWA 4LNBA 1JCQA 2IOSA 5ENSD 3G2WA 4JA7A 3UIOC 3L17A 4AXHA 1EDUA 1INZA 1WG0A 3LJNA 2JABA 2XEHA 3P1UA 5CCMA 4EQFA 4JHJA 5AQBA 5DIZA 4U63A 3ZFWA 1BLXB 3PEVB 3MYVA 2IFUA 5A7DB 4UI9K 3DEPA 1TJCA 3UKRG 4F1SA 2BF0X 3FH8A 2UWJG 3D9NA 4GTOA 2P9IG 4IRUA 4XE0A 2MYOA 3Q9UC 4EZJA 2CFZA 3TWXA 2A4ZA 1MX2A 3ZYMA 4K5BA 5EX3A 3B7BA 3ZXPA 5EIBE 4FULA 3D9PA 2EINE 4JB8P 4DX5D 2WXKA 5M72A 1O1RA 3LKUA 3CIAA 1X5BA 2Y1LE 1QZ2A 3FTWA 2YQ8A 3FTVA 4CEMA 3F6QA 3LXUX 1D8DA 3ASOE 2PM7A 4HRNA 5HQ8A 2XZDG 3PREA 4XKBA 3AG3E 5H7PA 1TN7A 5LCWJ 2LAHA 5KJMA 4ILHB 3SD5A 5AYWD 1EYHA 3TWSA 2DIWA 4TV3A 5AJDA 4CDRA 4F53A 3D9IA 2BKGA 2OVBA 3ISMC 3KAEA 3ULYA 1N4RA 3LYAA 3PRZA 3QWVA 3CV0A 4IN3B 1OWOA 5ENNA 4UWHA 3IV0A 1X81A 4U96D 3IHYA 5AAOA 4WUYA 4K5AB 2GW1A 3CHMA 2WXOA 4UUCA 1V55E 4GA2A 1OWNA 1TNBA 5KCMA 5FQ7A 5CRVA 1MJ0A 2NSZA 1WY6A 3HXCA 3DSTA 3PUKA 3VLEA 4GTVA 3RRMB 3RK6A 2VSOE 1BU9A 1LD8A 4FJYA 2AWIA 3EUVA 5CBOA 1Q2ZA 2NYJA 3I5PA 4U0UA 1Z3YA 3R9MA 1ELRA 1Y6IA 4YDYA 2KM4A 3AG1E 2I9CA 2X6IA 3JYSA 4L1BA 3I4GA 5B3SE 2P2CP 1H6PA 1MX4A 3Q73A 2GRNB 2J8SD 3B95A 5HKPA 2CHWA 3Q5MA 2DZOA 1K1AA 3Q79A 1DC2A 3EIQC 4I9CA 4I2WA 4N3BA 2IF4A 4B8AA 3HG0D 1Z6TA 4PH4B 5FJYA 1HE8A 3K9IA 4FU3A 3ZVVA 3FULA 4MRUA 3G2TA 3JQ0A 3GZSA 3RKVA 3OXGA 5FZRA 5JA4D 3KD7A 3Q47B 1NZNA 3PZ4A 2VYIA 3EHMA 4W9RA 1NFIE 4WNFA 3QNKA 4IYPA 3JUIA 1TNZA 4HI9A 3TWWA 3ZYQA 4AY6A 3KSQA 5BNWA 4BT8A 3C98A 2LNIA 1SZAA 2XQ0A 3C5RA 4ANWA 1UW4B 4DX1A 3MV3B 3RRUA 3FU0A 4DI3A 1OCCE 4F7AA 3QWPA 2LXMA 3TL5A 2A5UA 2PM6A 3EHNA 5HRYA 4TXQA 2L9BA 3SGHA 2KC7A 3CHQA 3E4BA 4LERA 4J8EA 2WM9A 3Q49B 3CVXA 2WXFA 2FEZA 1D8EA 4LRZA 3JXJA 1H2TC 4H7XA 5DBKA 4F1PA 1Z5SC 2V8SE 4RLYA 4HFGA 2XPIA 4ABNA 5T4YA 2IY0C 3C3OA 5CECB 4RSYA 3TWQA 2DYSE 4FP7A 4X8QA 3FFLA 3UT8A 3ASFA 2WXIA 5LX8A 2XEVA 4GYWA 1HX8A 4WNDA 1HXIA 2EQXA 2AW6A 2DYRE 3J5QB 3MEKA 5FINA 4APFA 3DBSA 3ENEA 4B0ZA 3JCKC 2FO7A 3PH0C 1U3CA 3LPZA 3GYZA 4JPSA 3ZHEB 2ETCA 1TNOA 4I6GA 2WXQA 3DWLG 4BX9A 5E75A 4J6IA 1FVFA 5JJTA 4EZKA 4BEPA 1FVHA 5ENPD 3IEGA 2IO2C 3EHRA 2GGFA 4ZFHA 1DNPA 4U8VD 4GA0A 3RSEG 3FH5A 5JJ6A 5IY5E 4QQIA 3UQ3A 3L13A 2QY7A 1FT1A 2AXZA 4U95D 4NURA 4BSXA 3CVVA 4K5CA 3FU6A 3L9TA 3CVUA 4GMLA 3NAWA 1N4PA 2J9QA 1RZ4A 3ZYKA 2WXMA 5T3RA 5KNHD 1YCSB 4UWLA 4ANUA 2LO6A 1QYMA 4G24A 4FLHA 2WVIA 4MBGA 4GTPA 4PS8A 2GROB 3U9WA 3ONKA 2X6HA 3Q7FA 3JUEA 4UQZA 5J08A 3GZ2A 3ZGQA 2J07A 3MA5A 3KEAA 2WMNA 1W3BA 5LCWC 4WNGA 4ATGA 3NF1A 5EIDA 1Y8MA 2XGSA 1N54A 2M63A 1HS6A 1N9AA 4AP2A 1KZOA 4EZLA 5ENRD 4GZDA 2J49A 1OY3D 2KZTB 4BFRA 3OXLA 4KVMA 2X6KA 1KPSB 1TYQG 4G26A 3PZ2A 2CHZA 2IO3C 3D3MA 3KSLA 3QC1A 4G25A 4KZCA 5ENQD 3DRAA 1S63A 4YDEA 1AWCB 4DLOA 4EECA 3NZSA 5FWQA 1HU3A 1N4SA 2NXPA 2CG2A 5J90A 5HI7A 4RQIA 4D10C 3CGHA 4HOSA 3G2UA 3C72A 5HS0A 3FUHA 3D9KA 2LSVA 3ASHA 3T9KA 3AG4E 5D2MC 4DX2A 1JCRA 2Y4TA 2P58C 2UY1B 1UN8A 4AOFA 1N11A 3SFZA 3PZ1A 2OV8A 2R17C 2MHKA 4MS6A 4XKCA 3L54A 4I6EA 2GRMA 3S7JA 4B8CB 5JMND 1OCZE 3FUNA 3CHRA 4AY5A 4ME2A 5AJLA 2H6GA 3FTZA 1P5QA 4V3IA 2WQHA 1PAQA 4KVOA 2ILRA 2QYUA 1HH8A 4RG9A 2IQCA 5KJKA 2L0IA 4JL0A 2VGXB 2FI7A 4U07A 3WXXA 4O60A 3UT4A 4UWKA 1NA0A 3HYMB 1PC2A 1G3NB 4A1GA 3TXMA 3DEOA 1EPUA 4GB9A 4O6FA 2R05A 4ILIA 3V30A 1SQMA 3IXEA 1MQSA 2R02A 3APDA 2I1JA 4HRLA 4LCTA 4WNEA 3ZXSA 4ATZD 1ZBPA 1OWLA 3TGOA 1IHGA 1TN8A 1UJJA 2GRRB 1IYGA 3C3RA 5ANRA 2ONDA 3ULQA 4RVBA 2CHXA 5JJ7A 3Q7AA 3S7FA 2IONA 2BTDA 1K3ZD 2KBXA 5AQ9A 2XGOA 1L5JA 4N39A 1B89A 2CFUA 5BT1A 3TJPA 1OWMA 1NP7A 2FULA 4ACKA 4NACA 3FUJA 4U8YD 4PS7A 4GMJA 3CHOA 3FTUA 3RU0A 5CRUA 2KCLA 2BKKB 3IBEA 5LP0A 4GZ3A 3ML9A 5KWDA 3UI2A 2VQ2A 3QAQA 2XHEA 1MX6A 5D0QD 5EDSA 4E85A 4I1MA 3DSVA 2EILE 3HXEA 3I3NA 2H6IA 2AXVA 3URZA 2QYJA 4CT4A 4XIFA 3ESLA 2F37A 4J0UA 5D0OD 5ARFA 3RIBA 5KBAA 2OEVA 3FDHA 3Q78A 4J8FA 3HVEB 3D9LA 4H7YA 3MGBA 3CVLA 4L23A 1OT8A 3AJIA 4I43A 5G04J 3GW4A 3O4ZA 4GAAA 4GMRA 1JUQA 3T5XA 4HRMB 5AQAA 2HO1A 3FUFA 3ULEG 2MOWA 4UWGA 2WB2A 4N5CA 1LF8A 4I9EA 1JWFA 3CHSA 2OVFA 2RG8A 2F8XK 3ABLE 1SW6A 5BPPA 2XGMA 3DPYA 4CDNA 1EF1C 3AU4A 5ARGA 4XI9A 5C2YA 5FZQA 4YVOA 2WXPA 3UUXA 4OYSA 1E8YA 4TXRA 2PL2A 2P9PG 2B0OE 2V5FA 2R2LA 4A3TA 4A55A 4NIKA 4GU5A 5CBNA 5FT9A 1E7UA 2RFAA 3DXKG 4EBAG 4ZHBA 5AN8A 3L16A 1TNUA 4UI9J 1A5EA 3SQVA 3CVYA 3FH7A 4JZYA 4GZCA 5G05J 5FQ6A 5BV1A 5BV0A 1KT1A 4MLPA 1HO8A 4G1TA 3E30A 3NBNB 