3HE0A

The structure of a putative transcriptional regulator tetr family protein from vibrio parahaemolyticus.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
182
Chain Sequence
DKRDQILAAAEQLIAESGFQGLSMQKLANEAGVAAGTIYRYFSDKEHLLEEVRLNVAKRIASAVQAGVNDDMPLKERYRTMWLNIWNLAGSNLNAISNRVLPCTTRNKTWELERKMFAQVDRLFNQGKEEGVFKPLDNEVLSGLSFEASVALARKHALGFYQLDDDALEAAIEASWDAIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Putative Transcriptional Regulator TetR Family Protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, TetR family
total genus 72
structure length 182
sequence length 186
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16295 TetR_C_10 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3he0A00
3QQAA 1RKWA 3IUVA 3DPJA 3HTHA 3FIWA 3FRQA 3BR5A 4JKZA 3KKCA 2ZB9A 3RD3A 2OF7A 3WHCA 2Q24A 5IOZA 3F0CA 3WHBA 3ON2A 4L62A 3BTIA 5DAJA 3ZQIA 3NRGA 1T33A 1JT6A 3DEWA 3HTIA 4D5CA 5HAWA 4GCLA 3SFIA 2OERA 2GENA 3PM1A 3IH3A 3VW1A 2GUHA 3MVPA 2NX4A 3JSJA 5F04A 3KZ9A 2D6YA 3BNIA 4D5FA 2O7TA 1RKTA 2VPRA 2FD5A 4B1RA 5H9TA 3E7QA 3BR2A 2G3BA 2XPUA 2DTZA 5J3LA 1Z77A 2FJ1A 3HIMA 2XB5A 2HKUA 5GPCA 4GFKA 1A6IA 2G7SA 3HGGA 5IOYA 3HTAA 3LHQA 3EGQA 3VVXA 1BJZA 2XGEA 2NS8A 2HQ5A 2IBDA 5CXGA 5FHPA 2ID6A 2UXIA 1JT0A 4NELA 3NI7A 5F0CA 4D7NA 3CWRA 2DG8A 3B6CA 4KWAA 1JUMA 2XPVA 2QIBA 4DW6A 2EH3A 2G0EA 4HKUA 2Y2ZA 3Q0UA 5K7ZA 2TRTA 4W97A 3VW2A 5EZGA 5F27A 2UXHA 4MXMA 3BR1A 4M3FA 1U9NA 4AC6A 4V2FA 4ICHA 3LSPA 4M3GA 2WGBA 2QOPA 4M3EA 3VPRA 2HYTA 2X9DA 2XGDA 3Q0WA 4X1EA 2V57A 3TP0A 2HYJA 3NPIA 3FK6A 3V78A 4MO7A 3TP3A 4AF5A 1QVUA 1JTXA 2Y31A 3G1OA 3PPBA 5FKMA 2ZCMA 2NP3A 2QCOA 2FBQA 3G1LA 3CDLA 3P9TA 2PBXA 2NS7A 3GZIA 3Q0VA 5GPAA 3LOCA 3MNLA 2PZ9A 5EZHA 4PXIA 3O60A 1QVTA 3BR0A 3BTJA 3VW0A 3O8GA 3QPSA 3B6AA 5F08A 2TCTA 2REKA 3BQYA 2OPTA 3G7RA 3CRJA 3BR3A 3IH4A 3BT9A 3COLA 2JK3A 3EUPA 4ME9A 3ZQGA 4M3DA 2FQ4A 5FKLA 4ABZA 4JL3A 3LSRA 2UXOA 2GBYA 3QPLA 2ID3A 2ZCNA 5GP9A 4I76A 2VKVA 1Z0XA 2XDNA 3ON4A 2G7LA 3VVYA 4W1UA 5D19A 3BTLA 1ORKA 2WUIA 2RASA 3C07A 4MK6A 2XPWA 2G7GA 2IAIA 3DCFA 3ZQHA 2XGCA 2I10A 2ZCXA 3CJDA 2RHAA 4CGRA 4UDSA 2FX0A 3HE0A 4G12A 1UI6A 2ZOYA 1ZK8A 3BQZA 5F0HA 2XRLA 3NNRA 4I6ZA 3CCYA 3ANGA 3V6GA 5HBUA 5CXIA 4V2GA 3G56A 5J1RA 2HXIA 1U9OA 5F1JA 