3HDXA

Crystal structure of susd superfamily protein (np_809182.1) from bacteroides thetaiotaomicron vpi-5482 at 1.50 a resolution
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
474
structure length
456
Chain Sequence
TQQWKTLEDTRSALMGVYGLTRAALADNNTHWICGDLRKGDFTVYKRSDLQAVSDNELNKPYDLLKKVSNWRRFYAVINAASVFMEKAPRTVELDRSYSEQNLKYDIAQVRALRAFAYFYMVRIWGDVPLVTYSYDNGTFPSMPRTDAQTVLSYAKAELLTAIEDLPYQYGTQTNLYYGSYGAQWQGKLFNKLSAYSVLAHICAWQGNYAEAETYSAFIIDHASEINAKYTSIADLTSETGLFYSNASVKGSRILGFNFAGHLEQLTLAYPLVQKSYPEIYISKDSLFSIFTNFDDLRFGIIDTIKYSSYYVQNLNEETPVFSKIKIIQGVFGSSIVFTRLEDITLLRAEALCALNRSTEAVSYLNMIRTNRGLREVSFKKDFGNNRESLIAEIFEERRRELMGEGWRWYDLVRRQKLMKDNEAFLRLISSGGIYWPVSEDIITANSQIEQNEFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SusD superfamily protein
publication title Crystal structure of SusD superfamily protein (NP_809182.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.50 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Polysaccharide binding protein
total genus 175
structure length 456
sequence length 474
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hdxA00
3CK8A 4L7TA 3EHMA 5T3RA 5FQ4A 5LX8A 3CKCA 3LEWA 3NQPA 3OTNA 3KEZA 3GZSA 3HDXA 3L22A 3SNXA 4F53A 4Q69A 4F7AA 3FDHA 5E75A 4MRUA 3JQ1A 5T4YA 3MX3A 3CGHA 3EJNA 3JQ0A 3CK9A 3I4GA 3QNKA 3EHNA 3SGHA 3MYVA 5J90A 3P1UA 5FQ7A 3CK7A 4PUCA 5FQ8A 5E76A 3IV0A 3MCXA 3CKBA 3JYSA 4LERA 5FQ6A
chains in the Genus database with same CATH superfamily
3FUMA 5AQBA 3R7QA 4JPSA 3MKQA 1OWNA 2IONA 1N4QA 4GB9A 3OXFA 1HF8A 2P58C 4KMOA 2WXNA 1E8YA 3QWWA 2J9QA 2LXLA 5LCWC 4LEUA 3UI2A 3JUEA 2VTBA 2J09A 4GYWA 2M63A 1OCCE 3ASDA 3I5PA 1UG3A 2XCCA 2GRLA 2XGOA 4A63B 3LCAA 3UM1A 3ZXPA 4GPMA 1Z3XA 1H6OA 3EHQA 4K03A 5KCMA 3LY9A 3Q78A 4RVBA 4WWNA 4BWRA 3EHMA 4CRWA 5AIJA 3D3MA 2F8YA 4FLHA 2GRRB 2OV8A 3G2VA 2P2CP 5BV1A 1EYHA 3VLDA 4EQFA 4JA9A 4GCOA 5ARFA 1UJKA 3ZHEB 2AXUA 4N3AA 4CGWA 2QZAA 5CRVA 4J0UA 1E8WA 1KT0A 4GPKA 3HRAA 1OCOE 3ASGA 4B8AA 1N4SA 3IKOB 2PL2A 4NIKA 1Z5SC 3EUVA 3D9MA 3J5QB 3MX3A 4LNGA 2YINA 4UQZA 4A55A 2ETBA 2BEDA 1NP7A 3CK8A 4PDXA 2XS1A 1HG2A 3Q9UC 4XE0A 4EZLA 4HBDA 2C0MA 5AJLA 3S7BA 4DX6D 3SF4A 3UQ3A 1NA0A 3D9NA 4A1GA 2UY1B 5EIBE 4UI9K 3SD5A 2R17C 4QFVA 3FHEA 4XI0A 2EINE 2GRPB 2CG2A 3B13A 3EIQC 4G1TA 2F0YA 4AIFA 3ZUVB 3UT8A 3PE3A 1OWPA 4U04A 5HRYA 2R2LA 4UI9C 2F8XK 2BUGA 5A6CA 5BXOA 2I9CA 4N5CA 4J8DA 1FPPA 2J8SD 2H6FA 2XENA 3RRNB 5EYLA 2P9IG 3VLFA 3FDHA 2HYZA 4U8HA 4JW1A 3TGOA 4L9PA 1MYOA 3LJ3A 4U63A 3DPYA 1HZ4A 1JPLA 4ME2A 3FH8A 2P9PG 3HG0D 3Q49B 5EILA 3ZIMA 1N52A 3HVEA 2KBXA 2AXZA 4GMJA 3ML9A 2XPIA 4J8YA 4DLQA 1N0QA 2IOSA 3AU4A 2YNQA 2WXIA 3S7FA 4HLLA 3CVQA 2L0TB 2JEKA 5G2NA 3DPDA 3ISMC 3ABKE 3CHQA 3V2OA 4GZ5A 1DNPA 2KCKA 3CVXA 3ULYA 2IFUA 2WPVA 3B7SA 3B95A 5A23A 2QYJA 2AJAA 2LSUA 1V55E 1VDYA 4JVSA 4FJYA 3FTVA 5CBNA 1JWFA 1K3ZD 5G05J 5IY5E 4O6FA 3HIZA 4W9RA 5CMYA 2VJ8A 3JQ1A 1YCSB 4CCAA 4U7EB 2WXFA 3RIBA 1DCEA 2I2OA 3SHFA 3FEXA 4AY6A 1FT2A 2IJGX 3HDXA 4BSXA 3AG4E 5D0QD 2KCLA 1L5JA 3RU0A 3NZUA 2DIWA 1A17A 4FA6A 3UX4A 3JCKC 4GTVA 4JB8P 4I17A 1KT1A 3CVLA 4APOA 1G3NB 4GZ3A 5EIDA 2GRQB 2L6BA 2IF4A 2VSOE 4HS2A 3LVQE 5CECB 4BESA 2CFZA 3I4RB 3FTWA 3CGHA 4UUCA 4R7LA 3FU6A 3FUFA 1WAO1 5HQ8A 4YDEA 4ATGA 3RSEG 3KD7A 4WWOA 5G55A 3AU5A 2X38A 2IO3C 1MX2A 2OCCE 1E90A 4BTBA 3DSVA 4IYPA 4MBGA 1LD8A 5JMND 4HVBA 3LDZA 4J8EA 1Z6TA 5AARA 2ZISA 1IQRA 2LSVA 2JLBA 3FU5A 4E85A 1TJFA 2V4HC 3NB2A 4KBQA 5LX8A 3HYMB 4FHKA 4N2QA 2OOEA 3FU3A 2C0LA 4V3IA 5AAOA 3DSTA 3ZVVA 3D9PA 3QNKA 2J08A 3BU8A 1RZ4A 3ESKA 4AM9A 3TXNA 4CEMA 1TNUA 1MHQA 1FVFA 3R9AB 3MA5A 4LUNU 4UWFA 1OUVA 1YYHA 2CHXA 3LS8A 2VSXE 3CSFA 4I9EA 5FJYA 1IKND 4O1OA 3T5VA 4HOQA 3TXMA 3TJPA 4JHRA 5B3SE 1O1TA 3L08A 4KZCA 3QWVA 3U64A 3I3NA 2X6IA 3ZRHA 2LAHA 2H6IA 2WMOA 3DRAA 3Q9NC 4G25A 4X8QA 2X3MA 3SQVA 3CKCA 3NQPA 1IHGA 3HXCA 1JCSA 3FFLA 3K9IA 1H2UA 2MYOA 2WXKA 3ZYLA 3DWLG 3D9KA 3EIJA 2FEZA 2XRYA 3PZDA 1YA0A 3P2BA 1WM5A 1HX8A 3ZN3A 2FO1E 3ULQA 2I1JA 3TWTA 3VLEA 3CHOA 3L6AA 5H7PA 1X5BA 3B7TA 4GTTA 4U07A 4B94A 1WDYA 4K0RA 4WNDA 3PEVB 2E0IA 2FBNA 3NBNB 2HM8A 3EDTB 4F3VA 5BXUA 4XZ4A 5ENNA 1MX4A 4UWLA 5KWDA 1E96B 4J6IA 3U66A 2UWJG 4K5BA 3RJVA 3TAXA 4FP7A 5FIOA 1SW6A 3R7RA 2MHKA 5EN5D 3PUKA 2ZU6B 1ELRA 3NOGD 1N9AA 1Z3YA 4ILGA 3JUIA 3EU9A 4DX5D 3QC1A 3PEUB 1HG5A 3RK6A 2DVWA 5G04J 2WXJA 3C3OA 2VGEA 4ATZD 2IY0C 4LRZA 3BUAA 5CERB 1MJ0A 1QNFA 5FQ7A 4JZYA 5J08A 1AWCB 3Q4AB 1EPUA 5T4YA 2Q7FA 2PM7A 3TWQA 1WG0A 3PDNA 2L9BA 2PQRA 4I1OB 1PC2A 4XX5A 3APDA 4HLEA 4OYSA 3FTUA 1NL4A 2V8SE 3FUIA 4EECA 2P9SG 3AG3E 2AXVA 5CEAA 3AG2E 3QKYA 4TXPA 3G2UA 1BLXB 2A5EA 3E30A 3ZKJA 4BT9A 2MOWA 1PAQA 4C48B 2V5FA 5HI7A 2DYSE 3U4TA 3CVUA 2XEEA 4LCTA 4G24A 2XEHA 5FQ6A 4GTSA 2AVPA 4ANVA 4CT0A 3AG1E 1ZBPA 3E32A 3ZEFA 3QAQA 1UOHA 3FWVA 2NSZA 2ZGDA 3L9TA 4UQXA 1N54A 3D9JA 4EBAA 3N71A 3OAWA 3JXIA 1SVXA 