4AVXA 3B7TA 2HE0A 3S7BA 3EJNA 3QKYA 2C0MA 3AS8A 5A6CA 4CGVA 3DSWA 3TG4A 4CGWA 2YHCA 4GTMA 3FUIA 2JEKA 3BU8A 3AS5A 3HHMA 5E76A 5EYPF 3MKRA 3RJVA 3V79K 1E90A 4LUNU 4JC8A 2DCPA 4BTAA 4JXTA 4GTTA 3EHQA 4U0SA 2J09A 3T8KA 2IOLA 4KYOB 5G05C 4CZ2D 3LY8A 3Q75A 4PS3A 3ASGA 2H6HA 2BEDA 3CK8A 1N52A 3VLFA 2Y3AA 2ZU6B 3ZNGA 1WM5A 3QOUA 2RKKA 2L0TB 3LY7A 3HXBA 4MKTA 3CEQA 2I1KA 4JEHA 4NRHB 4YNDA 4PUCA 4U0ZA 2KCVA 3NZUA 3KS2A 4DRXE 1YA0A 3CLJA 4G11A 3OTNA 2CG3A 3VTYA 1MYOA 2IU1A 3PE4A 3UIPC 5CCLA 4HB5A 4G8LA 2HYZA 4GCNA 4N2SA 4I2ZA 3ZU7B 5JHAA 3N71A 3PE3A 5FZSA 4FHJA 2DWZA 2X6JA 3PZ3A 5KJLA 5G04C 2JLBA 1OWPA 4U04A 1SA5A 3DSSA 4HLEA 2VSYA 3RO2A 5CERB 4L7TA 1ZU2A 4HVBA 2P9UG 4TUUA 3SI5A 1O5MA 2P9KG 3AU5A 4GZ6A 3PS6A 4HBDA 4J8SA 3QARA 3V2OA 1YMPA 1BI8B 5BXOA 4OAUC 4APOA 1S70B 4PDXA 3U66A 4HOQA 4WWPA 4L9PA 1TJFA 4XX5A 3APCA 4CDMA 3OXFA 3U64A 1E7VA 3TG5A 3L82A 1KLXA 1FPPA 3MCXA 2PNNA 4Y6WA 3O48A 1IKND 3SF4A 2OOEA 5A23A 1SVXA 4B94A 3CHPA 1TNYA 2V4LA 2VTBA 3EU9A 5ENOD 1K1BA 3PVLA 3ZEFA 3MZLB 3PEUB 4CT0A 2ZXWE 3SFYA 1IXVA 2QFCA 1N0QA 3FY4A 4BY6A 2P9SG 4KMOA 3ZN3A 3ASNE 2X3MA 1BD8A 2PQNA 4HQDA 4O1PA 3QB2A 1O1TA 1H2VC 3ZW3A 1OUVA 3B7RL 3UKUG 2MRIA 2XZTG 4K0RA 2YNQA 3SHFA 3S2AA 4BETA 4UWFA 5AARA 3NOCD 2XPYA 2LSUA 2ZIRA 5FTPA 3TWRA 3PNLB 4YVQC 3CSTA 4OVVA 2QC9A 1N94A 2KCKA 4URKA 5EN5D 5AIJA 1H19A 2WXGA 3CKCA 1MZCA 4GYOA 4J8DA 4EPZA 3HXDA 3ZUVB 4DJAA 3BUAA 3CVNA 3CSFA 4HXIA 2WXLA 3HDXA 4EBAA 2WXHA 4JVSA 3UM2A 3DXMG 4AM9A 4E6HA 3FP3A 3SBTB
chains in the Genus database with same CATH topology
2E0IA 2IJGX 2KZTA 3FDHA 2WXNA 5BNWA 4J8FA 4BT8A 1Z3XA 3C98A 3HVEB 3D9LA 4G2VA 4H7YA 2LNIA 1JWGA 1SZAA 3ESKA 4OVUA 3RO3A 3MGBA 3CVLA 4L23A 2XQ0A 1HFAA 4M3OA 4ANWA 5EX0A 1UN9A 3SBSA 1UW4B 4C0MA 3MV3B 4R7LA 3RRUA 3ZIMA 3FU0A 4I43A 4KBQA 4DI3A 3FEYA 4BT9A 2VTBB 3FWVA 5G04J 4B89A 4F7AA 3QWPA 3UMVA 4HOTA 3GW4A 3O4ZA 4GAAA 3FEXA 2AVPA 4JHRA 1E8XA 3TL5A 2NC9A 2R5SA 2A5UA 2PM6A 5KJNA 1JUQA 3Q4AB 3T5XA 3EHNA 2I6HA 4GCOA 4KXKB 2HO1A 3FUFA 2L9BA 2MOWA 2KC7A 5CMYA 3SGHA 2WMOA 1H6KA 4L2LA 3CHQA 3E4BA 4LERA 4AJWA 5AENA 3FU3A 4UWGA 2XRZA 2WB2A 4J8EA 2XCBA 2WM9A 5JHBA 4N5CA 1LF8A 3Q49B 4I9EA 4DPRA 1JWFA 3CVXA 2WXFA 4I6JA 3CHSA 3FUMA 2OVFA 1FCHA 2RG8A 4DLQA 3DPDA 2FEZA 5BPPA 2VSXE 4LRZA 2VGYA 2XGMA 3ZRHA 1H2TC 4FC8A 3I4RB 3TAXA 1EF1C 4CDNA 4I1AA 3CVPA 4H7XA 5DBKA 3AU4A 5ARGA 3FTYA 4XI9A 3QWWA 5C2YA 3PZDA 2V8SE 4NQ0A 5G2NA 5FZQA 1VDYA 3U3WA 4HFGA 2XPIA 4YVOA 3R7QA 2WXPA 3JQ1A 5T4YA 2VGXA 4OYSA 3UUXA 1E8YA 4ABNA 3BG0B 4RSYA 3MKQA 5EKQD 4WWNA 4Q96A 3T8MA 2VJ8A 4FP7A 2PL2A 3PNTB 3FFLA 4I17A 3UT8A 2V5FA 3ASFA 2FF4A 2WPVA 3ZPJA 2BUGA 2WXIA 1KT0A 4A3TA 5LX8A 4A55A 5CMWA 3G2VA 3FUKA 4ANXA 4GU5A 2XEVA 4FJZA 1GW6A 5BUZA 3CVQA 1HX8A 1E7UA 4GYWA 4WNDA 3Q15A 3CR3A 5FT9A 1HXIA 1ELWA 4C0EA 3UX4A 2EQXA 3NQPA 3LVRE 1ELKA 3FTSA 1UJKA 1XGWA 2AW6A 3LS8A 3MEKA 4FHKA 4EBAG 3FHEA 4APFA 3L16A 4UI9J 3DBSA 1IQUA 3CVYA 2Q7FA 3B7UX 2Y4UA 3FH7A 4JZYA 4GZCA 5G05J 4RG6A 5FQ6A 1WAO1 3ENEA 5BV1A 5BV0A 1KT1A 1HG2A 3PDNA 4B0ZA 3JCKC 3RRNB 3QK0A 2FO7A 3BG1B 3PH0C 4AIFA 2HR2A 1U3CA 4MLPA 3LPZA 3GYZA 1HO8A 4JPSA 2X6FA 4GPKA 4G1TA 2KATA 3ZHEB 4I6GA 2WXQA 4AVXA 2L6JA 3B7TA 4XI0A 2YINA 3S7BA 4BX9A 2YHEA 3EJNA 3QKYA 2C0MA 3AS8A 5E75A 3CQGB 4J6IA 3SNXA 4A1SA 4IULA 5A6CA 1FVFA 2E2EA 3VLDA 4CGVA 5JJTA 2J4DA 4HORA 3TG4A 2RD0A 3FU5A 4EZKA 4WWOA 4ILGA 4JHKA 2R59A 2DBAA 4CGWA 3OAWA 1FVHA 1NA3A 2YHCA 4BX8A 1E8ZA 3IEGA 4P29A 1MHQA 1XNFA 3FUIA 1QQEA 2JEKA 4KZ0A 3UPVA 3D9OA 5LFAA 3AS5A 2GGFA 3HHMA 3ONLA 5E76A 3MKRA 3RJVA 4KT6B 1E90A 1DNPA 4JC8A 4LUNU 2DCPA 4Q69A 4GA0A 1U3DA 4XZ4A 4JXTA 4BTAA 4N2QA 3FH5A 3TXNA 5JJ6A 3CVWA 3UQ3A 2IOSA 3L13A 4U0SA 2QY7A 3G2WA 4JA7A 2AXZA 2J09A 4NURA 4BSXA 2IOLA 3CVVA 4GYYA 4KYOB 3L17A 3FU6A 4AXHA 3CVUA 4GMLA 4ANVA 3AS4A 5G05C 3LY8A 4PS3A 1EDUA 3L6AA 3ASGA 2J9QA 1INZA 3CK8A 1N52A 3ZYKA 2WXMA 3VLFA 5T3RA 3P1UA 4UWLA 2Y3AA 3IHVA 4ANUA 5CCMA 2ZU6B 2LO6A 4EQFA 1WM5A 4G24A 4FLHA 2WVIA 3L22A 3QOUA 4FA6A 4PS8A 4JHJA 3U9WA 2L0TB 3LY7A 3ONKA 2X6HA 3HIZA 3FUEA 4UQZA 5DIZA 4U63A 4MKTA 5J08A 3GZ2A 4JW1A 1UG3A 3P2BA 3ZFWA 3ZGQA 3ZYLA 3CEQA 3T5VA 2J07A 3MA5A 2I1KA 3PEVB 3MYVA 2WMNA 1W3BA 5LCWC 2IFUA 4WNGA 4ATGA 4JEHA 5A7DB 4UI9K 3NF1A 3GZ1A 4NRHB 1Y8MA 2I2OA 2XGSA 4PUCA 4YNDA 1TJCA 4F1SA 2BF0X 4U0ZA 3FH8A 1N54A 2KCVA 