3NXCA 4GCKA 3FK7A 4YZEA 3VIBA 2UXPA 5F0FA 2DG7A 1JTYA 2RAEA 3AQSA 5EFYA 3VUQA 4D7MA 3HTJA 3VVZA 3BR6A 3QKXA 2YVEA 3BCGA 2F07A 5IP6A 3SDGA 3BHQA 4NN1A 2UXUA 4M3BA 5J1UA 5K7FA 3F1BA 2NP5A 2JJ7A 4B3AA 1JUPA 3BRUA 3LSJA 3Q3SA 1RPWA 3T6NA 3RH2A 2IU5A 5K7HA 5FKNA 2X6OA 2W53A 4ACIA 4XK4A 2GFNA 5FMPA 1VI0A 4JNNA 3KNWA 2QTQA 1ZKGA 1T56A 3VOXA 1SGMA 3B81A 5J1YA 3C2BA 5AQCA 2WV1A 3IH2A 5CW8A 2YVHA 2VKEA 3HGYA 2HXOA 3AQTA 1UI5A 3VP5A 3LJLA 3O8HA 3LWJA 2O7OA 4AUXA 5IPAA 2OI8A 5D1RA 2ZOZA 3BTCA 5K58A 2QWTA 2Y30A 5EYRA 5C4YA 1QPIA 3GEUA 3ZQLA 2IEKA 3BJBA 3G1MA 5FKKA 3ZQFA 3VOKA 4AC0A 4GFLA 3PASA 2QKOA 5HSZA 5FGLA 5FKOA 4JYKA 4GCTA 3ANPA 5D18A 3KKDA 1JUSA 3QBMA 3S5RA
chains in the Genus database with same CATH superfamily
3QQAA 1RKWA 3IUVA 3DPJA 3HTHA 3FIWA 3FRQA 3BR5A 4JKZA 3KKCA 2ZB9A 3RD3A 2OF7A 3WHCA 2Q24A 5IOZA 3F0CA 3WHBA 3ON2A 4L62A 3BTIA 5DAJA 3ZQIA 3NRGA 1T33A 1JT6A 2B3WA 3DEWA 3HTIA 4D5CA 5HAWA 4GCLA 3SFIA 2OERA 2GENA 3PM1A 3IH3A 3VW1A 2GUHA 3MVPA 2NX4A 3JSJA 5F04A 3KZ9A 2D6YA 3BNIA 2R7QA 4D5FA 2O7TA 1RKTA 2VPRA 2FD5A 4B1RA 5H9TA 3E7QA 3BR2A 2G3BA 2XPUA 2DTZA 5J3LA 1Z77A 2FJ1A 3HIMA 2XB5A 2HKUA 5GPCA 4GFKA 2R7OA 1A6IA 2G7SA 3HGGA 5IOYA 3HTAA 3LHQA 3EGQA 3VVXA 1BJZA 2XGEA 2NS8A 2HQ5A 2IBDA 4OD5A 5CXGA 5FHPA 2ID6A 2UXIA 1JT0A 4NELA 2R7SA 3NI7A 5F0CA 4D7NA 3CWRA 2DG8A 3B6CA 4KWAA 1JUMA 2XPVA 2QIBA 4DW6A 2EH3A 2G0EA 2PFVA 4HKUA 2Y2ZA 3Q0UA 5K7ZA 2R7UA 4U9NA 2TRTA 3FHNA 4W97A 3VW2A 5EZGA 5F27A 2UXHA 4MXMA 3BR1A 4M3FA 1U9NA 4AC6A 4V2FA 4ICHA 3LSPA 4M3GA 2WGBA 2QOPA 4M3EA 3VPRA 2HYTA 2X9DA 2XGDA 3Q0WA 4X1EA 3K8PC 2V57A 3TP0A 2HYJA 3NPIA 3FK6A 3V78A 4MO7A 3TP3A 4AF5A 1QVUA 1JTXA 2Y31A 3G1OA 3PPBA 5FKMA 2ZCMA 2NP3A 2QCOA 2FBQA 3G1LA 3CDLA 3P9TA 2R7WA 2PBXA 2NS7A 3GZIA 4DVYP 3Q0VA 3VTIA 5GPAA 3LOCA 3MNLA 2PZ9A 2A2FX 5EZHA 4PXIA 3O60A 1QVTA 3BR0A 3BTJA 3VW0A 3O8GA 3QPSA 3B6AA 5F08A 2R7TA 2TCTA 2ZY9A 2REKA 3BQYA 2OPTA 3G7RA 3KYLA 3CRJA 3BR3A 3IH4A 3BT9A 3COLA 2JK3A 3EUPA 4ME9A 2R7XA 3ZQGA 4M3DA 2FQ4A 5FKLA 4ABZA 4JL3A 3LSRA 2UXOA 2GBYA 3QPLA 2ID3A 2ZCNA 5GP9A 4I76A 2VKVA 1Z0XA 2XDNA 3ON4A 4U9LA 2G7LA 3VVYA 4W1UA 2R7RA 3DU6A 5D19A 3BTLA 4IRVA 1ORKA 2WUIA 2RASA 3C07A 4MK6A 2XPWA 3SWHA 2FJI1 2G7GA 2IAIA 3DCFA 3ZQHA 2XGCA 2YVXA 4OD4A 2I10A 2ZCXA 3CJDA 