3HDXA

Crystal structure of susd superfamily protein (np_809182.1) from bacteroides thetaiotaomicron vpi-5482 at 1.50 a resolution
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
474
structure length
456
Chain Sequence
b'TQQWKTLEDTRSALMGVYGLTRAALADNNTHWICGDLRKGDFTVYKRSDLQAVSDNELNKPYDLLKKVSNWRRFYAVINAASVFMEKAPRTVELDRSYSEQNLKYDIAQVRALRAFAYFYMVRIWGDVPLVTYSYDNGTFPSMPRTDAQTVLSYAKAELLTAIEDLPYQYGTQTNLYYGSYGAQWQGKLFNKLSAYSVLAHICAWQGNYAEAETYSAFIIDHASEINAKYTSIADLTSETGLFYSNASVKGSRILGFNFAGHLEQLTLAYPLVQKSYPEIYISKDSLFSIFTNFDDLRFGIIDTIKYSSYYVQNLNEETPVFSKIKIIQGVFGSSIVFTRLEDITLLRAEALCALNRSTEAVSYLNMIRTNRGLREVSFKKDFGNNRESLIAEIFEERRRELMGEGWRWYDLVRRQKLMKDNEAFLRLISSGGIYWPVSEDIITANSQIEQNEFWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SusD superfamily protein
publication title Crystal structure of SusD superfamily protein (NP_809182.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.50 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Polysaccharide binding protein
total genus 175
structure length 456
sequence length 474
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hdxA00
3CK8A 3CGHA 3JYSA 3L22A 3EHMA 5T4YA 3JQ0A 5J90A 5E76A 3NQPA 4Q69A 3FDHA 3HDXA 4F53A 5LX8A 3I4GA 3MYVA 3CK7A 4MRUA 5T3RA 4PUCA 5FQ4A 3JQ1A 5FQ6A 3SGHA 3MCXA 4F7AA 3MX3A 3P1UA 3CKCA 4L7TA 4LERA 5FQ7A 3EHNA 3CKBA 3OTNA 3CK9A 3GZSA 3EJNA 3SNXA 3QNKA 3KEZA 3LEWA 5FQ8A 5E75A 3IV0A
chains in the Genus database with same CATH superfamily
3SQVA 2P9IG 5LFAA 4UQXA 2R03A 3QDNA 1KLXA 4DI4A 4DX1A 1KZOA 1TN7A 4JEHA 5ARGA 4UI9K 3NZUA 3Q73A 4GMLA 4A3TA 3MYVA 2H6GA 5B1BE 3KAEA 3AG4E 4FJYA 2VYIA 1EPUA 2JLBA 3UT7A 1V55E 5AYWD 5T4YA 4GB9A 5CERB 3D9NA 4O60A 3W9FA 1U3DA 3CR3A 4YVQC 1TNYA 3RRMB 3D9IA 4KMOA 4PH4B 4CYMD 3KEZA 3ABME 1A17A 4JW1A 3FH8A 2DWZA 1SVXA 3UXGA 1TNOA 4HOQA 4GYWA 2J08A 3LKUA 2LUHA 2XEEA 4CGVA 2J8SD 1OWNA 5DBKA 4FULA 2GRNB 1MZCA 3CHQA 3PUKA 4JL0A 1E7VA 1EYHA 4YDEA 4JD2G 2KZTB 4OAVB 3BG1B 2WXLA 3T9KA 4HB5A 4V3IA 5FT9A 3FEYA 1INZA 3PRZA 3JXIA 3EJNA 1IHGA 3APDA 3PZDA 1WY6A 3HHMA 4JC8A 3JUIA 2PQNA 3PVLA 4GYOA 1KPSB 3E30A 3ZHEB 3AS5A 4I9EA 3DSWA 1WDYA 4JHRA 4B94A 3C5RA 3Q5MA 1O1TA 3PNTB 2BTDA 4N39A 5CEAA 4O6FA 4J8SA 1LD7A 3TJPA 4U0ZA 2LSUA 5CCMA 4C0EA 4MRUA 2P9LG 4YNDA 2XCBA 4AXHA 1OWMA 3AAAC 4EZJA 2ZGGA 3UINC 4YVOA 2YHEA 2ETAA 1EF1C 1N9AA 5A7DB 3G2SA 3UI2A 3ZXSA 4FA6A 5JHBA 1BLXB 3O48A 2VSXE 4RLYA 3Q4AB 1IKND 4AEZC 4EQFA 2AXVA 4WWNA 5AQAA 5FZSA 2LXMA 5HQ8A 2WXHA 3CK8A 4HFGA 3V30A 2E0IA 2AJAA 3AU4A 1K3ZD 4A3VA 3ESLA 3R9AB 4LG6A 2BF0X 4NURA 3GYZA 3FTYA 2LAIA 5FJYA 3ML8A 3UM3A 4CDNA 2C0LA 2DVWA 3ASHA 3L22A 2OV8A 4TUMA 4I6EA 3RRNB 3D9HA 4GTTA 4K03A 4PDXA 3ONKA 2UY1B 4TXRA 3PEVB 4ABNA 4F7AA 2PM6A 2V4HC 1E8YA 2FEZA 3V2XA 2FF4A 4B0ZA 2H6HA 3ABLE 4H7XA 3CVLA 3UQ3A 3SBSA 1ELWA 2R2LA 2VJ8A 4RG6A 3T5VA 3ZVVA 3S7FA 4HRMB 1ELKA 1U2VG 3CVQA 3P1UA 5JMND 2Y0BG 3ZYQA 3GZ1A 2R02A 3U9WA 3FUIA 3TGOA 4MKTA 3EDTB 3Q75A 3NQPA 1BPOA 1UW4B 2R5SA 3AG3E 2CHZA 5LCWC 1NA0A 4HS2A 4JA9A 3OTNA 2IFUA 3CHRA 3CHOA 4N2SA 4N3CA 4EBAG 3DSTA 4GZ3A 3NAWA 1D8DA 3CVXA 4OVVA 3E32A 4GA1A 2WXPA 4NRHB 1Y6IA 3DRAA 5LP0A 2I9CA 1HH8A 3SNXA 3LCAA 3BU8A 1HG5A 1SQMA 4G2VA 3RKVA 3QWVA 3NOCD 2QYJA 3D9PA 3E4BA 2WXOA 3R7RA 3RSEG 2DBAA 4FHJA 3ZKJA 3R7QA 4GTQA 5EX3A 3Q15A 4GU5A 5G04C 4FJZA 3EUVA 2DCPA 2I1KA 3L54A 4Y6WA 2DIWA 1OWOA 3HIZA 5KJKA 1IYGA 3IHYA 2RKKA 1QZ2A 2X3MA 5BXUA 1H6PA 4EBAA 1FCHA 1NZNA 4LNUD 4J6IA 3MCXA 3GW4A 3ASDA 1UJJA 4RQIA 3PE4A 4ZFHA 3FP3A 1OCZE 2GRRB 5H7PA 4B93B 1O5MA 4XX5A 1XNFA 1YA0A 4J8FA 3JCKC 4BEPA 2ETBA 1Z3XA 2NYJA 5ENOD 5LCWJ 5BUZA 3G2TA 5EYLA 4AY6A 3DPDA 3FEXA 3MKRA 4WUYA 1D9SA 3EIQC 3AG1E 4WAFA 1PAQA 4GZ5A 3TWUA 3CVWA 1AP7A 5IY5E 5EYPF 3VLFA 3EHNA 3CK9A 3JUEA 3NB2A 4KZCA 4HOUA 1Y8MA 3QJZA 4U8VD 3Q7FA 3CSFA 3B95A 1JWFA 3J5PA 1RW2A 2EILE 2XS8A 2OVFA 3G2VA 2RFAA 1QQEA 1NL4A 4LERA 2IQCA 3DSUA 4HBDA 5G04J 3LVQE 2XGOA 1BI8B 3L6AA 3ENEA 2IO2C 2PL2A 1XGWA 3L16A 5KJNA 3U4TA 3QARA 2IU1A 1YMPA 4CDMA 4TUUA 1TR4A 5J08A 3SZ7A 1EDUA 2VGYA 3T8KA 5JJ6A 2ZISA 2NC9A 4IN3B 2WQ6A 3IHVA 5E76A 5AJLA 1PY1A 4UI9J 5BNWA 2VGXB 4ME2A 3Q9NC 3ASNE 2L6BA 4GA0A 2EIME 3LS8A 1KT1A 2OEVA 3CVYA 2HR2A 5BPPA 2FBNA 2F8YA 2X6HA 2AXUA 2XEVA 3FU0A 2BEDA 4FADA 4ATGA 2P9NG 4Y6CA 3LY8A 2X6KA 5T8IA 4BT8A 3CKBA 4JHKA 5FQ8A 1JUQA 3ZYMA 5CHEE 3SO8A 3EHMA 1OCOE 1UN9A 3QC1A 5HRYA 4MLPA 3S7JA 3FUNA 1DCQA 3LXUX 5CBOA 1JWGA 3TWXA 4BTBA 4PS3A 2YHCA 3LEWA 2P9UG 3QAQA 4G24A 4BX8A 1N52A 3DSVA 3HRAA 3DPYA 1JPLA 4IRUA 1FT1A 3LVRE 1O1SA 1N4PA 3ABKE 3CV0A 3C3QA 4L7TA 3CKCA 2C2LA 3UMVA 3HXEA 2WXFA 4CT0A 2KCVA 5AN8A 3DEPA 5C2YA 2WQ7A 3PZ1A 2NSZA 4U0UA 5CCLA 4I1MA 2OOEA 3HVEB 1TN8A 4I9CA 3UIOC 4LUNU 4U04A 1P5QA 5A6CA 3GZSA 2Q7FA 3BQOA 4G11A 4NQ0A 1UJKA 1N4SA 4XKCA 4I2WA 3HDXA 4APFA 3Q79A 2DZOA 1UN8A 3QB2A 2KZTA 2X38A 2EIKE 5BXOA 2RFMA 3MKQB 4IULA 5AQ9A 4LNBA 4HQDA 