4C9BB 2UWJG 2M63A 3D9NA 1HS6A 3NZUA 3KS2A 5G55A 4AP2A 4N3CA 1YA0A 4EZLA 3B13A 3IKOB 4IRUA 3CLJA 4GZDA 4G11A 4XE0A 3UT7A 2J49A 3OTNA 2KZTB 2WXRA 4BFRA 4EZJA 3OXLA 4KVMA 2CG3A 2X6KA 3VTYA 4G26A 2CFZA 2IU1A 3PE4A 2A4ZA 2CHZA 3D3MA 3CK9A 1H0AA 3QC1A 4G25A 4KZCA 3ZYMA 5CCLA 3LEWA 2C0LA 2HYZA 5EX3A 4GCNA 4N2SA 3ASDA 4I2ZA 4DLOA 4EECA 5JHAA 3NZSA 3N71A 4FULA 5FWQA 1HU3A 3PE3A 2NXPA 2CG2A 3D9PA 5FZSA 1TEZA 4FHJA 5J90A 2X6JA 2WXKA 4LEUA 5HI7A 5KJLA 5M72A 4ACLA 2AXUA 3LKUA 5G04C 4D10C 2JLBA 1OWPA 3CGHA 4HOSA 3B7SA 4U04A 3L08A 3CIAA 3G2UA 4HLEA 1X5BA 3U4TA 3R7RA 2VSYA 4GZ5A 3RO2A 1QZ2A 2XPZA 3FUHA 3SZ7A 3D9JA 3D9KA 2YQ8A 3FTWA 3FTVA 4CEMA 3LXUX 2LSVA 3ASHA 4L7TA 3MV2B 3HVEA 1DVPA 1ZU2A 4HVBA 2PM7A 4TUUA 3ZHEA 2Y4TA 3SI5A 2P58C 5FQ4A 5HQ8A 2WQ7A 3AU5A 2UY1B 3PREA 1UN8A 4GZ6A 3PS6A 3R9AB 4AOFA 4XKBA 4J8SA 3QARA 3SFZA 2PZIA 4GA1A 4UQYA 2OV8A 2R17C 2MHKA 3LY9A 4MS6A 4XKCA 4APOA 2WQ6A 4A3VA 3L54A 4I6EA 5LCWJ 2LAHA 2GRMA 4PDXA 3S7JA 5KJMA 4ILHB 4B8CB 3SD5A 3U66A 2WXJA 1EYHA 4HOQA 4WWPA 5AYWD 3FUNA 3LDZA 2DIWA 4TV3A 1TJFA 2GRLA 2XCCA 1E96B 4XX5A 4DI4A 3APCA 5AJDA 3CHRA 4AY5A 4CDRA 4ME2A 5AJLA 4CDMA 3OXFA 3FTZA 5LOZA 3U64A 1E7VA 1P5QA 4V3IA 3TG5A 4F53A 2WQHA 1PAQA 1KLXA 2XRYA 3D9IA 4KVOA 2OVBA 3MX3A 2ILRA 4K03A 3KAEA 4WAFA 1PY1A 4UQXA 1HH8A 3G2SA 3LYAA 3MCXA 4I1OB 2LAIA 4RG9A 4FADA 2FBNA 3EDTB 2IQCA 4JA9A 3PRZA 5KJKA 3QWVA 3CV0A 4IN3B 1OWOA 4L2YA 5ENNA 4Y6WA 2L0IA 4JL0A 4QFVA 4UWHA 3IV0A 2VGXB 2FI7A 3O48A 3IHYA 4U07A 3WXXA 4WUYA 3SF4A 2GW1A 3UT4A 3CHMA 2OOEA 2WXOA 4UWKA 2HM8A 1NA0A 5A23A 5BW8C 3KEZA 3HYMB 4CRWA 4N3AA 1PC2A 4GA2A 1OWNA 3TXMA 3CHPA 4A1GA 4B94A 1EPUA 4F3VA 4CCAA 2V4LA 3APFA 4GB9A 5FQ7A 5KCMA 3VTXA 4O6FA 2NSZA 4ILIA 1WY6A 2VTBA 4HS2A 1SQMA 1BPOA 1MQSA 3APDA 2I1JA 3MJWA 4LCTA 4WNEA 3PVLA 4Q94A 3ZEFA 3MZLB 3PEUB 3ZXSA 3PUKA 4CT0A 1ZBPA 1OWLA 3VLEA 4TRQA 3TGOA 3RRMB 3RK6A 1IHGA 1HG5A 1UJJA 2QFCA 2VSOE 1IYGA 3FY4A 5ANRA 4BY6A 3PUJA 4FJYA 4KMOA 2ONDA 3ZN3A 3ULQA 4RVBA 1JPLA 2AWIA 2PQRA 2X3MA 2PQNA 2CHXA 3CKBA 5JJ7A 3I5PA 3FTXA 3QB2A 4U0UA 5T8IA 1Z3YA 3S7FA 3CQCB 1ELRA 1Y6IA 1H2VC 3ZW3A 5FQ8A 2IONA 5CHEE 2BTDA 1OUVA 2KM4A 3B7RL 2I9CA 1H2UA 1A17A 2XGOA 1QNFA 2X6IA 1L5JA 2MRIA 3JYSA 4N39A 4L1BA 3I4GA 4K0RA 2YNQA 3SHFA 1E8WA 1B89A 4AEZC 2C2LA 2CFUA 3S2AA 1HF8A 1HZ4A 5BT1A 3TJPA 4UWFA 1OWMA 2CHWA 3Q5MA 1NP7A 2FULA 2XPYA 2LSUA 4ACKA 4NACA 3FUJA 4Y6CA 5FTPA 3EIQC 4I9CA 3PNLB 4PS7A 4YVQC 4GMJA 4I2WA 4N3BA 2IF4A 4B8AA 1IQRA 3CSTA 4OVVA 3CHOA 3FTUA 5C1DA 1Z6TA 3S7DA 3RU0A 2KCKA 3LVQE 4PH4B 2KCLA 3IBEA 4URKA 5FJYA 5LP0A 4GZ3A 3ML9A 1HE8A 2J08A 5AIJA 1H19A 3K9IA 3QJZA 4FU3A 3ZVVA 3FULA 2VQ2A 3QAQA 1S0PA 3G2TA 2XHEA 4MRUA 3CK7A 3JQ0A 5D0QD 3QDNA 3GZSA 2WXGA 3RKVA 3CKCA 4GYOA 4DK5A 2J4BA 3LJ3A 5EDSA 4E85A 4I1MA 4UI9C 4J8DA 2V0PA 4EPZA 3OXGA 5FZRA 3KD7A 3Q47B 1SZ9A 2VSNA 4G23A 4BTBA 1NZNA 3I3NA 2VYIA 4FLBA 4AV7A 4DJAA 2AXVA 3EHMA 3CVNA 4W9RA 3URZA 3FUDA 3CSFA 4JEUA 4HXIA 4CT4A 3D9MA 2WXLA 4XIFA 3BEEA 3HDXA 3ESLA 4U8HA 4WNFA 3QNKA 3MKQB 3LCAA 4J0UA 4BWRA 4EBAA 2UY1A 2WXHA 3ML8A 2X38A 4IYPA 5ANLA 3JUIA 4JVSA 4HOUA 5D0OD 5ARFA 4AM9A 4E6HA 3FP3A 3RIBA 3ZYQA 3SBTB 4AY6A 3EIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IV0 A;  3L22 A;  3FDH A;  3NQP A;  3SGH A;  4LER A;  3OTN A;  5J90 A;  3JQ1 A;  3JYS A;  3EJN A;  5FQ4 A;  5T4Y A;  3KEZ A;  3I4G A;  5E75 A;  3EHM A;  3SNX A;  3MYV A;  3HDX A;  3CK9 A;  4F53 A;  3CGH A;  5FQ7 A;  4PUC A;  3QNK A;  5FQ6 A;  3LEW A;  3MX3 A;  4MRU A;  4F7A A;  5LX8 A;  3CKB A;  3CK8 A;  3JQ0 A;  3CK7 A;  3GZS A;  3CKC A;  3MCX A;  5T3R A;  3P1U A;  5E76 A;  5FQ8 A;  4Q69 A;  4L7T A;  3EHN A; 
#chains in the Genus database with same CATH topology
