3HE0A

The structure of a putative transcriptional regulator tetr family protein from vibrio parahaemolyticus.
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
182
Chain Sequence
DKRDQILAAAEQLIAESGFQGLSMQKLANEAGVAAGTIYRYFSDKEHLLEEVRLNVAKRIASAVQAGVNDDMPLKERYRTMWLNIWNLAGSNLNAISNRVLPCTTRNKTWELERKMFAQVDRLFNQGKEEGVFKPLDNEVLSGLSFEASVALARKHALGFYQLDDDALEAAIEASWDAIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title The Structure of a Putative Transcriptional Regulator TetR Family Protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transcription regulator
total genus 72
structure length 182
sequence length 186
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16295 TetR_C_10 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3he0A00
1RKWA 3BTCA 3G1OA 2EH3A 2D6YA 3NRGA 3BTIA 3VW0A 2GUHA 4GCTA 2XGDA 3IH4A 2UXUA 3FRQA 5J1UA 3VW1A 2XGEA 2TCTA 4JNNA 2X6OA 3CWRA 4HKUA 2FQ4A 2VKEA 3ZQFA 2OI8A 1BJZA 1QVTA 1JUMA 3HTJA 1A6IA 4AC0A 3BR2A 2HQ5A 2WV1A 3VW2A 3VUQA 2DG8A 3BQZA 1U9NA 2GFNA 2XPVA 2ZOZA 2XDNA 3B6AA 3BR1A 5J1YA 3BRUA 2UXPA 3IH2A 2FBQA 5FMPA 2Y31A 4JL3A 1Z77A 5FHPA 5F08A 3HGYA 1T33A 4M3FA 4L62A 4G12A 3IH3A 3HGGA 3AQSA 3BR5A 3ANPA 2ID6A 3EUPA 3EGQA 1JTYA 5EFYA 3LSPA 3NXCA 5F0HA 4I76A 3QPSA 3KKCA 2HXOA 3BNIA 3HTAA 2I10A 5J3LA 2JJ7A 4MK6A 5FKKA 2G7LA 2FX0A 2G7SA 2HXIA 3LOCA 4AUXA 5IPAA 3VVZA 2W53A 3HTIA 5CXGA 3PPBA 4M3DA 2GBYA 3QBMA 3DPJA 4GCKA 3JSJA 3BQYA 2UXOA 2XRLA 2REKA 1T56A 2YVHA 3G1MA 2UXHA 3TP0A 2QKOA 3VP5A 2XB5A 3QQAA 4NN1A 2HYJA 3Q0VA 4X1EA 1UI6A 2WUIA 3GEUA 3PM1A 2PZ9A 3Q0WA 2NS7A 3Q0UA 2O7TA 2OPTA 4PXIA 3RD3A 3PASA 3B81A 4V2GA 5IOZA 2V57A 2VKVA 3RH2A 3G56A 3VPRA 2PBXA 4ACIA 1ZK8A 3BTLA 2RHAA 3BR0A 2DG7A 2NS8A 2XPWA 1ZKGA 2G3BA 5FKNA 3O8HA 3ON4A 4NELA 4B1RA 4D7NA 1RPWA 2TRTA 4W97A 4D7MA 4MXMA 3AQTA 5HBUA 3ON2A 1Z0XA 1JTXA 3HTHA 5K7ZA 4M3GA 2DTZA 3MVPA 5AQCA 2Q24A 5FKMA 3ZQGA 5F0CA 3T6NA 3NPIA 5D1RA 3CDLA 2RAEA 2Y30A 1QPIA 5CW8A 5J1RA 3IUVA 2IBDA 5HSZA 1JUSA 5FKOA 4B3AA 3C2BA 3NI7A 