3HDXA

Crystal structure of susd superfamily protein (np_809182.1) from bacteroides thetaiotaomicron vpi-5482 at 1.50 a resolution
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
474
structure length
456
Chain Sequence
TQQWKTLEDTRSALMGVYGLTRAALADNNTHWICGDLRKGDFTVYKRSDLQAVSDNELNKPYDLLKKVSNWRRFYAVINAASVFMEKAPRTVELDRSYSEQNLKYDIAQVRALRAFAYFYMVRIWGDVPLVTYSYDNGTFPSMPRTDAQTVLSYAKAELLTAIEDLPYQYGTQTNLYYGSYGAQWQGKLFNKLSAYSVLAHICAWQGNYAEAETYSAFIIDHASEINAKYTSIADLTSETGLFYSNASVKGSRILGFNFAGHLEQLTLAYPLVQKSYPEIYISKDSLFSIFTNFDDLRFGIIDTIKYSSYYVQNLNEETPVFSKIKIIQGVFGSSIVFTRLEDITLLRAEALCALNRSTEAVSYLNMIRTNRGLREVSFKKDFGNNRESLIAEIFEERRRELMGEGWRWYDLVRRQKLMKDNEAFLRLISSGGIYWPVSEDIITANSQIEQNEFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SusD superfamily protein (NP_809182.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.50 A resolution
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Polysaccharide binding protein
molecule keywords SusD superfamily protein
total genus 175
structure length 456
sequence length 474
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07980 SusD_RagB SusD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hdxA00
4Q69A 4MRUA 3IV0A 3CGHA 3FDHA 5T4YA 3KEZA 3EHNA 3MCXA 3CK8A 3QNKA 3CKCA 3SNXA 3OTNA 4L7TA 5FQ6A 5FQ4A 4F7AA 3EHMA 3EJNA 3JQ1A 5T3RA 3SGHA 3CK9A 5E76A 5FQ8A 3MYVA 4LERA 3L22A 5FQ7A 3CK7A 4PUCA 5LX8A 3P1UA 5J90A 3I4GA 4F53A 3CKBA 3GZSA 5E75A 3JYSA 3MX3A 3NQPA 3HDXA 3LEWA 3JQ0A
chains in the Genus database with same CATH superfamily
1WAO1 4GTTA 3APCA 1RW2A 1D9SA 3JXIA 1HZ4A 3PEVB 2YINA 4FULA 3V79K 4FLHA 5FIOA 1HX8A 4NURA 3ASHA 3D9KA 5KNHD 3S7JA 1ELWA 5ARGA 3S7BA 3QNKA 3HVEB 4ATZD 3C3OA 4R7LA 2DZOA 1XGWA 3L17A 3CVNA 3D3MA 4B0ZA 2JABA 4B89A 1UW4B 1LF8A 1HO8A 2J8SD 5BUZA 1MX6A 3PNTB 2OVFA 2M63A 3UM1A 2J09A 3PZDA 5FZRA 3D9IA 3TAXA 2CHWA 2YQ8A 3EHQA 2IQCA 4FLBA 2EINE 3LCAA 5T3RA 4KBQA 3CHQA 4JL0A 4XKCA 2RD0A 1N4SA 1MQSA 3ZUVB 3U9WA 3SY2A 3HXFA 3FUFA 1D8DA 1IKND 5A7DB 2A4ZA 2XZTG 4BFRA 2PQNA 1A5EA 4WNDA 3CHRA 1YYHA 2WXOA 3DSWA 4L7TA 3DSTA 3UX4A 3ZXSA 1NFIE 2DIWA 2KZTB 3NB2A 2OEWA 4DX7D 3ULQA 3FULA 5JA4D 5EX3A 4OVUA 3VTXA 4HOTA 4Y6CA 4L9PA 1OWNA 3G2TA 4TUUA 4DJAA 2KC7A 4O1PA 2XHEA 3TGOA 3WG7E 4HFGA 4BEPA 3FUKA 1H2VC 2XCBA 3ZIMA 1S64A 4BX8A 3ASGA 3CK8A 3ZPJA 3FWVA 2NXPA 1N54A 1WY6A 4U63A 3CSFA 2XGOA 4H7XA 3IEGA 3UT4A 2YHEA 4YDOA 3EDTB 4U8VD 2DWZA 2CG3A 3KSQA 1LD8A 4CDRA 2OOEA 4YDWA 1E8WA 4ME2A 3DRAA 1OCOE 1N94A 3O48A 3EHNA 3PS6A 4DLOA 2L0TB 3SFYA 5G2NA 3JCKC 2Y1LE 3I5PA 4DI3A 3P2BA 2BTDA 3DSUA 1MZCA 4KT6B 3L9TA 2WXGA 4JC8A 5KCMA 4G24A 3OXLA 1XNFA 3LS8A 2CFUA 5G04J 3HHMA 4GAAA 4DLQA 1NA0A 2RFMA 4I43A 3RRUA 3SNXA 4LG6A 2WXIA 2AWIA 5G05J 1EF1C 4I1AA 3TWQA 2H6GA 2F0YA 3MV3B 3MZLB 2BKKB 4GZ6A 3MX3A 5AQ9A 4N2SA 4N5CA 3ZXPA 3AU5A 3MKQB 1MHQA 3NF1A 3DSVA 3RRMB 3EHRA 3DSXA 3MJWA 4BTAA 3G2WA 1KZPA 3VLEA 4OAUC 3KAEA 2IY0C 1JCSA 3FDHA 1OCCE 1U3CA 3L16A 3ZHEB 1N11A 1WG0A 4ATGA 2R05A 4XI9A 3U3WA 5EDSA 1NI1A 5ENOD 5JJ6A 3G2UA 3ZYQA 3S2AA 3TWSA 1KT0A 1JWGA 3MGBA 1HU3A 3CVYA 2I2OA 3LJ3A 1E8ZA 3LPZA 3LYAA 2UWJG 2VTBA 1SZAA 5DBKA 1N0QA 3DWLG 3FH8A 1FT2A 4G23A 3CVWA 4JXTA 2VSNA 3CKBA 4I9CA 1Z6TA 3B7BA 4LUNU 3MV2B 4J8YA 2JLBA 4UI9C 4CT4A 3R9AB 4HNAD 3Q73A 2DZNA 4L23A 3RO2A 2Y0BG 3MEKA 3SGHA 3PZ3A 5LFAA 5FQ7A 1EDUA 3QB2A 2UY1B 5HI7A 3LXUX 1YA0A 3MCXA 2AXZA 5M72A 2V4HC 3T5VA 1HG2A 4OVVA 4FADA 3CVXA 3EJNA 2IF4A 2BEDA 4EPZA 5CMWA 4O60A 3CK9A 4EHMA 3RU0A 4GCOA 3JYSA 2WM9A 2BKGA 4WNFA 4RSYA 3F6QA 2FEZA 4JA9A 3RIBA 2HO1A 3V31A 1NZNA 2WXMA 2FF4A 2GRRB 2IOLA 5ANLA 3UM0A 1PAQA 2FO1E 3N71A 4HORA 2X3MA 4FJZA 3LKUA 4J8SA 5AJDA 1U3DA 5EYPF 4HXIA 2C2LA 2KZTA 4PH4B 4I6JA 4C0MA 5CBOA 3CLJA 5KJKA 4AEZC 5A23A 1H2TC 3HVEA 4AXHA 1QZ2A 5ENNA 1X5BA 5JJTA 4GZ3A 3TWTA 5EIBE 3C3RA 2VQ2A 2PL2A 3BU8A 3PZ1A 4LCTA 4N2QA 3Q79A 3I4RB 3UKUG 4K5AB 2KCVA 3CQGB 3R7RA 3PE4A 2V8SE 5AARA 3RK6A 3RKVA 2AVPA 3CR3A 1KT1A 2WMNA 4Y6WA 3ASDA 3CVLA 5BV1A 3D9OA 3FUEA 3D9LA 4ILHB 2VYIA 2KATA 4AY5A 3C5RA 1PY1A 1TNBA 2VGXB 4B94A 1N95A 3V30A 4EECA 3KS2A 2AW6A 3L54A 4EBAA 2XRZA 3TWUA 5BNWA 3R7QA 3Q5MA 4G26A 3GW4A 3G2VA 1DNPA 3CHOA 3QC1A 4J7WA 1K1AA 2I1KA 3RO3A 2P58C 5E76A 1B89A 3JUIA 3TXMA 2WXJA 5HRYA 5IY5E 4DRXE 1Y8MA 4HVBA 2B6CA 3Q47B 1TR4A 2ILRA 4A1SA 4GTQA 5KJMA 5B1BE 3MKRA 2PNNA 4N3CA 3APFA 2EIJE 1UJKA 3B7SA 2IOSA 3LY8A 3AG3E 4A63B 1OWOA 4K5BA 5CEAA 2HE0A 2C0LA 3IBEA 5EKQD 3NOGD 4HI9A 2ZGGA 3E34A 5BPPA 5JHBA 3FUNA 5EIDA 3VTYA 1ELKA 1JPLA 4BESA 4YVOA 2P9PG 2YNQA 4MRUA 1H6KA 2PZIA 2Y3AA 1SA5A 3LDZA 3Q7FA 4C48B 3TWXA 2P2CP 1JWFA 2EIKE 3U66A 3FUHA 3ABLE 5ITZF 3URZA 4BX9A 3RJVA 3FTUA 1E8XA 3NBNB 3DPDA 4APFA 3ZKJA 1JCQA 4H7YA 1IQRA 4AP2A 2OEVA 2MOWA 2LXMA 2RKKA 4CGVA 4JEHA 4U07A 3RAUA 1TJCA 1O1SA 4JB8P 2EQXA 4NACA 2R5SA 3BEEA 4LERA 5CEDB 2UY1A 4I17A 3ZYMA 4F1SA 1BD8A 3L6AA 4BT8A 1E96B 5JHAA 2QC9A 