 2E0I A;  2IJG X;  2KZT A;  1Z3X A;  4G2V A;  3ESK A;  1JWG A;  4M3O A;  3SBS A;  4C0M A;  4R7L A;  3FEY A;  3FWV A;  4B89 A;  3UMV A;  3FEX A;  1E8X A;  3Q4A B;  4LG6 A;  4GCO A;  5CMY A;  3UM0 A;  4AJW A;  4J7W A;  3FU3 A;  2XRZ A;  2XCB A;  3ZKJ A;  4DPR A;  2OEW A;  4GPM A;  4I6J A;  4DLQ A;  3WG7 E;  2ZGG A;  2GRP B;  3TAX A;  5D66 A;  3PZD A;  1OCO E;  4NQ0 A;  2V4H C;  5G2N A;  3AG2 E;  2XEN A;  3BG0 B;  3SY2 A;  3MKQ A;  5EKQ D;  4Q96 A;  5CMW A;  3G2V A;  3FUK A;  4ANX A;  1GW6 A;  5BUZ A;  3CVQ A;  4GTS A;  1ELW A;  4C0E A;  3UX4 A;  3NQP A;  2L6B A;  3Q9N C;  3LVR E;  5EYL A;  1ELK A;  3FTS A;  2B6C A;  2ETA A;  3E32 A;  3LS8 A;  4FHK A;  3FHE A;  2Q7F A;  2IEJ A;  1WAO 1;  3PDN A;  5AQ7 A;  3QK0 A;  2HR2 A;  2ZIS A;  5ENT D;  4YDW A;  3TWT A;  1FT2 A;  2ETB A;  2X6F A;  4GPK A;  1O1S A;  4DUI A;  4OAV B;  2L6J A;  5B1B E;  3D9H A;  4A1S A;  3SNX A;  2E2E A;  3VLD A;  3FU5 A;  4WWO A;  4ILG A;  4JHK A;  2R59 A;  2DBA A;  3OAW A;  1NA3 A;  2XS1 A;  1E8Z A;  4P29 A;  1MHQ A;  1XNF A;  5LFA A;  4G8K A;  4Q69 A;  4N2Q A;  2V5Q C;  1U2V G;  4GYY A;  4CYM D;  4ANV A;  3AS4 A;  5FIO A;  3TWU A;  2EIK E;  3L6A A;  3RAU A;  3SO8 A;  5B1A E;  3IHV A;  3L22 A;  4FA6 A;  4BES A;  3HIZ A;  3FUE A;  4JW1 A;  1UG3 A;  3P2B A;  3ZYL A;  2FO1 E;  3T5V A;  3UM1 A;  3GZ1 A;  2I2O A;  4C9B B;  5G55 A;  4N3C A;  3B13 A;  4LNG A;  3DSU A;  3IKO B;  1AP7 A;  3UT7 A;  2WXR A;  2LXL A;  4N5Q A;  3CK9 A;  1H0A A;  2H6F A;  3LEW A;  2C0L A;  3ASD A;  2XS8 A;  1KZP A;  1S64 A;  2KXP C;  1NI1 A;  2F0Y A;  1TEZ A;  4LEU A;  3ABK E;  4XEI G;  4ACL A;  3W9G A;  2AXU A;  2P9L G;  3B7S A;  1N95 A;  3L08 A;  5KNG A;  1RW2 A;  3U4T A;  3R7R A;  4GZ5 A;  2XPZ A;  3SZ7 A;  3D9J A;  4BER A;  3MV2 B;  3HVE A;  1DVP A;  3UIN C;  3ZHE A;  3E34 A;  5FQ4 A;  1DCQ A;  2WQ7 A;  4TXP A;  1BI7 B;  3R9A B;  1NL4 A;  2PZI A;  4GA1 A;  4UQY A;  3J5P A;  3JXI A;  3LY9 A;  3W9F A;  2WQ6 A;  1N4Q A;  4A3V A;  4HI8 A;  1N0R A;  2WXJ A;  3LDZ A;  2GRL A;  2XCC A;  1E96 B;  4DI4 A;  1K8K G;  4LSZ E;  1QBQ A;  5LOZ A;  2QZA A;  3V31 A;  2XRY A;  5BXU A;  3HXF A;  3MX3 A;  4WAF A;  4K03 A;  2XEE A;  1PY1 A;  4UQX A;  4I1O B;  3G2S A;  4FAD A;  2LAI A;  2FBN A;  3EDT B;  4JA9 A;  4L2Y A;  4QFV A;  2HM8 A;  2ZGD A;  5BW8 C;  3KEZ A;  3E33 A;  4CRW A;  4N3A A;  5EIL A;  3UM3 A;  2GRQ B;  4Z68 A;  4M7C A;  4F3V A;  1V54 E;  4CCA A;  3APF A;  3VTX A;  3DSX A;  2LUH A;  4HS2 A;  1BPO A;  1UOH A;  2VGE A;  3MJW A;  4Q94 A;  4HNA D;  1WDY A;  4TRQ A;  1HG5 A;  2RFM A;  3AAA C;  3PUJ A;  1JPL A;  2PQR A;  3CKB A;  3FTX A;  5T8I A;  3CQC B;  5FQ8 A;  4A63 B;  5CHE E;  1H2U A;  1A17 A;  1QNF A;  1H6O A;  3NOG D;  1E8W A;  4AEZ C;  2C2L A;  3ABM E;  1HF8 A;  1SA4 A;  1HZ4 A;  3E37 A;  1DCE A;  4Y6C A;  2DZN A;  2OCC E;  2F8Y A;  2R03 A;  1IQR A;  5C1D A;  3S7D A;  2Y69 E;  3LVQ E;  2AJA A;  4O1O A;  2J08 A;  3QJZ A;  1TN6 A;  1TR4 A;  1S0P A;  3CK7 A;  4DX6 D;  3QDN A;  3BQO A;  4DK5 A;  2J4B A;  3LJ3 A;  4UI9 C;  3V2X A;  2V0P A;  1SZ9 A;  2VSN A;  4G23 A;  4BTB A;  3HRA A;  2EIJ E;  4AV7 A;  4FLB A;  3FUD A;  4J8Y A;  4JEU A;  3D9M A;  3BEE A;  4U8H A;  3MKQ B;  3LCA A;  4BWR A;  2UY1 A;  3ML8 A;  4HLL A;  2X38 A;  1IHB A;  5ANL A;  4F6R D;  3UTM A;  4HOU A;  3TWV A;  3EIJ A;  2WXN A;  4OVU A;  3RO3 A;  4GTR A;  1HFA A;  5EX0 A;  1UN9 A;  2Y0B G;  3ZIM A;  4KBQ A;  4BT9 A;  2A5E A;  2VTB B;  5CEA A;  4HOT A;  2AVP A;  1YYH A;  4JHR A;  2NC9 A;  2R5S A;  5KJN A;  1OCR E;  2I6H A;  4KXK B;  2WMO A;  1H6K A;  4L2L A;  4TUM A;  4DX7 D;  5AEN A;  1OXJ A;  5JHB A;  1LTX A;  2DVW A;  3FUM A;  1FCH A;  3DPD A;  2VSX E;  2VGY A;  3ZRH A;  4FC8 A;  3I4R B;  4I1A A;  3CVP A;  1D9S A;  3FTY A;  3QWW A;  4JD2 G;  1VDY A;  3U3W A;  3R7Q A;  3JQ1 A;  2VGX A;  4WWN A;  3T8M A;  2VJ8 A;  4YDO A;  3PNT B;  4I17 A;  2FF4 A;  2WPV A;  3SFX A;  3ZPJ A;  2BUG A;  1KT0 A;  4U7E B;  4FJZ A;  3Q15 A;  3CR3 A;  3C3Q A;  1UJK A;  1XGW A;  5ITZ F;  2P9N G;  4EHM A;  1IQU A;  1JCS A;  3B7U X;  2Y4U A;  3EU5 A;  4RG6 A;  1ZB1 A;  1HG2 A;  3RRN B;  3BG1 B;  4AIF A;  4GTQ A;  2KAT A;  3NB2 A;  4XI0 A;  2YIN A;  3UXG A;  2YHE A;  4BSZ B;  3CQG B;  4IUL A;  4HOR A;  4B93 B;  2J4D A;  2RD0 A;  2EIM E;  4BX8 A;  1LD7 A;  4C48 B;  1QQE A;  4KZ0 A;  3UPV A;  3D9O A;  3ONL A;  4LNU D;  4KT6 B;  3X2Q E;  1U3D A;  4XZ4 A;  3TXN A;  5CED B;  3CVW A;  4LNB A;  1JCQ A;  2IOS A;  5ENS D;  3G2W A;  4JA7 A;  3UIO C;  3L17 A;  4AXH A;  1EDU A;  1INZ A;  1WG0 A;  3LJN A;  2JAB A;  2XEH A;  3P1U A;  5CCM A;  4EQF A;  4JHJ A;  5AQB A;  5DIZ A;  4U63 A;  3ZFW A;  1BLX B;  3PEV B;  3MYV A;  2IFU A;  5A7D B;  4UI9 K;  3DEP A;  1TJC A;  3UKR G;  4F1S A;  2BF0 X;  3FH8 A;  2UWJ G;  3D9N A;  4GTO A;  2P9I G;  4IRU A;  4XE0 A;  2MYO A;  3Q9U C;  4EZJ A;  2CFZ A;  3TWX A;  2A4Z A;  1MX2 A;  