3AS4A 5HKPA 5EIDA 5FZRA 2OVBA 3MEKA 4BT9A 3MGBA 4JA7A 5EILA 3ZHEA 1HU3A 1DC2A 3FUJA 2HYZA 1K1AA 3RRUA 4D10C 4F1SA 2IOLA 5ENSD 1ELRA 4U0SA 2J9QA 5FTPA 1OWPA 2LSVA 2J07A 5KCMA 2J4BA 4GMJA 1E96B 3ISMC 4HI9A 5FIOA 4GYYA 2J4DA 5AQ7A 4CRWA 4OYSA 1TEZA 3L82A 3G2WA 3SFZA 2KCLA 4F6RD 4FHKA 5ENNA 2WXJA 4JB8P 4YDWA 3V31A 3FUHA 4CCAA 2ZIRA 4U8YD 4XE0A 4ZHBA 4GTSA 2KCKA 3IEGA 3PS6A 3AS8A 3B7RL 1NA3A 1BU9A 4JPSA 1ZU2A 3DXKG 2WMNA 3AU5A 2XZDG 4DX5D 4M3OA 3ZU7B 1O1RA 2A5UA 4GA2A 2LXLA 4CDRA 1E8ZA 4L2YA 5ARFA 2XGSA 3FH5A 4C48B 3CVNA 4ACLA 2ETCA 5T3RA 4BY6A 4PUCA 2WXNA 5EIBE 3IKOB 2UY1A 3UM1A 3E37A 3UKUG 4B8CB 3KD7A 3B7SA 4LCTA 5M72A 2P9PG 2ILRA 4ANUA 1YCSB 2JABA 2WMOA 3TL5A 1IXVA 4HOTA 4WWPA 2WB2A 5G05C 2Y4TA 1OY3D 3BEEA 2EIJE 2WXIA 4ACKA 2M63A 1S70B 3ASFA 3CHPA 4WNEA 2V4LA 3T8MA 3UUXA 3I5PA 2XPZA 2XPYA 4GMRA 3ZNGA 4ILGA 1SZAA 2QY7A 2I1JA 3MV2B 5EX0A 4DRXE 2KATA 4XIFA 3RAUA 3C3OA 4AIFA 3ZRHA 3G2UA 4GTVA 3I4GA 1JCQA 1NP7A 3FTXA 4I6GA 4UWKA 3TG4A 1H6KA 3ZFWA 2FO1E 4NACA 5D0OD 4DLQA 2A4ZA 4J8EA 4JVSA 2R17C 1OCRE 4HLEA 4CZ2D 1NI1A 4GTOA 5CBNA 4I6JA 2DYRE 1OUVA 2Y3AA 4U95D 1TN6A 1QYMA 1S63A 5ANRA 3ULQA 4QQIA 1IQUA 1L5JA 1HF8A 4MS6A 1PC2A 2BUGA 2PNNA 4I2ZA 1SA4A 4FU3A 2CG2A 1MQSA 4L9PA 4H7YA 3UT4A 1HO8A 3ZEFA 5G2NA 3R9MA 3C3RA 3JQ1A 1X81A 3CQGB 4O1PA 3Q47B 3VLEA 4K5BA 4GZCA 4U07A 3D9KA 4WNDA 3ZIMA 4J8YA 2F37A 4K0RA 4U8HA 2DZNA 1IHBA 3PDNA 3TXMA 4KXKB 3AJIA 3U3WA 4WWOA 3ZN3A 4BSXA 2X6FA 1FPPA 4HORA 3K9IA 1E8WA 3TWSA 3PE3A 1HXIA 1MX6A 4JXTA 1JCRA 4ILIA 3FUDA 4I17A 5FINA 1H2TC 3X2QE 3B7TA 2LNIA 4AVXA 3O4ZA 3CSTA 4L23A 3LPZA 2KC7A 3DSXA 4G8KA 4DK5A 4DX7D 2WXQA 2XENA 2F0YA 2EINE 4UWFA 4IYPA 2IJGX 3CQCB 4RVBA 3EIJA 3V2OA 4AM9A 4G26A 1E7UA 4XKBA 4CT4A 2XHEA 2XCCA 3U64A 1N0RA 3CGHA 3EU5A 1ZB1A 4AY5A 4UWHA 2P2CP 4AOFA 5D0QD 4EZLA 2IEJA 3KSLA 4N3AA 5ANLA 2WXGA 2VGXA 4G25A 3PZ4A 4Q94A 3L13A 4J8DA 3HXDA 4XEIG 3OXGA 3ULYA 3Q78A 5FWQA 3V79K 4Q69A 2P9SG 5A23A 1YYHA 4A1GA 1GW6A 3CHSA 3CVPA 2GRMA 3DSSA 5CECB 3CLJA 3UT8A 4F1PA 3JYSA 1S64A 3SF4A 4DPRA 5EKQD 3PNLB 1HS6A 4RSYA 2XRZA 3NOGD 1IQRA 5AQBA 3APFA 1Z5SC 4XI9A 2LO6A 2ZXWE 3SGHA 1UG3A 1K1BA 2UWJG 4AJWA 4AV7A 3Q7AA 2QC9A 4FC8A 2AW6A 3KS2A 3RO3A 2FO7A 3I3NA 3I4RB 4UWLA 4MBGA 3ONLA 2Y69E 3JXJA 3URZA 2R59A 1HZ4A 4UQYA 4OAUC 3FTZA 3LY9A 4K5CA 4TRQA 4FP7A 3HYMB 3PUJA 3MJWA 2J49A 2P9KG 3FU5A 3PEUB 2QFCA 4JEUA 1FVHA 4GPKA 5DIZA 3HXBA 4BSZB 4KT6B 4C0MA 1OXJA 2V5FA 3EHQA 3ZYLA 3MX3A 3CHMA 4N3BA 3HVEA 2MOWA 1TNBA 4DX6D 4HRNA 2FULA 3SBTB 5ENQD 4N5QA 1MJ0A 2XRYA 3TAXA 2B6CA 3J5QB 1BD8A 1OT8A 4HI8A 5CMYA 4GTMA 3MKQA 1K8KG 3AG2E 2A5EA 2ONDA 3CK7A 3UX4A 1Z6TA 3U66A 2Y4UA 5JJTA 3MA5A 2IOSA 4APOA 5BV1A 4JZYA 3RIBA 3PZ3A 4ANVA 2YQ8A 3RK6A 4G23A 5D66A 2GRQB 1Z3YA 1MX4A 2ZGDA 3LY7A 2QZAA 3CVVA 4BERA 1A5EA 4BWRA 1HE8A 3QNKA 1N54A 2RG8A 2XGMA 2XS1A 3TWRA 5JA4D 3FWVA 4HXIA 4L1BA 4I43A 3F6QA 3D9OA 3APCA 1MHQA 1OCCE 4GTPA 3E34A 1TYQG 2WM9A 3ML9A 2GW1A 3NZSA 3DEOA 2VTBA 3PZ2A 2WXMA 3UKRG 2X6IA 1NFIE 3PREA 1V54E 1WAO1 5CMWA 5FZQA 3FFLA 3QWWA 2EQXA 3LDZA 2KXPC 1UOHA 2MRIA 4U7EB 4JHJA 4F3VA 4RG9A 3D9LA 2VTBB 3D9MA 1B89A 5EN5D 1VDYA 4U63A 5CRUA 5BV0A 2XPIA 4KVMA 2E2EA 4HVBA 2V8SE 4B89A 2KM4A 5AENA 3DBSA 4ATZD 3NF1A 1N4RA 4GCOA 4LNGA 3FTVA 4DJAA 3IXEA 3WG7E 3W9GA 1LF8A 4G1TA 3UM2A 3L08A 2ZU6B 5KBAA 4TXPA 1E8XA 4ANXA 2YNQA 4TV3A 2AVPA 2VQ2A 3SHFA 2V5QC 1N4QA 2H6IA 2BKGA 5KWDA 2IONA 2MHKA 4HOSA 3BG0B 3PH0C 3S7DA 3QKYA 5FQ4A 3ESKA 4R7LA 4BESA 5LOZA 3CVUA 3SY2A 3FU6A 3B7BA 1G3NB 4KBQA 3IV0A 4N5CA 2H6FA 4GPMA 3E33A 3TWTA 3SFXA 4EHMA 4KZ0A 2GRPB 2AXZA 4M7CA 5LX8A 3WXXA 1H19A 2WXRA 5KJLA 3FH7A 1LTXA 1HX8A 1KZPA 1HFAA 3LJNA 3CIAA 2RD0A 3GZ2A 4P29A 2OCCE 4LEUA 4WNFA 4FLBA 2F8XK 3TXNA 1W3BA 5BW8C 4O1OA 1QBQA 4AP2A 2I2OA 2B0OE 5CEDB 3ZW3A 3ZGQA 5ITZF 4EPZA 2WVIA 4URKA 4GTRA 2KBXA 4W9RA 5C1DA 2JEKA 1SW6A 2I6HA 5AAOA 2WPVA 3ZPJA 2C0MA 2WXKA 4U96D 3RO2A 5E75A 4GZ6A 5JJ7A 4K5AB 2NXPA 5HS0A 4L2LA 3FDHA 2R05A 1WM5A 3EHRA 3SFYA 1FT2A 4BETA 2V0PA 4HNAD 1DCEA 4CGWA 3FTWA 2VSYA 4BFRA 4X8QA 3HXFA 2VGEA 2X6JA 4Z68A 3Q49B 1Q2ZA 2IF4A 3SI5A 3FUFA 4EZKA 1SZ9A 3ASGA 3FUEA 4A55A 4DLOA 5AJDA 4A63B 3KSQA 1X5BA 3HXCA 3ZXPA 1H6OA 2IO3C 1S0PA 4BX9A 4GAAA 1H0AA 2Y1LE 5D2MC 5G05J 2PM7A 3FUKA 1N94A 4G8LA 4UUCA 3KEAA 2XEHA 3FY4A 1LD8A 3IBEA 4E6HA 1RZ4A 1BI7B 3TWVA 5J90A 2CG3A 4YDOA 3LJ3A 2QYUA 4HLLA 4PS8A 3UM0A 4DI3A 3RJVA 3S7BA 1MYOA 5ENPD 1TNZA 3DWLG 4XI0A 3OAWA 4UI9C 3QK0A 1QNFA 3UTMA 1D8EA 3FTUA 5KJMA 2GGFA 4LRZA 2CFUA 4GZDA 2WQHA 4B8AA 5CRVA 5KNHD 2XQ0A 4KVOA 2VSOE 3SD5A 3QOUA 1N0QA 2L6JA 1U3CA 1HG2A 2PQRA 3FTSA 2P58C 3CEQA 5HI7A 3B7UX 3D9JA 1DNPA 1TJFA 4FLHA 3MV3B 1ZBPA 1DVPA 3VTYA 4YDYA 4N2QA 3FU3A 4ILHB 4BTAA 5G55A 3S2AA 4NIKA 4Q96A 3UPVA 2MYOA 3Q9UC 1FVFA 4UQZA 5AARA 3C72A 3C98A 4HRLA 3MZLB 4A1SA 5B3SE 2HE0A 4QFVA 3JQ0A 2LAHA 1SA5A 1N11A 3L9TA 1TJCA 1KT0A 2L0IA 4J0UA 4OVUA 4C9BB 2DYSE 3VLDA 2J09A 4I1OB 5AIJA 4PS7A 1JCSA 5BT1A 2CFZA 5B1AE 4GCNA 3HG0D 4CEMA 3ULEG 1AWCB 3FUMA 3BUAA 1MX2A 2L0TB 3FULA 4EECA 3L17A 2IY0C 2VSNA 3ZUVB 5JHAA 1OWLA 2L9BA 2FI7A 3OXLA 1WG0A 3RU0A 3QWPA 4DUIA 5FQ6A 2AWIA 3DXMG 4I1AA 1N95A 2GRLA 3UIPC 2HM8A 5KNGA 3NBNB 3LYAA 4UWGA 2CHXA 3VTXA 3FHEA 1E90A 2PZIA 5ENTD 4TXQA 4DX2A 4E85A 3TWQA 5EDSA 2HO1A 3OXFA 3EU9A 3N71A 4J7WA 4XZ4A 5ENRD 2XZTG 4LSZE 2CHWA 4F53A 3T5XA 3TWWA 2GROB 3TG5A 3P2BA 3ASOE 3ZYKA 1H2UA 4WNGA 2OEWA 5FQ7A 3D3MA 4KYOB 1H2VC 1TNUA 2YINA 2BKKB 4ANWA 3B13A