2RHAA 4CGRA 4UDSA 2FX0A 3HE0A 4G12A 1UI6A 2ZOYA 1ZK8A 3BQZA 5F0HA 2XRLA 3NNRA 4I6ZA 3CCYA 3ANGA 3V6GA 5HBUA 5CXIA 4V2GA 3G56A 5J1RA 2HXIA 1U9OA 5F1JA 3NXCA 4GCKA 3FK7A 3NS4A 4YZEA 3VIBA 2UXPA 5F0FA 2DG7A 1JTYA 2RAEA 3AQSA 5EFYA 3VUQA 4D7MA 3HTJA 3VVZA 2R7VA 3BR6A 3QKXA 2YVEA 3BCGA 2F07A 5IP6A 3SDGA 3BHQA 4NN1A 2UXUA 3DU5A 4M3BA 5J1UA 5K7FA 3F1BA 2NP5A 4C2MA 2JJ7A 4B3AA 1JUPA 3BRUA 3LSJA 3Q3SA 1RPWA 5CQGA 3T6NA 3RH2A 2IU5A 5K7HA 5FKNA 2X6OA 2W53A 4ACIA 4XK4A 2GFNA 5FMPA 1VI0A 4JNNA 3KNWA 2QTQA 1ZKGA 1T56A 3VOXA 1SGMA 3B81A 5J1YA 4WIBA 3C2BA 5AQCA 2WV1A 3IH2A 5CW8A 2YVHA 2VKEA 3HGYA 2HXOA 3AQTA 1UI5A 3VP5A 3LJLA 3O8HA 3LWJA 2O7OA 4AUXA 5IPAA 2OI8A 5D1RA 2ZOZA 3BTCA 5K58A 2QWTA 2Y30A 5EYRA 5C4YA 1QPIA 3GEUA 3ZQLA 2IEKA 3BJBA 3G1MA 5FKKA 3ZQFA 3VOKA 4AC0A 4GFLA 3PASA 2QKOA 5HSZA 2B1EA 5FGLA 5FKOA 4JYKA 4GCTA 3ANPA 5D18A 3KKDA 1JUSA 3QBMA 3S5RA
chains in the Genus database with same CATH topology
3QQAA 1RKWA 3IUVA 3DPJA 3HTHA 3FIWA 3FRQA 3BR5A 4JKZA 3KKCA 2ZB9A 3RD3A 2OF7A 3WHCA 2Q24A 5IOZA 3F0CA 3WHBA 3ON2A 4L62A 3BTIA 5DAJA 3ZQIA 3NRGA 1T33A 1JT6A 3DEWA 3HTIA 4D5CA 5HAWA 4GCLA 3SFIA 2OERA 2GENA 3PM1A 3IH3A 3VW1A 2GUHA 3MVPA 2NX4A 3JSJA 5F04A 3KZ9A 2D6YA 3BNIA 4D5FA 2O7TA 1RKTA 2VPRA 2FD5A 4B1RA 5H9TA 3E7QA 3BR2A 2G3BA 2XPUA 2DTZA 5J3LA 1Z77A 2FJ1A 3HIMA 2XB5A 2HKUA 5GPCA 4GFKA 1A6IA 2G7SA 3HGGA 5IOYA 3HTAA 3LHQA 3EGQA 3VVXA 1BJZA 2XGEA 2NS8A 2HQ5A 2IBDA 5CXGA 5FHPA 2ID6A 2UXIA 1JT0A 4NELA 3NI7A 5F0CA 4D7NA 3CWRA 2DG8A 3B6CA 4KWAA 1JUMA 2XPVA 2QIBA 4DW6A 2EH3A 2G0EA 4HKUA 2Y2ZA 3Q0UA 5K7ZA 2TRTA 4W97A 3VW2A 5EZGA 5F27A 2UXHA 4MXMA 3BR1A 4M3FA 1U9NA 4AC6A 4V2FA 4ICHA 3LSPA 4M3GA 2WGBA 2QOPA 4M3EA 3VPRA 2HYTA 2X9DA 2XGDA 3Q0WA 4X1EA 2V57A 3TP0A 2HYJA 3NPIA 3FK6A 3V78A 4MO7A 3TP3A 4AF5A 1QVUA 1JTXA 2Y31A 3G1OA 3PPBA 5FKMA 2ZCMA 2NP3A 2QCOA 2FBQA 3G1LA 3CDLA 3P9TA 2PBXA 2NS7A 3GZIA 3Q0VA 5GPAA 3LOCA 3MNLA 2PZ9A 5EZHA 4PXIA 3O60A 1QVTA 3BR0A 3BTJA 3VW0A 3O8GA 3QPSA 3B6AA 5F08A 2TCTA 2REKA 3BQYA 2OPTA 3G7RA 3CRJA 3BR3A 3IH4A 3BT9A 3COLA 2JK3A 3EUPA 4ME9A 3ZQGA 4M3DA 2FQ4A 5FKLA 4ABZA 4JL3A 3LSRA 2UXOA 2GBYA 3QPLA 2ID3A 2ZCNA 5GP9A 4I76A 2VKVA 1Z0XA 2XDNA 3ON4A 2G7LA 3VVYA 4W1UA 5D19A 3BTLA 1ORKA 2WUIA 2RASA 3C07A 4MK6A 2XPWA 2G7GA 2IAIA 