5ENSD 1BI8B 2ZGGA 1KZPA 4YNDA 3UM0A 1TR4A 3TWWA 3FUKA 1TNYA 3MKRA 2QC9A 4I43A 3OXGA 3KAEA 5FZRA 2ILRA 3S7JA 3FUDA 1D9SA 4BETA 3HXEA 2AW6A 2H6HA 4DX1A 4N39A 3D9LA 3GZSA 3DBSA 2ZIRA 1N0RA 2PQNA 1UW4B 1H19A 2VGXA 1HU3A 5J90A 4U0SA 4WAFA 3CK7A 4MLPA 4OAUC 2KZTB 2CHWA 5JJ6A 4RSYA 3V30A 2DWZA 4EHMA 2WQ6A 3ESLA 4ILHB 3LXUX 3TL5A 1U2VG 2I1KA 3SBSA 4I2WA 5HKPA 5EKQD 3HXDA 3CSTA 1H6PA 3EU5A 4CZ2D 3C98A 3B7BA 5FQ8A 2EIJE 3PE4A 4GYOA 3UT7A 1FVHA 4K5AB 3CHSA 3V79K 2V5QC 1N94A 3UT4A 5AQ9A 1N4RA 5DIZA 4WUYA 5FZSA 1K1AA 3DEOA 3B7RL 3SFYA 3LY8A 3KSQA 3NZSA 2WXRA 2PNNA 1OCRE 4UI9J 5D0OD 4JHJA 2QY7A 2DZNA 1NZNA 2BKGA 3RO3A 3DEPA 3MKQB 2CHZA 5B1BE 4F1PA 5ITZF 1SQMA 3FUJA 3CK9A 2OEWA 3FUNA 5FT9A 4ABNA 4FU3A 3QDNA 4CDRA 3WXXA 3ZYKA 3E4BA 3B7UX 4UWKA 2V4LA 2VTBB 2GRNB 3EHRA 2WM9A 2NYJA 2Y4TA 5JHAA 4BEPA 4YDOA 3C3RA 1ELWA 3LVRE 4GTOA 5CMWA 2XGMA 2WQHA 3Q47B 3QARA 4QQIA 4HXIA 3HXBA 2B6CA 4N3CA 3UIPC 3TWSA 2GRMA 2FF4A 5BPPA 3QK0A 5FWQA 2RD0A 3Q7FA 3JYSA 2NXPA 1KZOA 1LD7A 3SNXA 2LNIA 4CT4A 2VGYA 2KM4A 4G2VA 4HI9A 3CQCB 1XGWA 3CHPA 5BNWA 3MGBA 3C5RA 1UN8A 1LTXA 4DRXE 1JCQA 2ZXWE 3P1UA 1Y6IA 2WXLA 2J4BA 2CG3A 3IV0A 3CV0A 3BQOA 4GTPA 4C0MA 5EYPF 3ZW3A 1MQSA 2WXMA 2ETCA 4PS8A 3FP3A 5C2YA 4B89A 3ASFA 2WQ7A 5AQAA 1U3DA 4AJWA 3Q5MA 3FUEA 3SFXA 4RG6A 2DYRE 1HFAA 1MZCA 5FTPA 1ELKA 2MRIA 4YVQC 3R9MA 3CVYA 4N3BA 3PNTB 3T5XA 1Y8MA 1E8XA 3L13A 4PS7A 4PS3A 4FULA 4WNGA 3Q73A 5CRUA 5ENOD 3ZYMA 4WWPA 1INZA 5HS0A 1BPOA 4KYOB 3SY2A 4AEZC 3ZPJA 3CIAA 4ILIA 4G26A 1FCHA 2IO2C 2Y4UA 3MJWA 3ZHEA 2EIME 3FEYA 4FHJA 1O1SA 2QFCA 2XGSA 3ASHA 2LO6A 2XCBA 1O5MA 4AY5A 4J8FA 1EF1C 1XNFA 1KPSB 3MV2B 3TWUA 4UWGA 2BKKB 3EHNA 2Y69E 1H0AA 4BTAA 4BX8A 3NOCD 3HVEB 4CDNA 2GROB 2WXGA 4BT8A 4M3OA 4CYMD 1E8ZA 3MEKA 1N4PA 2UY1A 3DSWA 5AYWD 1JCRA 5T3RA 2VSYA 2A4ZA 3UXGA 1RW2A 4LNBA 2WXHA 2OVBA 3TG4A 3W9GA 1OWLA 3EJNA 5LOZA 4EZJA 5LP0A 1TNBA 2Y3AA 4EBAG 2HR2A 3SZ7A 3ABME 1TNOA 4H7XA 4BY6A 1S0PA 4YVOA 1GW6A 2H6GA 3GYZA 5CEDB 3PZ3A 5FZQA 3SGHA 1DCQA 4O60A 3OXLA 3QOUA 3UM3A 4DPRA 4Y6WA 1IQUA 4F53A 3UUXA 3RO2A 4F6RD 3SFZA 4ANXA 1BU9A 4H7YA 2P9LG 3G2WA 1NA3A 3FH7A 2P9NG 4G8KA 3KSLA 2LUHA 3E33A 3S2AA 4Y6CA 2X6HA 1H2TC 3BG1B 4I1AA 2VYIA 4HRLA 2XQ0A 4OVVA 1TN8A 3C72A 5ENTD 2XEVA 2IEJA 4IN3B 4U96D 3SBTB 2WXQA 3ONLA 2RG8A 3L22A 3QWPA 1HH8A 2ONDA 4HOSA 3GZ1A 3FUHA 3AS4A 3I4GA 1X81A 4ANWA 3SO8A 3ABLE 4BFRA 4RLYA 3ENEA 3G2TA 3NF1A 3CLJA 4A3TA 3FTYA 3LKUA 3VTXA 1BD8A 5CBOA 3TWXA 5BV0A 4K5CA 4HRMB 3PREA 4J8SA 3HXFA 1OXJA 3Q7AA 4DI4A 2DZOA 5D2MC 3MYVA 1KLXA 3ASNE 3U9WA 5E76A 3CKBA 2XPYA 1N11A 4DUIA 2VQ2A 5BUZA 3FY4A 4NQ0A 5JA4D 4BX9A 1E7VA 4F7AA 4TRQA 5LCWJ 3CVWA 4U95D 4D10C 2XZDG 3FH5A 5FINA 1SA5A 1TN7A 4EPZA 4GTRA 1S63A 5C1DA 2IU1A 4MKTA 1IHBA 1A5EA 4I6JA 5ENQD 2X6JA 3L82A 5KBAA 4KT6B 4HB5A 4I2ZA 4AP2A 4OAVB 3D9IA 4HRNA 5D66A 3UPVA 3ZFWA 4L2YA 4U0UA 2EIKE 3DSSA 4HFGA 3LY7A 3L17A 1DVPA 1UJJA 5EDSA 4RG9A 5EX3A 3D9OA 4GZ6A 3UM2A 4L1BA 4ZFHA 2GGFA 4F1SA 3HHMA 2XPZA 2JABA 4FJZA 4UQYA 1OY3D 2EILE 4MS6A 1QQEA 1AP7A 4HORA 3MZLB 3T9KA 4FLBA 4HI8A 4Q69A 3KEAA 2X6KA 2XZTG 4GZDA 5AN8A 5M72A 3X2QE 3BG0B 4TV3A 3TWVA 2YQ8A 4ANUA 2Y1LE 2P9UG 2LXMA 3FTSA 3APFA 1V54E 2OVFA 3SI5A 3JXJA 2DCPA 1D8DA 4TUMA 3U3WA 3O4ZA 4GTMA 3AJIA 4N5QA 2X6FA 5EX0A 4YDWA 2R5SA 5ARGA 3CQGB 2R02A 2KATA 3DSUA 1OT8A 3PNLB 4L7TA 3E34A 4LNUD 4DJAA 1JWGA 2KC7A 2L6JA 3PZ4A 4KXKB 2YHCA 3LPZA 4TUUA 3CEQA 2XS8A 4GA1A 2FO7A 5G05C 4XIFA 4YDYA 4JC8A 3PH0C 4M7CA 4HOTA 3W9FA 1YMPA 3RRUA 2E2EA 1TNZA 3C3QA 3PZ2A 5BT1A 3T8KA 2A5UA 4DI3A 5CHEE 4HQDA 3KS2A 1OWMA 3QJZA 2KCVA 1ZU2A 1W3BA 3PS6A 4GZCA 4AXHA 1PY1A 4GMLA 4LERA 4CGVA 2R59A 1QBQA 4B93B 4ACKA 3G2SA 1N95A 3AS8A 4IRUA 4AV7A 1E7UA 1Q2ZA 1SZ9A 2LAIA 1BI7B 4JL0A 4AOFA 5BW8C 1K1BA 2WXPA 2WMNA 3V2XA 2HE0A 1SA4A 4NURA 4KVOA 2R03A 4GA2A 3NAWA 4GU5A 3CHMA 3KEZA 4B0ZA 1TJCA 4L2LA 5JJTA 5E75A 4XEIG 3UKUG 2RFAA 3PRZA 3AS5A 2XRZA 1QYMA 4E6HA 3TWRA 1LF8A 2ETAA 5CCMA 5ANLA 1B89A 3BEEA 4Z68A 1TEZA 3CVPA 2VSNA 5JHBA 3UINC 3D9HA 1MX6A 4XKCA 2GW1A 3S7DA 4U0ZA 1HO8A 2J07A 4BERA 3FU0A 5KJLA 3MCXA 5AQ7A 3QB2A 4G11A 3J5PA 3LEWA 3OTNA 1P5QA 4C9BB 3L16A 3ZNGA 1S70B 1JUQA 4Q96A 1HXIA 3ML8A 2WVIA 4B8CB 4GA0A 5AENA 4G8LA 4DLOA 2Y0BG 1K8KG 5KNHD 1O1RA 3RAUA 3ASOE 4J7WA 4FC8A 5CCLA 4LG6A 1U3CA 3GZ2A 3RRMB 3Q79A 4ACLA 4URKA 4KVMA 5A7DB 3UMVA 4P29A 3DSXA 4Q94A 4GYYA 2NC9A 2WXOA 4GCNA 3E37A 4I6EA 4FADA 4XKBA 4I9CA 1OWOA 2R05A 3ZGQA 4WNFA 2FULA 1HS6A 4U8YD 3URZA 4MRUA 2AWIA 1NI1A 4DX2A 1WY6A 1EDUA 3IHYA 4XI9A 4U8VD 3FTXA 2VGXB 5JJ7A 1TN6A 2IOLA 3O48A 3AAAC 4CDMA 4N2SA 4G23A 3ZYQA 4LSZE 1H2VC 2BF0X 2CFUA 3UIOC 1DC2A 2J4DA 3ULEG 3UKRG 4O1PA 4I6GA 2V0PA 3IHVA 5FQ4A 1OCZE 4L23A 5ENRD 4OVUA 4JXTA 3V31A 2YHEA 2EQXA 4PH4B 4I1MA 4BSZB 3IXEA 3PVLA 3L54A 4TXRA 4TXQA 1QZ2A 4JA7A 4AVXA 4HNAD 5KJMA 3Q75A 4IULA 5LFAA 2HO1A 1SZAA 2XHEA 5AJDA 2I6HA 3DXMG 2PZIA 1S64A 3DXKG 2RFMA 3ZU7B 3CVNA 5KJNA 3TG5A 2BTDA 4KZ0A 4JEHA 4A1SA 1IXVA 5DBKA 4A3VA 3FULA 5KJKA 4ZHBA 3IEGA 3CVVA 4DX7D 5B1AE 3WG7E 5ANRA 4APFA 2L0IA 3ONKA 2KZTA 3ZXSA 3APCA 3FTZA 2PM6A 2P9KG 3CR3A 2OEVA 2WB2A 3T8MA 1H6KA 3IBEA 4WNEA 3MV3B 2RKKA 4GMRA 4JHKA 3CHRA 2B0OE 2KXPC 4NACA 3PUJA 5G04C 4JD2G 1TYQG 2QYUA 3JQ0A 4GAAA 3RKVA 1FT1A 1HE8A 2DBAA 3Q15A 3PZ1A 2IQCA 1UN9A 1ZB1A 3VTYA 4C0EA 4HOUA 3LYAA 2FI7A 2J49A 4JEUA 4EZKA 4UWHA 4NRHB 4GTQA 3GW4A 1IYGA 4RQIA 5T8IA 1NFIE 3UTMA 3F6QA 3LJNA 5ENPD 1D8EA 2C2LA 4PUCA 2F37A 5KNGA 4DK5A