5K58A 3VVYA 2ZCNA 2QCOA 5C4YA 2ZCXA 2OERA 3S5RA 3ZQLA 2Y2ZA 5GPAA 3KKDA 5D18A 1RKTA 4XK4A 2ZCMA 2F07A 2IAIA 3VOKA 2ZB9A 2XPUA 3BTJA 3CRJA 3NNRA 5F0FA 2HYTA 1SGMA 2FJ1A 2IEKA 3P9TA 2GENA 2WGBA 4ABZA 3BR6A 2QTQA 3FIWA 3TP3A 3BCGA 5EZHA 3WHCA 2O7OA 5EZGA 1JT6A 1ORKA 5EYRA 5F04A 5HAWA 3F0CA 2HKUA 4M3EA 4GFLA 3G7RA 5F27A 2ZOYA 3ZQHA 4GCLA 3QKXA 2UXIA 3COLA 3LHQA 2QOPA 2XGCA 2YVEA 4AF5A 4YZEA 2QIBA 3O8GA 2OF7A 3QPLA 2QWTA 1U9OA 3ZQIA 2G0EA 3Q3SA 3HE0A 5GP9A 3DEWA 3V6GA 3LSJA 3VVXA 2JK3A 3O60A 5CXIA 5DAJA 3SFIA 3DCFA 3KNWA 3C07A 3MNLA 3LWJA 4GFKA 3F1BA 3KZ9A 2NP3A 4I6ZA 4W1UA 4D5CA 5K7HA 2FD5A 4M3BA 5FKLA 1VI0A 3BR3A 5D19A 4CGRA 3ANGA 5F1JA 5GPCA 5FGLA 3G1LA 3LJLA 3HIMA 3GZIA 3VOXA 3SDGA 4MO7A 4ME9A 3BHQA 3BJBA 2G7GA 5H9TA 5IP6A 2RASA 5K7FA 3VIBA 2IU5A 4V2FA 2X9DA 3FK7A 2ID3A 4AC6A 3B6CA 3WHBA 4UDSA 3BT9A 4JYKA 5IOYA 3CCYA 4KWAA 4D5FA 1UI5A 2NP5A 2NX4A 3CJDA 1QVUA 3E7QA 3V78A 1JUPA 4JKZA 3LSRA 2VPRA 4DW6A 1JT0A 4ICHA 3FK6A
chains in the Genus database with same CATH superfamily
1RKWA 3BTCA 3G1OA 2EH3A 2D6YA 3NRGA 3BTIA 3VW0A 2GUHA 4GCTA 2XGDA 3IH4A 2UXUA 3FRQA 2R7OA 5J1UA 3VW1A 2XGEA 2TCTA 4JNNA 2X6OA 3CWRA 4HKUA 2FQ4A 2VKEA 3ZQFA 2OI8A 2R7VA 1BJZA 1QVTA 1JUMA 3HTJA 1A6IA 4AC0A 3BR2A 2HQ5A 2WV1A 3VW2A 3VUQA 2DG8A 3BQZA 1U9NA 2GFNA 2XPVA 2ZOZA 2XDNA 3B6AA 3BR1A 5J1YA 4OD4A 3BRUA 2UXPA 2R7RA 3IH2A 2FBQA 5FMPA 2Y31A 4JL3A 1Z77A 5FHPA 5F08A 3HGYA 1T33A 4M3FA 4L62A 4G12A 3IH3A 3HGGA 3AQSA 3BR5A 3ANPA 2ID6A 3EUPA 2YVXA 3EGQA 1JTYA 3K8PC 5EFYA 3LSPA 3NXCA 5F0HA 4I76A 3QPSA 3KKCA 2HXOA 3BNIA 3HTAA 2I10A 5J3LA 2R7XA 2JJ7A 4MK6A 5FKKA 2G7LA 2FX0A 2G7SA 2HXIA 3LOCA 4AUXA 5IPAA 3VVZA 2W53A 3HTIA 5CXGA 3PPBA 4M3DA 2GBYA 3QBMA 3DPJA 4GCKA 3JSJA 3BQYA 2UXOA 2XRLA 2REKA 1T56A 2FJI1 4IRVA 2YVHA 3G1MA 3NS4A 2UXHA 3TP0A 2QKOA 3VP5A 2XB5A 3QQAA 4NN1A 2HYJA 3Q0VA 4X1EA 1UI6A 2WUIA 4U9LA 3GEUA 3PM1A 2PZ9A 3Q0WA 2NS7A 3Q0UA 2O7TA 2OPTA 4PXIA 3RD3A 3PASA 3B81A 4V2GA 5IOZA 2V57A 2R7QA 2VKVA 3RH2A 3G56A 3VPRA 2PBXA 4ACIA 4U9NA 