3FTYA 4LEUA 1MX4A 2Y4UA 1O1TA 3EUVA 3SQVA 3Q4AB 3W9FA 1SVXA 4GU5A 5FZQA 3FTVA 4GMRA 3JQ0A 2MYOA 2E0IA 4CGWA 4AJWA 3SO8A 5DIZA 3ASFA 5ENQD 2P9NG 2GRPB 1UN8A 5FQ6A 4A3VA 3OXFA 5EX0A 3PDNA 1TNOA 3PE3A 4TV3A 4IN3B 2J4BA 1HXIA 3ENEA 2OV8A 2VGEA 3CVQA 3HXBA 3AJIA 4KZ0A 5ENSD 1W3BA 4F1PA 3ZRHA 4OYSA 2XS8A 2J08A 2CHXA 1HE8A 1QYMA 5ENTD 3FEYA 3FP3A 1DCEA 4B93B 2XEVA 2GRMA 3LEWA 3SF4A 4I6EA 1X81A 4UI9K 1IQUA 4FP7A 4AY6A 3AAAC 3ZNGA 4BTBA 4P29A 2HYZA 4C9BB 5FT9A 3FTXA 3NOCD 3TWVA 2HR2A 1NA3A 4HRMB 1Z5SC 1OCZE 4M3OA 5ENPD 3DXMG 4DK5A 2XRYA 5EYLA 4UQZA 2QFCA 3V2XA 1FCHA 3NQPA 4WUYA 5FZSA 2IFUA 4ILIA 3E33A 1KLXA 2AJAA 3ABKE 3CIAA 4ILGA 3QJZA 4RG6A 5BXUA 2ZU6B 2PM7A 2VGXA 4MKTA 3QDNA 3AS4A 3UPVA 3EU5A 3E32A 5T8IA 5AQBA 4NIKA 3B13A 3QWPA 1AP7A 4JHRA 1ZBPA 4WWNA 1DVPA 4GA2A 3KSLA 4GTSA 4FA6A 2DYSE 2LNIA 2WXFA 3U4TA 2LAHA 3Q75A 1HS6A 4GZ5A 4YNDA 5JJ7A 4I2WA 5CRVA 3FUDA 3ZHEA 4GA0A 3UINC 4UWHA 1V54E 3VLDA 4ANWA 4K5CA 2QZAA 4J8DA 4E6HA 3PZ4A 1MYOA 2R03A 1TNYA 4J0UA 4A3TA 3X2QE 4GYOA 4G8LA 4UWKA 4KMOA 2MRIA 3FH5A 1OCRE 3DXKG 5T4YA 5EILA 3ZEFA 1UJJA 2L6BA 5HQ8A 5B3SE 5CHEE 1H6OA 3DEOA 2EILE 1BPOA 2J49A 4WNGA 4EZLA 3QARA 3Q49B 4N39A 3C98A 1AWCB 3CEQA 3AU4A 2Y69E 3LY7A 2Q7FA 4HB5A 3PREA 4DX5D 4UWGA 4WNEA 3OXGA 1MJ0A 3TWRA 2R17C 4JW1A 1H2UA 3CHPA 4ANVA 3D9NA 2J07A 2V5QC 3I4GA 4ZHBA 1OWMA 3ZW3A 5BV0A 3AG1E 2P9IG 4HBDA 4J8EA 2LXLA 1VDYA 2QYUA 4F53A 2CG2A 3QKYA 2ZISA 3B95A 3LVRE 3T8MA 2ETCA 3Q7AA 1TN7A 3R9MA 4QQIA 3IKOB 1Z3YA 1IYGA 4HOSA 2X6IA 2E2EA 1YCSB 2VJ8A 4G11A 3ZFWA 4JHKA 2H6FA 4CCAA 5HKPA 3FTSA 4A55A 1DCQA 4DX1A 4TXRA 4ZFHA 2J4DA 4QFVA 1EPUA 4BERA 2IEJA 5ENRD 4JEUA 3B7TA 3CQCB 3OAWA 4UI9J 5BXOA 4GYYA 2KBXA 3ML9A 1UN9A 3HXDA 5J08A 2X6JA 3ZYKA 3HXEA 4ACLA 2J9QA 2F8XK 2VSXE 4U95D 2WQ7A 1QQEA 3FTZA 1PC2A 3PNLB 4G25A 2WMOA 4K03A 2FULA 3FEXA 1TJFA 3FTWA 4TXPA 4C0EA 4G2VA 5LX8A 2WQ6A 5FJYA 2QY7A 4B8CB 3CVUA 4N3BA 1BI8B 5AJLA 3J5PA 3UM3A 2JEKA 4AOFA 2YHCA 2WXHA 4TRQA 4KVMA 3DEPA 2P9UG 3L22A 5CBNA 4PUCA 4GZCA 2XCCA 3HYMB 3KEAA 1NP7A 4XE0A 1LD7A 5FTPA 2XPYA 3FU0A 2HM8A 2FI7A 3FU3A 1SZ9A 2WXLA 5C2YA 1FVFA 1H0AA 2OCCE 4AVXA 2GROB 3UMVA 3HDXA 4DX2A 3ZU7B 5G55A 2WXNA 4GTPA 3L82A 3SFZA 1Q2ZA 2DYRE 4LRZA 5G05C 4YDEA 1FVHA 4XKBA 4BWRA 4EZJA 2VGYA 4GZDA 3T8KA 4RQIA 2ZGDA 1D8EA 4FHJA 1E7UA 3G2SA 3DBSA 1TNZA 3ML8A 3NAWA 3ASOE 5AQAA 2CFZA 2NC9A 5LOZA 2A5EA 3T5XA 4O6FA 1UG3A 2GRQB 3CHMA 3HG0D 3AG2E 2R2LA 3CKCA 4YDYA 2H6IA 4FU3A 4ANUA 3UT7A 4BT9A 3T9KA 4GB9A 3RSEG 4I9EA 4PDXA 2AXVA 4RLYA 4GTRA 2MHKA 4U0UA 5AAOA 5J90A 3ASNE 2C0MA 4NRHB 4GPMA 4HI8A 4ABNA 2VSYA 4L1BA 2H6HA 3UM2A 1H19A 1N4QA 1ZB1A 3V2OA 4PS3A 4U0ZA 4URKA 4JD2G 3WXXA 2X6KA 4U8HA 4DPRA 2KXPC 4PS7A 4FC8A 4JPSA 4K0RA 3AG4E 5KBAA 3HRAA 4FJYA 4Q96A 3TG5A 3O4ZA 4LNBA 2R02A 3ZVVA 5ARFA 2XEHA 1Y6IA 4I6GA 2WB2A 3TXNA 2XENA 5FQ8A 3E30A 4MBGA 5AIJA 1L5JA 4N3AA 3J5QB 1QBQA 3FUMA 5CMYA 4HOQA 5FWQA 1OWLA 3SD5A 4WWOA 1TN6A 3PUJA 4G1TA 3U64A 4FHKA 2LAIA 3D9MA 4WWPA 3MYVA 2WXKA 3S7DA 3QWVA 3PH0C 3E4BA 1TEZA 4Z68A 1V55E 2XGSA 2GRNB 4TXQA 5HS0A 3UIPC 5KJLA 3SBTB 4DI4A 4ANXA 2QYJA 4B8AA 2AXUA 3QAQA 4KVOA 3PRZA 1K3ZD 3FFLA 3I3NA 3ABME 1WM5A 4AM9A 4X8QA 4G8KA 1UOHA 4E85A 2IO2C 1OT8A 5LP0A 5CCMA 4GA1A 3Q15A 1INZA 1IHBA 3UIOC 3HIZA 1KPSB 2VSOE 4CYMD 3OTNA 5LCWJ 1QNFA 4NQ0A 4KZCA 1G3NB 4HRLA 3UXGA 3NZUA 3E37A 2P9LG 4HRNA 3GZ1A 4YVQC 5JMND 1SA4A 5D0OD 4XX5A 4U0SA 3TJPA 4AIFA 2XQ0A 2B0OE 4GCNA 1OUVA 3PVLA 3UT8A 2IU1A 2R59A 5AYWD 1P5QA 1ZU2A 4BSZB 3DSSA 3CK7A 4L2LA 4RVBA 5BW8C 2WVIA 2RG8A 4EBAG 2WPVA 4N5QA 1S70B 2LUHA 3TL5A 4PS8A 1WDYA 3D9PA 1IXVA 3ZYLA 2F8YA 2P9KG 3Q78A 2LSUA 2WXPA 2CHZA 1SW6A 5EN5D 2GRLA 3Q9UC 1HFAA 1EYHA 3QOUA 3HXCA 2GGFA 2PM6A 1A17A 4UQYA 4UWFA 2DVWA 1YMPA 4F6RD 1U2VG 3RRNB 2Y4TA 4L2YA 5AQ7A 2XPZA 5ANRA 4U7EB 1TYQG 4XIFA 5G04C 3CHSA 3KEZA 1E90A 4MS6A 2FO7A 5LCWC 2NSZA 3C72A 4HLEA 1N52A 2XEEA 1N4PA 5FQ4A 3VLFA 4IRUA 4U04A 3ULYA 3L13A 4XEIG 2I9CA 2XGMA 3BQOA 3FHEA 3ZN3A 3DPYA 5CECB 3SI5A 4JZYA 3L08A 3EIQC 1TNUA 3B7UX 3CVPA 3EIJA 3TG4A 3GZ2A 2LO6A 1SQMA 2ETBA 2BF0X 3KD7A 2GW1A 2VTBB 2I6HA 1O5MA 1NL4A 1N0RA 1K1BA 1E8YA 3CGHA 3EU9A 1S63A 2NYJA 1O1RA 2BUGA 3SBSA 3APDA 3FUIA 3UQ3A 4HS2A 4GTVA 1MX2A 3FU5A 5CCLA 3LY9A 3ESKA 3PZ2A 1Z3XA 4A1GA 3C3QA 2L0IA 3FU6A 2ZXWE 4U8YD 4CDMA 4DX6D 2LSVA 3JUEA 4I1OB 1S0PA 3LVQE 1BLXB 4D10C 3LJNA 3CVVA 5FINA 2V0PA 5AENA 3JXJA 4KYOB 3IXEA 1DC2A 1JUQA 4CZ2D 4CRWA 2WXRA 1HH8A 3CSTA 4OAVB 4F3VA 2ETAA 2KCLA 1ELRA 2ZIRA 4W9RA 2V5FA 2WXQA 2L9BA 3ESLA 3ONKA 4Q94A 5KWDA 3W9GA 3SZ7A 4I1MA 5KNGA 1HG5A 2L6JA 1N9AA 4LNGA 5E75A 1TN8A 3MKQA 4CT0A 3FUJA 5C1DA 3S7FA 3PEUB 4JHJA 4IYPA 4U96D 3D9HA 3IHVA 1BU9A 3BG1B 3UI2A 2X6FA 2P9SG 3EHMA 3JQ1A 2X6HA 5AN8A 2FBNA 2X38A 2IJGX 3GZSA 4J6IA 4M7CA 4J8FA 4V3IA 4MLPA 3BUAA 2V4LA 4IULA 4LSZE 1KZOA 4JA7A 3K9IA 3AS8A 1OXJA 3MA5A 4GYWA 2F37A 4O1OA 4F7AA 3FY4A 5H7PA 3ONLA 5KJNA 1JCRA 2OVBA 2EIME 3CV0A 5CRUA 1OWPA 4ACKA 1E7VA 1GW6A 1HF8A 3NZSA 4XZ4A 3B7RL 3D9JA 2RFAA 2WQHA 4BETA 4BSXA 3P1UA 3BG0B 4AV7A 2DCPA 4TUMA 4HLLA 3UKRG 4HOUA 4WAFA 5D66A 2PQRA 5BT1A 4UQXA 2IONA 4EQFA 5A6CA 1IHGA 4APOA 1OY3D 3ZGQA 4KXKB 2DBAA 4CDNA 2KM4A 4GTMA 4JVSA 4UWLA 4I2ZA 1FPPA 2KCKA 2I1JA 4GMJA 4GPKA 1K8KG 3Q9NC 3IV0A 4XI0A 4LNUD 5B1AE 3TWWA 2IO3C 3FH7A 1LTXA 5CERB 4UUCA 2XPIA 4RG9A 4HQDA 3SHFA 3GYZA 2A5UA 4Q69A 4CEMA 2XZDG 5D2MC 3UUXA 1BI7B 4EZKA 4GTOA 3PUKA 3AS5A 2ONDA 3UTMA 4GMLA 3QWWA 4BY6A 1FT1A 3IHYA 4DUIA 1RZ4A 3QK0A 3SFXA 2XS1A 1N4RA 3ULEG 1H6PA 3ISMC 5D0QD
chains in the Genus database with same CATH topology
4GA0A 3CLJA 3Q15A 4UWHA 1INZA 5KJKA 3VLDA 4ANWA 1WAO1 3HIZA 4AEZC 3APCA 5A23A 4J8DA 4E6HA 2VSOE 1H2TC 3OTNA 1HZ4A 4J0UA 4A3TA 5LCWJ 3PEVB 3HVEA 2YINA 4GYOA 4AXHA 1QZ2A 4FULA 1X5BA 5ENNA 5JJTA 4GZ3A 4FLHA 1QNFA 4NQ0A 4UWKA 4KMOA 1HX8A 4KZCA 3NZUA 2MRIA 3FH5A 4NURA 2VQ2A 2PL2A 3ASHA 3D9KA 3GZ1A 4LCTA 4YVQC 4N2QA 3S7JA 1ELWA 3I4RB 5T4YA 5ARGA 3S7BA 3QNKA 3HVEB 1UJJA 3ZEFA 5HQ8A 5D0OD 4XX5A 4U0SA 5CHEE 3TJPA 4AIFA 2XQ0A 4GCNA 2KCVA 4R7LA 1OUVA 1XGWA 1BPOA 2J49A 3CQGB 3L17A 3CVNA 3D3MA 3PVLA 3R7RA 3PE4A 3UT8A 4B0ZA 4WNGA 4B89A 2IU1A 4EZLA 2R59A 1UW4B 2V8SE 3QARA 1LF8A 5AYWD 1HO8A 1P5QA 3RK6A 1ZU2A 3Q49B 5BUZA 3RKVA 3CK7A 2AVPA 3PNTB 4L2LA 4N39A 2OVFA 2M63A 3CR3A 4RVBA 3C98A 1KT1A 5BW8C 2J09A 3CEQA 3PZDA 2WVIA 3AU4A 2RG8A 2WMNA 3ASDA 3LY7A 4Y6WA 2Q7FA 5FZRA 4EBAG 2WPVA 3D9IA 3CVLA 3TAXA 3PREA 3D9OA 3FUEA 5BV1A 3D9LA 4ILHB 4UWGA 2CHWA 3TL5A 2YQ8A 4WNEA 2IQCA 4FLBA 3OXGA 4PS8A 3D9PA 2VYIA 2KATA 2R17C 3LCAA 5T3RA 4KBQA 4AY5A 3CHQA 4JL0A 3ZYLA 4JW1A 1PY1A 1H2UA 2VGXB 4XKCA 4B94A 2RD0A 3CHPA 4ANVA 3D9NA 2J07A 1MQSA 4EECA 3I4GA 3U9WA 3KS2A 2AW6A 2LSUA 3L54A 2WXPA 4EBAA 2CHZA 2XRZA 1OWMA 5BNWA 3FUFA 3R7QA 3ZW3A 5A7DB 3Q5MA 2A4ZA 4BFRA 2GRLA 2PQNA 4G26A 1HFAA 1EYHA 3GW4A 3G2VA 4WNDA 3QOUA 3CHRA 5BV0A 1DNPA 2WXOA 3CHOA 2GGFA 3QC1A 2PM6A 1A17A 4UQYA 4L7TA 3UX4A 4J8EA 4UWFA 2I1KA 3ZXSA 3RO3A 2P58C 2DIWA 5E76A 1B89A 3RRNB 1VDYA 3JUIA 3TXMA 2Y4TA 4F53A 2CG2A 2KZTB 2WXJA 3QKYA 4L2YA 3LVRE 2XPZA 3T8MA 1Y8MA 5ANRA 4XIFA 5G04C 4HVBA 3CHSA 3KEZA 1E90A 3ULQA 4MS6A 3Q47B 3IKOB 3FULA 2ILRA 2FO7A 5LCWC 1Z3YA 2NSZA 4HLEA 1N52A 5FQ4A 4A1SA 3VLFA 5KJMA 1IYGA 4HOSA 3MKRA 4IRUA 4U04A 5EX3A 2X6IA 2E2EA 3L13A 4N3CA 3APFA 2VJ8A 4G11A 1UJKA 3ZFWA 2I9CA 2XGMA 3B7SA 4OVUA 2IOSA 3LY8A 4JHKA 3VTXA 3FHEA 3ZN3A 4Y6CA 4CCAA 1OWOA 4HOTA 1OWNA 3G2TA 3FTSA 3SI5A 4TUUA 4DJAA 4JZYA 2KC7A 2C0LA 3L08A 3IBEA 3EIQC 4A55A 2XHEA 5EKQD 2J4DA 3TGOA 3B7UX 4QFVA 3CVPA 1EPUA 3EIJA 3TG4A 3GZ2A 5BPPA 4HFGA 3FUNA 5JHBA 2LO6A 1SQMA 2BF0X 4JEUA 3B7TA 3CQCB 3KD7A 3OAWA 4UI9J 3FUKA 1H2VC 2GW1A 2VTBB 3VTYA 2I6HA 4GYYA 1ELKA 2XCBA 1JPLA 3ML9A 1UN9A 3ZIMA 5J08A 2X6JA 3ZYKA 4ACLA 4YVOA 4BX8A 2YNQA 4MRUA 2J9QA 3ASGA 1E8YA 1H6KA 2VSXE 3CGHA 3CK8A 2PZIA 2Y3AA 3FWVA 2NXPA 3ZPJA 2WQ7A 1QQEA 3FTZA 1N54A 1WY6A 4U63A 3CSFA 1PC2A 3LDZA 3PNLB 2XGOA 4G25A 2BUGA 3SBSA 1JWFA 2WMOA 3APDA 4H7XA 3IEGA 3FUIA 3UT4A 4K03A 2FULA 3UQ3A 2YHEA 3FEXA 1TJFA 3FTWA 3EDTB 4C0EA 4G2VA 3U66A 4HS2A 5LX8A 2CG3A 2WQ6A 3FUHA 3FU5A 5FJYA 5CCLA 2QY7A 4B8CB 4CDRA 3LY9A 2OOEA 3ESKA 1Z3XA 3CVUA 3URZA 4N3BA 1E8WA 5AJLA 4ME2A 4A1GA 3O48A 4BX9A 3EHNA 3PS6A 3RJVA 2L0IA 3FU6A 4DLOA 3FTUA 1E8XA 2L0TB 2JEKA 4CDMA 2LSVA 4AOFA 3DPDA 4APFA 5G2NA 3JCKC 4H7YA 2YHCA 2WXHA 4I1OB 4TRQA 1IQRA 1S0PA 3I5PA 4KVMA 4AP2A 4DI3A 3P2BA 2BTDA 3LVQE 3L22A 4KT6B 2MOWA 4PUCA 4GZCA 2WXGA 4JC8A 5KCMA 2XCCA 4G24A 3HYMB 3OXLA 1NP7A 4XE0A 1XNFA 4CGVA 4JEHA 3LS8A 5FTPA 2CFUA 4D10C 4U07A 2XPYA 3FU0A 5G04J 3HHMA 3CVVA 2HM8A 4GAAA 4DLQA 1NA0A 2V0PA 5AENA 1TJCA 3RRUA 2FI7A 4I43A 3SNXA 3FU3A 4KYOB 1SZ9A 2WXLA 5C2YA 2WXIA 1FVFA 2EQXA 2AWIA 4NACA 5G05J 2R5SA 1EF1C 1H0AA 3BEEA 1JUQA 4CRWA 4I1AA 2WXRA 4AVXA 4LERA 1HH8A 2UY1A 3MV3B 3MZLB 3CSTA 4I17A 3UMVA 3ZYMA 4F1SA 4GZ6A 4F3VA 2KCLA 3MX3A 3L6AA 3HDXA 1ELRA 4N2SA 5G55A 4N5CA 4W9RA 2WXNA 4BT8A 1E96B 2V5FA 3AU5A 5JHAA 2WXQA 3SFZA 3MKQB 1MHQA 2L9BA 3FTYA 3ESLA 4LEUA 3ONKA 2Y4UA 4LRZA 3NF1A 4Q94A 5G05C 3Q4AB 1FVHA 4XKBA 4GU5A 4BWRA 3RRMB 4EZJA 3SZ7A 2VGYA 5FZQA 4I1MA 1HG5A 2L6JA 3FTVA 3MJWA 4GZDA 4BTAA 5E75A 3G2WA 3VLEA 3JQ0A 3MKQA 3KAEA 3FUJA 4CT0A 4FHJA 1E7UA 3S7FA 5C1DA 2E0IA 4CGWA 3G2SA 3FDHA 3PEUB 4AJWA 4JHJA 1U3CA 4IYPA 3L16A 5DIZA 3ZHEB 3DBSA 4ATGA 3ASFA 3IHVA 3BG1B 4XI9A 3U3WA 2X6FA 1UN8A 5FQ6A 5EDSA 3ML8A 3EHMA 3JQ1A 3G2UA 5JJ6A 2CFZA 2X6HA 3ZYQA 2NC9A 4A3VA 3OXFA 2FBNA 5LOZA 3S2AA 5EX0A 2X38A 3PDNA 1KT0A 2IJGX 3T5XA 1JWGA 3PE3A 4TV3A 3MGBA 1HU3A 4IN3B 3CVYA 2I2OA 2J4BA 3GZSA 4J6IA 4J8FA 1UG3A 4O6FA 4V3IA 1HXIA 3LJ3A 4MLPA 3CHMA 3ENEA 2OV8A 3CVQA 4KZ0A 1E8ZA 1W3BA 3LPZA 3LYAA 2V4LA 3CKCA 3ZRHA 4OYSA 4IULA 2J08A 4FU3A 2UWJG 4ANUA 2VTBA 1SZAA 4JA7A 3UT7A 4BT9A 4GB9A 3K9IA 3AS8A 2CHXA 5DBKA 1HE8A 4I9EA 3MA5A 3FH8A 4PDXA 2AXVA 4G23A 