chains in the Genus database with same CATH topology
4KVMA 4HOUA 2E2EA 5LFAA 4UQXA 1Y8MA 3QJZA 2V8SE 1KLXA 3QDNA 4HVBA 4DI4A 4B89A 2KM4A 3CSFA 4J8EA 4JVSA 5AENA 2R17C 1JWFA 3DBSA 4HLEA 4JEHA 5ARGA 4UI9K 3NZUA 4GMLA 4A3TA 3MYVA 4I6JA 1OUVA 2Y3AA 2OVFA 3G2VA 5ANRA 1QQEA 3ULQA 3KAEA 4LERA 2IQCA 4FJYA 1IQUA 3NF1A 1L5JA 4GCOA 1HF8A 2VYIA 3FTVA 4MS6A 1PC2A 2BUGA 1EPUA 2JLBA 3UT7A 5G04J 3LVQE 4DJAA 2XGOA 3L6AA 4I2ZA 5AYWD 5T4YA 4GB9A 4FU3A 2CG2A 1MQSA 3ENEA 3D9NA 2PL2A 1XGWA 3L16A 5KJNA 1U3DA 4H7YA 3CR3A 1LF8A 3QARA 4YVQC 3U4TA 3UT4A 4G1TA 1HO8A 3RRMB 3ZEFA 5G2NA 2IU1A 3D9IA 3JQ1A 3L08A 4CDMA 2ZU6B 3CQGB 4TUUA 4KMOA 1E8XA 4ANXA 3Q47B 2YNQA 5J08A 4TV3A 1EDUA 3SZ7A 2VGYA 4PH4B 2AVPA 3KEZA 3VLEA 2VQ2A 1A17A 5JJ6A 3SHFA 4JW1A 4GZCA 3FH8A 2NC9A 4IN3B 2WQ6A 4U07A 3D9KA 4WNDA 3IHVA 5E76A 2IONA 2MHKA 3ZIMA 4HOSA 3BG0B 4K0RA 3PH0C 4HOQA 5AJLA 1PY1A 4GYWA 3S7DA 2J08A 4UI9J 3LKUA 4U8HA 3TXMA 3PDNA 5BNWA 4CGVA 4KXKB 2VGXB 3U3WA 4ME2A 1OWNA 4WWOA 4GA0A 3QKYA 5FQ4A 3ESKA 5DBKA 4R7LA 3ZN3A 4BSXA 2X6FA 5LOZA 3CVUA 3LS8A 1KT1A 3FU6A 3CVYA 2HR2A 4KBQA 5BPPA 4FULA 3IV0A 4HORA 4N5CA 2FBNA 3K9IA 1E8WA 3CHQA 3PUKA 2X6HA 4KZ0A 2AXUA 2AXZA 4JL0A 1E7VA 1EYHA 2XEVA 2KZTB 3PE3A 5LX8A 3WXXA 3FU0A 1H19A 2WXRA 1HXIA 3FH7A 4JXTA 5KJLA 3BG1B 4FADA 1HX8A 2WXLA 1HFAA 4ATGA 4Y6CA 3LY8A 2X6KA 4V3IA 5T8IA 5FT9A 3FEYA 1INZA 4ILIA 4BT8A 3CKBA 3PRZA 3CIAA 3FUDA 4I17A 3EJNA 1IHGA 2RD0A 3GZ2A 4JHKA 5FQ8A 4P29A 4LEUA 1H2TC 1JUQA 4FLBA 4WNFA 3APDA 3ZYMA 3TXNA 5CHEE 3PZDA 1W3BA 3B7TA 3EHMA 5BW8C 1WY6A 1UN9A 3QC1A 3HHMA 2LNIA 4MLPA 4JC8A 4AVXA 3JUIA 4AP2A 3O4ZA 2I2OA 2PQNA 3CSTA 3PVLA 3LPZA 4GYOA 4L23A 3S7JA 3ZW3A 3ZGQA 3FUNA 3ZHEB 2WVIA 3AS5A 3LXUX 4I9EA 2KC7A 4EPZA 4URKA 4DK5A 2WXQA 4W9RA 4JHRA 5C1DA 1JWGA 4B94A 2JEKA 2I6HA 2WPVA 3ZPJA 4PS3A 4BTBA 3Q5MA 2YHCA 2C0MA 2WXKA 3LEWA 3RO2A 5E75A 4GZ6A 4UWFA 3PNTB 5JJ7A 2BTDA 2IJGX 3CQCB 4IYPA 3QAQA 4N39A 4G24A 4RVBA 2NXPA 4BX8A 1N52A 3EIJA 4O6FA 4L2LA 4J8SA 3FDHA 1JPLA 4IRUA 3TJPA 3LVRE 4U0ZA 2LSUA 4AM9A 5CCMA 4C0EA 4MRUA 4G26A 1E7UA 4XKBA 4CT4A 4YNDA 3CV0A 1WM5A 2XCBA 4AXHA 4L7TA 3CKCA 2C2LA 1OWMA 3UMVA 2XHEA 4EZJA 2V0PA 2XCCA 3U64A 4CGWA 2WXFA 3FTWA 2VSYA 4YVOA 4CT0A 4BFRA 2YHEA 3CGHA 2X6JA 2KCVA 3Q49B 1EF1C 5A7DB 4UWHA 3G2SA 5C2YA 3ZXSA 4AY5A 4FA6A 4AOFA 2WQ7A 2IF4A 3SI5A 2NSZA 4U0UA 3FUFA 5CCLA 4I1MA 5JHBA 4EZKA 2OOEA 3O48A 1SZ9A 3ASGA 3FUEA 4A55A 4DLOA 5D0QD 2VSXE 4EZLA 5AJDA 1X5BA 3HVEB 3Q4AB 4N3AA 4AEZC 1S0PA 5ANLA 4I9CA 4LUNU 2WXGA 4BX9A 2VGXA 4EQFA 4U04A 4GAAA 1P5QA 4G25A 5A6CA 1H0AA 2AXVA 3GZSA 2Q7FA 4Q94A 4WWNA 5FZSA 3L13A 4J8DA 5HQ8A 2WXHA 3CK8A 4HFGA 4G11A 3OXGA 4NQ0A 2E0IA 5G05J 3AU4A 5FWQA 1UJKA 2PM7A 4XKCA 4A3VA 4I2WA 4Q69A 5BV0A 3HDXA 3FUKA 3ESLA 2XPIA 4APFA 3R9AB 1UN8A 2BF0X 5A23A 4A1GA 3QB2A 2KZTA 3FY4A 1GW6A 2X38A 3CHSA 3CVPA 2GRMA 4NURA 3MKQB 3GYZA 3CLJA 3FTYA 2LAIA 3IBEA 5FJYA 3UT8A 4IULA 3ML8A 4E6HA 4CDNA 2C0LA 3AS4A 3ASHA 3JYSA 3L22A 2OV8A 5J90A 4I6EA 2CG3A 3RRNB 4K03A 3SF4A 4DPRA 5EKQD 5FZRA 4PDXA 3PNLB 3LJ3A 2OVBA 3ONKA 3MEKA 1HS6A 4RSYA 4PS8A 2UY1B 2XRZA 4BT9A 1IQRA 3APFA 3PEVB 4DI3A 3RJVA 3MGBA 2LO6A 4JA7A 4XI9A 3S7BA 4ABNA 3SGHA 4F7AA 1UG3A 3ZHEA 1HU3A 2PM6A 3FUJA 2UWJG 4AJWA 4AV7A 1E8YA 2FEZA 2HYZA 4XI0A 4FC8A 3OAWA 4UI9C 3RRUA 4D10C 2AW6A 2FF4A 3KS2A 3QK0A 3RO3A 4B0ZA 4F1SA 2IOLA 1QNFA 4H7XA 3CVLA 2FO7A 3I3NA 3I4RB 4UWLA 1ELRA 3ONLA 4U0SA 3SBSA 3UQ3A 2J9QA 5FTPA 1ELWA 3FTUA 2VJ8A 4RG6A 3T5VA 5KJMA 2GGFA 3URZA 3ZVVA 3S7FA 2R59A 4LRZA 2CFUA 1OWPA 1HZ4A 4GZDA 1ELKA 2WQHA 4UQYA 4B8AA 3CVQA 3P1UA 2LSVA 2XQ0A 2J07A 4KVOA 5KCMA 3FTZA 3LY9A 4TRQA 2J4BA 4GMJA 2VSOE 4FP7A 3SD5A 1E96B 3HYMB 3QOUA 3PUJA 3MJWA 2J49A 2L6JA 3GZ1A 3U9WA 3ZYQA 3FUIA 2J4DA 3FU5A 4GYYA 3TGOA 3PEUB 1U3CA 1HG2A 2PQRA 2QFCA 3EDTB 3FTSA 4MKTA 2P58C 3CEQA 4CRWA 4JEUA 4OYSA 1TEZA 1FVHA 3NQPA 5HI7A 3B7UX 1BPOA 1UW4B 5DIZA 3D9JA 4GPKA 1DNPA 1TJFA 4FLHA 2R5SA 4KT6B 3MV3B 4C0MA 2CHZA 1ZBPA 1DVPA 5LCWC 3G2WA 1NA0A 3SFZA 3VTYA 2V5FA 4HS2A 3ZYLA 2KCLA 4N2QA 3FU3A 4FHKA 4ILHB 5ENNA 2WXJA 3MX3A 4JA9A 4BTAA 5G55A 3S2AA 3CHMA 3OTNA 4N3BA 4Q96A 2IFUA 3HVEA 3CHRA 3CHOA 2MOWA 3FUHA 4CCAA 4N2SA 3UPVA 4XE0A 1FVFA 2KCKA 3IEGA 2FULA 3PS6A 3AS8A 4N3CA 3B7RL 4UQZA 3SBTB 4EBAG 1NA3A 4GZ3A 4JPSA 2XRYA 1ZU2A 3TAXA 3CVXA 4OVVA 4GA1A 2WXPA 3C98A 4NRHB 2WMNA 1Y6IA 3MZLB 