3ZYM A;  4K5B A;  5EX3 A;  3B7B A;  3ZXP A;  5EIB E;  4FUL A;  3D9P A;  2EIN E;  4JB8 P;  4DX5 D;  2WXK A;  5M72 A;  1O1R A;  3LKU A;  3CIA A;  1X5B A;  2Y1L E;  1QZ2 A;  3FTW A;  2YQ8 A;  3FTV A;  4CEM A;  3F6Q A;  3LXU X;  1D8D A;  3ASO E;  2PM7 A;  4HRN A;  5HQ8 A;  2XZD G;  3PRE A;  4XKB A;  3AG3 E;  5H7P A;  1TN7 A;  5LCW J;  2LAH A;  5KJM A;  4ILH B;  3SD5 A;  5AYW D;  1EYH A;  3TWS A;  2DIW A;  4TV3 A;  5AJD A;  4CDR A;  4F53 A;  3D9I A;  2BKG A;  2OVB A;  3ISM C;  3KAE A;  3ULY A;  1N4R A;  3LYA A;  3PRZ A;  3QWV A;  3CV0 A;  4IN3 B;  1OWO A;  5ENN A;  4UWH A;  3IV0 A;  1X81 A;  4U96 D;  3IHY A;  5AAO A;  4WUY A;  4K5A B;  2GW1 A;  3CHM A;  2WXO A;  4UUC A;  1V55 E;  4GA2 A;  1OWN A;  1TNB A;  5KCM A;  5FQ7 A;  5CRV A;  1MJ0 A;  2NSZ A;  1WY6 A;  3HXC A;  3DST A;  3PUK A;  3VLE A;  4GTV A;  3RRM B;  3RK6 A;  2VSO E;  1BU9 A;  1LD8 A;  4FJY A;  2AWI A;  3EUV A;  5CBO A;  1Q2Z A;  2NYJ A;  3I5P A;  4U0U A;  1Z3Y A;  3R9M A;  1ELR A;  1Y6I A;  4YDY A;  2KM4 A;  3AG1 E;  2I9C A;  2X6I A;  3JYS A;  4L1B A;  3I4G A;  5B3S E;  2P2C P;  1H6P A;  1MX4 A;  3Q73 A;  2GRN B;  2J8S D;  3B95 A;  5HKP A;  2CHW A;  3Q5M A;  2DZO A;  1K1A A;  3Q79 A;  1DC2 A;  3EIQ C;  4I9C A;  4I2W A;  4N3B A;  2IF4 A;  4B8A A;  3HG0 D;  1Z6T A;  4PH4 B;  5FJY A;  1HE8 A;  3K9I A;  4FU3 A;  3ZVV A;  3FUL A;  4MRU A;  3G2T A;  3JQ0 A;  3GZS A;  3RKV A;  3OXG A;  5FZR A;  5JA4 D;  3KD7 A;  3Q47 B;  1NZN A;  3PZ4 A;  2VYI A;  3EHM A;  4W9R A;  1NFI E;  4WNF A;  3QNK A;  4IYP A;  3JUI A;  1TNZ A;  4HI9 A;  3TWW A;  3ZYQ A;  4AY6 A;  3KSQ A;  5BNW A;  4BT8 A;  3C98 A;  2LNI A;  1SZA A;  2XQ0 A;  3C5R A;  4ANW A;  1UW4 B;  4DX1 A;  3MV3 B;  3RRU A;  3FU0 A;  4DI3 A;  1OCC E;  4F7A A;  3QWP A;  2LXM A;  3TL5 A;  2A5U A;  2PM6 A;  3EHN A;  5HRY A;  4TXQ A;  2L9B A;  3SGH A;  2KC7 A;  3CHQ A;  3E4B A;  4LER A;  4J8E A;  2WM9 A;  3Q49 B;  3CVX A;  2WXF A;  2FEZ A;  1D8E A;  4LRZ A;  3JXJ A;  1H2T C;  4H7X A;  5DBK A;  4F1P A;  1Z5S C;  2V8S E;  4RLY A;  4HFG A;  2XPI A;  4ABN A;  5T4Y A;  2IY0 C;  3C3O A;  5CEC B;  4RSY A;  3TWQ A;  2DYS E;  4FP7 A;  4X8Q A;  3FFL A;  3UT8 A;  3ASF A;  2WXI A;  5LX8 A;  2XEV A;  4GYW A;  1HX8 A;  4WND A;  1HXI A;  2EQX A;  2AW6 A;  2DYR E;  3J5Q B;  3MEK A;  5FIN A;  4APF A;  3DBS A;  3ENE A;  4B0Z A;  3JCK C;  2FO7 A;  3PH0 C;  1U3C A;  3LPZ A;  3GYZ A;  4JPS A;  3ZHE B;  2ETC A;  1TNO A;  4I6G A;  2WXQ A;  3DWL G;  4BX9 A;  5E75 A;  4J6I A;  1FVF A;  5JJT A;  4EZK A;  4BEP A;  1FVH A;  5ENP D;  3IEG A;  2IO2 C;  3EHR A;  2GGF A;  4ZFH A;  1DNP A;  4U8V D;  4GA0 A;  3RSE G;  3FH5 A;  5JJ6 A;  5IY5 E;  4QQI A;  3UQ3 A;  3L13 A;  2QY7 A;  1FT1 A;  2AXZ A;  4U95 D;  4NUR A;  4BSX A;  3CVV A;  4K5C A;  3FU6 A;  3L9T A;  3CVU A;  4GML A;  3NAW A;  1N4P A;  2J9Q A;  1RZ4 A;  3ZYK A;  2WXM A;  5T3R A;  5KNH D;  1YCS B;  4UWL A;  4ANU A;  2LO6 A;  1QYM A;  4G24 A;  4FLH A;  2WVI A;  4MBG A;  4GTP A;  4PS8 A;  2GRO B;  3U9W A;  3ONK A;  2X6H A;  3Q7F A;  3JUE A;  4UQZ A;  5J08 A;  3GZ2 A;  3ZGQ A;  2J07 A;  3MA5 A;  3KEA A;  2WMN A;  1W3B A;  5LCW C;  4WNG A;  4ATG A;  3NF1 A;  5EID A;  1Y8M A;  2XGS A;  1N54 A;  2M63 A;  1HS6 A;  1N9A A;  4AP2 A;  1KZO A;  4EZL A;  5ENR D;  4GZD A;  2J49 A;  1OY3 D;  2KZT B;  4BFR A;  3OXL A;  4KVM A;  2X6K A;  1KPS B;  1TYQ G;  4G26 A;  3PZ2 A;  2CHZ A;  2IO3 C;  3D3M A;  3KSL A;  3QC1 A;  4G25 A;  4KZC A;  5ENQ D;  3DRA A;  1S63 A;  4YDE A;  1AWC B;  4DLO A;  4EEC A;  3NZS A;  5FWQ A;  1HU3 A;  1N4S A;  2NXP A;  2CG2 A;  5J90 A;  5HI7 A;  4RQI A;  4D10 C;  3CGH A;  4HOS A;  3G2U A;  3C72 A;  5HS0 A;  3FUH A;  3D9K A;  2LSV A;  3ASH A;  3T9K A;  3AG4 E;  5D2M C;  4DX2 A;  1JCR A;  2Y4T A;  2P58 C;  2UY1 B;  1UN8 A;  4AOF A;  1N11 A;  3SFZ A;  3PZ1 A;  2OV8 A;  2R17 C;  2MHK A;  4MS6 A;  4XKC A;  3L54 A;  4I6E A;  2GRM A;  3S7J A;  4B8C B;  5JMN D;  1OCZ E;  3FUN A;  3CHR A;  4AY5 A;  4ME2 A;  5AJL A;  2H6G A;  3FTZ A;  1P5Q A;  4V3I A;  2WQH A;  1PAQ A;  4KVO A;  2ILR A;  2QYU A;  1HH8 A;  4RG9 A;  2IQC A;  5KJK A;  2L0I A;  4JL0 A;  2VGX B;  2FI7 A;  4U07 A;  3WXX A;  4O60 A;  3UT4 A;  4UWK A;  1NA0 A;  3HYM B;  1PC2 A;  1G3N B;  4A1G A;  3TXM A;  3DEO A;  1EPU A;  4GB9 A;  4O6F A;  2R05 