1ZK8A 3BTLA 2RHAA 3BR0A 2DG7A 2NS8A 2XPWA 1ZKGA 2G3BA 5FKNA 3O8HA 3ON4A 4NELA 4B1RA 4D7NA 1RPWA 2TRTA 4W97A 4D7MA 4MXMA 3AQTA 5HBUA 3ON2A 1Z0XA 1JTXA 3HTHA 5K7ZA 4M3GA 2DTZA 3MVPA 5AQCA 2Q24A 5FKMA 3VTIA 3ZQGA 5F0CA 3T6NA 3NPIA 5D1RA 3SWHA 3CDLA 2RAEA 2Y30A 1QPIA 2R7SA 5CW8A 5J1RA 2PFVA 3IUVA 2IBDA 5HSZA 1JUSA 5FKOA 4B3AA 3C2BA 3NI7A 5K58A 3VVYA 2ZCNA 2QCOA 5C4YA 2ZCXA 2OERA 3S5RA 3ZQLA 2Y2ZA 5GPAA 3KKDA 5D18A 1RKTA 4XK4A 2ZCMA 2F07A 2B1EA 2IAIA 3VOKA 2ZB9A 5CQGA 2R7UA 2XPUA 3BTJA 3CRJA 3NNRA 5F0FA 2HYTA 1SGMA 2FJ1A 2IEKA 3P9TA 2GENA 2WGBA 4ABZA 3BR6A 2QTQA 3FIWA 3TP3A 3BCGA 5EZHA 3WHCA 2O7OA 5EZGA 1JT6A 1ORKA 5EYRA 5F04A 5HAWA 3F0CA 3DU5A 2HKUA 4M3EA 4WIBA 4GFLA 3KYLA 2A2FX 3DU6A 3G7RA 5F27A 4C2MA 2ZOYA 3ZQHA 4GCLA 3QKXA 2UXIA 3COLA 3LHQA 2QOPA 2XGCA 2YVEA 4AF5A 4YZEA 2QIBA 2R7WA 3O8GA 2OF7A 3QPLA 2QWTA 1U9OA 3ZQIA 2B3WA 2G0EA 3Q3SA 3HE0A 5GP9A 3DEWA 3V6GA 3LSJA 3VVXA 2JK3A 3O60A 2ZY9A 4OD5A 5CXIA 5DAJA 3SFIA 3DCFA 3KNWA 3C07A 3MNLA 2R7TA 3LWJA 4GFKA 3F1BA 3KZ9A 2NP3A 4I6ZA 4W1UA 4D5CA 5K7HA 2FD5A 4M3BA 5FKLA 1VI0A 3BR3A 5D19A 4CGRA 3ANGA 5F1JA 5GPCA 5FGLA 3G1LA 3LJLA 3HIMA 3GZIA 4DVYP 3VOXA 3SDGA 4MO7A 4ME9A 3BHQA 3BJBA 2G7GA 5H9TA 5IP6A 2RASA 5K7FA 3VIBA 2IU5A 4V2FA 2X9DA 3FK7A 2ID3A 4AC6A 3B6CA 3WHBA 4UDSA 3BT9A 4JYKA 5IOYA 3CCYA 3FHNA 4KWAA 4D5FA 1UI5A 2NP5A 2NX4A 3CJDA 1QVUA 3E7QA 3V78A 1JUPA 4JKZA 3LSRA 2VPRA 4DW6A 1JT0A 4ICHA 3FK6A
chains in the Genus database with same CATH topology
1RKWA 3BTCA 3G1OA 2EH3A 2D6YA 3NRGA 3BTIA 3VW0A 2GUHA 4GCTA 2XGDA 3IH4A 2UXUA 3FRQA 5J1UA 3VW1A 2XGEA 2TCTA 4JNNA 2X6OA 3CWRA 4HKUA 2FQ4A 2VKEA 3ZQFA 2OI8A 1BJZA 1QVTA 1JUMA 3HTJA 1A6IA 4AC0A 3BR2A 2HQ5A 2WV1A 3VW2A 3VUQA 2DG8A 3BQZA 1U9NA 2GFNA 2XPVA 2ZOZA 2XDNA 3B6AA 3BR1A 5J1YA 3BRUA 2UXPA 3IH2A 2FBQA 5FMPA 2Y31A 4JL3A 1Z77A 5FHPA 5F08A 3HGYA 1T33A 4M3FA 4L62A 4G12A 3IH3A 3HGGA 3AQSA 3BR5A 3ANPA 2ID6A 3EUPA 3EGQA 1JTYA 5EFYA 3LSPA 3NXCA 5F0HA 4I76A 3QPSA 3KKCA 2HXOA 3BNIA 3HTAA 2I10A 5J3LA 2JJ7A 4MK6A 5FKKA 