4A1SA 5CMYA 5LP0A 2I9CA 1HH8A 3SNXA 3LCAA 3AU5A 4QFVA 4M3OA 3MKQA 2A5UA 1HG5A 1SQMA 4GA2A 4G2VA 3RKVA 3QWVA 3JQ0A 4CDRA 2LAHA 1E8ZA 4L2YA 5ARFA 3D9PA 2XGSA 3FH5A 3E4BA 1TJCA 1KT0A 2L0IA 4J0UA 2WXOA 4OVUA 4C9BB 3R7RA 3VLDA 2ONDA 3CVNA 2J09A 4ACLA 4I1OB 2DBAA 4FHJA 5AIJA 3R7QA 4PS7A 5EX3A 3CK7A 5T3RA 3Q15A 4BY6A 4PUCA 5BT1A 3UX4A 4GU5A 2CFZA 5G04C 1Z6TA 4FJZA 2WXNA 3IKOB 2UY1A 4GCNA 4CEMA 3U66A 2Y4UA 2DCPA 3FUMA 5JJTA 4B8CB 3KD7A 3MA5A 2IOSA 2I1KA 3L54A 4APOA 3B7SA 4Y6WA 4LCTA 2DIWA 4JZYA 5BV1A 1OWOA 5M72A 3RIBA 4ANVA 3HIZA 5KJKA 2YQ8A 1IYGA 2L0TB 3FULA 4EECA 3IHYA 2ILRA 3L17A 2VSNA 4ANUA 3RK6A 4G23A 5JHAA 1OWLA 2L9BA 1Z3YA 2WMOA 1QZ2A 2FI7A 2X3MA 3OXLA 4EBAA 3RU0A 1FCHA 1NZNA 3QWPA 3LY7A 3TL5A 4HOTA 4J6IA 3CVVA 4WWPA 5FQ6A 3MCXA 2WB2A 5G05C 4BWRA 1HE8A 2AWIA 3QNKA 2Y4TA 1N54A 4I1AA 3GW4A 3ASDA 2RG8A 1UJJA 2XGMA 3BEEA 2GRLA 3PE4A 2WXIA 2HM8A 3FP3A 4ACKA 2M63A 3FWVA 4HXIA 4L1BA 4I43A 3ASFA 4XX5A 3D9OA 3APCA 3CHPA 1XNFA 1MHQA 1YA0A 4WNEA 4J8FA 3JCKC 2V4LA 3T8MA 1Z3XA 3UUXA 3LYAA 3I5PA 4UWGA 2CHXA 3VTXA 3FHEA 2WM9A 5LCWJ 5BUZA 2XPZA 3G2TA 3ML9A 1E90A 2XPYA 2GW1A 2PZIA 4ILGA 1SZAA 2QY7A 4E85A 2I1JA 3NZSA 3MV2B 3DPDA 4AY6A 3FEXA 5EDSA 2HO1A 2VTBA 5EX0A 3MKRA 4WUYA 3OXFA 2KATA 2WXMA 2X6IA 4XIFA 3PREA 3N71A 4AIFA 1WAO1 4XZ4A 3ZRHA 3EIQC 5FZQA 5CMWA 3FFLA 3G2UA 2CHWA 3QWWA 2EQXA 4F53A 4WAFA 3LDZA 3T5XA 1PAQA 4GZ5A 3I4GA 2MRIA 3TG5A 3CVWA 3P2BA 1NP7A 3ZYKA 4JHJA 3FTXA 1H2UA 4I6GA 4UWKA 4WNGA 3TG4A 4RG9A 4F3VA 3VLFA 5FQ7A 3D9LA 3EHNA 1H6KA 3D3MA 2VTBB 3D9MA 1B89A 3CK9A 4KYOB 3ZFWA 1VDYA 4NACA 1H2VC 4U63A 2YINA 5D0OD 4KZCA 4DLQA 2A4ZA 4ANWA 3B13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK8 A;  3CGH A;  3JYS A;  3L22 A;  3EHM A;  5T4Y A;  3JQ0 A;  5J90 A;  5E76 A;  3NQP A;  4Q69 A;  3FDH A;  3HDX A;  4F53 A;  5LX8 A;  3I4G A;  3MYV A;  3CK7 A;  4MRU A;  5T3R A;  4PUC A;  5FQ4 A;  3JQ1 A;  5FQ6 A;  3SGH A;  3MCX A;  4F7A A;  3MX3 A;  3P1U A;  3CKC A;  4L7T A;  4LER A;  5FQ7 A;  3EHN A;  3CKB A;  3OTN A;  3CK9 A;  3GZS A;  3EJN A;  3SNX A;  3QNK A;  3KEZ A;  3LEW A;  5FQ8 A;  5E75 A;  3IV0 A; 
#chains in the Genus database with same CATH topology
 3SQV A;  2P9I G;  5LFA A;  4UQX A;  2R03 A;  3QDN A;  1KLX A;  4DI4 A;  4DX1 A;  1KZO A;  1TN7 A;  4JEH A;  5ARG A;  4UI9 K;  3NZU A;  3Q73 A;  4GML A;  4A3T A;  3MYV A;  2H6G A;  5B1B E;  3KAE A;  3AG4 E;  4FJY A;  2VYI A;  1EPU A;  2JLB A;  3UT7 A;  1V55 E;  5AYW D;  5T4Y A;  4GB9 A;  5CER B;  3D9N A;  4O60 A;  3W9F A;  1U3D A;  3CR3 A;  4YVQ C;  1TNY A;  3RRM B;  3D9I A;  4KMO A;  4PH4 B;  4CYM D;  3KEZ A;  3ABM E;  1A17 A;  4JW1 A;  3FH8 A;  2DWZ A;  1SVX A;  3UXG A;  1TNO A;  4HOQ A;  4GYW A;  2J08 A;  3LKU A;  2LUH A;  2XEE A;  4CGV A;  2J8S D;  1OWN A;  5DBK A;  4FUL A;  2GRN B;  1MZC A;  3CHQ A;  3PUK A;  4JL0 A;  1E7V A;  1EYH A;  4YDE A;  4JD2 G;  2KZT B;  4OAV B;  3BG1 B;  2WXL A;  3T9K A;  4HB5 A;  4V3I A;  5FT9 A;  3FEY A;  1INZ A;  3PRZ A;  3JXI A;  3EJN A;  1IHG A;  3APD A;  3PZD A;  1WY6 A;  3HHM A;  4JC8 A;  3JUI A;  2PQN A;  3PVL A;  4GYO A;  1KPS B;  3E30 A;  3ZHE B;  3AS5 A;  4I9E A;  3DSW A;  1WDY A;  4JHR A;  4B94 A;  3C5R A;  3Q5M A;  1O1T A;  3PNT B;  2BTD A;  4N39 A;  5CEA A;  4O6F A;  4J8S A;  1LD7 A;  3TJP A;  4U0Z A;  2LSU A;  5CCM A;  4C0E A;  4MRU A;  2P9L G;  4YND A;  2XCB A;  4AXH A;  1OWM A;  3AAA C;  4EZJ A;  2ZGG A;  3UIN C;  4YVO A;  2YHE A;  2ETA A;  1EF1 C;  1N9A A;  5A7D B;  3G2S A;  3UI2 A;  3ZXS A;  4FA6 A;  5JHB A;  1BLX B;  3O48 A;  2VSX E;  4RLY A;  3Q4A B;  1IKN D;  4AEZ C;  4EQF A;  2AXV A;  4WWN A;  5AQA A;  5FZS A;  2LXM A;  5HQ8 A;  2WXH A;  3CK8 A;  4HFG A;  3V30 A;  2E0I A;  2AJA A;  3AU4 A;  1K3Z D;  4A3V A;  3ESL A;  3R9A B;  4LG6 A;  2BF0 X;  4NUR A;  3GYZ A;  3FTY A;  2LAI A;  5FJY A;  3ML8 A;  3UM3 A;  4CDN A;  2C0L A;  2DVW A;  3ASH A;  3L22 A;  2OV8 A;  4TUM A;  4I6E A;  3RRN B;  3D9H A;  4GTT A;  4K03 A;  4PDX A;  3ONK A;  2UY1 B;  4TXR A;  3PEV B;  4ABN A;  4F7A A;  2PM6 A;  2V4H C;  1E8Y A;  2FEZ A;  3V2X A;  2FF4 A;  4B0Z A;  2H6H A;  3ABL E;  4H7X A;  3CVL A;  3UQ3 A;  3SBS A;  1ELW A;  2R2L A;  2VJ8 A;  4RG6 A;  3T5V A;  3ZVV A;  3S7F A;  4HRM B;  1ELK A;  1U2V G;  3CVQ A;  3P1U A;  5JMN D;  2Y0B G;  3ZYQ A;  3GZ1 A;  2R02 A;  3U9W A;  3FUI A;  3TGO A;  4MKT A;  3EDT B;  3Q75 A;  3NQP A;  1BPO A;  1UW4 B;  2R5S A;  3AG3 E;  2CHZ A;  5LCW C;  1NA0 A;  4HS2 A;  4JA9 A;  3OTN A;  2IFU A;  3CHR A;  3CHO A;  4N2S A;  4N3C A;  4EBA G;  3DST A;  4GZ3 A;  3NAW A;  1D8D A;  3CVX A;  4OVV A;  3E32 A;  4GA1 A;  2WXP A;  4NRH B;  1Y6I A;  3DRA A;  5LP0 A;  2I9C A;  1HH8 A;  3SNX A;  3LCA A;  3BU8 A;  1HG5 A;  1SQM A;  4G2V A;  3RKV A;  3QWV A;  3NOC D;  2QYJ A;  3D9P A;  3E4B A;  2WXO A;  3R7R A;  3RSE G;  2DBA A;  4FHJ A;  3ZKJ A;  3R7Q A;  4GTQ A;  5EX3 A;  3Q15 A;  4GU5 A;  5G04 C;  4FJZ A;  3EUV A;  2DCP A;  2I1K A;  3L54 A;  4Y6W A;  2DIW A;  1OWO A;  3HIZ A;  5KJK A;  1IYG A;  3IHY A;  2RKK A;  1QZ2 A;  2X3M A;  5BXU A;  1H6P A;  4EBA A;  1FCH A;  1NZN A;  4LNU D;  4J6I A;  3MCX A;  3GW4 A;  3ASD A;  1UJJ A;  4RQI A;  3PE4 A;  4ZFH A;  3FP3 A;  1OCZ E;  2GRR B;  5H7P A;  4B93 B;  1O5M A;  4XX5 A;  1XNF A;  1YA0 A;  4J8F A;  3JCK C;  4BEP A;  2ETB A;  1Z3X A;  2NYJ A;  5ENO D;  5LCW J;  5BUZ A;  3G2T A;  5EYL A;  4AY6 A;  3DPD A;  3FEX A;  3MKR A;  4WUY A;  1D9S A;  3EIQ C;  3AG1 E;  4WAF A;  1PAQ A;  4GZ5 A;  3TWU A;  3CVW A;  1AP7 A;  5IY5 E;  5EYP F;  3VLF A;  3EHN A;  3CK9 A;  3JUE A;  3NB2 A;  4KZC A;  4HOU A;  1Y8M A;  3QJZ A;  4U8V D;  3Q7F A;  3CSF A;  3B95 A;  1JWF A;  3J5P A;  1RW2 A;  2EIL E;  2XS8 A;  2OVF A;  3G2V A;  2RFA A;  1QQE A;  1NL4 A;  4LER A;  2IQC A;  3DSU A;  4HBD A;  5G04 J;  3LVQ E;  2XGO A;  1BI8 B;  3L6A A;  3ENE A;  2IO2 C;  2PL2 A;  1XGW A;  3L16 A;  5KJN A;  3U4T A;  3QAR A;  2IU1 A;  1YMP A;  4CDM A;  4TUU A;  1TR4 A;  5J08 A;  3SZ7 A;  1EDU A;  2VGY A;  3T8K A;  5JJ6 A;  2ZIS A;  2NC9 A;  4IN3 B;  2WQ6 A;  3IHV A;  5E76 A;  5AJL A;  1PY1 A;  4UI9 J;  5BNW A;  2VGX B;  4ME2 A;  3Q9N C;  3ASN E;  2L6B A;  4GA0 A;  2EIM E;  3LS8 A;  1KT1 A;  2OEV A;  3CVY A;  2HR2 A;  5BPP A;  2FBN A;  2F8Y A;  2X6H A;  2AXU A;  2XEV A;  3FU0 A;  2BED A;  4FAD A;  4ATG A;  2P9N G;  4Y6C A;  3LY8 A;  2X6K A;  5T8I A;  4BT8 A;  3CKB A;  4JHK A;  5FQ8 A;  1JUQ A;  3ZYM A;  5CHE E;  3SO8 A;  3EHM A;  1OCO E;  1UN9 A;  3QC1 A;  5HRY A;  4MLP A;  3S7J A;  3FUN A;  1DCQ A;  3LXU X;  5CBO A;  1JWG A;  3TWX A;  4BTB A;  4PS3 A;  2YHC A;  3LEW A;  2P9U G;  3QAQ A;  4G24 A;  4BX8 A;  1N52 A;  3DSV A;  3HRA A;  3DPY A;  1JPL A;  4IRU A;  1FT1 A;  3LVR E;  1O1S A;  1N4P A;  3ABK E;  3CV0 A;  3C3Q A;  4L7T A;  3CKC A;  2C2L A;  3UMV A;  3HXE A;  2WXF A;  4CT0 A;  2KCV A;  5AN8 A;  3DEP A;  5C2Y A;  2WQ7 A;  3PZ1 A;  2NSZ A;  4U0U A;  5CCL A;  4I1M A;  2OOE A;  3HVE B;  1TN8 A;  4I9C A;  3UIO C;  4LUN U;  4U04 A;  1P5Q A;  5A6C A;  3GZS A;  2Q7F A;  3BQO A;  4G11 A;  4NQ0 A;  1UJK A;  1N4S A;  4XKC A;  4I2W A;  3HDX A;  4APF A;  3Q79 A;  2DZO A;  1UN8 A;  3QB2 A;  2KZT A;  2X38 A;  2EIK E;  5BXO A;  2RFM A;  3MKQ B;  4IUL A;  5AQ9 A;  4LNB A;  4HQD A;  3AS4 A;  5HKP A;  5EID A;  5FZR A;  2OVB A;  3MEK A;  4BT9 A;  3MGB A;  4JA7 A;  5EIL A;  3ZHE A;  1HU3 A;  1DC2 A;  3FUJ A;  2HYZ A;  1K1A A;  3RRU A;  4D10 C;  4F1S A;  2IOL A;  5ENS D;  1ELR A;  4U0S A;  2J9Q A;  5FTP A;  1OWP A;  2LSV A;  2J07 A;  5KCM A;  2J4B A;  4GMJ A;  1E96 B;  3ISM C;  4HI9 A;  5FIO A;  4GYY A;  2J4D A;  5AQ7 A;  4CRW A;  4OYS A;  1TEZ A;  3L82 A;  3G2W A;  3SFZ A;  2KCL A;  4F6R D;  4FHK A;  5ENN A;  2WXJ A;  4JB8 P;  4YDW A;  3V31 A;  3FUH A;  4CCA A;  2ZIR A;  4U8Y D;  4XE0 A;  4ZHB A;  4GTS A;  2KCK A;  3IEG A;  3PS6 A;  3AS8 A;  3B7R L;  1NA3 A;  1BU9 A;  4JPS A;  1ZU2 A;  3DXK G;  2WMN A;  3AU5 A;  2XZD G;  4DX5 D;  4M3O A;  3ZU7 B;  1O1R A;  2A5U A;  4GA2 A;  2LXL A;  4CDR A;  1E8Z A;  4L2Y A;  5ARF A;  2XGS A;  3FH5 A;  4C48 B;  3CVN A;  4ACL A;  2ETC A;  5T3R A;  4BY6 A;  4PUC A;  2WXN A;  5EIB E;  3IKO B;  2UY1 A;  3UM1 A;  3E37 A;  3UKU G;  4B8C B;  3KD7 A;  3B7S A;  4LCT A;  5M72 A;  2P9P G;  2ILR A;  4ANU A;  1YCS B;  2JAB A;  2WMO A;  3TL5 A;  1IXV A;  4HOT A;  4WWP A;  2WB2 A;  5G05 C;  2Y4T A;  1OY3 D;  3BEE A;  2EIJ E;  2WXI A;  4ACK A;  2M63 A;  1S70 B;  3ASF A;  3CHP A;  4WNE A;  2V4L A;  3T8M A;  3UUX A;  3I5P A;  2XPZ A;  2XPY A;  4GMR A;  3ZNG A;  4ILG A;  1SZA A;  2QY7 A;  2I1J A;  3MV2 B;  5EX0 A;  4DRX E;  2KAT A;  4XIF A;  3RAU A;  3C3O A;  4AIF A;  3ZRH A;  3G2U A;  4GTV A;  3I4G A;  1JCQ A;  1NP7 A;  3FTX A;  4I6G A;  4UWK A;  3TG4 A;  1H6K A;  3ZFW A;  2FO1 E;  4NAC A;  5D0O D;  4DLQ A;  2A4Z A;  4J8E A;  4JVS A;  2R17 C;  1OCR E;  4HLE A;  4CZ2 D;  1NI1 A;  4GTO A;  5CBN A;  4I6J A;  2DYR E;  1OUV A;  2Y3A A;  4U95 D;  1TN6 A;  1QYM A;  1S63 A;  5ANR A;  3ULQ A;  4QQI A;  1IQU A;  1L5J A;  1HF8 A;  4MS6 A;  1PC2 A;  2BUG A;  2PNN A;  4I2Z A;  1SA4 A;  4FU3 A;  2CG2 A;  1MQS A;  4L9P A;  4H7Y A;  3UT4 A;  1HO8 A;  3ZEF A;  5G2N A;  3R9M A;  3C3R A;  3JQ1 A;  1X81 A;  3CQG B;  4O1P A;  3Q47 B;  3VLE A;  4K5B A;  4GZC A;  4U07 A;  3D9K A;  4WND A;  3ZIM A;  4J8Y A;  2F37 A;  4K0R A;  4U8H A;  2DZN A;  1IHB A;  3PDN A;  3TXM A;  4KXK B;  3AJI A;  3U3W A;  4WWO A;  3ZN3 A;  4BSX A;  2X6F A;  1FPP A;  4HOR A;  3K9I A;  1E8W A;  3TWS A;  3PE3 A;  1HXI A;  1MX6 A;  4JXT A;  1JCR A;  4ILI A;  3FUD A;  4I17 A;  5FIN A;  1H2T C;  3X2Q E;  3B7T A;  2LNI A;  4AVX A;  3O4Z A;  3CST A;  4L23 A;  3LPZ A;  2KC7 A;  3DSX A;  4G8K A;  4DK5 A;  4DX7 D;  2WXQ A;  2XEN A;  2F0Y A;  2EIN E;  