A;  4ILI A;  3V30 A;  1SQM A;  3IXE A;  1MQS A;  2R02 A;  3APD A;  2I1J A;  4HRL A;  4LCT A;  4WNE A;  3ZXS A;  4ATZ D;  1ZBP A;  1OWL A;  3TGO A;  1IHG A;  1TN8 A;  1UJJ A;  2GRR B;  1IYG A;  3C3R A;  5ANR A;  2OND A;  3ULQ A;  4RVB A;  2CHX A;  5JJ7 A;  3Q7A A;  3S7F A;  2ION A;  2BTD A;  1K3Z D;  2KBX A;  5AQ9 A;  2XGO A;  1L5J A;  4N39 A;  1B89 A;  2CFU A;  5BT1 A;  3TJP A;  1OWM A;  1NP7 A;  2FUL A;  4ACK A;  4NAC A;  3FUJ A;  4U8Y D;  4PS7 A;  4GMJ A;  3CHO A;  3FTU A;  3RU0 A;  5CRU A;  2KCL A;  2BKK B;  3IBE A;  5LP0 A;  4GZ3 A;  3ML9 A;  5KWD A;  3UI2 A;  2VQ2 A;  3QAQ A;  2XHE A;  1MX6 A;  5D0Q D;  5EDS A;  4E85 A;  4I1M A;  3DSV A;  2EIL E;  3HXE A;  3I3N A;  2H6I A;  2AXV A;  3URZ A;  2QYJ A;  4CT4 A;  4XIF A;  3ESL A;  2F37 A;  4J0U A;  5D0O D;  5ARF A;  3RIB A;  5KBA A;  2OEV A;  3FDH A;  3Q78 A;  4J8F A;  3HVE B;  3D9L A;  4H7Y A;  3MGB A;  3CVL A;  4L23 A;  1OT8 A;  3AJI A;  4I43 A;  5G04 J;  3GW4 A;  3O4Z A;  4GAA A;  4GMR A;  1JUQ A;  3T5X A;  4HRM B;  5AQA A;  2HO1 A;  3FUF A;  3ULE G;  2MOW A;  4UWG A;  2WB2 A;  4N5C A;  1LF8 A;  4I9E A;  1JWF A;  3CHS A;  2OVF A;  2RG8 A;  2F8X K;  3ABL E;  1SW6 A;  5BPP A;  2XGM A;  3DPY A;  4CDN A;  1EF1 C;  3AU4 A;  5ARG A;  4XI9 A;  5C2Y A;  5FZQ A;  4YVO A;  2WXP A;  3UUX A;  4OYS A;  1E8Y A;  4TXR A;  2PL2 A;  2P9P G;  2B0O E;  2V5F A;  2R2L A;  4A3T A;  4A55 A;  4NIK A;  4GU5 A;  5CBN A;  5FT9 A;  1E7U A;  2RFA A;  3DXK G;  4EBA G;  4ZHB A;  5AN8 A;  3L16 A;  1TNU A;  4UI9 J;  1A5E A;  3SQV A;  3CVY A;  3FH7 A;  4JZY A;  4GZC A;  5G05 J;  5FQ6 A;  5BV1 A;  5BV0 A;  1KT1 A;  4MLP A;  1HO8 A;  4G1T A;  3E30 A;  3NBN B;  4AVX A;  3B7T A;  2HE0 A;  3S7B A;  3EJN A;  3QKY A;  2C0M A;  3AS8 A;  5A6C A;  4CGV A;  3DSW A;  3TG4 A;  4CGW A;  2YHC A;  4GTM A;  3FUI A;  2JEK A;  3BU8 A;  3AS5 A;  3HHM A;  5E76 A;  5EYP F;  3MKR A;  3RJV A;  3V79 K;  1E90 A;  4LUN U;  4JC8 A;  2DCP A;  4BTA A;  4JXT A;  4GTT A;  3EHQ A;  4U0S A;  2J09 A;  3T8K A;  2IOL A;  4KYO B;  5G05 C;  4CZ2 D;  3LY8 A;  3Q75 A;  4PS3 A;  3ASG A;  2H6H A;  2BED A;  3CK8 A;  1N52 A;  3VLF A;  2Y3A A;  2ZU6 B;  3ZNG A;  1WM5 A;  3QOU A;  2RKK A;  2L0T B;  3LY7 A;  3HXB A;  4MKT A;  3CEQ A;  2I1K A;  4JEH A;  4NRH B;  4YND A;  4PUC A;  4U0Z A;  2KCV A;  3NZU A;  3KS2 A;  4DRX E;  1YA0 A;  3CLJ A;  4G11 A;  3OTN A;  2CG3 A;  3VTY A;  1MYO A;  2IU1 A;  3PE4 A;  3UIP C;  5CCL A;  4HB5 A;  4G8L A;  2HYZ A;  4GCN A;  4N2S A;  4I2Z A;  3ZU7 B;  5JHA A;  3N71 A;  3PE3 A;  5FZS A;  4FHJ A;  2DWZ A;  2X6J A;  3PZ3 A;  5KJL A;  5G04 C;  2JLB A;  1OWP A;  4U04 A;  1SA5 A;  3DSS A;  4HLE A;  2VSY A;  3RO2 A;  5CER B;  4L7T A;  1ZU2 A;  4HVB A;  2P9U G;  4TUU A;  3SI5 A;  1O5M A;  2P9K G;  3AU5 A;  4GZ6 A;  3PS6 A;  4HBD A;  4J8S A;  3QAR A;  3V2O A;  1YMP A;  1BI8 B;  5BXO A;  4OAU C;  4APO A;  1S70 B;  4PDX A;  3U66 A;  4HOQ A;  4WWP A;  4L9P A;  1TJF A;  4XX5 A;  3APC A;  4CDM A;  3OXF A;  3U64 A;  1E7V A;  3TG5 A;  3L82 A;  1KLX A;  1FPP A;  3MCX A;  2PNN A;  4Y6W A;  3O48 A;  1IKN D;  3SF4 A;  2OOE A;  5A23 A;  1SVX A;  4B94 A;  3CHP A;  1TNY A;  2V4L A;  2VTB A;  3EU9 A;  5ENO D;  1K1B A;  3PVL A;  3ZEF A;  3MZL B;  3PEU B;  4CT0 A;  2ZXW E;  3SFY A;  1IXV A;  2QFC A;  1N0Q A;  3FY4 A;  4BY6 A;  2P9S G;  4KMO A;  3ZN3 A;  3ASN E;  2X3M A;  1BD8 A;  2PQN A;  4HQD A;  4O1P A;  3QB2 A;  1O1T A;  1H2V C;  3ZW3 A;  1OUV A;  3B7R L;  3UKU G;  2MRI A;  2XZT G;  4K0R A;  2YNQ A;  3SHF A;  3S2A A;  4BET A;  4UWF A;  5AAR A;  3NOC D;  2XPY A;  2LSU A;  2ZIR A;  5FTP A;  3TWR A;  3PNL B;  4YVQ C;  3CST A;  4OVV A;  2QC9 A;  1N94 A;  2KCK A;  4URK A;  5EN5 D;  5AIJ A;  1H19 A;  2WXG A;  3CKC A;  1MZC A;  4GYO A;  4J8D A;  4EPZ A;  3HXD A;  3ZUV B;  4DJA A;  3BUA A;  3CVN A;  3CSF A;  4HXI A;  2WXL A;  3HDX A;  4EBA A;  2WXH A;  4JVS A;  3UM2 A;  3DXM G;  4AM9 A;  4E6H A;  3FP3 A;  3SBT B; 
#chains in the Genus database with same CATH homology