chains in the Genus database with same CATH topology
3TXNA 4HORA 2WQHA 3FUMA 3MZLB 3Q47B 3R7QA 3QARA 4JPSA 4CEMA 3MKQA 4FLBA 1OWNA 4HXIA 1MHQA 1FVFA 4Q69A 3R9AB 2X6KA 2IONA 4N3CA 3MA5A 4LUNU 4GZDA 4GB9A 3OXFA 1HF8A 5M72A 4UWFA 2P58C 2GRMA 4KMOA 1OUVA 3BG0B 2FF4A 2CHXA 1E8YA 2WXNA 4TV3A 3LS8A 5BPPA 3QWWA 3QK0A 5FWQA 2VSXE 3CSFA 4I9EA 2J9QA 2YQ8A 4ANUA 2RD0A 5FJYA 5LCWC 3JYSA 4LEUA 2NXPA 3FTSA 3T5VA 3APFA 4HOQA 2J09A 3TXMA 2VTBA 2OVFA 4GYWA 3TJPA 4JHRA 3SI5A 2M63A 3SNXA 3ASDA 2LNIA 4CT4A 3I5PA 3L08A 1UG3A 2DCPA 2VGYA 2KM4A 2XCCA 3QWVA 4KZCA 2GRLA 2XGOA 4G2VA 3U3WA 3U64A 3CQCB 3LCAA 3O4ZA 1XGWA 3CHPA 3I3NA 2X6IA 5BNWA 3ZRHA 3MGBA 1UN8A 2X6FA 1Z3XA 5EX0A 2R5SA 5ARGA 2LAHA 3CQGB 4K03A 3P1UA 1Y6IA 2WXLA 2J4BA 2CG3A 2WMOA 5KCMA 3IV0A 3LY9A 2KATA 3CV0A 4G25A 3PNLB 4RVBA 4WWNA 4L7TA 4BWRA 2X3MA 3EHMA 4CRWA 5AIJA 4C0MA 3D3MA 4DJAA 3CKCA 3NQPA 4FLHA 1JWGA 1IHGA 3ZW3A 2OV8A 1MQSA 2WXMA 3G2VA 2KC7A 2L6JA 4PS8A 3FFLA 3K9IA 1H2UA 2WXKA 3FP3A 3ZYLA 5C2YA 4B89A 4KXKB 3ASFA 5BV1A 2YHCA 3D9KA 3EIJA 3LPZA 2FEZA 4TUUA 2WQ7A 3CEQA 1EYHA 1U3DA 3VLDA 4AJWA 4EQFA 2XRYA 2FO7A 3PZDA 3Q5MA 4GA1A 5G05C 4JA9A 1YA0A 4XIFA 4GCOA 5ARFA 4JC8A 3P2BA 3FUEA 1UJKA 1WM5A 2AXUA 3PH0C 3ZHEB 4N3AA 4HOTA 4CGWA 4RG6A 3RRUA 4J0UA 1HX8A 2E2EA 3ZN3A 1E8WA 1KT0A 4GPKA 1HFAA 3ASGA 5FTPA 4B8AA 1ELKA 3ULQA 2MRIA 2I1JA 3IKOB 4YVQC 2PL2A 3CVYA 5BT1A 2A5UA 3VLEA 3D9MA 5CHEE 3CHOA 3L6AA 4DI3A 3KS2A 3MX3A 1X5BA 3B7TA 1OWMA 2YINA 3QJZA 4UQZA 4N3BA 3PNTB 4U07A 3T5XA 4A55A 2KCVA 4B94A 1Y8MA 4K0RA 1ZU2A 4WNDA 1E8XA 1W3BA 3PS6A 4GZCA 3PEVB 2E0IA 1PY1A 3L13A 4GMLA 4PS7A 4PS3A 4AXHA 4FULA 4LERA 1NP7A 3CK8A 4PDXA 4CGVA 1HG2A 2R59A 2FBNA 4WNGA 3ZYMA 2HM8A 3EDTB 4XE0A 4ACKA 4WWPA 4F3VA 2C0MA 4XZ4A 4EZLA 1INZA 5ENNA 3G2SA 1BPOA 4UWLA 3AS8A 4IRUA 5AJLA 3S7BA 4AV7A 1E7UA 4KYOB 1SZ9A 4AEZC 2LAIA 4JL0A 3SF4A 3ZPJA 3CIAA 4AOFA 1E96B 5BW8C 4J6IA 3U66A 2WXPA 3UQ3A 4ILIA 2UWJG 4G26A 1NA0A 2WMNA 1FCHA 2Y4UA 3MJWA 3ZHEA 3D9NA 4A1GA 2UY1B 3RJVA 3TAXA 4FP7A 4UI9K 3SD5A 2R17C 4NURA 4KVOA 3R7RA 3FEYA 4FHJA 4GA2A 4QFVA 4GU5A 2QFCA 3CHMA 2XGSA 2MHKA 3KEZA 3ASHA 4B0ZA 1TJCA 2LO6A 3PUKA 2ZU6B 1ELRA 3FHEA 4L2LA 5JJTA 2XCBA 4XI0A 5E75A 4AY5A 4J8FA 3PRZA 2CG2A 3B13A 1Z3YA 4ILGA 1EF1C 3AS5A 1XNFA 3JUIA 2XRZA 3MV2B 4UWGA 4E6HA 1LF8A 3EIQC 3QC1A 3EHNA 3PEUB 4G1TA 1HG5A 1H0AA 5CCMA 3RK6A 5ANLA 4BTAA 4AIFA 5G04J 4BX8A 1B89A 2WXJA 3BEEA 1TEZA 3UT8A 3CVPA 2VSNA 3PE3A 1OWPA 4U04A 3HVEB 4CDNA 5JHBA 2WXGA 4BT8A 4XKCA 2GW1A 3S7DA 4M3OA 1E8ZA 3MEKA 4U0ZA 1HO8A 4LRZA 2J07A 2UY1A 4UI9C 3FU0A 1QNFA 5FQ7A 4JZYA 5AYWD 5J08A 2BUGA 5A6CA 5KJLA 3MCXA 3Q4AB 2I9CA 4N5CA 1EPUA 5T4YA 3QB2A 4J8DA 5T3RA 4G11A 2Q7FA 2PM7A 2VSYA 3LEWA 1P5QA 3OTNA 4C9BB 3L16A 2A4ZA 3RRNB 3PDNA 2L9BA 3VLFA 2PQRA 1JUQA 1PC2A 3FDHA 4I1OB 1HXIA 4Q96A 2HYZA 3ML8A 4XX5A 2WXHA 4U8HA 2OVBA 2WVIA 3TG4A 3APDA 4JW1A 4B8CB 3TGOA 4HLEA 4OYSA 1OWLA 3FTUA 3LJ3A 4GA0A 5AENA 3EJNA 4U63A 5LOZA 4DLOA 2V8SE 3FUIA 4EECA 1HZ4A 1JPLA 4ME2A 3FH8A 3Q49B 4EZJA 5LP0A 3ZIMA 1N52A 2AXVA 4FC8A 3HVEA 5CCLA 2Y3AA 4EBAG 1U3CA 2AXZA 2HR2A 3QKYA 3GZ2A 4GMJA 3RRMB 3SZ7A 3ML9A 4ACLA 2XPIA 3G2UA 4URKA 4KVMA 4H7XA 5A7DB 3UMVA 4BY6A 4DLQA 4P29A 4BT9A 1S0PA 4YVOA 1GW6A 3GYZA 2MOWA 2IOSA 4Q94A 1PAQA 2NC9A 3AU4A 2YNQA 4GYYA 2WXIA 3S7FA 5FZQA 2WXOA 3SGHA 2V5FA 5HI7A 3CVUA 3U4TA 3OXLA 4GCNA 3CVQA 3QOUA 2L0TB 4LCTA 4I6EA 4G24A 4FADA 4XKBA 5FQ6A 2JEKA 4I9CA 1OWOA 2AVPA 5G2NA 3DPDA 3ZGQA 4DPRA 4WNFA 4Y6WA 4ANVA 4CT0A 1IQUA 1ZBPA 2FULA 4F53A 3ZEFA 1HS6A 3CHQA 3QAQA 4GZ5A 3FWVA 3URZA 1DNPA 2NSZA 3UUXA 2KCKA 4MRUA 3CVXA 2AWIA 2IFUA 2WPVA 4UQXA 1N54A 3RO2A 3SFZA 4ANXA 3B7SA 3D9JA 4EBAA 5A23A 3N71A 1WY6A 3OAWA 4H7YA 1EDUA 2LSUA 3G2WA 3IHYA 4XI9A 1NA3A 1VDYA 3FH7A 4JVSA 4FJYA 4YNDA 3FTXA 2VGXB 3S2AA 4Y6CA 3FTVA 5JJ7A 1JWFA 2X6HA 1H2TC 3BG1B 2IOLA 3FUKA 4I1AA 5G05J 4O6FA 2VYIA 3HIZA 3O48A 3MKRA 4W9RA 2XQ0A 4I43A 4CDMA 4OVVA 5CMYA 2VJ8A 4N2SA 3JQ1A 3OXGA 4G23A 3ZYQA 3KAEA 4CCAA 1H2VC 2XEVA 5FZRA 2ILRA 3S7JA 2BF0X 2CFUA 3FUDA 2WXFA 2J4DA 3RIBA 2I2OA 4IN3B 3SBTB 3SHFA 2WXQA 3FEXA 2AW6A 4I6GA 2V0PA 4AY6A 3ONLA 3IHVA 5FQ4A 4N39A 2RG8A 2IJGX 3D9LA 4L23A 3GZSA 3HDXA 3DBSA 3L22A 3QWPA 4OVUA 4JXTA 4BSXA 2YHEA 2PQNA 2KCLA 5D0QD 1HH8A 1L5JA 2ONDA 2EQXA 3RU0A 1UW4B 3NZUA 4PH4B 2DIWA 4HOSA 4I1MA 3GZ1A 3FUHA 3AS4A 1H19A 2VGXA 