2G7LA 2FX0A 2G7SA 2HXIA 3LOCA 4AUXA 5IPAA 3VVZA 2W53A 3HTIA 5CXGA 3PPBA 4M3DA 2GBYA 3QBMA 3DPJA 4GCKA 3JSJA 3BQYA 2UXOA 2XRLA 2REKA 1T56A 2YVHA 3G1MA 2UXHA 3TP0A 2QKOA 3VP5A 2XB5A 3QQAA 4NN1A 2HYJA 3Q0VA 4X1EA 1UI6A 2WUIA 3GEUA 3PM1A 2PZ9A 3Q0WA 2NS7A 3Q0UA 2O7TA 2OPTA 4PXIA 3RD3A 3PASA 3B81A 4V2GA 5IOZA 2V57A 2VKVA 3RH2A 3G56A 3VPRA 2PBXA 4ACIA 1ZK8A 3BTLA 2RHAA 3BR0A 2DG7A 2NS8A 2XPWA 1ZKGA 2G3BA 5FKNA 3O8HA 3ON4A 4NELA 4B1RA 4D7NA 1RPWA 2TRTA 4W97A 4D7MA 4MXMA 3AQTA 5HBUA 3ON2A 1Z0XA 1JTXA 3HTHA 5K7ZA 4M3GA 2DTZA 3MVPA 5AQCA 2Q24A 5FKMA 3ZQGA 5F0CA 3T6NA 3NPIA 5D1RA 3CDLA 2RAEA 2Y30A 1QPIA 5CW8A 5J1RA 3IUVA 2IBDA 5HSZA 1JUSA 5FKOA 4B3AA 3C2BA 3NI7A 5K58A 3VVYA 2ZCNA 2QCOA 5C4YA 2ZCXA 2OERA 3S5RA 3ZQLA 2Y2ZA 5GPAA 3KKDA 5D18A 1RKTA 4XK4A 2ZCMA 2F07A 2IAIA 3VOKA 2ZB9A 2XPUA 3BTJA 3CRJA 3NNRA 5F0FA 2HYTA 1SGMA 2FJ1A 2IEKA 3P9TA 2GENA 2WGBA 4ABZA 3BR6A 2QTQA 3FIWA 3TP3A 3BCGA 5EZHA 3WHCA 2O7OA 5EZGA 1JT6A 1ORKA 5EYRA 5F04A 5HAWA 3F0CA 2HKUA 4M3EA 4GFLA 3G7RA 5F27A 2ZOYA 3ZQHA 4GCLA 3QKXA 2UXIA 3COLA 3LHQA 2QOPA 2XGCA 2YVEA 4AF5A 4YZEA 2QIBA 3O8GA 2OF7A 3QPLA 2QWTA 1U9OA 3ZQIA 2G0EA 3Q3SA 3HE0A 5GP9A 3DEWA 3V6GA 3LSJA 3VVXA 2JK3A 3O60A 5CXIA 5DAJA 3SFIA 3DCFA 3KNWA 3C07A 3MNLA 3LWJA 4GFKA 3F1BA 3KZ9A 2NP3A 4I6ZA 4W1UA 4D5CA 5K7HA 2FD5A 4M3BA 5FKLA 1VI0A 3BR3A 5D19A 4CGRA 3ANGA 5F1JA 5GPCA 5FGLA 3G1LA 3LJLA 3HIMA 3GZIA 3VOXA 3SDGA 4MO7A 4ME9A 3BHQA 3BJBA 2G7GA 5H9TA 5IP6A 2RASA 5K7FA 3VIBA 2IU5A 4V2FA 2X9DA 3FK7A 2ID3A 4AC6A 3B6CA 3WHBA 4UDSA 3BT9A 4JYKA 5IOYA 3CCYA 4KWAA 4D5FA 1UI5A 2NP5A 2NX4A 3CJDA 1QVUA 3E7QA 3V78A 1JUPA 4JKZA 3LSRA 2VPRA 4DW6A 1JT0A 4ICHA 3FK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKW A;  3BTC A;  3G1O A;  2EH3 A;  2D6Y A;  3NRG A;  3BTI A;  3VW0 A;  2GUH A;  4GCT A;  2XGD A;  3IH4 A;  2UXU A;  3FRQ A;  5J1U A;  3VW1 A;  2XGE A;  2TCT A;  4JNN A;  2X6O A;  3CWR A;  4HKU A;  2FQ4 A;  2VKE A;  3ZQF A;  2OI8 A;  1BJZ A;  1QVT A;  1JUM A;  3HTJ A;  1A6I A;  4AC0 A;  3BR2 