3DCFA 3ZQHA 2XGCA 2I10A 2ZCXA 3CJDA 2RHAA 4CGRA 4UDSA 2FX0A 3HE0A 4G12A 1UI6A 2ZOYA 1ZK8A 3BQZA 5F0HA 2XRLA 3NNRA 4I6ZA 3CCYA 3ANGA 3V6GA 5HBUA 5CXIA 4V2GA 3G56A 5J1RA 2HXIA 1U9OA 5F1JA 3NXCA 4GCKA 3FK7A 4YZEA 3VIBA 2UXPA 5F0FA 2DG7A 1JTYA 2RAEA 3AQSA 5EFYA 3VUQA 4D7MA 3HTJA 3VVZA 3BR6A 3QKXA 2YVEA 3BCGA 2F07A 5IP6A 3SDGA 3BHQA 4NN1A 2UXUA 4M3BA 5J1UA 5K7FA 3F1BA 2NP5A 2JJ7A 4B3AA 1JUPA 3BRUA 3LSJA 3Q3SA 1RPWA 3T6NA 3RH2A 2IU5A 5K7HA 5FKNA 2X6OA 2W53A 4ACIA 4XK4A 2GFNA 5FMPA 1VI0A 4JNNA 3KNWA 2QTQA 1ZKGA 1T56A 3VOXA 1SGMA 3B81A 5J1YA 3C2BA 5AQCA 2WV1A 3IH2A 5CW8A 2YVHA 2VKEA 3HGYA 2HXOA 3AQTA 1UI5A 3VP5A 3LJLA 3O8HA 3LWJA 2O7OA 4AUXA 5IPAA 2OI8A 5D1RA 2ZOZA 3BTCA 5K58A 2QWTA 2Y30A 5EYRA 5C4YA 1QPIA 3GEUA 3ZQLA 2IEKA 3BJBA 3G1MA 5FKKA 3ZQFA 3VOKA 4AC0A 4GFLA 3PASA 2QKOA 5HSZA 5FGLA 5FKOA 4JYKA 4GCTA 3ANPA 5D18A 3KKDA 1JUSA 3QBMA 3S5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQA A;  1RKW A;  3IUV A;  3DPJ A;  3HTH A;  3FIW A;  3FRQ A;  3BR5 A;  4JKZ A;  3KKC A;  2ZB9 A;  3RD3 A;  2OF7 A;  3WHC A;  2Q24 A;  5IOZ A;  3F0C A;  3WHB A;  3ON2 A;  4L62 A;  3BTI A;  5DAJ A;  3ZQI A;  3NRG A;  1T33 A;  1JT6 A;  3DEW A;  3HTI A;  4D5C A;  5HAW A;  4GCL A;  3SFI A;  2OER A;  2GEN A;  3PM1 A;  3IH3 A;  3VW1 A;  2GUH A;  3MVP A;  2NX4 A;  3JSJ A;  5F04 A;  3KZ9 A;  2D6Y A;  3BNI A;  4D5F A;  2O7T A;  1RKT A;  2VPR A;  2FD5 A;  4B1R A;  5H9T A;  3E7Q A;  3BR2 A;  2G3B A;  2XPU A;  2DTZ A;  5J3L A;  1Z77 A;  2FJ1 A;  3HIM A;  2XB5 A;  2HKU A;  5GPC A;  4GFK A;  1A6I A;  2G7S A;  3HGG A;  5IOY A;  3HTA A;  3LHQ A;  3EGQ A;  3VVX A;  1BJZ A;  2XGE A;  2NS8 A;  2HQ5 A;  2IBD A;  5CXG A;  5FHP A;  2ID6 A;  2UXI A;  1JT0 A;  4NEL A;  3NI7 A;  5F0C A;  4D7N A;  3CWR A;  2DG8 A;  3B6C A;  4KWA A;  1JUM A;  2XPV A;  2QIB A;  4DW6 A;  2EH3 A;  2G0E A;  4HKU A;  2Y2Z A;  3Q0U A;  5K7Z A;  2TRT A;  4W97 A;  3VW2 A;  5EZG A;  5F27 A;  2UXH A;  4MXM A;  3BR1 A;  4M3F A;  1U9N A;  4AC6 A;  4V2F A;  4ICH A;  3LSP A;  4M3G A;  2WGB A;  2QOP A;  4M3E A;  3VPR A;  2HYT A;  2X9D A;  2XGD A;  3Q0W A;  4X1E A;  2V57 A;  3TP0 A;  2HYJ A;  3NPI A;  3FK6 A;  3V78 A;  4MO7 A;  3TP3 A;  4AF5 A;  1QVU A;  1JTX A;  2Y31 A;  3G1O A;  3PPB A;  5FKM A;  2ZCM A;  