3I4GA 3PVLA 1A17A 1HU3A 4ANWA 5J90A 3L54A 4U0SA 4WAFA 3CK7A 4FA6A 4MLPA 3UX4A 4BFRA 2KZTB 2CHWA 3ENEA 3G2TA 3JCKC 3NF1A 4RSYA 5JJ6A 1QZ2A 3CLJA 4JA7A 4A3TA 4AVXA 2WQ6A 3ESLA 3FTYA 3LKUA 4ILHB 3LXUX 3TL5A 4I17A 1KT1A 2I1KA 3CVLA 3VTXA 5KJMA 3SBSA 4APOA 4IULA 4I2WA 2HO1A 5LFAA 1SZAA 4GZ3A 2XHEA 5AJDA 5EKQD 5BV0A 3CSTA 2IF4A 2VSOE 2I6HA 4HS2A 3LVQE 3PREA 4J8SA 2CFZA 3I4RB 2PZIA 3FTWA 3CGHA 3C98A 4DI4A 3CVNA 1KLXA 3MYVA 3U9WA 4R7LA 5FQ8A 5E76A 3FU6A 3FUFA 1WAO1 3CKBA 5HQ8A 5KJNA 2XPYA 3TG5A 2VQ2A 2BTDA 3PE4A 3FY4A 4GYOA 4JEHA 4KZ0A 5BUZA 3UT7A 1FVHA 4NQ0A 4A1SA 4BX9A 3CHSA 4ATGA 1E7VA 4F7AA 5DBKA 3UT4A 3FULA 4TRQA 3KD7A 4WWOA 4A3VA 3IEGA 5KJKA 5LCWJ 3CVVA 3CVWA 5DIZA 5ANRA 4D10C 4WUYA 4APFA 5G55A 5FZSA 2L0IA 3ONKA 3AU5A 3FH5A 3B7RL 3LY8A 2KZTA 2X38A 4EPZA 3ZXSA 3APCA 4BTBA 1E90A 3NZSA 2IU1A 2PM6A 3FTZA 5C1DA 2WXRA 3CR3A 4MKTA 4IYPA 4I6JA 4UI9J 5D0OD 4HVBA 4JHJA 2WB2A 2QY7A 3LDZA 3T8MA 2X6JA 1NZNA 1H6KA 4J8EA 1Z6TA 3IBEA 4WNEA 3MV3B 3RO3A 4KT6B 3MKQB 2CHZA 4JHKA 3CHRA 4I2ZA 4NACA 4AP2A 1IQRA 1SQMA 3PUJA 3D9IA 3FUJA 5G04C 3CK9A 3JQ0A 4GAAA 2LSVA 3RKVA 3FUNA 1HE8A 3Q15A 2DBAA 5FT9A 3ZFWA 4ABNA 2JLBA 3UPVA 4FU3A 4L2YA 4U0UA 3QDNA 4CDRA 2IQCA 1UN9A 3FU5A 3WXXA 4E85A 1TJFA 3VTYA 4C0EA 4KBQA 4HOUA 3ZYKA 3E4BA 3B7UX 3LYAA 2FI7A 2J49A 4JEUA 4HFGA 4UWKA 4EZKA 5LX8A 3HYMB 3LY7A 4FHKA 2V4LA 3L17A 2VTBB 1DVPA 1UJJA 4UWHA 5EDSA 4N2QA 4NRHB 4RG9A 2OOEA 3FU3A 3GW4A 1IYGA 2WM9A 5EX3A 5T8IA 2C0LA 4V3IA 3D9OA 4GZ6A 2Y4TA 4L1BA 5JHAA 2GGFA 4F1SA 3HHMA 3ZVVA 2XPZA 3D9PA 1ELWA 2C2LA 2J08A 3QNKA 4FJZA 4UQYA 3LVRE 4PUCA 3ESKA 5CMWA 4MS6A 4DK5A 4AM9A 1QQEA 2XGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK8 A;  4L7T A;  3EHM A;  5T3R A;  5FQ4 A;  5LX8 A;  3CKC A;  3LEW A;  3NQP A;  3OTN A;  3KEZ A;  3GZS A;  3HDX A;  3L22 A;  3SNX A;  4F53 A;  4Q69 A;  4F7A A;  3FDH A;  5E75 A;  4MRU A;  3JQ1 A;  5T4Y A;  3MX3 A;  3CGH A;  3EJN A;  3JQ0 A;  3CK9 A;  3I4G A;  3QNK A;  3EHN A;  3SGH A;  3MYV A;  5J90 A;  3P1U A;  5FQ7 A;  3CK7 A;  4PUC A;  5FQ8 A;  5E76 A;  3IV0 A;  3MCX A;  3CKB A;  3JYS A;  4LER A;  5FQ6 A; 
#chains in the Genus database with same CATH topology
 3FUM A;  5AQB A;  3R7Q A;  4JPS A;  3MKQ A;  1OWN A;  2ION A;  1N4Q A;  4GB9 A;  3OXF A;  1HF8 A;  2P58 C;  4KMO A;  2WXN A;  1E8Y A;  3QWW A;  2J9Q A;  2LXL A;  5LCW C;  4LEU A;  3UI2 A;  3JUE A;  2VTB A;  2J09 A;  4GYW A;  2M63 A;  1OCC E;  3ASD A;  3I5P A;  1UG3 A;  2XCC A;  2GRL A;  2XGO A;  4A63 B;  3LCA A;  3UM1 A;  3ZXP A;  4GPM A;  1Z3X A;  1H6O A;  3EHQ A;  4K03 A;  5KCM A;  3LY9 A;  3Q78 A;  4RVB A;  4WWN A;  4BWR A;  3EHM A;  4CRW A;  5AIJ A;  3D3M A;  2F8Y A;  4FLH A;  2GRR B;  2OV8 A;  3G2V A;  2P2C P;  5BV1 A;  1EYH A;  3VLD A;  4EQF A;  4JA9 A;  4GCO A;  5ARF A;  1UJK A;  3ZHE B;  2AXU A;  4N3A A;  4CGW A;  2QZA A;  5CRV A;  4J0U A;  1E8W A;  1KT0 A;  4GPK A;  3HRA A;  1OCO E;  3ASG A;  4B8A A;  1N4S A;  3IKO B;  2PL2 A;  4NIK A;  1Z5S C;  3EUV A;  3D9M A;  3J5Q B;  3MX3 A;  4LNG A;  2YIN A;  4UQZ A;  4A55 A;  2ETB A;  2BED A;  1NP7 A;  3CK8 A;  4PDX A;  2XS1 A;  1HG2 A;  3Q9U C;  4XE0 A;  4EZL A;  4HBD A;  2C0M A;  5AJL A;  3S7B A;  4DX6 D;  3SF4 A;  3UQ3 A;  1NA0 A;  3D9N A;  4A1G A;  2UY1 B;  5EIB E;  4UI9 K;  3SD5 A;  2R17 C;  4QFV A;  3FHE A;  4XI0 A;  2EIN E;  2GRP B;  2CG2 A;  3B13 A;  3EIQ C;  4G1T A;  2F0Y A;  4AIF A;  3ZUV B;  3UT8 A;  3PE3 A;  1OWP A;  4U04 A;  5HRY A;  2R2L A;  4UI9 C;  2F8X K;  2BUG A;  5A6C A;  5BXO A;  2I9C A;  4N5C A;  4J8D A;  1FPP A;  2J8S D;  2H6F A;  2XEN A;  3RRN B;  5EYL A;  2P9I G;  3VLF A;  3FDH A;  2HYZ A;  4U8H A;  4JW1 A;  3TGO A;  4L9P A;  1MYO A;  3LJ3 A;  4U63 A;  3DPY A;  1HZ4 A;  1JPL A;  4ME2 A;  3FH8 A;  2P9P G;  3HG0 D;  3Q49 B;  5EIL A;  3ZIM A;  1N52 A;  3HVE A;  2KBX A;  2AXZ A;  4GMJ A;  3ML9 A;  2XPI A;  4J8Y A;  4DLQ A;  1N0Q A;  2IOS A;  3AU4 A;  2YNQ A;  2WXI A;  3S7F A;  4HLL A;  3CVQ A;  2L0T B;  2JEK A;  5G2N A;  3DPD A;  3ISM C;  3ABK E;  3CHQ A;  3V2O A;  4GZ5 A;  1DNP A;  2KCK A;  3CVX A;  3ULY A;  2IFU A;  2WPV A;  3B7S A;  3B95 A;  5A23 A;  2QYJ A;  2AJA A;  2LSU A;  1V55 E;  1VDY A;  4JVS A;  4FJY A;  3FTV A;  5CBN A;  1JWF A;  1K3Z D;  5G05 J;  5IY5 E;  4O6F A;  3HIZ A;  4W9R A;  5CMY A;  2VJ8 A;  3JQ1 A;  1YCS B;  4CCA A;  4U7E B;  2WXF A;  3RIB A;  1DCE A;  2I2O A;  3SHF A;  3FEX A;  4AY6 A;  1FT2 A;  2IJG X;  3HDX A;  4BSX A;  3AG4 E;  5D0Q D;  2KCL A;  1L5J A;  3RU0 A;  3NZU A;  2DIW A;  1A17 A;  4FA6 A;  3UX4 A;  3JCK C;  4GTV A;  4JB8 P;  4I17 A;  1KT1 A;  3CVL A;  4APO A;  1G3N B;  4GZ3 A;  5EID A;  2GRQ B;  2L6B A;  2IF4 A;  2VSO E;  4HS2 A;  3LVQ E;  5CEC B;  4BES A;  2CFZ A;  3I4R B;  3FTW A;  3CGH A;  4UUC A;  4R7L A;  3FU6 A;  3FUF A;  1WAO 1;  5HQ8 A;  4YDE A;  4ATG A;  3RSE G;  3KD7 A;  4WWO A;  5G55 