3FEYA 3CVWA 3FP3A 2MHKA 4JXTA 2VSNA 4GYWA 4U0UA 5J90A 3CKBA 2XEVA 2C0MA 2GRMA 4NRHB 4F7AA 3LEWA 4I9CA 3SF4A 4ABNA 4I6EA 3FY4A 2VSYA 4UI9K 1Z6TA 4L1BA 4LUNU 3ONLA 3MV2B 1H19A 2JLBA 5KJNA 4UI9C 2OVBA 1IQUA 4PS3A 3CV0A 4CT4A 4U0ZA 1OWPA 4ACKA 4URKA 1E7VA 1GW6A 3WXXA 1HF8A 3R9AB 2X6KA 4FP7A 4U8HA 3NZSA 4XZ4A 4AY6A 3B7RL 3D9JA 4L23A 4P29A 3RO2A 4BTBA 4DPRA 2WQHA 3MEKA 2HYZA 4FC8A 4PS7A 3SGHA 5LFAA 4BSXA 5FQ7A 4C9BB 3P1UA 3BG0B 1EDUA 3FTXA 5FT9A 3QB2A 4JPSA 2UY1B 4K0RA 4AV7A 2DCPA 4FJYA 4Q96A 5HI7A 3LXUX 4HOUA 1YA0A 4WAFA 2HR2A 3TG5A 1NA3A 3MCXA 3O4ZA 2AXZA 3ZVVA 5M72A 2PQRA 5BT1A 4UQXA 3T5VA 5ARFA 2IONA 4M3OA 4EQFA 1HG2A 5A6CA 1IHGA 4OVVA 4FADA 3CVXA 3EJNA 4APOA 2IF4A 1Y6IA 4I6GA 4DK5A 5CMWA 4EPZA 2WB2A 3ZGQA 4KXKB 2XRYA 3TXNA 2DBAA 3CK9A 5FQ8A 4UQZA 4CDNA 5AIJA 1L5JA 2QFCA 1FCHA 2KM4A 4N3AA 4JVSA 4UWLA 4GCOA 3JYSA 4I2ZA 3NQPA 4WUYA 5FZSA 3RU0A 2KCKA 2IFUA 2I1JA 2WM9A 4ILIA 4GMJA 4GPKA 3FUMA 1KLXA 4HOQA 4WNFA 4RSYA 3IV0A 5CMYA 3CIAA 4XI0A 2FEZA 5FWQA 1OWLA 3SD5A 4WWOA 4ILGA 3QJZA 3PUJA 4G1TA 4JA9A 3U64A 4FHKA 4RG6A 3RIBA 2ZU6B 2LAIA 2PM7A 2HO1A 3FH7A 2VGXA 4MKTA 3QDNA 3AS4A 1NZNA 3D9MA 3UPVA 4WWPA 5T8IA 2WXMA 3B13A 3MYVA 2XPIA 2FF4A 2WXKA 3S7DA 3QWPA 4RG9A 4JHRA 3QWVA 3SHFA 3PH0C 3GYZA 3E4BA 2IOLA 1ZBPA 1TEZA 4WWNA 1DVPA 2A5UA 4GA2A 4CEMA 2XGSA 4Q69A 5ANLA 5KJLA 3SBTB 4DI4A 4FA6A 1PAQA 3UUXA 4ANXA 4B8AA 2AXUA 3QAQA 3N71A 4KVOA 3PRZA 4EZKA 4HORA 2X3MA 2LNIA 2WXFA 3FFLA 3PUKA 3AS5A 2ONDA 3I3NA 4FJZA 2LAHA 4GMLA 3U4TA 3QWWA 3LKUA 1WM5A 4J8SA 5AJDA 1U3DA 4AM9A 4BY6A 1HS6A 4GZ5A 3IHYA 4HXIA 3QK0A 2C2LA 4YNDA 4E85A 2KZTA 4PH4B 5JJ7A 5LP0A 5CCMA 4I2WA 4I6JA 4C0MA 3FUDA 3ZHEA 4GA1A 5D0QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q69 A;  4MRU A;  3IV0 A;  3CGH A;  3FDH A;  5T4Y A;  3KEZ A;  3EHN A;  3MCX A;  3CK8 A;  3QNK A;  3CKC A;  3SNX A;  3OTN A;  4L7T A;  5FQ6 A;  5FQ4 A;  4F7A A;  3EHM A;  3EJN A;  3JQ1 A;  5T3R A;  3SGH A;  3CK9 A;  5E76 A;  5FQ8 A;  3MYV A;  4LER A;  3L22 A;  5FQ7 A;  3CK7 A;  4PUC A;  5LX8 A;  3P1U A;  5J90 A;  3I4G A;  4F53 A;  3CKB A;  3GZS A;  5E75 A;  3JYS A;  3MX3 A;  3NQP A;  3HDX A;  3LEW A;  3JQ0 A; 
#chains in the Genus database with same CATH topology
 1WAO 1;  4GTT A;  3APC A;  1RW2 A;  1D9S A;  3JXI A;  1HZ4 A;  3PEV B;  2YIN A;  4FUL A;  3V79 K;  4FLH A;  5FIO A;  1HX8 A;  4NUR A;  3ASH A;  3D9K A;  5KNH D;  3S7J A;  1ELW A;  5ARG A;  3S7B A;  3QNK A;  3HVE B;  4ATZ D;  3C3O A;  4R7L A;  2DZO A;  1XGW A;  3L17 A;  3CVN A;  3D3M A;  4B0Z A;  2JAB A;  4B89 A;  1UW4 B;  1LF8 A;  1HO8 A;  2J8S D;  5BUZ A;  1MX6 A;  3PNT B;  2OVF A;  2M63 A;  3UM1 A;  2J09 A;  3PZD A;  5FZR A;  3D9I A;  3TAX A;  2CHW A;  2YQ8 A;  3EHQ A;  2IQC A;  4FLB A;  2EIN E;  3LCA A;  5T3R A;  4KBQ A;  3CHQ A;  4JL0 A;  4XKC A;  2RD0 A;  1N4S A;  1MQS A;  3ZUV B;  3U9W A;  3SY2 A;  3HXF A;  3FUF A;  1D8D A;  1IKN D;  5A7D B;  2A4Z A;  2XZT G;  4BFR A;  2PQN A;  1A5E A;  4WND A;  3CHR A;  1YYH A;  2WXO A;  3DSW A;  4L7T A;  3DST A;  3UX4 A;  3ZXS A;  1NFI E;  2DIW A;  2KZT B;  3NB2 A;  2OEW A;  4DX7 D;  3ULQ A;  3FUL A;  5JA4 D;  5EX3 A;  4OVU A;  3VTX A;  4HOT A;  4Y6C A;  4L9P A;  1OWN A;  3G2T A;  4TUU A;  4DJA A;  2KC7 A;  4O1P A;  2XHE A;  3TGO A;  3WG7 E;  4HFG A;  4BEP A;  3FUK A;  1H2V C;  2XCB A;  3ZIM A;  1S64 A;  4BX8 A;  3ASG A;  3CK8 A;  3ZPJ A;  3FWV A;  2NXP A;  1N54 A;  1WY6 A;  4U63 A;  3CSF A;  2XGO A;  4H7X A;  3IEG A;  3UT4 A;  2YHE A;  4YDO A;  3EDT B;  4U8V D;  2DWZ A;  2CG3 A;  3KSQ A;  1LD8 A;  4CDR A;  2OOE A;  4YDW A;  1E8W A;  4ME2 A;  3DRA A;  1OCO E;  1N94 A;  3O48 A;  3EHN A;  3PS6 A;  4DLO A;  2L0T B;  3SFY A;  5G2N A;  3JCK C;  2Y1L E;  3I5P A;  4DI3 A;  3P2B A;  2BTD A;  3DSU A;  1MZC A;  4KT6 B;  3L9T A;  2WXG A;  4JC8 A;  5KCM A;  4G24 A;  3OXL A;  1XNF A;  3LS8 A;  2CFU A;  5G04 J;  3HHM A;  4GAA A;  4DLQ A;  1NA0 A;  2RFM A;  4I43 A;  3RRU A;  3SNX A;  4LG6 A;  2WXI A;  2AWI A;  5G05 J;  1EF1 C;  4I1A A;  3TWQ A;  2H6G A;  2F0Y A;  3MV3 B;  3MZL B;  2BKK B;  4GZ6 A;  3MX3 A;  5AQ9 A;  4N2S A;  4N5C A;  3ZXP A;  3AU5 A;  3MKQ B;  1MHQ A;  3NF1 A;  3DSV A;  3RRM B;  3EHR A;  3DSX A;  3MJW A;  4BTA A;  3G2W A;  1KZP A;  3VLE A;  4OAU C;  3KAE A;  2IY0 C;  1JCS A;  3FDH A;  1OCC E;  1U3C A;  3L16 A;  3ZHE B;  1N11 A;  1WG0 A;  4ATG A;  2R05 A;  4XI9 A;  3U3W A;  5EDS A;  1NI1 A;  5ENO D;  5JJ6 A;  3G2U A;  3ZYQ A;  3S2A A;  3TWS A;  1KT0 A;  1JWG A;  3MGB A;  1HU3 A;  3CVY A;  2I2O A;  3LJ3 A;  1E8Z A;  3LPZ A;  3LYA A;  2UWJ G;  2VTB A;  1SZA A;  5DBK A;  1N0Q A;  3DWL G;  3FH8 A;  1FT2 A;  4G23 A;  3CVW A;  4JXT A;  2VSN A;  3CKB A;  4I9C A;  1Z6T A;  3B7B A;  4LUN U;  3MV2 B;  4J8Y A;  2JLB A;  4UI9 C;  4CT4 A;  3R9A B;  4HNA D;  3Q73 A;  2DZN A;  4L23 A;  3RO2 A;  2Y0B G;  3MEK A;  3SGH A;  3PZ3 A;  5LFA A;  