 2E0I A;  2IJG X;  2KZT A;  3FDH A;  2WXN A;  5BNW A;  4J8F A;  4BT8 A;  1Z3X A;  3C98 A;  3HVE B;  3D9L A;  4G2V A;  4H7Y A;  2LNI A;  1JWG A;  1SZA A;  3ESK A;  4OVU A;  3RO3 A;  3MGB A;  3CVL A;  4L23 A;  2XQ0 A;  1HFA A;  4M3O A;  4ANW A;  5EX0 A;  1UN9 A;  3SBS A;  1UW4 B;  4C0M A;  3MV3 B;  4R7L A;  3RRU A;  3ZIM A;  3FU0 A;  4I43 A;  4KBQ A;  4DI3 A;  3FEY A;  4BT9 A;  2VTB B;  3FWV A;  5G04 J;  4B89 A;  4F7A A;  3QWP A;  3UMV A;  4HOT A;  3GW4 A;  3O4Z A;  4GAA A;  3FEX A;  2AVP A;  4JHR A;  1E8X A;  3TL5 A;  2NC9 A;  2R5S A;  2A5U A;  2PM6 A;  5KJN A;  1JUQ A;  3Q4A B;  3T5X A;  3EHN A;  2I6H A;  4GCO A;  4KXK B;  2HO1 A;  3FUF A;  2L9B A;  2MOW A;  2KC7 A;  5CMY A;  3SGH A;  2WMO A;  1H6K A;  4L2L A;  3CHQ A;  3E4B A;  4LER A;  4AJW A;  5AEN A;  3FU3 A;  4UWG A;  2XRZ A;  2WB2 A;  4J8E A;  2XCB A;  2WM9 A;  5JHB A;  4N5C A;  1LF8 A;  3Q49 B;  4I9E A;  4DPR A;  1JWF A;  3CVX A;  2WXF A;  4I6J A;  3CHS A;  3FUM A;  2OVF A;  1FCH A;  2RG8 A;  4DLQ A;  3DPD A;  2FEZ A;  5BPP A;  2VSX E;  4LRZ A;  2VGY A;  2XGM A;  3ZRH A;  1H2T C;  4FC8 A;  3I4R B;  3TAX A;  1EF1 C;  4CDN A;  4I1A A;  3CVP A;  4H7X A;  5DBK A;  3AU4 A;  5ARG A;  3FTY A;  4XI9 A;  3QWW A;  5C2Y A;  3PZD A;  2V8S E;  4NQ0 A;  5G2N A;  5FZQ A;  1VDY A;  3U3W A;  4HFG A;  2XPI A;  4YVO A;  3R7Q A;  2WXP A;  3JQ1 A;  5T4Y A;  2VGX A;  4OYS A;  3UUX A;  1E8Y A;  4ABN A;  3BG0 B;  4RSY A;  3MKQ A;  5EKQ D;  4WWN A;  4Q96 A;  3T8M A;  2VJ8 A;  4FP7 A;  2PL2 A;  3PNT B;  3FFL A;  4I17 A;  3UT8 A;  2V5F A;  3ASF A;  2FF4 A;  2WPV A;  3ZPJ A;  2BUG A;  2WXI A;  1KT0 A;  4A3T A;  5LX8 A;  4A55 A;  5CMW A;  3G2V A;  3FUK A;  4ANX A;  4GU5 A;  2XEV A;  4FJZ A;  1GW6 A;  5BUZ A;  3CVQ A;  1HX8 A;  1E7U A;  4GYW A;  4WND A;  3Q15 A;  3CR3 A;  5FT9 A;  1HXI A;  1ELW A;  4C0E A;  3UX4 A;  2EQX A;  3NQP A;  3LVR E;  1ELK A;  3FTS A;  1UJK A;  1XGW A;  2AW6 A;  3LS8 A;  3MEK A;  4FHK A;  4EBA G;  3FHE A;  4APF A;  3L16 A;  4UI9 J;  3DBS A;  1IQU A;  3CVY A;  2Q7F A;  3B7U X;  2Y4U A;  3FH7 A;  4JZY A;  4GZC A;  5G05 J;  4RG6 A;  5FQ6 A;  1WAO 1;  3ENE A;  5BV1 A;  5BV0 A;  1KT1 A;  1HG2 A;  3PDN A;  4B0Z A;  3JCK C;  3RRN B;  3QK0 A;  2FO7 A;  3BG1 B;  3PH0 C;  4AIF A;  2HR2 A;  1U3C A;  4MLP A;  3LPZ A;  3GYZ A;  1HO8 A;  4JPS A;  2X6F A;  4GPK A;  4G1T A;  2KAT A;  3ZHE B;  4I6G A;  2WXQ A;  4AVX A;  2L6J A;  3B7T A;  4XI0 A;  2YIN A;  3S7B A;  4BX9 A;  2YHE A;  3EJN A;  3QKY A;  2C0M A;  3AS8 A;  5E75 A;  3CQG B;  4J6I A;  3SNX A;  4A1S A;  4IUL A;  5A6C A;  1FVF A;  2E2E A;  3VLD A;  4CGV A;  5JJT A;  2J4D A;  4HOR A;  3TG4 A;  2RD0 A;  3FU5 A;  4EZK A;  4WWO A;  4ILG A;  4JHK A;  2R59 A;  2DBA A;  4CGW A;  3OAW A;  1FVH A;  1NA3 A;  2YHC A;  4BX8 A;  1E8Z A;  3IEG A;  4P29 A;  1MHQ A;  1XNF A;  3FUI A;  1QQE A;  2JEK A;  4KZ0 A;  3UPV A;  3D9O A;  5LFA A;  3AS5 A;  2GGF A;  3HHM A;  3ONL A;  5E76 A;  3MKR A;  3RJV A;  4KT6 B;  1E90 A;  1DNP A;  4JC8 A;  4LUN U;  2DCP A;  4Q69 A;  4GA0 A;  1U3D A;  4XZ4 A;  4JXT A;  4BTA A;  4N2Q A;  3FH5 A;  3TXN A;  5JJ6 A;  3CVW A;  3UQ3 A;  2IOS A;  3L13 A;  4U0S A;  2QY7 A;  3G2W A;  4JA7 A;  2AXZ A;  2J09 A;  4NUR A;  4BSX A;  2IOL A;  3CVV A;  4GYY A;  4KYO B;  3L17 A;  3FU6 A;  4AXH A;  3CVU A;  4GML A;  4ANV A;  3AS4 A;  5G05 C;  3LY8 A;  4PS3 A;  1EDU A;  3L6A A;  3ASG A;  2J9Q A;  1INZ A;  3CK8 A;  1N52 A;  3ZYK A;  2WXM A;  3VLF A;  5T3R A;  3P1U A;  4UWL A;  2Y3A A;  3IHV A;  4ANU A;  5CCM A;  2ZU6 B;  2LO6 A;  4EQF A;  1WM5 A;  4G24 A;  4FLH A;  2WVI A;  3L22 A;  3QOU A;  4FA6 A;  4PS8 A;  4JHJ A;  3U9W A;  2L0T B;  3LY7 A;  3ONK A;  2X6H A;  3HIZ A;  3FUE A;  4UQZ A;  5DIZ A;  4U63 A;  4MKT A;  5J08 A;  3GZ2 A;  4JW1 A;  1UG3 A;  3P2B A;  3ZFW A;  3ZGQ A;  3ZYL A;  3CEQ A;  3T5V A;  2J07 A;  3MA5 A;  2I1K A;  3PEV B;  3MYV A;  2WMN A;  1W3B A;  5LCW C;  2IFU A;  4WNG A;  4ATG A;  4JEH A;  5A7D B;  4UI9 K;  3NF1 A;  3GZ1 A;  4NRH B;  1Y8M A;  2I2O A;  2XGS A;  4PUC A;  4YND A;  1TJC A;  4F1S A;  2BF0 X;  4U0Z A;  3FH8 A;  1N54 A;  2KCV A;  4C9B B;  2UWJ G;  2M63 A;  3D9N A;  1HS6 A;  3NZU A;  3KS2 A;  5G55 A;  4AP2 A;  4N3C A;  1YA0 A;  4EZL A;  3B13 A;  3IKO B;  4IRU A;  3CLJ A;  4GZD A;  4G11 A;  4XE0 A;  3UT7 A;  2J49 A;  3OTN A;  2KZT B;  2WXR A;  4BFR A;  4EZJ A;  3OXL A;  4KVM A;  2CG3 A;  2X6K A;  3VTY A;  4G26 A;  2CFZ A;  2IU1 A;  3PE4 A;  2A4Z A;  2CHZ A;  3D3M A;  3CK9 A;  1H0A A;  3QC1 A;  4G25 A;  4KZC A;  3ZYM A;  5CCL A;  3LEW A;  2C0L A;  2HYZ A;  5EX3 A;  4GCN A;  4N2S A;  