A;  3AU5 A;  2X38 A;  2IO3 C;  1MX2 A;  2OCC E;  1E90 A;  4BTB A;  3DSV A;  4IYP A;  4MBG A;  1LD8 A;  5JMN D;  4HVB A;  3LDZ A;  4J8E A;  1Z6T A;  5AAR A;  2ZIS A;  1IQR A;  2LSV A;  2JLB A;  3FU5 A;  4E85 A;  1TJF A;  2V4H C;  3NB2 A;  4KBQ A;  5LX8 A;  3HYM B;  4FHK A;  4N2Q A;  2OOE A;  3FU3 A;  2C0L A;  4V3I A;  5AAO A;  3DST A;  3ZVV A;  3D9P A;  3QNK A;  2J08 A;  3BU8 A;  1RZ4 A;  3ESK A;  4AM9 A;  3TXN A;  4CEM A;  1TNU A;  1MHQ A;  1FVF A;  3R9A B;  3MA5 A;  4LUN U;  4UWF A;  1OUV A;  1YYH A;  2CHX A;  3LS8 A;  2VSX E;  3CSF A;  4I9E A;  5FJY A;  1IKN D;  4O1O A;  3T5V A;  4HOQ A;  3TXM A;  3TJP A;  4JHR A;  5B3S E;  1O1T A;  3L08 A;  4KZC A;  3QWV A;  3U64 A;  3I3N A;  2X6I A;  3ZRH A;  2LAH A;  2H6I A;  2WMO A;  3DRA A;  3Q9N C;  4G25 A;  4X8Q A;  2X3M A;  3SQV A;  3CKC A;  3NQP A;  1IHG A;  3HXC A;  1JCS A;  3FFL A;  3K9I A;  1H2U A;  2MYO A;  2WXK A;  3ZYL A;  3DWL G;  3D9K A;  3EIJ A;  2FEZ A;  2XRY A;  3PZD A;  1YA0 A;  3P2B A;  1WM5 A;  1HX8 A;  3ZN3 A;  2FO1 E;  3ULQ A;  2I1J A;  3TWT A;  3VLE A;  3CHO A;  3L6A A;  5H7P A;  1X5B A;  3B7T A;  4GTT A;  4U07 A;  4B94 A;  1WDY A;  4K0R A;  4WND A;  3PEV B;  2E0I A;  2FBN A;  3NBN B;  2HM8 A;  3EDT B;  4F3V A;  5BXU A;  4XZ4 A;  5ENN A;  1MX4 A;  4UWL A;  5KWD A;  1E96 B;  4J6I A;  3U66 A;  2UWJ G;  4K5B A;  3RJV A;  3TAX A;  4FP7 A;  5FIO A;  1SW6 A;  3R7R A;  2MHK A;  5EN5 D;  3PUK A;  2ZU6 B;  1ELR A;  3NOG D;  1N9A A;  1Z3Y A;  4ILG A;  3JUI A;  3EU9 A;  4DX5 D;  3QC1 A;  3PEU B;  1HG5 A;  3RK6 A;  2DVW A;  5G04 J;  2WXJ A;  3C3O A;  2VGE A;  4ATZ D;  2IY0 C;  4LRZ A;  3BUA A;  5CER B;  1MJ0 A;  1QNF A;  5FQ7 A;  4JZY A;  5J08 A;  1AWC B;  3Q4A B;  1EPU A;  5T4Y A;  2Q7F A;  2PM7 A;  3TWQ A;  1WG0 A;  3PDN A;  2L9B A;  2PQR A;  4I1O B;  1PC2 A;  4XX5 A;  3APD A;  4HLE A;  4OYS A;  3FTU A;  1NL4 A;  2V8S E;  3FUI A;  4EEC A;  2P9S G;  3AG3 E;  2AXV A;  5CEA A;  3AG2 E;  3QKY A;  4TXP A;  3G2U A;  1BLX B;  2A5E A;  3E30 A;  3ZKJ A;  4BT9 A;  2MOW A;  1PAQ A;  4C48 B;  2V5F A;  5HI7 A;  2DYS E;  3U4T A;  3CVU A;  2XEE A;  4LCT A;  4G24 A;  2XEH A;  5FQ6 A;  4GTS A;  2AVP A;  4ANV A;  4CT0 A;  3AG1 E;  1ZBP A;  3E32 A;  3ZEF A;  3QAQ A;  1UOH A;  3FWV A;  2NSZ A;  2ZGD A;  3L9T A;  4UQX A;  1N54 A;  3D9J A;  4EBA A;  3N71 A;  3OAW A;  3JXI A;  1SVX A;  5ENS D;  1BI8 B;  2ZGG A;  1KZP A;  4YND A;  3UM0 A;  1TR4 A;  3TWW A;  3FUK A;  1TNY A;  3MKR A;  2QC9 A;  4I43 A;  3OXG A;  3KAE A;  5FZR A;  2ILR A;  3S7J A;  3FUD A;  1D9S A;  4BET A;  3HXE A;  2AW6 A;  2H6H A;  4DX1 A;  4N39 A;  3D9L A;  3GZS A;  3DBS A;  2ZIR A;  1N0R A;  2PQN A;  1UW4 B;  1H19 A;  2VGX A;  1HU3 A;  5J90 A;  4U0S A;  4WAF A;  3CK7 A;  4MLP A;  4OAU C;  2KZT B;  2CHW A;  5JJ6 A;  4RSY A;  3V30 A;  2DWZ A;  4EHM A;  2WQ6 A;  3ESL A;  4ILH B;  3LXU X;  3TL5 A;  1U2V G;  2I1K A;  3SBS A;  4I2W A;  5HKP A;  5EKQ D;  3HXD A;  3CST A;  1H6P A;  3EU5 A;  4CZ2 D;  3C98 A;  3B7B A;  5FQ8 A;  2EIJ E;  3PE4 A;  4GYO A;  3UT7 A;  1FVH A;  4K5A B;  3CHS A;  3V79 K;  2V5Q C;  1N94 A;  3UT4 A;  5AQ9 A;  1N4R A;  5DIZ A;  4WUY A;  5FZS A;  1K1A A;  3DEO A;  3B7R L;  3SFY A;  3LY8 A;  3KSQ A;  3NZS A;  2WXR A;  2PNN A;  1OCR E;  4UI9 J;  5D0O D;  4JHJ A;  2QY7 A;  2DZN A;  1NZN A;  2BKG A;  3RO3 A;  3DEP A;  3MKQ B;  2CHZ A;  5B1B E;  4F1P A;  5ITZ F;  1SQM A;  3FUJ A;  3CK9 A;  2OEW A;  3FUN A;  5FT9 A;  4ABN A;  4FU3 A;  3QDN A;  4CDR A;  3WXX A;  3ZYK A;  3E4B A;  3B7U X;  4UWK A;  2V4L A;  2VTB B;  2GRN B;  3EHR A;  2WM9 A;  2NYJ A;  2Y4T A;  5JHA A;  4BEP A;  4YDO A;  3C3R A;  1ELW A;  3LVR E;  4GTO A;  5CMW A;  2XGM A;  2WQH A;  3Q47 B;  3QAR A;  4QQI A;  4HXI A;  3HXB A;  2B6C A;  4N3C A;  3UIP C;  3TWS A;  2GRM A;  2FF4 A;  5BPP A;  3QK0 A;  5FWQ A;  2RD0 A;  3Q7F A;  3JYS A;  2NXP A;  1KZO A;  1LD7 A;  3SNX A;  2LNI A;  4CT4 A;  2VGY A;  2KM4 A;  4G2V A;  4HI9 A;  3CQC B;  1XGW A;  3CHP A;  5BNW A;  3MGB A;  3C5R A;  1UN8 A;  1LTX A;  4DRX E;  1JCQ A;  2ZXW E;  3P1U A;  1Y6I A;  2WXL A;  2J4B A;  2CG3 A;  3IV0 A;  3CV0 A;  3BQO A;  4GTP A;  4C0M A;  5EYP F;  3ZW3 A;  1MQS A;  2WXM A;  2ETC A;  4PS8 A;  3FP3 A;  5C2Y A;  4B89 A;  3ASF A;  2WQ7 A;  5AQA A;  1U3D A;  4AJW A;  3Q5M A;  3FUE A;  3SFX A;  4RG6 A;  2DYR E;  1HFA A;  1MZC A;  5FTP A;  1ELK A;  2MRI A;  4YVQ C;  3R9M A;  3CVY A;  4N3B A;  3PNT B;  3T5X A;  1Y8M A;  1E8X A;  3L13 A;  4PS7 A;  4PS3 A;  4FUL A;  4WNG A;  3Q73 A;  5CRU A;  5ENO D;  3ZYM A;  4WWP A;  1INZ A;  5HS0 A;  1BPO A;  4KYO B;  3SY2 A;  4AEZ C;  3ZPJ A;  3CIA A;  4ILI A;  4G26 A;  1FCH A;  2IO2 C;  2Y4U A;  3MJW A;  3ZHE A;  2EIM E;  3FEY A;  4FHJ A;  1O1S A;  2QFC A;  2XGS A;  3ASH A;  2LO6 A;  2XCB A;  1O5M A;  4AY5 A;  4J8F A;  1EF1 C;  1XNF A;  1KPS B;  3MV2 B;  3TWU A;  4UWG A;  