4UWF A;  4IYP A;  2IJG X;  3CQC B;  4RVB A;  3EIJ A;  3V2O A;  4AM9 A;  4G26 A;  1E7U A;  4XKB A;  4CT4 A;  2XHE A;  2XCC A;  3U64 A;  1N0R A;  3CGH A;  3EU5 A;  1ZB1 A;  4AY5 A;  4UWH A;  2P2C P;  4AOF A;  5D0Q D;  4EZL A;  2IEJ A;  3KSL A;  4N3A A;  5ANL A;  2WXG A;  2VGX A;  4G25 A;  3PZ4 A;  4Q94 A;  3L13 A;  4J8D A;  3HXD A;  4XEI G;  3OXG A;  3ULY A;  3Q78 A;  5FWQ A;  3V79 K;  4Q69 A;  2P9S G;  5A23 A;  1YYH A;  4A1G A;  1GW6 A;  3CHS A;  3CVP A;  2GRM A;  3DSS A;  5CEC B;  3CLJ A;  3UT8 A;  4F1P A;  3JYS A;  1S64 A;  3SF4 A;  4DPR A;  5EKQ D;  3PNL B;  1HS6 A;  4RSY A;  2XRZ A;  3NOG D;  1IQR A;  5AQB A;  3APF A;  1Z5S C;  4XI9 A;  2LO6 A;  2ZXW E;  3SGH A;  1UG3 A;  1K1B A;  2UWJ G;  4AJW A;  4AV7 A;  3Q7A A;  2QC9 A;  4FC8 A;  2AW6 A;  3KS2 A;  3RO3 A;  2FO7 A;  3I3N A;  3I4R B;  4UWL A;  4MBG A;  3ONL A;  2Y69 E;  3JXJ A;  3URZ A;  2R59 A;  1HZ4 A;  4UQY A;  4OAU C;  3FTZ A;  3LY9 A;  4K5C A;  4TRQ A;  4FP7 A;  3HYM B;  3PUJ A;  3MJW A;  2J49 A;  2P9K G;  3FU5 A;  3PEU B;  2QFC A;  4JEU A;  1FVH A;  4GPK A;  5DIZ A;  3HXB A;  4BSZ B;  4KT6 B;  4C0M A;  1OXJ A;  2V5F A;  3EHQ A;  3ZYL A;  3MX3 A;  3CHM A;  4N3B A;  3HVE A;  2MOW A;  1TNB A;  4DX6 D;  4HRN A;  2FUL A;  3SBT B;  5ENQ D;  4N5Q A;  1MJ0 A;  2XRY A;  3TAX A;  2B6C A;  3J5Q B;  1BD8 A;  1OT8 A;  4HI8 A;  5CMY A;  4GTM A;  3MKQ A;  1K8K G;  3AG2 E;  2A5E A;  2OND A;  3CK7 A;  3UX4 A;  1Z6T A;  3U66 A;  2Y4U A;  5JJT A;  3MA5 A;  2IOS A;  4APO A;  5BV1 A;  4JZY A;  3RIB A;  3PZ3 A;  4ANV A;  2YQ8 A;  3RK6 A;  4G23 A;  5D66 A;  2GRQ B;  1Z3Y A;  1MX4 A;  2ZGD A;  3LY7 A;  2QZA A;  3CVV A;  4BER A;  1A5E A;  4BWR A;  1HE8 A;  3QNK A;  1N54 A;  2RG8 A;  2XGM A;  2XS1 A;  3TWR A;  5JA4 D;  3FWV A;  4HXI A;  4L1B A;  4I43 A;  3F6Q A;  3D9O A;  3APC A;  1MHQ A;  1OCC E;  4GTP A;  3E34 A;  1TYQ G;  2WM9 A;  3ML9 A;  2GW1 A;  3NZS A;  3DEO A;  2VTB A;  3PZ2 A;  2WXM A;  3UKR G;  2X6I A;  1NFI E;  3PRE A;  1V54 E;  1WAO 1;  5CMW A;  5FZQ A;  3FFL A;  3QWW A;  2EQX A;  3LDZ A;  2KXP C;  1UOH A;  2MRI A;  4U7E B;  4JHJ A;  4F3V A;  4RG9 A;  3D9L A;  2VTB B;  3D9M A;  1B89 A;  5EN5 D;  1VDY A;  4U63 A;  5CRU A;  5BV0 A;  2XPI A;  4KVM A;  2E2E A;  4HVB A;  2V8S E;  4B89 A;  2KM4 A;  5AEN A;  3DBS A;  4ATZ D;  3NF1 A;  1N4R A;  4GCO A;  4LNG A;  3FTV A;  4DJA A;  3IXE A;  3WG7 E;  3W9G A;  1LF8 A;  4G1T A;  3UM2 A;  3L08 A;  2ZU6 B;  5KBA A;  4TXP A;  1E8X A;  4ANX A;  2YNQ A;  4TV3 A;  2AVP A;  2VQ2 A;  3SHF A;  2V5Q C;  1N4Q A;  2H6I A;  2BKG A;  5KWD A;  2ION A;  2MHK A;  4HOS A;  3BG0 B;  3PH0 C;  3S7D A;  3QKY A;  5FQ4 A;  3ESK A;  4R7L A;  4BES A;  5LOZ A;  3CVU A;  3SY2 A;  3FU6 A;  3B7B A;  1G3N B;  4KBQ A;  3IV0 A;  4N5C A;  2H6F A;  4GPM A;  3E33 A;  3TWT A;  3SFX A;  4EHM A;  4KZ0 A;  2GRP B;  2AXZ A;  4M7C A;  5LX8 A;  3WXX A;  1H19 A;  2WXR A;  5KJL A;  3FH7 A;  1LTX A;  1HX8 A;  1KZP A;  1HFA A;  3LJN A;  3CIA A;  2RD0 A;  3GZ2 A;  4P29 A;  2OCC E;  4LEU A;  4WNF A;  4FLB A;  2F8X K;  3TXN A;  1W3B A;  5BW8 C;  4O1O A;  1QBQ A;  4AP2 A;  2I2O A;  2B0O E;  5CED B;  3ZW3 A;  3ZGQ A;  5ITZ F;  4EPZ A;  2WVI A;  4URK A;  4GTR A;  2KBX A;  4W9R A;  5C1D A;  2JEK A;  1SW6 A;  2I6H A;  5AAO A;  2WPV A;  3ZPJ A;  2C0M A;  2WXK A;  4U96 D;  3RO2 A;  5E75 A;  4GZ6 A;  5JJ7 A;  4K5A B;  2NXP A;  5HS0 A;  4L2L A;  3FDH A;  2R05 A;  1WM5 A;  3EHR A;  3SFY A;  1FT2 A;  4BET A;  2V0P A;  4HNA D;  1DCE A;  4CGW A;  3FTW A;  2VSY A;  4BFR A;  4X8Q A;  3HXF A;  2VGE A;  2X6J A;  4Z68 A;  3Q49 B;  1Q2Z A;  2IF4 A;  3SI5 A;  3FUF A;  4EZK A;  1SZ9 A;  3ASG A;  3FUE A;  4A55 A;  4DLO A;  5AJD A;  4A63 B;  3KSQ A;  1X5B A;  3HXC A;  3ZXP A;  1H6O A;  2IO3 C;  1S0P A;  4BX9 A;  4GAA A;  1H0A A;  2Y1L E;  5D2M C;  5G05 J;  2PM7 A;  3FUK A;  1N94 A;  4G8L A;  4UUC A;  3KEA A;  2XEH A;  3FY4 A;  1LD8 A;  3IBE A;  4E6H A;  1RZ4 A;  1BI7 B;  3TWV A;  5J90 A;  2CG3 A;  4YDO A;  3LJ3 A;  2QYU A;  4HLL A;  4PS8 A;  3UM0 A;  4DI3 A;  3RJV A;  3S7B A;  1MYO A;  5ENP D;  1TNZ A;  3DWL G;  4XI0 A;  3OAW A;  4UI9 C;  3QK0 A;  1QNF A;  3UTM A;  1D8E A;  3FTU A;  5KJM A;  2GGF A;  4LRZ A;  2CFU A;  4GZD A;  2WQH A;  4B8A A;  5CRV A;  5KNH D;  2XQ0 A;  4KVO A;  2VSO E;  3SD5 A;  3QOU A;  1N0Q A;  2L6J A;  1U3C A;  1HG2 A;  2PQR A;  3FTS A;  2P58 C;  3CEQ A;  5HI7 A;  3B7U X;  3D9J A;  1DNP A;  1TJF A;  4FLH A;  3MV3 B;  1ZBP A;  1DVP A;  3VTY A;  4YDY A;  4N2Q A;  3FU3 A;  4ILH B;  4BTA A;  5G55 A;  3S2A A;  4NIK A;  4Q96 A;  3UPV A;  2MYO A;  3Q9U C;  1FVF A;  4UQZ A;  5AAR A;  3C72 A;  3C98 A;  4HRL A;  3MZL B;  4A1S A;  5B3S E;  2HE0 A;  4QFV A;  3JQ0 A;  2LAH A;  1SA5 A;  1N11 A;  3L9T A;  1TJC A;  1KT0 A;  2L0I A;  4J0U A;  4OVU A;  4C9B B;  2DYS E;  3VLD A;  2J09 A;  4I1O B;  5AIJ A;  4PS7 A;  1JCS