5FQ7 A;  1EDU A;  3QB2 A;  2UY1 B;  5HI7 A;  3LXU X;  1YA0 A;  3MCX A;  2AXZ A;  5M72 A;  2V4H C;  3T5V A;  1HG2 A;  4OVV A;  4FAD A;  3CVX A;  3EJN A;  2IF4 A;  2BED A;  4EPZ A;  5CMW A;  4O60 A;  3CK9 A;  4EHM A;  3RU0 A;  4GCO A;  3JYS A;  2WM9 A;  2BKG A;  4WNF A;  4RSY A;  3F6Q A;  2FEZ A;  4JA9 A;  3RIB A;  2HO1 A;  3V31 A;  1NZN A;  2WXM A;  2FF4 A;  2GRR B;  2IOL A;  5ANL A;  3UM0 A;  1PAQ A;  2FO1 E;  3N71 A;  4HOR A;  2X3M A;  4FJZ A;  3LKU A;  4J8S A;  5AJD A;  1U3D A;  5EYP F;  4HXI A;  2C2L A;  2KZT A;  4PH4 B;  4I6J A;  4C0M A;  5CBO A;  3CLJ A;  5KJK A;  4AEZ C;  5A23 A;  1H2T C;  3HVE A;  4AXH A;  1QZ2 A;  5ENN A;  1X5B A;  5JJT A;  4GZ3 A;  3TWT A;  5EIB E;  3C3R A;  2VQ2 A;  2PL2 A;  3BU8 A;  3PZ1 A;  4LCT A;  4N2Q A;  3Q79 A;  3I4R B;  3UKU G;  4K5A B;  2KCV A;  3CQG B;  3R7R A;  3PE4 A;  2V8S E;  5AAR A;  3RK6 A;  3RKV A;  2AVP A;  3CR3 A;  1KT1 A;  2WMN A;  4Y6W A;  3ASD A;  3CVL A;  5BV1 A;  3D9O A;  3FUE A;  3D9L A;  4ILH B;  2VYI A;  2KAT A;  4AY5 A;  3C5R A;  1PY1 A;  1TNB A;  2VGX B;  4B94 A;  1N95 A;  3V30 A;  4EEC A;  3KS2 A;  2AW6 A;  3L54 A;  4EBA A;  2XRZ A;  3TWU A;  5BNW A;  3R7Q A;  3Q5M A;  4G26 A;  3GW4 A;  3G2V A;  1DNP A;  3CHO A;  3QC1 A;  4J7W A;  1K1A A;  2I1K A;  3RO3 A;  2P58 C;  5E76 A;  1B89 A;  3JUI A;  3TXM A;  2WXJ A;  5HRY A;  5IY5 E;  4DRX E;  1Y8M A;  4HVB A;  2B6C A;  3Q47 B;  1TR4 A;  2ILR A;  4A1S A;  4GTQ A;  5KJM A;  5B1B E;  3MKR A;  2PNN A;  4N3C A;  3APF A;  2EIJ E;  1UJK A;  3B7S A;  2IOS A;  3LY8 A;  3AG3 E;  4A63 B;  1OWO A;  4K5B A;  5CEA A;  2HE0 A;  2C0L A;  3IBE A;  5EKQ D;  3NOG D;  4HI9 A;  2ZGG A;  3E34 A;  5BPP A;  5JHB A;  3FUN A;  5EID A;  3VTY A;  1ELK A;  1JPL A;  4BES A;  4YVO A;  2P9P G;  2YNQ A;  4MRU A;  1H6K A;  2PZI A;  2Y3A A;  1SA5 A;  3LDZ A;  3Q7F A;  4C48 B;  3TWX A;  2P2C P;  1JWF A;  2EIK E;  3U66 A;  3FUH A;  3ABL E;  5ITZ F;  3URZ A;  4BX9 A;  3RJV A;  3FTU A;  1E8X A;  3NBN B;  3DPD A;  4APF A;  3ZKJ A;  1JCQ A;  4H7Y A;  1IQR A;  4AP2 A;  2OEV A;  2MOW A;  2LXM A;  2RKK A;  4CGV A;  4JEH A;  4U07 A;  3RAU A;  1TJC A;  1O1S A;  4JB8 P;  2EQX A;  4NAC A;  2R5S A;  3BEE A;  4LER A;  5CED B;  2UY1 A;  4I17 A;  3ZYM A;  4F1S A;  1BD8 A;  3L6A A;  4BT8 A;  1E96 B;  5JHA A;  2QC9 A;  3FTY A;  4LEU A;  1MX4 A;  2Y4U A;  1O1T A;  3EUV A;  3SQV A;  3Q4A B;  3W9F A;  1SVX A;  4GU5 A;  5FZQ A;  3FTV A;  4GMR A;  3JQ0 A;  2MYO A;  2E0I A;  4CGW A;  4AJW A;  3SO8 A;  5DIZ A;  3ASF A;  5ENQ D;  2P9N G;  2GRP B;  1UN8 A;  5FQ6 A;  4A3V A;  3OXF A;  5EX0 A;  3PDN A;  1TNO A;  3PE3 A;  4TV3 A;  4IN3 B;  2J4B A;  1HXI A;  3ENE A;  2OV8 A;  2VGE A;  3CVQ A;  3HXB A;  3AJI A;  4KZ0 A;  5ENS D;  1W3B A;  4F1P A;  3ZRH A;  4OYS A;  2XS8 A;  2J08 A;  2CHX A;  1HE8 A;  1QYM A;  5ENT D;  3FEY A;  3FP3 A;  1DCE A;  4B93 B;  2XEV A;  2GRM A;  3LEW A;  3SF4 A;  4I6E A;  1X81 A;  4UI9 K;  1IQU A;  4FP7 A;  4AY6 A;  3AAA C;  3ZNG A;  4BTB A;  4P29 A;  2HYZ A;  4C9B B;  5FT9 A;  3FTX A;  3NOC D;  3TWV A;  2HR2 A;  1NA3 A;  4HRM B;  1Z5S C;  1OCZ E;  4M3O A;  5ENP D;  3DXM G;  4DK5 A;  2XRY A;  5EYL A;  4UQZ A;  2QFC A;  3V2X A;  1FCH A;  3NQP A;  4WUY A;  5FZS A;  2IFU A;  4ILI A;  3E33 A;  1KLX A;  2AJA A;  3ABK E;  3CIA A;  4ILG A;  3QJZ A;  4RG6 A;  5BXU A;  2ZU6 B;  2PM7 A;  2VGX A;  4MKT A;  3QDN A;  3AS4 A;  3UPV A;  3EU5 A;  3E32 A;  5T8I A;  5AQB A;  4NIK A;  3B13 A;  3QWP A;  1AP7 A;  4JHR A;  1ZBP A;  4WWN A;  1DVP A;  4GA2 A;  3KSL A;  4GTS A;  4FA6 A;  2DYS E;  2LNI A;  2WXF A;  3U4T A;  2LAH A;  3Q75 A;  1HS6 A;  4GZ5 A;  4YND A;  5JJ7 A;  4I2W A;  5CRV A;  3FUD A;  3ZHE A;  4GA0 A;  3UIN C;  4UWH A;  1V54 E;  3VLD A;  4ANW A;  4K5C A;  2QZA A;  4J8D A;  4E6H A;  3PZ4 A;  1MYO A;  2R03 A;  1TNY A;  4J0U A;  4A3T A;  3X2Q E;  4GYO A;  4G8L A;  4UWK A;  4KMO A;  2MRI A;  3FH5 A;  1OCR E;  3DXK G;  5T4Y A;  5EIL A;  3ZEF A;  1UJJ A;  2L6B A;  5HQ8 A;  5B3S E;  5CHE E;  1H6O A;  3DEO A;  2EIL E;  1BPO A;  2J49 A;  4WNG A;  4EZL A;  3QAR A;  3Q49 B;  4N39 A;  3C98 A;  1AWC B;  3CEQ A;  3AU4 A;  2Y69 E;  3LY7 A;  2Q7F A;  4HB5 A;  3PRE A;  4DX5 D;  4UWG A;  4WNE A;  3OXG A;  1MJ0 A;  3TWR A;  2R17 C;  4JW1 A;  1H2U A;  3CHP A;  4ANV A;  3D9N A;  2J07 A;  2V5Q C;  3I4G A;  4ZHB A;  1OWM A;  3ZW3 A;  5BV0 A;  3AG1 E;  2P9I G;  4HBD A;  4J8E A;  2LXL A;  1VDY A;  2QYU A;  4F53 A;  2CG2 A;  3QKY A;  2ZIS A;  3B95 A;  3LVR E;  3T8M A;  2ETC A;  3Q7A A;  1TN7 A;  3R9M A;  4QQI A;  3IKO B;  1Z3Y A;  1IYG A;  4HOS A;  2X6I A;  2E2E A;  1YCS B;  2VJ8 A;  4G11 A;  3ZFW A;  4JHK A;  2H6F A;  4CCA A;  5HKP A;  3FTS A;  4A55 A;  1DCQ A;  4DX1 A;  4TXR A;  4ZFH A;  2J4D A;  4QFV A;  1EPU A;  4BER A;  2IEJ A;  5ENR D;  4JEU A;  3B7T A;  3CQC B;  3OAW A;  4UI9 J;  5BXO A;  4GYY A;  2KBX A;  3ML9 