A;  2HQ5 A;  2WV1 A;  3VW2 A;  3VUQ A;  2DG8 A;  3BQZ A;  1U9N A;  2GFN A;  2XPV A;  2ZOZ A;  2XDN A;  3B6A A;  3BR1 A;  5J1Y A;  3BRU A;  2UXP A;  3IH2 A;  2FBQ A;  5FMP A;  2Y31 A;  4JL3 A;  1Z77 A;  5FHP A;  5F08 A;  3HGY A;  1T33 A;  4M3F A;  4L62 A;  4G12 A;  3IH3 A;  3HGG A;  3AQS A;  3BR5 A;  3ANP A;  2ID6 A;  3EUP A;  3EGQ A;  1JTY A;  5EFY A;  3LSP A;  3NXC A;  5F0H A;  4I76 A;  3QPS A;  3KKC A;  2HXO A;  3BNI A;  3HTA A;  2I10 A;  5J3L A;  2JJ7 A;  4MK6 A;  5FKK A;  2G7L A;  2FX0 A;  2G7S A;  2HXI A;  3LOC A;  4AUX A;  5IPA A;  3VVZ A;  2W53 A;  3HTI A;  5CXG A;  3PPB A;  4M3D A;  2GBY A;  3QBM A;  3DPJ A;  4GCK A;  3JSJ A;  3BQY A;  2UXO A;  2XRL A;  2REK A;  1T56 A;  2YVH A;  3G1M A;  2UXH A;  3TP0 A;  2QKO A;  3VP5 A;  2XB5 A;  3QQA A;  4NN1 A;  2HYJ A;  3Q0V A;  4X1E A;  1UI6 A;  2WUI A;  3GEU A;  3PM1 A;  2PZ9 A;  3Q0W A;  2NS7 A;  3Q0U A;  2O7T A;  2OPT A;  4PXI A;  3RD3 A;  3PAS A;  3B81 A;  4V2G A;  5IOZ A;  2V57 A;  2VKV A;  3RH2 A;  3G56 A;  3VPR A;  2PBX A;  4ACI A;  1ZK8 A;  3BTL A;  2RHA A;  3BR0 A;  2DG7 A;  2NS8 A;  2XPW A;  1ZKG A;  2G3B A;  5FKN A;  3O8H A;  3ON4 A;  4NEL A;  4B1R A;  4D7N A;  1RPW A;  2TRT A;  4W97 A;  4D7M A;  4MXM A;  3AQT A;  5HBU A;  3ON2 A;  1Z0X A;  1JTX A;  3HTH A;  5K7Z A;  4M3G A;  2DTZ A;  3MVP A;  5AQC A;  2Q24 A;  5FKM A;  3ZQG A;  5F0C A;  3T6N A;  3NPI A;  5D1R A;  3CDL A;  2RAE A;  2Y30 A;  1QPI A;  5CW8 A;  5J1R A;  3IUV A;  2IBD A;  5HSZ A;  1JUS A;  5FKO A;  4B3A A;  3C2B A;  3NI7 A;  5K58 A;  3VVY A;  2ZCN A;  2QCO A;  5C4Y A;  2ZCX A;  2OER A;  3S5R A;  3ZQL A;  2Y2Z A;  5GPA A;  3KKD A;  5D18 A;  1RKT A;  4XK4 A;  2ZCM A;  2F07 A;  2IAI A;  3VOK A;  2ZB9 A;  2XPU A;  3BTJ A;  3CRJ A;  3NNR A;  5F0F A;  2HYT A;  1SGM A;  2FJ1 A;  2IEK A;  3P9T A;  2GEN A;  2WGB A;  4ABZ A;  3BR6 A;  2QTQ A;  3FIW A;  3TP3 A;  3BCG A;  5EZH A;  3WHC A;  2O7O A;  5EZG A;  1JT6 A;  1ORK A;  5EYR A;  5F04 A;  5HAW A;  3F0C A;  2HKU A;  4M3E A;  4GFL A;  