2NP3 A;  2QCO A;  2FBQ A;  3G1L A;  3CDL A;  3P9T A;  2PBX A;  2NS7 A;  3GZI A;  3Q0V A;  5GPA A;  3LOC A;  3MNL A;  2PZ9 A;  5EZH A;  4PXI A;  3O60 A;  1QVT A;  3BR0 A;  3BTJ A;  3VW0 A;  3O8G A;  3QPS A;  3B6A A;  5F08 A;  2TCT A;  2REK A;  3BQY A;  2OPT A;  3G7R A;  3CRJ A;  3BR3 A;  3IH4 A;  3BT9 A;  3COL A;  2JK3 A;  3EUP A;  4ME9 A;  3ZQG A;  4M3D A;  2FQ4 A;  5FKL A;  4ABZ A;  4JL3 A;  3LSR A;  2UXO A;  2GBY A;  3QPL A;  2ID3 A;  2ZCN A;  5GP9 A;  4I76 A;  2VKV A;  1Z0X A;  2XDN A;  3ON4 A;  2G7L A;  3VVY A;  4W1U A;  5D19 A;  3BTL A;  1ORK A;  2WUI A;  2RAS A;  3C07 A;  4MK6 A;  2XPW A;  2G7G A;  2IAI A;  3DCF A;  3ZQH A;  2XGC A;  2I10 A;  2ZCX A;  3CJD A;  2RHA A;  4CGR A;  4UDS A;  2FX0 A;  3HE0 A;  4G12 A;  1UI6 A;  2ZOY A;  1ZK8 A;  3BQZ A;  5F0H A;  2XRL A;  3NNR A;  4I6Z A;  3CCY A;  3ANG A;  3V6G A;  5HBU A;  5CXI A;  4V2G A;  3G56 A;  5J1R A;  2HXI A;  1U9O A;  5F1J A;  3NXC A;  4GCK A;  3FK7 A;  4YZE A;  3VIB A;  2UXP A;  5F0F A;  2DG7 A;  1JTY A;  2RAE A;  3AQS A;  5EFY A;  3VUQ A;  4D7M A;  3HTJ A;  3VVZ A;  3BR6 A;  3QKX A;  2YVE A;  3BCG A;  2F07 A;  5IP6 A;  3SDG A;  3BHQ A;  4NN1 A;  2UXU A;  4M3B A;  5J1U A;  5K7F A;  3F1B A;  2NP5 A;  2JJ7 A;  4B3A A;  1JUP A;  3BRU A;  3LSJ A;  3Q3S A;  1RPW A;  3T6N A;  3RH2 A;  2IU5 A;  5K7H A;  5FKN A;  2X6O A;  2W53 A;  4ACI A;  4XK4 A;  2GFN A;  5FMP A;  1VI0 A;  4JNN A;  3KNW A;  2QTQ A;  1ZKG A;  1T56 A;  3VOX A;  1SGM A;  3B81 A;  5J1Y A;  3C2B A;  5AQC A;  2WV1 A;  3IH2 A;  5CW8 A;  2YVH A;  2VKE A;  3HGY A;  2HXO A;  3AQT A;  1UI5 A;  3VP5 A;  3LJL A;  3O8H A;  3LWJ A;  2O7O A;  4AUX A;  5IPA A;  2OI8 A;  5D1R A;  2ZOZ A;  3BTC A;  5K58 A;  2QWT A;  2Y30 A;  5EYR A;  5C4Y A;  1QPI A;  3GEU A;  3ZQL A;  2IEK A;  3BJB A;  3G1M A;  5FKK A;  3ZQF A;  3VOK A;  4AC0 A;  4GFL A;  3PAS A;  2QKO A;  5HSZ A;  5FGL A;  5FKO A;  4JYK A;  4GCT A;  3ANP A;  5D18 A;  3KKD A;  1JUS A;  3QBM A;  3S5R A; 
#chains in the Genus database with same CATH topology