A;  1UN9 A;  3HXD A;  5J08 A;  2X6J A;  3ZYK A;  3HXE A;  4ACL A;  2J9Q A;  2F8X K;  2VSX E;  4U95 D;  2WQ7 A;  1QQE A;  3FTZ A;  1PC2 A;  3PNL B;  4G25 A;  2WMO A;  4K03 A;  2FUL A;  3FEX A;  1TJF A;  3FTW A;  4TXP A;  4C0E A;  4G2V A;  5LX8 A;  2WQ6 A;  5FJY A;  2QY7 A;  4B8C B;  3CVU A;  4N3B A;  1BI8 B;  5AJL A;  3J5P A;  3UM3 A;  2JEK A;  4AOF A;  2YHC A;  2WXH A;  4TRQ A;  4KVM A;  3DEP A;  2P9U G;  3L22 A;  5CBN A;  4PUC A;  4GZC A;  2XCC A;  3HYM B;  3KEA A;  1NP7 A;  4XE0 A;  1LD7 A;  5FTP A;  2XPY A;  3FU0 A;  2HM8 A;  2FI7 A;  3FU3 A;  1SZ9 A;  2WXL A;  5C2Y A;  1FVF A;  1H0A A;  2OCC E;  4AVX A;  2GRO B;  3UMV A;  3HDX A;  4DX2 A;  3ZU7 B;  5G55 A;  2WXN A;  4GTP A;  3L82 A;  3SFZ A;  1Q2Z A;  2DYR E;  4LRZ A;  5G05 C;  4YDE A;  1FVH A;  4XKB A;  4BWR A;  4EZJ A;  2VGY A;  4GZD A;  3T8K A;  4RQI A;  2ZGD A;  1D8E A;  4FHJ A;  1E7U A;  3G2S A;  3DBS A;  1TNZ A;  3ML8 A;  3NAW A;  3ASO E;  5AQA A;  2CFZ A;  2NC9 A;  5LOZ A;  2A5E A;  3T5X A;  4O6F A;  1UG3 A;  2GRQ B;  3CHM A;  3HG0 D;  3AG2 E;  2R2L A;  3CKC A;  4YDY A;  2H6I A;  4FU3 A;  4ANU A;  3UT7 A;  4BT9 A;  3T9K A;  4GB9 A;  3RSE G;  4I9E A;  4PDX A;  2AXV A;  4RLY A;  4GTR A;  2MHK A;  4U0U A;  5AAO A;  5J90 A;  3ASN E;  2C0M A;  4NRH B;  4GPM A;  4HI8 A;  4ABN A;  2VSY A;  4L1B A;  2H6H A;  3UM2 A;  1H19 A;  1N4Q A;  1ZB1 A;  3V2O A;  4PS3 A;  4U0Z A;  4URK A;  4JD2 G;  3WXX A;  2X6K A;  4U8H A;  4DPR A;  2KXP C;  4PS7 A;  4FC8 A;  4JPS A;  4K0R A;  3AG4 E;  5KBA A;  3HRA A;  4FJY A;  4Q96 A;  3TG5 A;  3O4Z A;  4LNB A;  2R02 A;  3ZVV A;  5ARF A;  2XEH A;  1Y6I A;  4I6G A;  2WB2 A;  3TXN A;  2XEN A;  5FQ8 A;  3E30 A;  4MBG A;  5AIJ A;  1L5J A;  4N3A A;  3J5Q B;  1QBQ A;  3FUM A;  5CMY A;  4HOQ A;  5FWQ A;  1OWL A;  3SD5 A;  4WWO A;  1TN6 A;  3PUJ A;  4G1T A;  3U64 A;  4FHK A;  2LAI A;  3D9M A;  4WWP A;  3MYV A;  2WXK A;  3S7D A;  3QWV A;  3PH0 C;  3E4B A;  1TEZ A;  4Z68 A;  1V55 E;  2XGS A;  2GRN B;  4TXQ A;  5HS0 A;  3UIP C;  5KJL A;  3SBT B;  4DI4 A;  4ANX A;  2QYJ A;  4B8A A;  2AXU A;  3QAQ A;  4KVO A;  3PRZ A;  1K3Z D;  3FFL A;  3I3N A;  3ABM E;  1WM5 A;  4AM9 A;  4X8Q A;  4G8K A;  1UOH A;  4E85 A;  2IO2 C;  1OT8 A;  5LP0 A;  5CCM A;  4GA1 A;  3Q15 A;  1INZ A;  1IHB A;  3UIO C;  3HIZ A;  1KPS B;  2VSO E;  4CYM D;  3OTN A;  5LCW J;  1QNF A;  4NQ0 A;  4KZC A;  1G3N B;  4HRL A;  3UXG A;  3NZU A;  3E37 A;  2P9L G;  4HRN A;  3GZ1 A;  4YVQ C;  5JMN D;  1SA4 A;  5D0O D;  4XX5 A;  4U0S A;  3TJP A;  4AIF A;  2XQ0 A;  2B0O E;  4GCN A;  1OUV A;  3PVL A;  3UT8 A;  2IU1 A;  2R59 A;  5AYW D;  1P5Q A;  1ZU2 A;  4BSZ B;  3DSS A;  3CK7 A;  4L2L A;  4RVB A;  5BW8 C;  2WVI A;  2RG8 A;  4EBA G;  2WPV A;  4N5Q A;  1S70 B;  2LUH A;  3TL5 A;  4PS8 A;  1WDY A;  3D9P A;  1IXV A;  3ZYL A;  2F8Y A;  2P9K G;  3Q78 A;  2LSU A;  2WXP A;  2CHZ A;  1SW6 A;  5EN5 D;  2GRL A;  3Q9U C;  1HFA A;  1EYH A;  3QOU A;  3HXC A;  2GGF A;  2PM6 A;  1A17 A;  4UQY A;  4UWF A;  2DVW A;  1YMP A;  4F6R D;  1U2V G;  3RRN B;  2Y4T A;  4L2Y A;  5AQ7 A;  2XPZ A;  5ANR A;  4U7E B;  1TYQ G;  4XIF A;  5G04 C;  3CHS A;  3KEZ A;  1E90 A;  4MS6 A;  2FO7 A;  5LCW C;  2NSZ A;  3C72 A;  4HLE A;  1N52 A;  2XEE A;  1N4P A;  5FQ4 A;  3VLF A;  4IRU A;  4U04 A;  3ULY A;  3L13 A;  4XEI G;  2I9C A;  2XGM A;  3BQO A;  3FHE A;  3ZN3 A;  3DPY A;  5CEC B;  3SI5 A;  4JZY A;  3L08 A;  3EIQ C;  1TNU A;  3B7U X;  3CVP A;  3EIJ A;  3TG4 A;  3GZ2 A;  2LO6 A;  1SQM A;  2ETB A;  2BF0 X;  3KD7 A;  2GW1 A;  2VTB B;  2I6H A;  1O5M A;  1NL4 A;  1N0R A;  1K1B A;  1E8Y A;  3CGH A;  3EU9 A;  1S63 A;  2NYJ A;  1O1R A;  2BUG A;  3SBS A;  3APD A;  3FUI A;  3UQ3 A;  4HS2 A;  4GTV A;  1MX2 A;  3FU5 A;  5CCL A;  3LY9 A;  3ESK A;  3PZ2 A;  1Z3X A;  4A1G A;  3C3Q A;  2L0I A;  3FU6 A;  2ZXW E;  4U8Y D;  4CDM A;  4DX6 D;  2LSV A;  3JUE A;  4I1O B;  1S0P A;  3LVQ E;  1BLX B;  4D10 C;  3LJN A;  3CVV A;  5FIN A;  2V0P A;  5AEN A;  3JXJ A;  4KYO B;  3IXE A;  1DC2 A;  1JUQ A;  4CZ2 D;  4CRW A;  2WXR A;  1HH8 A;  3CST A;  4OAV B;  4F3V A;  2ETA A;  2KCL A;  1ELR A;  2ZIR A;  4W9R A;  2V5F A;  2WXQ A;  2L9B A;  3ESL A;  3ONK A;  4Q94 A;  5KWD A;  3W9G A;  3SZ7 A;  4I1M A;  5KNG A;  1HG5 A;  2L6J A;  1N9A A;  4LNG A;  5E75 A;  1TN8 A;  3MKQ A;  4CT0 A;  3FUJ A;  5C1D A;  3S7F A;  3PEU B;  4JHJ A;  4IYP A;  4U96 D;  3D9H A;  3IHV A;  1BU9 A;  3BG1 B;  3UI2 A;  2X6F A;  2P9S G;  3EHM A;  3JQ1 A;  2X6H A;  5AN8 A;  2FBN A;  2X38 A;  2IJG X;  3GZS A;  4J6I A;  4M7C A;  4J8F A;  4V3I A;  4MLP A;  3BUA A;  2V4L A;  4IUL A;  4LSZ E;  1KZO A;  4JA7 A;  3K9I A;  3AS8 A;  1OXJ A;  3MA5 A;  4GYW A;  2F37 A;  4O1O A;  4F7A A;  3FY4 A;  5H7P A;  3ONL A;  5KJN A;  1JCR A;  2OVB A;  2EIM E;  3CV0 A;  5CRU A;  1OWP A;  4ACK A;  1E7V A;  1GW6 A;  1HF8 A;  3NZS A;  4XZ4 A;  3B7R L;  3D9J A;  