A;  5BT1 A;  2CFZ A;  5B1A E;  4GCN A;  3HG0 D;  4CEM A;  3ULE G;  1AWC B;  3FUM A;  3BUA A;  1MX2 A;  2L0T B;  3FUL A;  4EEC A;  3L17 A;  2IY0 C;  2VSN A;  3ZUV B;  5JHA A;  1OWL A;  2L9B A;  2FI7 A;  3OXL A;  1WG0 A;  3RU0 A;  3QWP A;  4DUI A;  5FQ6 A;  2AWI A;  3DXM G;  4I1A A;  1N95 A;  2GRL A;  3UIP C;  2HM8 A;  5KNG A;  3NBN B;  3LYA A;  4UWG A;  2CHX A;  3VTX A;  3FHE A;  1E90 A;  2PZI A;  5ENT D;  4TXQ A;  4DX2 A;  4E85 A;  3TWQ A;  5EDS A;  2HO1 A;  3OXF A;  3EU9 A;  3N71 A;  4J7W A;  4XZ4 A;  5ENR D;  2XZT G;  4LSZ E;  2CHW A;  4F53 A;  3T5X A;  3TWW A;  2GRO B;  3TG5 A;  3P2B A;  3ASO E;  3ZYK A;  1H2U A;  4WNG A;  2OEW A;  5FQ7 A;  3D3M A;  4KYO B;  1H2V C;  1TNU A;  2YIN A;  2BKK B;  4ANW A;  3B13 A; 
#chains in the Genus database with same CATH homology
 4KVM A;  4HOU A;  2E2E A;  5LFA A;  4UQX A;  1Y8M A;  3QJZ A;  2V8S E;  1KLX A;  3QDN A;  4HVB A;  4DI4 A;  4B89 A;  2KM4 A;  3CSF A;  4J8E A;  4JVS A;  5AEN A;  2R17 C;  1JWF A;  3DBS A;  4HLE A;  4JEH A;  5ARG A;  4UI9 K;  3NZU A;  4GML A;  4A3T A;  3MYV A;  4I6J A;  1OUV A;  2Y3A A;  2OVF A;  3G2V A;  5ANR A;  1QQE A;  3ULQ A;  3KAE A;  4LER A;  2IQC A;  4FJY A;  1IQU A;  3NF1 A;  1L5J A;  4GCO A;  1HF8 A;  2VYI A;  3FTV A;  4MS6 A;  1PC2 A;  2BUG A;  1EPU A;  2JLB A;  3UT7 A;  5G04 J;  3LVQ E;  4DJA A;  2XGO A;  3L6A A;  4I2Z A;  5AYW D;  5T4Y A;  4GB9 A;  4FU3 A;  2CG2 A;  1MQS A;  3ENE A;  3D9N A;  2PL2 A;  1XGW A;  3L16 A;  5KJN A;  1U3D A;  4H7Y A;  3CR3 A;  1LF8 A;  3QAR A;  4YVQ C;  3U4T A;  3UT4 A;  4G1T A;  1HO8 A;  3RRM B;  3ZEF A;  5G2N A;  2IU1 A;  3D9I A;  3JQ1 A;  3L08 A;  4CDM A;  2ZU6 B;  3CQG B;  4TUU A;  4KMO A;  1E8X A;  4ANX A;  3Q47 B;  2YNQ A;  5J08 A;  4TV3 A;  1EDU A;  3SZ7 A;  2VGY A;  4PH4 B;  2AVP A;  3KEZ A;  3VLE A;  2VQ2 A;  1A17 A;  5JJ6 A;  3SHF A;  4JW1 A;  4GZC A;  3FH8 A;  2NC9 A;  4IN3 B;  2WQ6 A;  4U07 A;  3D9K A;  4WND A;  3IHV A;  5E76 A;  2ION A;  2MHK A;  3ZIM A;  4HOS A;  3BG0 B;  4K0R A;  3PH0 C;  4HOQ A;  5AJL A;  1PY1 A;  4GYW A;  3S7D A;  2J08 A;  4UI9 J;  3LKU A;  4U8H A;  3TXM A;  3PDN A;  5BNW A;  4CGV A;  4KXK B;  2VGX B;  3U3W A;  4ME2 A;  1OWN A;  4WWO A;  4GA0 A;  3QKY A;  5FQ4 A;  3ESK A;  5DBK A;  4R7L A;  3ZN3 A;  4BSX A;  2X6F A;  5LOZ A;  3CVU A;  3LS8 A;  1KT1 A;  3FU6 A;  3CVY A;  2HR2 A;  4KBQ A;  5BPP A;  4FUL A;  3IV0 A;  4HOR A;  4N5C A;  2FBN A;  3K9I A;  1E8W A;  3CHQ A;  3PUK A;  2X6H A;  4KZ0 A;  2AXU A;  2AXZ A;  4JL0 A;  1E7V A;  1EYH A;  2XEV A;  2KZT B;  3PE3 A;  5LX8 A;  3WXX A;  3FU0 A;  1H19 A;  2WXR A;  1HXI A;  3FH7 A;  4JXT A;  5KJL A;  3BG1 B;  4FAD A;  1HX8 A;  2WXL A;  1HFA A;  4ATG A;  4Y6C A;  3LY8 A;  2X6K A;  4V3I A;  5T8I A;  5FT9 A;  3FEY A;  1INZ A;  4ILI A;  4BT8 A;  3CKB A;  3PRZ A;  3CIA A;  3FUD A;  4I17 A;  3EJN A;  1IHG A;  2RD0 A;  3GZ2 A;  4JHK A;  5FQ8 A;  4P29 A;  4LEU A;  1H2T C;  1JUQ A;  4FLB A;  4WNF A;  3APD A;  3ZYM A;  3TXN A;  5CHE E;  3PZD A;  1W3B A;  3B7T A;  3EHM A;  5BW8 C;  1WY6 A;  1UN9 A;  3QC1 A;  3HHM A;  2LNI A;  4MLP A;  4JC8 A;  4AVX A;  3JUI A;  4AP2 A;  3O4Z A;  2I2O A;  2PQN A;  3CST A;  3PVL A;  3LPZ A;  4GYO A;  4L23 A;  3S7J A;  3ZW3 A;  3ZGQ A;  3FUN A;  3ZHE B;  2WVI A;  3AS5 A;  3LXU X;  4I9E A;  2KC7 A;  4EPZ A;  4URK A;  4DK5 A;  2WXQ A;  4W9R A;  4JHR A;  5C1D A;  1JWG A;  4B94 A;  2JEK A;  2I6H A;  2WPV A;  3ZPJ A;  4PS3 A;  4BTB A;  3Q5M A;  2YHC A;  2C0M A;  2WXK A;  3LEW A;  3RO2 A;  5E75 A;  4GZ6 A;  4UWF A;  3PNT B;  5JJ7 A;  2BTD A;  2IJG X;  3CQC B;  4IYP A;  3QAQ A;  4N39 A;  4G24 A;  4RVB A;  2NXP A;  4BX8 A;  1N52 A;  3EIJ A;  4O6F A;  4L2L A;  4J8S A;  3FDH A;  1JPL A;  4IRU A;  3TJP A;  3LVR E;  4U0Z A;  2LSU A;  4AM9 A;  5CCM A;  4C0E A;  4MRU A;  4G26 A;  1E7U A;  4XKB A;  4CT4 A;  4YND A;  3CV0 A;  1WM5 A;  2XCB A;  4AXH A;  4L7T A;  3CKC A;  2C2L A;  1OWM A;  3UMV A;  2XHE A;  4EZJ A;  2V0P A;  2XCC A;  3U64 A;  4CGW A;  2WXF A;  3FTW A;  2VSY A;  4YVO A;  4CT0 A;  4BFR A;  2YHE A;  3CGH A;  2X6J A;  2KCV A;  3Q49 B;  1EF1 C;  5A7D B;  4UWH A;  3G2S A;  5C2Y A;  3ZXS A;  4AY5 A;  4FA6 A;  4AOF A;  2WQ7 A;  2IF4 A;  3SI5 A;  2NSZ A;  4U0U A;  3FUF A;  5CCL A;  4I1M A;  5JHB A;  4EZK A;  2OOE A;  3O48 A;  1SZ9 A;  3ASG A;  3FUE A;  4A55 A;  4DLO A;  5D0Q D;  2VSX E;  4EZL A;  5AJD A;  1X5B A;  3HVE B;  3Q4A B;  4N3A A;  4AEZ C;  1S0P A;  5ANL A;  4I9C A;  4LUN U;  2WXG A;  4BX9 A;  2VGX A;  4EQF A;  4U04 A;  4GAA A;  1P5Q A;  4G25 A;  5A6C A;  1H0A A;  2AXV A;  3GZS A;  2Q7F A;  4Q94 A;  4WWN A;  5FZS A;  3L13 A;  4J8D A;  5HQ8 A;  2WXH A;  3CK8 A;  4HFG A;  4G11 A;  3OXG A;  4NQ0 A;  2E0I A;  5G05 J;  3AU4 A;  5FWQ A;  1UJK A;  2PM7 A;  4XKC A;  4A3V A;  4I2W A;  4Q69 A;  5BV0 A;  3HDX A;  3FUK A;  3ESL A;  2XPI A;  4APF A;  