 3QQA A;  1RKW A;  3IUV A;  3DPJ A;  3HTH A;  3FIW A;  3FRQ A;  3BR5 A;  4JKZ A;  3KKC A;  2ZB9 A;  3RD3 A;  2OF7 A;  3WHC A;  2Q24 A;  5IOZ A;  3F0C A;  3WHB A;  3ON2 A;  4L62 A;  3BTI A;  5DAJ A;  3ZQI A;  3NRG A;  1T33 A;  1JT6 A;  2B3W A;  3DEW A;  3HTI A;  4D5C A;  5HAW A;  4GCL A;  3SFI A;  2OER A;  2GEN A;  3PM1 A;  3IH3 A;  3VW1 A;  2GUH A;  3MVP A;  2NX4 A;  3JSJ A;  5F04 A;  3KZ9 A;  2D6Y A;  3BNI A;  2R7Q A;  4D5F A;  2O7T A;  1RKT A;  2VPR A;  2FD5 A;  4B1R A;  5H9T A;  3E7Q A;  3BR2 A;  2G3B A;  2XPU A;  2DTZ A;  5J3L A;  1Z77 A;  2FJ1 A;  3HIM A;  2XB5 A;  2HKU A;  5GPC A;  4GFK A;  2R7O A;  1A6I A;  2G7S A;  3HGG A;  5IOY A;  3HTA A;  3LHQ A;  3EGQ A;  3VVX A;  1BJZ A;  2XGE A;  2NS8 A;  2HQ5 A;  2IBD A;  4OD5 A;  5CXG A;  5FHP A;  2ID6 A;  2UXI A;  1JT0 A;  4NEL A;  2R7S A;  3NI7 A;  5F0C A;  4D7N A;  3CWR A;  2DG8 A;  3B6C A;  4KWA A;  1JUM A;  2XPV A;  2QIB A;  4DW6 A;  2EH3 A;  2G0E A;  2PFV A;  4HKU A;  2Y2Z A;  3Q0U A;  5K7Z A;  2R7U A;  4U9N A;  2TRT A;  3FHN A;  4W97 A;  3VW2 A;  5EZG A;  5F27 A;  2UXH A;  4MXM A;  3BR1 A;  4M3F A;  1U9N A;  4AC6 A;  4V2F A;  4ICH A;  3LSP A;  4M3G A;  2WGB A;  2QOP A;  4M3E A;  3VPR A;  2HYT A;  2X9D A;  2XGD A;  3Q0W A;  4X1E A;  3K8P C;  2V57 A;  3TP0 A;  2HYJ A;  3NPI A;  3FK6 A;  3V78 A;  4MO7 A;  3TP3 A;  4AF5 A;  1QVU A;  1JTX A;  2Y31 A;  3G1O A;  3PPB A;  5FKM A;  2ZCM A;  2NP3 A;  2QCO A;  2FBQ A;  3G1L A;  3CDL A;  3P9T A;  2R7W A;  2PBX A;  2NS7 A;  3GZI A;  4DVY P;  3Q0V A;  3VTI A;  5GPA A;  3LOC A;  3MNL A;  2PZ9 A;  2A2F X;  5EZH A;  4PXI A;  3O60 A;  1QVT A;  3BR0 A;  3BTJ A;  3VW0 A;  3O8G A;  3QPS A;  3B6A A;  5F08 A;  2R7T A;  2TCT A;  2ZY9 A;  2REK A;  3BQY A;  2OPT A;  3G7R A;  3KYL A;  3CRJ A;  3BR3 A;  3IH4 A;  3BT9 A;  3COL A;  2JK3 A;  3EUP A;  4ME9 A;  2R7X A;  3ZQG A;  4M3D A;  2FQ4 A;  5FKL A;  4ABZ A;  4JL3 A;  3LSR A;  2UXO A;  2GBY A;  3QPL A;  2ID3 A;  2ZCN A;  5GP9 A;  4I76 A;  2VKV A;  1Z0X A;  2XDN A;  3ON4 A;  4U9L A;  2G7L A;  3VVY A;  4W1U A;  2R7R A;  3DU6 A;  5D19 A;  3BTL A;  4IRV A;  1ORK A;  2WUI A;  2RAS A;  3C07 A;  4MK6 A;  2XPW A;  3SWH A;  2FJI 1;  2G7G A;  2IAI A;  3DCF A;  3ZQH A;  2XGC A;  2YVX A;  4OD4 A;  2I10 A;  2ZCX A;  3CJD A;  2RHA A;  4CGR A;  4UDS A;  2FX0 A;  3HE0 A;  4G12 A;  1UI6 A;  2ZOY A;  1ZK8 A;  3BQZ A;  5F0H A;  2XRL A;  3NNR A;  4I6Z A;  3CCY A;  3ANG A;  3V6G A;  5HBU A;  5CXI A;  4V2G A;  3G56 A;  5J1R A;  2HXI A;  1U9O