2BKK B;  3EHN A;  2Y69 E;  1H0A A;  4BTA A;  4BX8 A;  3NOC D;  3HVE B;  4CDN A;  2GRO B;  2WXG A;  4BT8 A;  4M3O A;  4CYM D;  1E8Z A;  3MEK A;  1N4P A;  2UY1 A;  3DSW A;  5AYW D;  1JCR A;  5T3R A;  2VSY A;  2A4Z A;  3UXG A;  1RW2 A;  4LNB A;  2WXH A;  2OVB A;  3TG4 A;  3W9G A;  1OWL A;  3EJN A;  5LOZ A;  4EZJ A;  5LP0 A;  1TNB A;  2Y3A A;  4EBA G;  2HR2 A;  3SZ7 A;  3ABM E;  1TNO A;  4H7X A;  4BY6 A;  1S0P A;  4YVO A;  1GW6 A;  2H6G A;  3GYZ A;  5CED B;  3PZ3 A;  5FZQ A;  3SGH A;  1DCQ A;  4O60 A;  3OXL A;  3QOU A;  3UM3 A;  4DPR A;  4Y6W A;  1IQU A;  4F53 A;  3UUX A;  3RO2 A;  4F6R D;  3SFZ A;  4ANX A;  1BU9 A;  4H7Y A;  2P9L G;  3G2W A;  1NA3 A;  3FH7 A;  2P9N G;  4G8K A;  3KSL A;  2LUH A;  3E33 A;  3S2A A;  4Y6C A;  2X6H A;  1H2T C;  3BG1 B;  4I1A A;  2VYI A;  4HRL A;  2XQ0 A;  4OVV A;  1TN8 A;  3C72 A;  5ENT D;  2XEV A;  2IEJ A;  4IN3 B;  4U96 D;  3SBT B;  2WXQ A;  3ONL A;  2RG8 A;  3L22 A;  3QWP A;  1HH8 A;  2OND A;  4HOS A;  3GZ1 A;  3FUH A;  3AS4 A;  3I4G A;  1X81 A;  4ANW A;  3SO8 A;  3ABL E;  4BFR A;  4RLY A;  3ENE A;  3G2T A;  3NF1 A;  3CLJ A;  4A3T A;  3FTY A;  3LKU A;  3VTX A;  1BD8 A;  5CBO A;  3TWX A;  5BV0 A;  4K5C A;  4HRM B;  3PRE A;  4J8S A;  3HXF A;  1OXJ A;  3Q7A A;  4DI4 A;  2DZO A;  5D2M C;  3MYV A;  1KLX A;  3ASN E;  3U9W A;  5E76 A;  3CKB A;  2XPY A;  1N11 A;  4DUI A;  2VQ2 A;  5BUZ A;  3FY4 A;  4NQ0 A;  5JA4 D;  4BX9 A;  1E7V A;  4F7A A;  4TRQ A;  5LCW J;  3CVW A;  4U95 D;  4D10 C;  2XZD G;  3FH5 A;  5FIN A;  1SA5 A;  1TN7 A;  4EPZ A;  4GTR A;  1S63 A;  5C1D A;  2IU1 A;  4MKT A;  1IHB A;  1A5E A;  4I6J A;  5ENQ D;  2X6J A;  3L82 A;  5KBA A;  4KT6 B;  4HB5 A;  4I2Z A;  4AP2 A;  4OAV B;  3D9I A;  4HRN A;  5D66 A;  3UPV A;  3ZFW A;  4L2Y A;  4U0U A;  2EIK E;  3DSS A;  4HFG A;  3LY7 A;  3L17 A;  1DVP A;  1UJJ A;  5EDS A;  4RG9 A;  5EX3 A;  3D9O A;  4GZ6 A;  3UM2 A;  4L1B A;  4ZFH A;  2GGF A;  4F1S A;  3HHM A;  2XPZ A;  2JAB A;  4FJZ A;  4UQY A;  1OY3 D;  2EIL E;  4MS6 A;  1QQE A;  1AP7 A;  4HOR A;  3MZL B;  3T9K A;  4FLB A;  4HI8 A;  4Q69 A;  3KEA A;  2X6K A;  2XZT G;  4GZD A;  5AN8 A;  5M72 A;  3X2Q E;  3BG0 B;  4TV3 A;  3TWV A;  2YQ8 A;  4ANU A;  2Y1L E;  2P9U G;  2LXM A;  3FTS A;  3APF A;  1V54 E;  2OVF A;  3SI5 A;  3JXJ A;  2DCP A;  1D8D A;  4TUM A;  3U3W A;  3O4Z A;  4GTM A;  3AJI A;  4N5Q A;  2X6F A;  5EX0 A;  4YDW A;  2R5S A;  5ARG A;  3CQG B;  2R02 A;  2KAT A;  3DSU A;  1OT8 A;  3PNL B;  4L7T A;  3E34 A;  4LNU D;  4DJA A;  1JWG A;  2KC7 A;  2L6J A;  3PZ4 A;  4KXK B;  2YHC A;  3LPZ A;  4TUU A;  3CEQ A;  2XS8 A;  4GA1 A;  2FO7 A;  5G05 C;  4XIF A;  4YDY A;  4JC8 A;  3PH0 C;  4M7C A;  4HOT A;  3W9F A;  1YMP A;  3RRU A;  2E2E A;  1TNZ A;  3C3Q A;  3PZ2 A;  5BT1 A;  3T8K A;  2A5U A;  4DI3 A;  5CHE E;  4HQD A;  3KS2 A;  1OWM A;  3QJZ A;  2KCV A;  1ZU2 A;  1W3B A;  3PS6 A;  4GZC A;  4AXH A;  1PY1 A;  4GML A;  4LER A;  4CGV A;  2R59 A;  1QBQ A;  4B93 B;  4ACK A;  3G2S A;  1N95 A;  3AS8 A;  4IRU A;  4AV7 A;  1E7U A;  1Q2Z A;  1SZ9 A;  2LAI A;  1BI7 B;  4JL0 A;  4AOF A;  5BW8 C;  1K1B A;  2WXP A;  2WMN A;  3V2X A;  2HE0 A;  1SA4 A;  4NUR A;  4KVO A;  2R03 A;  4GA2 A;  3NAW A;  4GU5 A;  3CHM A;  3KEZ A;  4B0Z A;  1TJC A;  4L2L A;  5JJT A;  5E75 A;  4XEI G;  3UKU G;  2RFA A;  3PRZ A;  3AS5 A;  2XRZ A;  1QYM A;  4E6H A;  3TWR A;  1LF8 A;  2ETA A;  5CCM A;  5ANL A;  1B89 A;  3BEE A;  4Z68 A;  1TEZ A;  3CVP A;  2VSN A;  5JHB A;  3UIN C;  3D9H A;  1MX6 A;  4XKC A;  2GW1 A;  3S7D A;  4U0Z A;  1HO8 A;  2J07 A;  4BER A;  3FU0 A;  5KJL A;  3MCX A;  5AQ7 A;  3QB2 A;  4G11 A;  3J5P A;  3LEW A;  3OTN A;  1P5Q A;  4C9B B;  3L16 A;  3ZNG A;  1S70 B;  1JUQ A;  4Q96 A;  1HXI A;  3ML8 A;  2WVI A;  4B8C B;  4GA0 A;  5AEN A;  4G8L A;  4DLO A;  2Y0B G;  1K8K G;  5KNH D;  1O1R A;  3RAU A;  3ASO E;  4J7W A;  4FC8 A;  5CCL A;  4LG6 A;  1U3C A;  3GZ2 A;  3RRM B;  3Q79 A;  4ACL A;  4URK A;  4KVM A;  5A7D B;  3UMV A;  4P29 A;  3DSX A;  4Q94 A;  4GYY A;  2NC9 A;  2WXO A;  4GCN A;  3E37 A;  4I6E A;  4FAD A;  4XKB A;  4I9C A;  1OWO A;  2R05 A;  3ZGQ A;  4WNF A;  2FUL A;  1HS6 A;  4U8Y D;  3URZ A;  4MRU A;  2AWI A;  1NI1 A;  4DX2 A;  1WY6 A;  1EDU A;  3IHY A;  4XI9 A;  4U8V D;  3FTX A;  2VGX B;  5JJ7 A;  1TN6 A;  2IOL A;  3O48 A;  3AAA C;  4CDM A;  4N2S A;  4G23 A;  3ZYQ A;  4LSZ E;  1H2V C;  2BF0 X;  2CFU A;  3UIO C;  1DC2 A;  2J4D A;  3ULE G;  3UKR G;  4O1P A;  4I6G A;  2V0P A;  3IHV A;  5FQ4 A;  1OCZ E;  4L23 A;  5ENR D;  4OVU A;  4JXT A;  3V31 A;  2YHE A;  2EQX A;  4PH4 B;  4I1M A;  4BSZ B;  3IXE A;  3PVL A;  3L54 A;  4TXR A;  4TXQ A;  1QZ2 A;  4JA7 A;  4AVX A;  4HNA D;  5KJM A;  3Q75 A;  4IUL A;  5LFA A;  2HO1 A;  1SZA A;  2XHE A;  5AJD A;  2I6H A;  3DXM G;  2PZI A;  1S64 A;  3DXK G;  2RFM A;  3ZU7 B;  3CVN A;  5KJN A;  3TG5 A;  2BTD A;  4KZ0 