3ASD A;  4I2Z A;  4DLO A;  4EEC A;  5JHA A;  3NZS A;  3N71 A;  4FUL A;  5FWQ A;  1HU3 A;  3PE3 A;  2NXP A;  2CG2 A;  3D9P A;  5FZS A;  1TEZ A;  4FHJ A;  5J90 A;  2X6J A;  2WXK A;  4LEU A;  5HI7 A;  5KJL A;  5M72 A;  4ACL A;  2AXU A;  3LKU A;  5G04 C;  4D10 C;  2JLB A;  1OWP A;  3CGH A;  4HOS A;  3B7S A;  4U04 A;  3L08 A;  3CIA A;  3G2U A;  4HLE A;  1X5B A;  3U4T A;  3R7R A;  2VSY A;  4GZ5 A;  3RO2 A;  1QZ2 A;  2XPZ A;  3FUH A;  3SZ7 A;  3D9J A;  3D9K A;  2YQ8 A;  3FTW A;  3FTV A;  4CEM A;  3LXU X;  2LSV A;  3ASH A;  4L7T A;  3MV2 B;  3HVE A;  1DVP A;  1ZU2 A;  4HVB A;  2PM7 A;  4TUU A;  3ZHE A;  2Y4T A;  3SI5 A;  2P58 C;  5FQ4 A;  5HQ8 A;  2WQ7 A;  3AU5 A;  2UY1 B;  3PRE A;  1UN8 A;  4GZ6 A;  3PS6 A;  3R9A B;  4AOF A;  4XKB A;  4J8S A;  3QAR A;  3SFZ A;  2PZI A;  4GA1 A;  4UQY A;  2OV8 A;  2R17 C;  2MHK A;  3LY9 A;  4MS6 A;  4XKC A;  4APO A;  2WQ6 A;  4A3V A;  3L54 A;  4I6E A;  5LCW J;  2LAH A;  2GRM A;  4PDX A;  3S7J A;  5KJM A;  4ILH B;  4B8C B;  3SD5 A;  3U66 A;  2WXJ A;  1EYH A;  4HOQ A;  4WWP A;  5AYW D;  3FUN A;  3LDZ A;  2DIW A;  4TV3 A;  1TJF A;  2GRL A;  2XCC A;  1E96 B;  4XX5 A;  4DI4 A;  3APC A;  5AJD A;  3CHR A;  4AY5 A;  4CDR A;  4ME2 A;  5AJL A;  4CDM A;  3OXF A;  3FTZ A;  5LOZ A;  3U64 A;  1E7V A;  1P5Q A;  4V3I A;  3TG5 A;  4F53 A;  2WQH A;  1PAQ A;  1KLX A;  2XRY A;  3D9I A;  4KVO A;  2OVB A;  3MX3 A;  2ILR A;  4K03 A;  3KAE A;  4WAF A;  1PY1 A;  4UQX A;  1HH8 A;  3G2S A;  3LYA A;  3MCX A;  4I1O B;  2LAI A;  4RG9 A;  4FAD A;  2FBN A;  3EDT B;  2IQC A;  4JA9 A;  3PRZ A;  5KJK A;  3QWV A;  3CV0 A;  4IN3 B;  1OWO A;  4L2Y A;  5ENN A;  4Y6W A;  2L0I A;  4JL0 A;  4QFV A;  4UWH A;  3IV0 A;  2VGX B;  2FI7 A;  3O48 A;  3IHY A;  4U07 A;  3WXX A;  4WUY A;  3SF4 A;  2GW1 A;  3UT4 A;  3CHM A;  2OOE A;  2WXO A;  4UWK A;  2HM8 A;  1NA0 A;  5A23 A;  5BW8 C;  3KEZ A;  3HYM B;  4CRW A;  4N3A A;  1PC2 A;  4GA2 A;  1OWN A;  3TXM A;  3CHP A;  4A1G A;  4B94 A;  1EPU A;  4F3V A;  4CCA A;  2V4L A;  3APF A;  4GB9 A;  5FQ7 A;  5KCM A;  3VTX A;  4O6F A;  2NSZ A;  4ILI A;  1WY6 A;  2VTB A;  4HS2 A;  1SQM A;  1BPO A;  1MQS A;  3APD A;  2I1J A;  3MJW A;  4LCT A;  4WNE A;  3PVL A;  4Q94 A;  3ZEF A;  3MZL B;  3PEU B;  3ZXS A;  3PUK A;  4CT0 A;  1ZBP A;  1OWL A;  3VLE A;  4TRQ A;  3TGO A;  3RRM B;  3RK6 A;  1IHG A;  1HG5 A;  1UJJ A;  2QFC A;  2VSO E;  1IYG A;  3FY4 A;  5ANR A;  4BY6 A;  3PUJ A;  4FJY A;  4KMO A;  2OND A;  3ZN3 A;  3ULQ A;  4RVB A;  1JPL A;  2AWI A;  2PQR A;  2X3M A;  2PQN A;  2CHX A;  3CKB A;  5JJ7 A;  3I5P A;  3FTX A;  3QB2 A;  4U0U A;  5T8I A;  1Z3Y A;  3S7F A;  3CQC B;  1ELR A;  1Y6I A;  1H2V C;  3ZW3 A;  5FQ8 A;  2ION A;  5CHE E;  2BTD A;  1OUV A;  2KM4 A;  3B7R L;  2I9C A;  1H2U A;  1A17 A;  2XGO A;  1QNF A;  2X6I A;  1L5J A;  2MRI A;  3JYS A;  4N39 A;  4L1B A;  3I4G A;  4K0R A;  2YNQ A;  3SHF A;  1E8W A;  1B89 A;  4AEZ C;  2C2L A;  2CFU A;  3S2A A;  1HF8 A;  1HZ4 A;  5BT1 A;  3TJP A;  4UWF A;  1OWM A;  2CHW A;  3Q5M A;  1NP7 A;  2FUL A;  2XPY A;  2LSU A;  4ACK A;  4NAC A;  3FUJ A;  4Y6C A;  5FTP A;  3EIQ C;  4I9C A;  3PNL B;  4PS7 A;  4YVQ C;  4GMJ A;  4I2W A;  4N3B A;  2IF4 A;  4B8A A;  1IQR A;  3CST A;  4OVV A;  3CHO A;  3FTU A;  5C1D A;  1Z6T A;  3S7D A;  3RU0 A;  2KCK A;  3LVQ E;  4PH4 B;  2KCL A;  3IBE A;  4URK A;  5FJY A;  5LP0 A;  4GZ3 A;  3ML9 A;  1HE8 A;  2J08 A;  5AIJ A;  1H19 A;  3K9I A;  3QJZ A;  4FU3 A;  3ZVV A;  3FUL A;  2VQ2 A;  3QAQ A;  1S0P A;  3G2T A;  2XHE A;  4MRU A;  3CK7 A;  3JQ0 A;  5D0Q D;  3QDN A;  3GZS A;  2WXG A;  3RKV A;  3CKC A;  4GYO A;  4DK5 A;  2J4B A;  3LJ3 A;  5EDS A;  4E85 A;  4I1M A;  4UI9 C;  4J8D A;  2V0P A;  4EPZ A;  3OXG A;  5FZR A;  3KD7 A;  3Q47 B;  1SZ9 A;  2VSN A;  4G23 A;  4BTB A;  1NZN A;  3I3N A;  2VYI A;  4FLB A;  4AV7 A;  4DJA A;  2AXV A;  3EHM A;  3CVN A;  4W9R A;  3URZ A;  3FUD A;  3CSF A;  4JEU A;  4HXI A;  4CT4 A;  3D9M A;  2WXL A;  4XIF A;  3BEE A;  3HDX A;  3ESL A;  4U8H A;  4WNF A;  3QNK A;  3MKQ B;  3LCA A;  4J0U A;  4BWR A;  4EBA A;  2UY1 A;  2WXH A;  3ML8 A;  2X38 A;  4IYP A;  5ANL A;  3JUI A;  4JVS A;  4HOU A;  5D0O D;  5ARF A;  4AM9 A;  4E6H A;  3FP3 A;  3RIB A;  3ZYQ A;  3SBT B;  4AY6 A;  3EIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...