3G7R A;  5F27 A;  2ZOY A;  3ZQH A;  4GCL A;  3QKX A;  2UXI A;  3COL A;  3LHQ A;  2QOP A;  2XGC A;  2YVE A;  4AF5 A;  4YZE A;  2QIB A;  3O8G A;  2OF7 A;  3QPL A;  2QWT A;  1U9O A;  3ZQI A;  2G0E A;  3Q3S A;  3HE0 A;  5GP9 A;  3DEW A;  3V6G A;  3LSJ A;  3VVX A;  2JK3 A;  3O60 A;  5CXI A;  5DAJ A;  3SFI A;  3DCF A;  3KNW A;  3C07 A;  3MNL A;  3LWJ A;  4GFK A;  3F1B A;  3KZ9 A;  2NP3 A;  4I6Z A;  4W1U A;  4D5C A;  5K7H A;  2FD5 A;  4M3B A;  5FKL A;  1VI0 A;  3BR3 A;  5D19 A;  4CGR A;  3ANG A;  5F1J A;  5GPC A;  5FGL A;  3G1L A;  3LJL A;  3HIM A;  3GZI A;  3VOX A;  3SDG A;  4MO7 A;  4ME9 A;  3BHQ A;  3BJB A;  2G7G A;  5H9T A;  5IP6 A;  2RAS A;  5K7F A;  3VIB A;  2IU5 A;  4V2F A;  2X9D A;  3FK7 A;  2ID3 A;  4AC6 A;  3B6C A;  3WHB A;  4UDS A;  3BT9 A;  4JYK A;  5IOY A;  3CCY A;  4KWA A;  4D5F A;  1UI5 A;  2NP5 A;  2NX4 A;  3CJD A;  1QVU A;  3E7Q A;  3V78 A;  1JUP A;  4JKZ A;  3LSR A;  2VPR A;  4DW6 A;  1JT0 A;  4ICH A;  3FK6 A; 
#chains in the Genus database with same CATH topology
 1RKW A;  3BTC A;  3G1O A;  2EH3 A;  2D6Y A;  3NRG A;  3BTI A;  3VW0 A;  2GUH A;  4GCT A;  2XGD A;  3IH4 A;  2UXU A;  3FRQ A;  2R7O A;  5J1U A;  3VW1 A;  2XGE A;  2TCT A;  4JNN A;  2X6O A;  3CWR A;  4HKU A;  2FQ4 A;  2VKE A;  3ZQF A;  2OI8 A;  2R7V A;  1BJZ A;  1QVT A;  1JUM A;  3HTJ A;  1A6I A;  4AC0 A;  3BR2 A;  2HQ5 A;  2WV1 A;  3VW2 A;  3VUQ A;  2DG8 A;  3BQZ A;  1U9N A;  2GFN A;  2XPV A;  2ZOZ A;  2XDN A;  3B6A A;  3BR1 A;  5J1Y A;  4OD4 A;  3BRU A;  2UXP A;  2R7R A;  3IH2 A;  2FBQ A;  5FMP A;  2Y31 A;  4JL3 A;  1Z77 A;  5FHP A;  5F08 A;  3HGY A;  1T33 A;  4M3F A;  4L62 A;  4G12 A;  3IH3 A;  3HGG A;  3AQS A;  3BR5 A;  3ANP A;  2ID6 A;  3EUP A;  2YVX A;  3EGQ A;  1JTY A;  3K8P C;  5EFY A;  3LSP A;  3NXC A;  5F0H A;  4I76 A;  3QPS A;  3KKC A;  2HXO A;  3BNI A;  3HTA A;  2I10 A;  5J3L A;  2R7X A;  2JJ7 A;  4MK6 A;  5FKK A;  2G7L A;  2FX0 A;  2G7S A;  2HXI A;  3LOC A;  4AUX A;  5IPA A;  3VVZ A;  2W53 A;  3HTI A;  5CXG A;  3PPB