A;  5F1J A;  3NXC A;  4GCK A;  3FK7 A;  3NS4 A;  4YZE A;  3VIB A;  2UXP A;  5F0F A;  2DG7 A;  1JTY A;  2RAE A;  3AQS A;  5EFY A;  3VUQ A;  4D7M A;  3HTJ A;  3VVZ A;  2R7V A;  3BR6 A;  3QKX A;  2YVE A;  3BCG A;  2F07 A;  5IP6 A;  3SDG A;  3BHQ A;  4NN1 A;  2UXU A;  3DU5 A;  4M3B A;  5J1U A;  5K7F A;  3F1B A;  2NP5 A;  4C2M A;  2JJ7 A;  4B3A A;  1JUP A;  3BRU A;  3LSJ A;  3Q3S A;  1RPW A;  5CQG A;  3T6N A;  3RH2 A;  2IU5 A;  5K7H A;  5FKN A;  2X6O A;  2W53 A;  4ACI A;  4XK4 A;  2GFN A;  5FMP A;  1VI0 A;  4JNN A;  3KNW A;  2QTQ A;  1ZKG A;  1T56 A;  3VOX A;  1SGM A;  3B81 A;  5J1Y A;  4WIB A;  3C2B A;  5AQC A;  2WV1 A;  3IH2 A;  5CW8 A;  2YVH A;  2VKE A;  3HGY A;  2HXO A;  3AQT A;  1UI5 A;  3VP5 A;  3LJL A;  3O8H A;  3LWJ A;  2O7O A;  4AUX A;  5IPA A;  2OI8 A;  5D1R A;  2ZOZ A;  3BTC A;  5K58 A;  2QWT A;  2Y30 A;  5EYR A;  5C4Y A;  1QPI A;  3GEU A;  3ZQL A;  2IEK A;  3BJB A;  3G1M A;  5FKK A;  3ZQF A;  3VOK A;  4AC0 A;  4GFL A;  3PAS A;  2QKO A;  5HSZ A;  2B1E A;  5FGL A;  5FKO A;  4JYK A;  4GCT A;  3ANP A;  5D18 A;  3KKD A;  1JUS A;  3QBM A;  3S5R A; 
#chains in the Genus database with same CATH homology
 3QQA A;  1RKW A;  3IUV A;  3DPJ A;  3HTH A;  3FIW A;  3FRQ A;  3BR5 A;  4JKZ A;  3KKC A;  2ZB9 A;  3RD3 A;  2OF7 A;  3WHC A;  2Q24 A;  5IOZ A;  3F0C A;  3WHB A;  3ON2 A;  4L62 A;  3BTI A;  5DAJ A;  3ZQI A;  3NRG A;  1T33 A;  1JT6 A;  3DEW A;  3HTI A;  4D5C A;  5HAW A;  4GCL A;  3SFI A;  2OER A;  2GEN A;  3PM1 A;  3IH3 A;  3VW1 A;  2GUH A;  3MVP A;  2NX4 A;  3JSJ A;  5F04 A;  3KZ9 A;  2D6Y A;  3BNI A;  4D5F A;  2O7T A;  1RKT A;  2VPR A;  2FD5 A;  4B1R A;  5H9T A;  3E7Q A;  3BR2 A;  2G3B A;  2XPU A;  2DTZ A;  5J3L A;  1Z77 A;  2FJ1 A;  3HIM A;  2XB5 A;  2HKU A;  5GPC A;  4GFK A;  1A6I A;  2G7S A;  3HGG A;  5IOY A;  3HTA A;  3LHQ A;  3EGQ A;  3VVX A;  1BJZ A;  2XGE A;  2NS8 A;  2HQ5 A;  2IBD A;  5CXG A;  5FHP A;  2ID6 A;  2UXI A;  1JT0 A;  4NEL A;  3NI7 A;  5F0C A;  4D7N A;  3CWR A;  2DG8 A;  3B6C A;  4KWA A;  1JUM A;  2XPV A;  2QIB A;  4DW6 A;  2EH3 A;  2G0E A;  4HKU A;  2Y2Z A;  3Q0U A;  5K7Z A;  2TRT A;  4W97 A;  3VW2 A;  5EZG A;  5F27 A;  2UXH A;  4MXM A;  3BR1 A;  4M3F A;  1U9N A;  4AC6 A;  4V2F A;  4ICH A;  3LSP A;  4M3G A;  