2RFA A;  2WQH A;  4BET A;  4BSX A;  3P1U A;  3BG0 B;  4AV7 A;  2DCP A;  4TUM A;  4HLL A;  3UKR G;  4HOU A;  4WAF A;  5D66 A;  2PQR A;  5BT1 A;  4UQX A;  2ION A;  4EQF A;  5A6C A;  1IHG A;  4APO A;  1OY3 D;  3ZGQ A;  4KXK B;  2DBA A;  4CDN A;  2KM4 A;  4GTM A;  4JVS A;  4UWL A;  4I2Z A;  1FPP A;  2KCK A;  2I1J A;  4GMJ A;  4GPK A;  1K8K G;  3Q9N C;  3IV0 A;  4XI0 A;  4LNU D;  5B1A E;  3TWW A;  2IO3 C;  3FH7 A;  1LTX A;  5CER B;  4UUC A;  2XPI A;  4RG9 A;  4HQD A;  3SHF A;  3GYZ A;  2A5U A;  4Q69 A;  4CEM A;  2XZD G;  5D2M C;  3UUX A;  1BI7 B;  4EZK A;  4GTO A;  3PUK A;  3AS5 A;  2OND A;  3UTM A;  4GML A;  3QWW A;  4BY6 A;  1FT1 A;  3IHY A;  4DUI A;  1RZ4 A;  3QK0 A;  3SFX A;  2XS1 A;  1N4R A;  3ULE G;  1H6P A;  3ISM C;  5D0Q D; 
#chains in the Genus database with same CATH homology
 4GA0 A;  3CLJ A;  3Q15 A;  4UWH A;  1INZ A;  5KJK A;  3VLD A;  4ANW A;  1WAO 1;  3HIZ A;  4AEZ C;  3APC A;  5A23 A;  4J8D A;  4E6H A;  2VSO E;  1H2T C;  3OTN A;  1HZ4 A;  4J0U A;  4A3T A;  5LCW J;  3PEV B;  3HVE A;  2YIN A;  4GYO A;  4AXH A;  1QZ2 A;  4FUL A;  1X5B A;  5ENN A;  5JJT A;  4GZ3 A;  4FLH A;  1QNF A;  4NQ0 A;  4UWK A;  4KMO A;  1HX8 A;  4KZC A;  3NZU A;  2MRI A;  3FH5 A;  4NUR A;  2VQ2 A;  2PL2 A;  3ASH A;  3D9K A;  3GZ1 A;  4LCT A;  4YVQ C;  4N2Q A;  3S7J A;  1ELW A;  3I4R B;  5T4Y A;  5ARG A;  3S7B A;  3QNK A;  3HVE B;  1UJJ A;  3ZEF A;  5HQ8 A;  5D0O D;  4XX5 A;  4U0S A;  5CHE E;  3TJP A;  4AIF A;  2XQ0 A;  4GCN A;  2KCV A;  4R7L A;  1OUV A;  1XGW A;  1BPO A;  2J49 A;  3CQG B;  3L17 A;  3CVN A;  3D3M A;  3PVL A;  3R7R A;  3PE4 A;  3UT8 A;  4B0Z A;  4WNG A;  4B89 A;  2IU1 A;  4EZL A;  2R59 A;  1UW4 B;  2V8S E;  3QAR A;  1LF8 A;  5AYW D;  1HO8 A;  1P5Q A;  3RK6 A;  1ZU2 A;  3Q49 B;  5BUZ A;  3RKV A;  3CK7 A;  2AVP A;  3PNT B;  4L2L A;  4N39 A;  2OVF A;  2M63 A;  3CR3 A;  4RVB A;  3C98 A;  1KT1 A;  5BW8 C;  2J09 A;  3CEQ A;  3PZD A;  2WVI A;  3AU4 A;  2RG8 A;  2WMN A;  3ASD A;  3LY7 A;  4Y6W A;  2Q7F A;  5FZR A;  4EBA G;  2WPV A;  3D9I A;  3CVL A;  3TAX A;  3PRE A;  3D9O A;  3FUE A;  5BV1 A;  3D9L A;  4ILH B;  4UWG A;  2CHW A;  3TL5 A;  2YQ8 A;  4WNE A;  2IQC A;  4FLB A;  3OXG A;  4PS8 A;  3D9P A;  2VYI A;  2KAT A;  2R17 C;  3LCA A;  5T3R A;  4KBQ A;  4AY5 A;  3CHQ A;  4JL0 A;  3ZYL A;  4JW1 A;  1PY1 A;  1H2U A;  2VGX B;  4XKC A;  4B94 A;  2RD0 A;  3CHP A;  4ANV A;  3D9N A;  2J07 A;  1MQS A;  4EEC A;  3I4G A;  3U9W A;  3KS2 A;  2AW6 A;  2LSU A;  3L54 A;  2WXP A;  4EBA A;  2CHZ A;  2XRZ A;  1OWM A;  5BNW A;  3FUF A;  3R7Q A;  3ZW3 A;  5A7D B;  3Q5M A;  2A4Z A;  4BFR A;  2GRL A;  2PQN A;  4G26 A;  1HFA A;  1EYH A;  3GW4 A;  3G2V A;  4WND A;  3QOU A;  3CHR A;  5BV0 A;  1DNP A;  2WXO A;  3CHO A;  2GGF A;  3QC1 A;  2PM6 A;  1A17 A;  4UQY A;  4L7T A;  3UX4 A;  4J8E A;  4UWF A;  2I1K A;  3ZXS A;  3RO3 A;  2P58 C;  2DIW A;  5E76 A;  1B89 A;  3RRN B;  1VDY A;  3JUI A;  3TXM A;  2Y4T A;  4F53 A;  2CG2 A;  2KZT B;  2WXJ A;  3QKY A;  4L2Y A;  3LVR E;  2XPZ A;  3T8M A;  1Y8M A;  5ANR A;  4XIF A;  5G04 C;  4HVB A;  3CHS A;  3KEZ A;  1E90 A;  3ULQ A;  4MS6 A;  3Q47 B;  3IKO B;  3FUL A;  2ILR A;  2FO7 A;  5LCW C;  1Z3Y A;  2NSZ A;  4HLE A;  1N52 A;  5FQ4 A;  4A1S A;  3VLF A;  5KJM A;  1IYG A;  4HOS A;  3MKR A;  4IRU A;  4U04 A;  5EX3 A;  2X6I A;  2E2E A;  3L13 A;  4N3C A;  3APF A;  2VJ8 A;  4G11 A;  1UJK A;  3ZFW A;  2I9C A;  2XGM A;  3B7S A;  4OVU A;  2IOS A;  3LY8 A;  4JHK A;  3VTX A;  3FHE A;  3ZN3 A;  4Y6C A;  4CCA A;  1OWO A;  4HOT A;  1OWN A;  3G2T A;  3FTS A;  3SI5 A;  4TUU A;  4DJA A;  4JZY A;  2KC7 A;  2C0L A;  3L08 A;  3IBE A;  3EIQ C;  4A55 A;  2XHE A;  5EKQ D;  2J4D A;  3TGO A;  3B7U X;  4QFV A;  3CVP A;  1EPU A;  3EIJ A;  3TG4 A;  3GZ2 A;  5BPP A;  4HFG A;  3FUN A;  5JHB A;  2LO6 A;  1SQM A;  2BF0 X;  4JEU A;  3B7T A;  3CQC B;  3KD7 A;  3OAW A;  4UI9 J;  3FUK A;  1H2V C;  2GW1 A;  2VTB B;  3VTY A;  2I6H A;  4GYY A;  1ELK A;  2XCB A;  1JPL A;  3ML9 A;  1UN9 A;  3ZIM A;  5J08 A;  2X6J A;  3ZYK A;  4ACL A;  4YVO A;  4BX8 A;  2YNQ A;  4MRU A;  2J9Q A;  3ASG A;  1E8Y A;  1H6K A;  2VSX E;  3CGH A;  3CK8 A;  2PZI A;  2Y3A A;  3FWV A;  2NXP A;  3ZPJ A;  2WQ7 A;  1QQE A;  3FTZ A;  1N54 A;  1WY6 A;  4U63 A;  3CSF A;  1PC2 A;  3LDZ A;  3PNL B;  2XGO A;  4G25 A;  2BUG A;  3SBS A;  1JWF A;  2WMO A;  3APD A;  4H7X A;  3IEG A;  3FUI A;  3UT4 A;  4K03 A;  2FUL A;  3UQ3 A;  2YHE A;  3FEX A;  1TJF A;  3FTW A;  3EDT B;  4C0E A;  4G2V A;  3U66 A;  4HS2 A;  5LX8 A;  2CG3 A;  2WQ6 A;  3FUH A;  3FU5 A;  5FJY A;  5CCL A;  2QY7 A;  4B8C B;  4CDR A;  3LY9 A;  2OOE A;  3ESK A;  1Z3X A;  3CVU A;  3URZ A;  4N3B A;  1E8W A;  5AJL A;  4ME2 A;  4A1G A;  3O48 A;  4BX9 A;  3EHN A;  3PS6 A;  3RJV A;  2L0I A;  3FU6 A;  4DLO A;  3FTU A;  1E8X A;  2L0T B;  2JEK A;  4CDM A;  2LSV A;  4AOF A;  