A;  4M3D A;  2GBY A;  3QBM A;  3DPJ A;  4GCK A;  3JSJ A;  3BQY A;  2UXO A;  2XRL A;  2REK A;  1T56 A;  2FJI 1;  4IRV A;  2YVH A;  3G1M A;  3NS4 A;  2UXH A;  3TP0 A;  2QKO A;  3VP5 A;  2XB5 A;  3QQA A;  4NN1 A;  2HYJ A;  3Q0V A;  4X1E A;  1UI6 A;  2WUI A;  4U9L A;  3GEU A;  3PM1 A;  2PZ9 A;  3Q0W A;  2NS7 A;  3Q0U A;  2O7T A;  2OPT A;  4PXI A;  3RD3 A;  3PAS A;  3B81 A;  4V2G A;  5IOZ A;  2V57 A;  2R7Q A;  2VKV A;  3RH2 A;  3G56 A;  3VPR A;  2PBX A;  4ACI A;  4U9N A;  1ZK8 A;  3BTL A;  2RHA A;  3BR0 A;  2DG7 A;  2NS8 A;  2XPW A;  1ZKG A;  2G3B A;  5FKN A;  3O8H A;  3ON4 A;  4NEL A;  4B1R A;  4D7N A;  1RPW A;  2TRT A;  4W97 A;  4D7M A;  4MXM A;  3AQT A;  5HBU A;  3ON2 A;  1Z0X A;  1JTX A;  3HTH A;  5K7Z A;  4M3G A;  2DTZ A;  3MVP A;  5AQC A;  2Q24 A;  5FKM A;  3VTI A;  3ZQG A;  5F0C A;  3T6N A;  3NPI A;  5D1R A;  3SWH A;  3CDL A;  2RAE A;  2Y30 A;  1QPI A;  2R7S A;  5CW8 A;  5J1R A;  2PFV A;  3IUV A;  2IBD A;  5HSZ A;  1JUS A;  5FKO A;  4B3A A;  3C2B A;  3NI7 A;  5K58 A;  3VVY A;  2ZCN A;  2QCO A;  5C4Y A;  2ZCX A;  2OER A;  3S5R A;  3ZQL A;  2Y2Z A;  5GPA A;  3KKD A;  5D18 A;  1RKT A;  4XK4 A;  2ZCM A;  2F07 A;  2B1E A;  2IAI A;  3VOK A;  2ZB9 A;  5CQG A;  2R7U A;  2XPU A;  3BTJ A;  3CRJ A;  3NNR A;  5F0F A;  2HYT A;  1SGM A;  2FJ1 A;  2IEK A;  3P9T A;  2GEN A;  2WGB A;  4ABZ A;  3BR6 A;  2QTQ A;  3FIW A;  3TP3 A;  3BCG A;  5EZH A;  3WHC A;  2O7O A;  5EZG A;  1JT6 A;  1ORK A;  5EYR A;  5F04 A;  5HAW A;  3F0C A;  3DU5 A;  2HKU A;  4M3E A;  4WIB A;  4GFL A;  3KYL A;  2A2F X;  3DU6 A;  3G7R A;  5F27 A;  4C2M A;  2ZOY A;  3ZQH A;  4GCL A;  3QKX A;  2UXI A;  3COL A;  3LHQ A;  2QOP A;  2XGC A;  2YVE A;  4AF5 A;  4YZE A;  2QIB A;  2R7W A;  3O8G A;  2OF7 A;  3QPL A;  2QWT A;  1U9O A;  3ZQI A;  2B3W A;  2G0E A;  3Q3S A;  3HE0 A;  5GP9 A;  3DEW A;  3V6G A;  3LSJ A;  3VVX A;  2JK3 A;  3O60 A;  2ZY9 A;  4OD5 A;  5CXI A;  5DAJ A;  3SFI A;  3DCF A;  3KNW A;  3C07 A;  3MNL A;  2R7T A;  3LWJ A;  4GFK A;  3F1B