3R9A B;  1UN8 A;  2BF0 X;  5A23 A;  4A1G A;  3QB2 A;  2KZT A;  3FY4 A;  1GW6 A;  2X38 A;  3CHS A;  3CVP A;  2GRM A;  4NUR A;  3MKQ B;  3GYZ A;  3CLJ A;  3FTY A;  2LAI A;  3IBE A;  5FJY A;  3UT8 A;  4IUL A;  3ML8 A;  4E6H A;  4CDN A;  2C0L A;  3AS4 A;  3ASH A;  3JYS A;  3L22 A;  2OV8 A;  5J90 A;  4I6E A;  2CG3 A;  3RRN B;  4K03 A;  3SF4 A;  4DPR A;  5EKQ D;  5FZR A;  4PDX A;  3PNL B;  3LJ3 A;  2OVB A;  3ONK A;  3MEK A;  1HS6 A;  4RSY A;  4PS8 A;  2UY1 B;  2XRZ A;  4BT9 A;  1IQR A;  3APF A;  3PEV B;  4DI3 A;  3RJV A;  3MGB A;  2LO6 A;  4JA7 A;  4XI9 A;  3S7B A;  4ABN A;  3SGH A;  4F7A A;  1UG3 A;  3ZHE A;  1HU3 A;  2PM6 A;  3FUJ A;  2UWJ G;  4AJW A;  4AV7 A;  1E8Y A;  2FEZ A;  2HYZ A;  4XI0 A;  4FC8 A;  3OAW A;  4UI9 C;  3RRU A;  4D10 C;  2AW6 A;  2FF4 A;  3KS2 A;  3QK0 A;  3RO3 A;  4B0Z A;  4F1S A;  2IOL A;  1QNF A;  4H7X A;  3CVL A;  2FO7 A;  3I3N A;  3I4R B;  4UWL A;  1ELR A;  3ONL A;  4U0S A;  3SBS A;  3UQ3 A;  2J9Q A;  5FTP A;  1ELW A;  3FTU A;  2VJ8 A;  4RG6 A;  3T5V A;  5KJM A;  2GGF A;  3URZ A;  3ZVV A;  3S7F A;  2R59 A;  4LRZ A;  2CFU A;  1OWP A;  1HZ4 A;  4GZD A;  1ELK A;  2WQH A;  4UQY A;  4B8A A;  3CVQ A;  3P1U A;  2LSV A;  2XQ0 A;  2J07 A;  4KVO A;  5KCM A;  3FTZ A;  3LY9 A;  4TRQ A;  2J4B A;  4GMJ A;  2VSO E;  4FP7 A;  3SD5 A;  1E96 B;  3HYM B;  3QOU A;  3PUJ A;  3MJW A;  2J49 A;  2L6J A;  3GZ1 A;  3U9W A;  3ZYQ A;  3FUI A;  2J4D A;  3FU5 A;  4GYY A;  3TGO A;  3PEU B;  1U3C A;  1HG2 A;  2PQR A;  2QFC A;  3EDT B;  3FTS A;  4MKT A;  2P58 C;  3CEQ A;  4CRW A;  4JEU A;  4OYS A;  1TEZ A;  1FVH A;  3NQP A;  5HI7 A;  3B7U X;  1BPO A;  1UW4 B;  5DIZ A;  3D9J A;  4GPK A;  1DNP A;  1TJF A;  4FLH A;  2R5S A;  4KT6 B;  3MV3 B;  4C0M A;  2CHZ A;  1ZBP A;  1DVP A;  5LCW C;  3G2W A;  1NA0 A;  3SFZ A;  3VTY A;  2V5F A;  4HS2 A;  3ZYL A;  2KCL A;  4N2Q A;  3FU3 A;  4FHK A;  4ILH B;  5ENN A;  2WXJ A;  3MX3 A;  4JA9 A;  4BTA A;  5G55 A;  3S2A A;  3CHM A;  3OTN A;  4N3B A;  4Q96 A;  2IFU A;  3HVE A;  3CHR A;  3CHO A;  2MOW A;  3FUH A;  4CCA A;  4N2S A;  3UPV A;  4XE0 A;  1FVF A;  2KCK A;  3IEG A;  2FUL A;  3PS6 A;  3AS8 A;  4N3C A;  3B7R L;  4UQZ A;  3SBT B;  4EBA G;  1NA3 A;  4GZ3 A;  4JPS A;  2XRY A;  1ZU2 A;  3TAX A;  3CVX A;  4OVV A;  4GA1 A;  2WXP A;  3C98 A;  4NRH B;  2WMN A;  1Y6I A;  3MZL B;  4A1S A;  5CMY A;  5LP0 A;  2I9C A;  1HH8 A;  3SNX A;  3LCA A;  3AU5 A;  4QFV A;  4M3O A;  3MKQ A;  2A5U A;  1HG5 A;  1SQM A;  4GA2 A;  4G2V A;  3RKV A;  3QWV A;  3JQ0 A;  4CDR A;  2LAH A;  1E8Z A;  4L2Y A;  5ARF A;  3D9P A;  2XGS A;  3FH5 A;  3E4B A;  1TJC A;  1KT0 A;  2L0I A;  4J0U A;  2WXO A;  4OVU A;  4C9B B;  3R7R A;  3VLD A;  2OND A;  3CVN A;  2J09 A;  4ACL A;  4I1O B;  2DBA A;  4FHJ A;  5AIJ A;  3R7Q A;  4PS7 A;  5EX3 A;  3CK7 A;  5T3R A;  3Q15 A;  4BY6 A;  4PUC A;  5BT1 A;  3UX4 A;  4GU5 A;  2CFZ A;  5G04 C;  1Z6T A;  4FJZ A;  2WXN A;  3IKO B;  2UY1 A;  4GCN A;  4CEM A;  3U66 A;  2Y4U A;  2DCP A;  3FUM A;  5JJT A;  4B8C B;  3KD7 A;  3MA5 A;  2IOS A;  2I1K A;  3L54 A;  4APO A;  3B7S A;  4Y6W A;  4LCT A;  2DIW A;  4JZY A;  5BV1 A;  1OWO A;  5M72 A;  3RIB A;  4ANV A;  3HIZ A;  5KJK A;  2YQ8 A;  1IYG A;  2L0T B;  3FUL A;  4EEC A;  3IHY A;  2ILR A;  3L17 A;  2VSN A;  4ANU A;  3RK6 A;  4G23 A;  5JHA A;  1OWL A;  2L9B A;  1Z3Y A;  2WMO A;  1QZ2 A;  2FI7 A;  2X3M A;  3OXL A;  4EBA A;  3RU0 A;  1FCH A;  1NZN A;  3QWP A;  3LY7 A;  3TL5 A;  4HOT A;  4J6I A;  3CVV A;  4WWP A;  5FQ6 A;  3MCX A;  2WB2 A;  5G05 C;  4BWR A;  1HE8 A;  2AWI A;  3QNK A;  2Y4T A;  1N54 A;  4I1A A;  3GW4 A;  3ASD A;  2RG8 A;  1UJJ A;  2XGM A;  3BEE A;  2GRL A;  3PE4 A;  2WXI A;  2HM8 A;  3FP3 A;  4ACK A;  2M63 A;  3FWV A;  4HXI A;  4L1B A;  4I43 A;  3ASF A;  4XX5 A;  3D9O A;  3APC A;  3CHP A;  1XNF A;  1MHQ A;  1YA0 A;  4WNE A;  4J8F A;  3JCK C;  2V4L A;  3T8M A;  1Z3X A;  3UUX A;  3LYA A;  3I5P A;  4UWG A;  2CHX A;  3VTX A;  3FHE A;  2WM9 A;  5LCW J;  5BUZ A;  2XPZ A;  3G2T A;  3ML9 A;  1E90 A;  2XPY A;  2GW1 A;  2PZI A;  4ILG A;  1SZA A;  2QY7 A;  4E85 A;  2I1J A;  3NZS A;  3MV2 B;  3DPD A;  4AY6 A;  3FEX A;  5EDS A;  2HO1 A;  2VTB A;  5EX0 A;  3MKR A;  4WUY A;  3OXF A;  2KAT A;  2WXM A;  2X6I A;  4XIF A;  3PRE A;  3N71 A;  4AIF A;  1WAO 1;  4XZ4 A;  3ZRH A;  3EIQ C;  5FZQ A;  5CMW A;  3FFL A;  3G2U A;  2CHW A;  3QWW A;  2EQX A;  4F53 A;  4WAF A;  3LDZ A;  3T5X A;  1PAQ A;  4GZ5 A;  3I4G A;  2MRI A;  3TG5 A;  3CVW A;  3P2B A;  1NP7 A;  3ZYK A;  4JHJ A;  3FTX A;  1H2U A;  4I6G A;  4UWK A;  4WNG A;  3TG4 A;  4RG9 A;  4F3V A;  3VLF A;  5FQ7 A;  3D9L A;  3EHN A;  1H6K A;  3D3M A;  2VTB B;  3D9M A;  1B89 A;  3CK9 A;  4KYO B;  3ZFW A;  1VDY A;  4NAC A;  1H2V C;  4U63 A;  2YIN A;  5D0O D;  4KZC A;  4DLQ A;  2A4Z A;  4ANW A;  3B13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...