A;  4JEH A;  4A1S A;  1IXV A;  5DBK A;  4A3V A;  3FUL A;  5KJK A;  4ZHB A;  3IEG A;  3CVV A;  4DX7 D;  5B1A E;  3WG7 E;  5ANR A;  4APF A;  2L0I A;  3ONK A;  2KZT A;  3ZXS A;  3APC A;  3FTZ A;  2PM6 A;  2P9K G;  3CR3 A;  2OEV A;  2WB2 A;  3T8M A;  1H6K A;  3IBE A;  4WNE A;  3MV3 B;  2RKK A;  4GMR A;  4JHK A;  3CHR A;  2B0O E;  2KXP C;  4NAC A;  3PUJ A;  5G04 C;  4JD2 G;  1TYQ G;  2QYU A;  3JQ0 A;  4GAA A;  3RKV A;  1FT1 A;  1HE8 A;  2DBA A;  3Q15 A;  3PZ1 A;  2IQC A;  1UN9 A;  1ZB1 A;  3VTY A;  4C0E A;  4HOU A;  3LYA A;  2FI7 A;  2J49 A;  4JEU A;  4EZK A;  4UWH A;  4NRH B;  4GTQ A;  3GW4 A;  1IYG A;  4RQI A;  5T8I A;  1NFI E;  3UTM A;  3F6Q A;  3LJN A;  5ENP D;  1D8E A;  2C2L A;  4PUC A;  2F37 A;  5KNG A;  4DK5 A; 
#chains in the Genus database with same CATH homology
 3TXN A;  4HOR A;  2WQH A;  3FUM A;  3MZL B;  3Q47 B;  3R7Q A;  3QAR A;  4JPS A;  4CEM A;  3MKQ A;  4FLB A;  1OWN A;  4HXI A;  1MHQ A;  1FVF A;  4Q69 A;  3R9A B;  2X6K A;  2ION A;  4N3C A;  3MA5 A;  4LUN U;  4GZD A;  4GB9 A;  3OXF A;  1HF8 A;  5M72 A;  4UWF A;  2P58 C;  2GRM A;  4KMO A;  1OUV A;  3BG0 B;  2FF4 A;  2CHX A;  1E8Y A;  2WXN A;  4TV3 A;  3LS8 A;  5BPP A;  3QWW A;  3QK0 A;  5FWQ A;  2VSX E;  3CSF A;  4I9E A;  2J9Q A;  2YQ8 A;  4ANU A;  2RD0 A;  5FJY A;  5LCW C;  3JYS A;  4LEU A;  2NXP A;  3FTS A;  3T5V A;  3APF A;  4HOQ A;  2J09 A;  3TXM A;  2VTB A;  2OVF A;  4GYW A;  3TJP A;  4JHR A;  3SI5 A;  2M63 A;  3SNX A;  3ASD A;  2LNI A;  4CT4 A;  3I5P A;  3L08 A;  1UG3 A;  2DCP A;  2VGY A;  2KM4 A;  2XCC A;  3QWV A;  4KZC A;  2GRL A;  2XGO A;  4G2V A;  3U3W A;  3U64 A;  3CQC B;  3LCA A;  3O4Z A;  1XGW A;  3CHP A;  3I3N A;  2X6I A;  5BNW A;  3ZRH A;  3MGB A;  1UN8 A;  2X6F A;  1Z3X A;  5EX0 A;  2R5S A;  5ARG A;  2LAH A;  3CQG B;  4K03 A;  3P1U A;  1Y6I A;  2WXL A;  2J4B A;  2CG3 A;  2WMO A;  5KCM A;  3IV0 A;  3LY9 A;  2KAT A;  3CV0 A;  4G25 A;  3PNL B;  4RVB A;  4WWN A;  4L7T A;  4BWR A;  2X3M A;  3EHM A;  4CRW A;  5AIJ A;  4C0M A;  3D3M A;  4DJA A;  3CKC A;  3NQP A;  4FLH A;  1JWG A;  1IHG A;  3ZW3 A;  2OV8 A;  1MQS A;  2WXM A;  3G2V A;  2KC7 A;  2L6J A;  4PS8 A;  3FFL A;  3K9I A;  1H2U A;  2WXK A;  3FP3 A;  3ZYL A;  5C2Y A;  4B89 A;  4KXK B;  3ASF A;  5BV1 A;  2YHC A;  3D9K A;  3EIJ A;  3LPZ A;  2FEZ A;  4TUU A;  2WQ7 A;  3CEQ A;  1EYH A;  1U3D A;  3VLD A;  4AJW A;  4EQF A;  2XRY A;  2FO7 A;  3PZD A;  3Q5M A;  4GA1 A;  5G05 C;  4JA9 A;  1YA0 A;  4XIF A;  4GCO A;  5ARF A;  4JC8 A;  3P2B A;  3FUE A;  1UJK A;  1WM5 A;  2AXU A;  3PH0 C;  3ZHE B;  4N3A A;  4HOT A;  4CGW A;  4RG6 A;  3RRU A;  4J0U A;  1HX8 A;  2E2E A;  3ZN3 A;  1E8W A;  1KT0 A;  4GPK A;  1HFA A;  3ASG A;  5FTP A;  4B8A A;  1ELK A;  3ULQ A;  2MRI A;  2I1J A;  3IKO B;  4YVQ C;  2PL2 A;  3CVY A;  5BT1 A;  2A5U A;  3VLE A;  3D9M A;  5CHE E;  3CHO A;  3L6A A;  4DI3 A;  3KS2 A;  3MX3 A;  1X5B A;  3B7T A;  1OWM A;  2YIN A;  3QJZ A;  4UQZ A;  4N3B A;  3PNT B;  4U07 A;  3T5X A;  4A55 A;  2KCV A;  4B94 A;  1Y8M A;  4K0R A;  1ZU2 A;  4WND A;  1E8X A;  1W3B A;  3PS6 A;  4GZC A;  3PEV B;  2E0I A;  1PY1 A;  3L13 A;  4GML A;  4PS7 A;  4PS3 A;  4AXH A;  4FUL A;  4LER A;  1NP7 A;  3CK8 A;  4PDX A;  4CGV A;  1HG2 A;  2R59 A;  2FBN A;  4WNG A;  3ZYM A;  2HM8 A;  3EDT B;  4XE0 A;  4ACK A;  4WWP A;  4F3V A;  2C0M A;  4XZ4 A;  4EZL A;  1INZ A;  5ENN A;  3G2S A;  1BPO A;  4UWL A;  3AS8 A;  4IRU A;  5AJL A;  3S7B A;  4AV7 A;  1E7U A;  4KYO B;  1SZ9 A;  4AEZ C;  2LAI A;  4JL0 A;  3SF4 A;  3ZPJ A;  3CIA A;  4AOF A;  1E96 B;  5BW8 C;  4J6I A;  3U66 A;  2WXP A;  3UQ3 A;  4ILI A;  2UWJ G;  4G26 A;  1NA0 A;  2WMN A;  1FCH A;  2Y4U A;  3MJW A;  3ZHE A;  3D9N A;  4A1G A;  2UY1 B;  3RJV A;  3TAX A;  4FP7 A;  4UI9 K;  3SD5 A;  2R17 C;  4NUR A;  4KVO A;  3R7R A;  3FEY A;  4FHJ A;  4GA2 A;  4QFV A;  4GU5 A;  2QFC A;  3CHM A;  2XGS A;  2MHK A;  3KEZ A;  3ASH A;  4B0Z A;  1TJC A;  2LO6 A;  3PUK A;  2ZU6 B;  1ELR A;  3FHE A;  4L2L A;  5JJT A;  2XCB A;  4XI0 A;  5E75 A;  4AY5 A;  4J8F A;  3PRZ A;  2CG2 A;  3B13 A;  1Z3Y A;  4ILG A;  1EF1 C;  3AS5 A;  1XNF A;  3JUI A;  2XRZ A;  3MV2 B;  4UWG A;  4E6H A;  1LF8 A;  3EIQ C;  3QC1 A;  3EHN A;  3PEU B;  4G1T A;  1HG5 A;  1H0A A;  5CCM A;  3RK6 A;  5ANL A;  4BTA A;  4AIF A;  5G04 J;  4BX8 A;  1B89 A;  2WXJ A;  3BEE A;  1TEZ A;  3UT8 A;  3CVP A;  2VSN A;  3PE3 A;  1OWP A;  4U04 A;  3HVE B;  4CDN A;  5JHB A;  2WXG A;  4BT8 A;  4XKC A;  2GW1 A;  3S7D A;  4M3O A;  1E8Z A;  3MEK A;  4U0Z A;  1HO8 A;  4LRZ A;  2J07 A;  2UY1 A;  4UI9 C;  3FU0 A;  1QNF A;  5FQ7 A;  4JZY A;  5AYW D;  5J08 A;  2BUG A;  5A6C A;  5KJL A;  3MCX A;  3Q4A B;  2I9C A;  4N5C A;  1EPU A;  5T4Y A;  3QB2 A;  4J8D A;  5T3R A;  4G11 A;  2Q7F A;  2PM7 A;  2VSY A;  3LEW A;  1P5Q A;  3OTN A;  4C9B B;  3L16 A;  2A4Z A;  3RRN B;  3PDN A;  2L9B A;  