3DPD A;  4APF A;  5G2N A;  3JCK C;  4H7Y A;  2YHC A;  2WXH A;  4I1O B;  4TRQ A;  1IQR A;  1S0P A;  3I5P A;  4KVM A;  4AP2 A;  4DI3 A;  3P2B A;  2BTD A;  3LVQ E;  3L22 A;  4KT6 B;  2MOW A;  4PUC A;  4GZC A;  2WXG A;  4JC8 A;  5KCM A;  2XCC A;  4G24 A;  3HYM B;  3OXL A;  1NP7 A;  4XE0 A;  1XNF A;  4CGV A;  4JEH A;  3LS8 A;  5FTP A;  2CFU A;  4D10 C;  4U07 A;  2XPY A;  3FU0 A;  5G04 J;  3HHM A;  3CVV A;  2HM8 A;  4GAA A;  4DLQ A;  1NA0 A;  2V0P A;  5AEN A;  1TJC A;  3RRU A;  2FI7 A;  4I43 A;  3SNX A;  3FU3 A;  4KYO B;  1SZ9 A;  2WXL A;  5C2Y A;  2WXI A;  1FVF A;  2EQX A;  2AWI A;  4NAC A;  5G05 J;  2R5S A;  1EF1 C;  1H0A A;  3BEE A;  1JUQ A;  4CRW A;  4I1A A;  2WXR A;  4AVX A;  4LER A;  1HH8 A;  2UY1 A;  3MV3 B;  3MZL B;  3CST A;  4I17 A;  3UMV A;  3ZYM A;  4F1S A;  4GZ6 A;  4F3V A;  2KCL A;  3MX3 A;  3L6A A;  3HDX A;  1ELR A;  4N2S A;  5G55 A;  4N5C A;  4W9R A;  2WXN A;  4BT8 A;  1E96 B;  2V5F A;  3AU5 A;  5JHA A;  2WXQ A;  3SFZ A;  3MKQ B;  1MHQ A;  2L9B A;  3FTY A;  3ESL A;  4LEU A;  3ONK A;  2Y4U A;  4LRZ A;  3NF1 A;  4Q94 A;  5G05 C;  3Q4A B;  1FVH A;  4XKB A;  4GU5 A;  4BWR A;  3RRM B;  4EZJ A;  3SZ7 A;  2VGY A;  5FZQ A;  4I1M A;  1HG5 A;  2L6J A;  3FTV A;  3MJW A;  4GZD A;  4BTA A;  5E75 A;  3G2W A;  3VLE A;  3JQ0 A;  3MKQ A;  3KAE A;  3FUJ A;  4CT0 A;  4FHJ A;  1E7U A;  3S7F A;  5C1D A;  2E0I A;  4CGW A;  3G2S A;  3FDH A;  3PEU B;  4AJW A;  4JHJ A;  1U3C A;  4IYP A;  3L16 A;  5DIZ A;  3ZHE B;  3DBS A;  4ATG A;  3ASF A;  3IHV A;  3BG1 B;  4XI9 A;  3U3W A;  2X6F A;  1UN8 A;  5FQ6 A;  5EDS A;  3ML8 A;  3EHM A;  3JQ1 A;  3G2U A;  5JJ6 A;  2CFZ A;  2X6H A;  3ZYQ A;  2NC9 A;  4A3V A;  3OXF A;  2FBN A;  5LOZ A;  3S2A A;  5EX0 A;  2X38 A;  3PDN A;  1KT0 A;  2IJG X;  3T5X A;  1JWG A;  3PE3 A;  4TV3 A;  3MGB A;  1HU3 A;  4IN3 B;  3CVY A;  2I2O A;  2J4B A;  3GZS A;  4J6I A;  4J8F A;  1UG3 A;  4O6F A;  4V3I A;  1HXI A;  3LJ3 A;  4MLP A;  3CHM A;  3ENE A;  2OV8 A;  3CVQ A;  4KZ0 A;  1E8Z A;  1W3B A;  3LPZ A;  3LYA A;  2V4L A;  3CKC A;  3ZRH A;  4OYS A;  4IUL A;  2J08 A;  4FU3 A;  2UWJ G;  4ANU A;  2VTB A;  1SZA A;  4JA7 A;  3UT7 A;  4BT9 A;  4GB9 A;  3K9I A;  3AS8 A;  2CHX A;  5DBK A;  1HE8 A;  4I9E A;  3MA5 A;  3FH8 A;  4PDX A;  2AXV A;  4G23 A;  3FEY A;  3CVW A;  3FP3 A;  2MHK A;  4JXT A;  2VSN A;  4GYW A;  4U0U A;  5J90 A;  3CKB A;  2XEV A;  2C0M A;  2GRM A;  4NRH B;  4F7A A;  3LEW A;  4I9C A;  3SF4 A;  4ABN A;  4I6E A;  3FY4 A;  2VSY A;  4UI9 K;  1Z6T A;  4L1B A;  4LUN U;  3ONL A;  3MV2 B;  1H19 A;  2JLB A;  5KJN A;  4UI9 C;  2OVB A;  1IQU A;  4PS3 A;  3CV0 A;  4CT4 A;  4U0Z A;  1OWP A;  4ACK A;  4URK A;  1E7V A;  1GW6 A;  3WXX A;  1HF8 A;  3R9A B;  2X6K A;  4FP7 A;  4U8H A;  3NZS A;  4XZ4 A;  4AY6 A;  3B7R L;  3D9J A;  4L23 A;  4P29 A;  3RO2 A;  4BTB A;  4DPR A;  2WQH A;  3MEK A;  2HYZ A;  4FC8 A;  4PS7 A;  3SGH A;  5LFA A;  4BSX A;  5FQ7 A;  4C9B B;  3P1U A;  3BG0 B;  1EDU A;  3FTX A;  5FT9 A;  3QB2 A;  4JPS A;  2UY1 B;  4K0R A;  4AV7 A;  2DCP A;  4FJY A;  4Q96 A;  5HI7 A;  3LXU X;  4HOU A;  1YA0 A;  4WAF A;  2HR2 A;  3TG5 A;  1NA3 A;  3MCX A;  3O4Z A;  2AXZ A;  3ZVV A;  5M72 A;  2PQR A;  5BT1 A;  4UQX A;  3T5V A;  5ARF A;  2ION A;  4M3O A;  4EQF A;  1HG2 A;  5A6C A;  1IHG A;  4OVV A;  4FAD A;  3CVX A;  3EJN A;  4APO A;  2IF4 A;  1Y6I A;  4I6G A;  4DK5 A;  5CMW A;  4EPZ A;  2WB2 A;  3ZGQ A;  4KXK B;  2XRY A;  3TXN A;  2DBA A;  3CK9 A;  5FQ8 A;  4UQZ A;  4CDN A;  5AIJ A;  1L5J A;  2QFC A;  1FCH A;  2KM4 A;  4N3A A;  4JVS A;  4UWL A;  4GCO A;  3JYS A;  4I2Z A;  3NQP A;  4WUY A;  5FZS A;  3RU0 A;  2KCK A;  2IFU A;  2I1J A;  2WM9 A;  4ILI A;  4GMJ A;  4GPK A;  3FUM A;  1KLX A;  4HOQ A;  4WNF A;  4RSY A;  3IV0 A;  5CMY A;  3CIA A;  4XI0 A;  2FEZ A;  5FWQ A;  1OWL A;  3SD5 A;  4WWO A;  4ILG A;  3QJZ A;  3PUJ A;  4G1T A;  4JA9 A;  3U64 A;  4FHK A;  4RG6 A;  3RIB A;  2ZU6 B;  2LAI A;  2PM7 A;  2HO1 A;  3FH7 A;  2VGX A;  4MKT A;  3QDN A;  3AS4 A;  1NZN A;  3D9M A;  3UPV A;  4WWP A;  5T8I A;  2WXM A;  3B13 A;  3MYV A;  2XPI A;  2FF4 A;  2WXK A;  3S7D A;  3QWP A;  4RG9 A;  4JHR A;  3QWV A;  3SHF A;  3PH0 C;  3GYZ A;  3E4B A;  2IOL A;  1ZBP A;  1TEZ A;  4WWN A;  1DVP A;  2A5U A;  4GA2 A;  4CEM A;  2XGS A;  4Q69 A;  5ANL A;  5KJL A;  3SBT B;  4DI4 A;  4FA6 A;  1PAQ A;  3UUX A;  4ANX A;  4B8A A;  2AXU A;  3QAQ A;  3N71 A;  4KVO A;  3PRZ A;  4EZK A;  4HOR A;  2X3M A;  2LNI A;  2WXF A;  3FFL A;  3PUK A;  3AS5 A;  2OND A;  3I3N A;  4FJZ A;  2LAH A;  4GML A;  3U4T A;  3QWW A;  3LKU A;  1WM5 A;  4J8S A;  5AJD A;  1U3D A;  4AM9 A;  4BY6 A;  1HS6 A;  4GZ5 A;  3IHY A;  4HXI A;  3QK0 A;  2C2L A;  4YND A;  4E85 A;  2KZT A;  4PH4 B;  5JJ7 A;  5LP0 A;  5CCM A;  4I2W A;  4I6J A;  4C0M A;  3FUD A;  3ZHE A;  4GA1 A;  5D0Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...