2WGB A;  2QOP A;  4M3E A;  3VPR A;  2HYT A;  2X9D A;  2XGD A;  3Q0W A;  4X1E A;  2V57 A;  3TP0 A;  2HYJ A;  3NPI A;  3FK6 A;  3V78 A;  4MO7 A;  3TP3 A;  4AF5 A;  1QVU A;  1JTX A;  2Y31 A;  3G1O A;  3PPB A;  5FKM A;  2ZCM A;  2NP3 A;  2QCO A;  2FBQ A;  3G1L A;  3CDL A;  3P9T A;  2PBX A;  2NS7 A;  3GZI A;  3Q0V A;  5GPA A;  3LOC A;  3MNL A;  2PZ9 A;  5EZH A;  4PXI A;  3O60 A;  1QVT A;  3BR0 A;  3BTJ A;  3VW0 A;  3O8G A;  3QPS A;  3B6A A;  5F08 A;  2TCT A;  2REK A;  3BQY A;  2OPT A;  3G7R A;  3CRJ A;  3BR3 A;  3IH4 A;  3BT9 A;  3COL A;  2JK3 A;  3EUP A;  4ME9 A;  3ZQG A;  4M3D A;  2FQ4 A;  5FKL A;  4ABZ A;  4JL3 A;  3LSR A;  2UXO A;  2GBY A;  3QPL A;  2ID3 A;  2ZCN A;  5GP9 A;  4I76 A;  2VKV A;  1Z0X A;  2XDN A;  3ON4 A;  2G7L A;  3VVY A;  4W1U A;  5D19 A;  3BTL A;  1ORK A;  2WUI A;  2RAS A;  3C07 A;  4MK6 A;  2XPW A;  2G7G A;  2IAI A;  3DCF A;  3ZQH A;  2XGC A;  2I10 A;  2ZCX A;  3CJD A;  2RHA A;  4CGR A;  4UDS A;  2FX0 A;  3HE0 A;  4G12 A;  1UI6 A;  2ZOY A;  1ZK8 A;  3BQZ A;  5F0H A;  2XRL A;  3NNR A;  4I6Z A;  3CCY A;  3ANG A;  3V6G A;  5HBU A;  5CXI A;  4V2G A;  3G56 A;  5J1R A;  2HXI A;  1U9O A;  5F1J A;  3NXC A;  4GCK A;  3FK7 A;  4YZE A;  3VIB A;  2UXP A;  5F0F A;  2DG7 A;  1JTY A;  2RAE A;  3AQS A;  5EFY A;  3VUQ A;  4D7M A;  3HTJ A;  3VVZ A;  3BR6 A;  3QKX A;  2YVE A;  3BCG A;  2F07 A;  5IP6 A;  3SDG A;  3BHQ A;  4NN1 A;  2UXU A;  4M3B A;  5J1U A;  5K7F A;  3F1B A;  2NP5 A;  2JJ7 A;  4B3A A;  1JUP A;  3BRU A;  3LSJ A;  3Q3S A;  1RPW A;  3T6N A;  3RH2 A;  2IU5 A;  5K7H A;  5FKN A;  2X6O A;  2W53 A;  4ACI A;  4XK4 A;  2GFN A;  5FMP A;  1VI0 A;  4JNN A;  3KNW A;  2QTQ A;  1ZKG A;  1T56 A;  3VOX A;  1SGM A;  3B81 A;  5J1Y A;  3C2B A;  5AQC A;  2WV1 A;  3IH2 A;  5CW8 A;  2YVH A;  2VKE A;  3HGY A;  2HXO A;  3AQT A;  1UI5 A;  3VP5 A;  3LJL A;  3O8H A;  3LWJ A;  2O7O A;  4AUX A;  5IPA A;  2OI8 A;  5D1R A;  2ZOZ A;  3BTC A;  5K58 A;  2QWT A;  2Y30 A;  5EYR A;  5C4Y A;  1QPI A;  3GEU A;  3ZQL A;  2IEK A;  3BJB A;  3G1M A;  5FKK A;  3ZQF A;  3VOK A;  4AC0 A;  4GFL A;  3PAS A;  2QKO A;  5HSZ A;  5FGL A;  5FKO A;  4JYK A;  4GCT A;  3ANP A;  5D18 A;  3KKD A;  1JUS A;  3QBM A;  3S5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...