3VLF A;  2PQR A;  1JUQ A;  1PC2 A;  3FDH A;  4I1O B;  1HXI A;  4Q96 A;  2HYZ A;  3ML8 A;  4XX5 A;  2WXH A;  4U8H A;  2OVB A;  2WVI A;  3TG4 A;  3APD A;  4JW1 A;  4B8C B;  3TGO A;  4HLE A;  4OYS A;  1OWL A;  3FTU A;  3LJ3 A;  4GA0 A;  5AEN A;  3EJN A;  4U63 A;  5LOZ A;  4DLO A;  2V8S E;  3FUI A;  4EEC A;  1HZ4 A;  1JPL A;  4ME2 A;  3FH8 A;  3Q49 B;  4EZJ A;  5LP0 A;  3ZIM A;  1N52 A;  2AXV A;  4FC8 A;  3HVE A;  5CCL A;  2Y3A A;  4EBA G;  1U3C A;  2AXZ A;  2HR2 A;  3QKY A;  3GZ2 A;  4GMJ A;  3RRM B;  3SZ7 A;  3ML9 A;  4ACL A;  2XPI A;  3G2U A;  4URK A;  4KVM A;  4H7X A;  5A7D B;  3UMV A;  4BY6 A;  4DLQ A;  4P29 A;  4BT9 A;  1S0P A;  4YVO A;  1GW6 A;  3GYZ A;  2MOW A;  2IOS A;  4Q94 A;  1PAQ A;  2NC9 A;  3AU4 A;  2YNQ A;  4GYY A;  2WXI A;  3S7F A;  5FZQ A;  2WXO A;  3SGH A;  2V5F A;  5HI7 A;  3CVU A;  3U4T A;  3OXL A;  4GCN A;  3CVQ A;  3QOU A;  2L0T B;  4LCT A;  4I6E A;  4G24 A;  4FAD A;  4XKB A;  5FQ6 A;  2JEK A;  4I9C A;  1OWO A;  2AVP A;  5G2N A;  3DPD A;  3ZGQ A;  4DPR A;  4WNF A;  4Y6W A;  4ANV A;  4CT0 A;  1IQU A;  1ZBP A;  2FUL A;  4F53 A;  3ZEF A;  1HS6 A;  3CHQ A;  3QAQ A;  4GZ5 A;  3FWV A;  3URZ A;  1DNP A;  2NSZ A;  3UUX A;  2KCK A;  4MRU A;  3CVX A;  2AWI A;  2IFU A;  2WPV A;  4UQX A;  1N54 A;  3RO2 A;  3SFZ A;  4ANX A;  3B7S A;  3D9J A;  4EBA A;  5A23 A;  3N71 A;  1WY6 A;  3OAW A;  4H7Y A;  1EDU A;  2LSU A;  3G2W A;  3IHY A;  4XI9 A;  1NA3 A;  1VDY A;  3FH7 A;  4JVS A;  4FJY A;  4YND A;  3FTX A;  2VGX B;  3S2A A;  4Y6C A;  3FTV A;  5JJ7 A;  1JWF A;  2X6H A;  1H2T C;  3BG1 B;  2IOL A;  3FUK A;  4I1A A;  5G05 J;  4O6F A;  2VYI A;  3HIZ A;  3O48 A;  3MKR A;  4W9R A;  2XQ0 A;  4I43 A;  4CDM A;  4OVV A;  5CMY A;  2VJ8 A;  4N2S A;  3JQ1 A;  3OXG A;  4G23 A;  3ZYQ A;  3KAE A;  4CCA A;  1H2V C;  2XEV A;  5FZR A;  2ILR A;  3S7J A;  2BF0 X;  2CFU A;  3FUD A;  2WXF A;  2J4D A;  3RIB A;  2I2O A;  4IN3 B;  3SBT B;  3SHF A;  2WXQ A;  3FEX A;  2AW6 A;  4I6G A;  2V0P A;  4AY6 A;  3ONL A;  3IHV A;  5FQ4 A;  4N39 A;  2RG8 A;  2IJG X;  3D9L A;  4L23 A;  3GZS A;  3HDX A;  3DBS A;  3L22 A;  3QWP A;  4OVU A;  4JXT A;  4BSX A;  2YHE A;  2PQN A;  2KCL A;  5D0Q D;  1HH8 A;  1L5J A;  2OND A;  2EQX A;  3RU0 A;  1UW4 B;  3NZU A;  4PH4 B;  2DIW A;  4HOS A;  4I1M A;  3GZ1 A;  3FUH A;  3AS4 A;  1H19 A;  2VGX A;  3I4G A;  3PVL A;  1A17 A;  1HU3 A;  4ANW A;  5J90 A;  3L54 A;  4U0S A;  4WAF A;  3CK7 A;  4FA6 A;  4MLP A;  3UX4 A;  4BFR A;  2KZT B;  2CHW A;  3ENE A;  3G2T A;  3JCK C;  3NF1 A;  4RSY A;  5JJ6 A;  1QZ2 A;  3CLJ A;  4JA7 A;  4A3T A;  4AVX A;  2WQ6 A;  3ESL A;  3FTY A;  3LKU A;  4ILH B;  3LXU X;  3TL5 A;  4I17 A;  1KT1 A;  2I1K A;  3CVL A;  3VTX A;  5KJM A;  3SBS A;  4APO A;  4IUL A;  4I2W A;  2HO1 A;  5LFA A;  1SZA A;  4GZ3 A;  2XHE A;  5AJD A;  5EKQ D;  5BV0 A;  3CST A;  2IF4 A;  2VSO E;  2I6H A;  4HS2 A;  3LVQ E;  3PRE A;  4J8S A;  2CFZ A;  3I4R B;  2PZI A;  3FTW A;  3CGH A;  3C98 A;  4DI4 A;  3CVN A;  1KLX A;  3MYV A;  3U9W A;  4R7L A;  5FQ8 A;  5E76 A;  3FU6 A;  3FUF A;  1WAO 1;  3CKB A;  5HQ8 A;  5KJN A;  2XPY A;  3TG5 A;  2VQ2 A;  2BTD A;  3PE4 A;  3FY4 A;  4GYO A;  4JEH A;  4KZ0 A;  5BUZ A;  3UT7 A;  1FVH A;  4NQ0 A;  4A1S A;  4BX9 A;  3CHS A;  4ATG A;  1E7V A;  4F7A A;  5DBK A;  3UT4 A;  3FUL A;  4TRQ A;  3KD7 A;  4WWO A;  4A3V A;  3IEG A;  5KJK A;  5LCW J;  3CVV A;  3CVW A;  5DIZ A;  5ANR A;  4D10 C;  4WUY A;  4APF A;  5G55 A;  5FZS A;  2L0I A;  3ONK A;  3AU5 A;  3FH5 A;  3B7R L;  3LY8 A;  2KZT A;  2X38 A;  4EPZ A;  3ZXS A;  3APC A;  4BTB A;  1E90 A;  3NZS A;  2IU1 A;  2PM6 A;  3FTZ A;  5C1D A;  2WXR A;  3CR3 A;  4MKT A;  4IYP A;  4I6J A;  4UI9 J;  5D0O D;  4HVB A;  4JHJ A;  2WB2 A;  2QY7 A;  3LDZ A;  3T8M A;  2X6J A;  1NZN A;  1H6K A;  4J8E A;  1Z6T A;  3IBE A;  4WNE A;  3MV3 B;  3RO3 A;  4KT6 B;  3MKQ B;  2CHZ A;  4JHK A;  3CHR A;  4I2Z A;  4NAC A;  4AP2 A;  1IQR A;  1SQM A;  3PUJ A;  3D9I A;  3FUJ A;  5G04 C;  3CK9 A;  3JQ0 A;  4GAA A;  2LSV A;  3RKV A;  3FUN A;  1HE8 A;  3Q15 A;  2DBA A;  5FT9 A;  3ZFW A;  4ABN A;  2JLB A;  3UPV A;  4FU3 A;  4L2Y A;  4U0U A;  3QDN A;  4CDR A;  2IQC A;  1UN9 A;  3FU5 A;  3WXX A;  4E85 A;  1TJF A;  3VTY A;  4C0E A;  4KBQ A;  4HOU A;  3ZYK A;  3E4B A;  3B7U X;  3LYA A;  2FI7 A;  2J49 A;  4JEU A;  4HFG A;  4UWK A;  4EZK A;  5LX8 A;  3HYM B;  3LY7 A;  4FHK A;  2V4L A;  3L17 A;  2VTB B;  1DVP A;  1UJJ A;  4UWH A;  5EDS A;  4N2Q A;  4NRH B;  4RG9 A;  2OOE A;  3FU3 A;  3GW4 A;  1IYG A;  2WM9 A;  5EX3 A;  5T8I A;  2C0L A;  4V3I A;  3D9O A;  4GZ6 A;  2Y4T A;  4L1B A;  5JHA A;  2GGF A;  4F1S A;  3HHM A;  3ZVV A;  2XPZ A;  3D9P A;  1ELW A;  2C2L A;  2J08 A;  3QNK A;  4FJZ A;  4UQY A;  3LVR E;  4PUC A;  3ESK A;  5CMW A;  4MS6 A;  4DK5 A;  4AM9 A;  1QQE A;  2XGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...