A;  3KZ9 A;  2NP3 A;  4I6Z A;  4W1U A;  4D5C A;  5K7H A;  2FD5 A;  4M3B A;  5FKL A;  1VI0 A;  3BR3 A;  5D19 A;  4CGR A;  3ANG A;  5F1J A;  5GPC A;  5FGL A;  3G1L A;  3LJL A;  3HIM A;  3GZI A;  4DVY P;  3VOX A;  3SDG A;  4MO7 A;  4ME9 A;  3BHQ A;  3BJB A;  2G7G A;  5H9T A;  5IP6 A;  2RAS A;  5K7F A;  3VIB A;  2IU5 A;  4V2F A;  2X9D A;  3FK7 A;  2ID3 A;  4AC6 A;  3B6C A;  3WHB A;  4UDS A;  3BT9 A;  4JYK A;  5IOY A;  3CCY A;  3FHN A;  4KWA A;  4D5F A;  1UI5 A;  2NP5 A;  2NX4 A;  3CJD A;  1QVU A;  3E7Q A;  3V78 A;  1JUP A;  4JKZ A;  3LSR A;  2VPR A;  4DW6 A;  1JT0 A;  4ICH A;  3FK6 A; 
#chains in the Genus database with same CATH homology
 1RKW A;  3BTC A;  3G1O A;  2EH3 A;  2D6Y A;  3NRG A;  3BTI A;  3VW0 A;  2GUH A;  4GCT A;  2XGD A;  3IH4 A;  2UXU A;  3FRQ A;  5J1U A;  3VW1 A;  2XGE A;  2TCT A;  4JNN A;  2X6O A;  3CWR A;  4HKU A;  2FQ4 A;  2VKE A;  3ZQF A;  2OI8 A;  1BJZ A;  1QVT A;  1JUM A;  3HTJ A;  1A6I A;  4AC0 A;  3BR2 A;  2HQ5 A;  2WV1 A;  3VW2 A;  3VUQ A;  2DG8 A;  3BQZ A;  1U9N A;  2GFN A;  2XPV A;  2ZOZ A;  2XDN A;  3B6A A;  3BR1 A;  5J1Y A;  3BRU A;  2UXP A;  3IH2 A;  2FBQ A;  5FMP A;  2Y31 A;  4JL3 A;  1Z77 A;  5FHP A;  5F08 A;  3HGY A;  1T33 A;  4M3F A;  4L62 A;  4G12 A;  3IH3 A;  3HGG A;  3AQS A;  3BR5 A;  3ANP A;  2ID6 A;  3EUP A;  3EGQ A;  1JTY A;  5EFY A;  3LSP A;  3NXC A;  5F0H A;  4I76 A;  3QPS A;  3KKC A;  2HXO A;  3BNI A;  3HTA A;  2I10 A;  5J3L A;  2JJ7 A;  4MK6 A;  5FKK A;  2G7L A;  2FX0 A;  2G7S A;  2HXI A;  3LOC A;  4AUX A;  5IPA A;  3VVZ A;  2W53 A;  3HTI A;  5CXG A;  3PPB A;  4M3D A;  2GBY A;  3QBM A;  3DPJ A;  4GCK A;  3JSJ A;  3BQY A;  2UXO A;  2XRL A;  2REK A;  1T56 A;  2YVH A;  3G1M A;  2UXH A;  3TP0 A;  2QKO A;  3VP5 A;  2XB5 A;  3QQA A;  4NN1 A;  2HYJ A;  3Q0V A;  4X1E A;  1UI6 A;  2WUI A;  3GEU A;  3PM1 A;  2PZ9 A;  3Q0W A;  2NS7 A;  3Q0U A;  2O7T A;  2OPT A;  4PXI A;  3RD3 A;  3PAS A;  3B81 A;  4V2G A;  5IOZ A;  2V57 A;  2VKV A;  3RH2 A;  3G56 A;  3VPR A;  2PBX A;  4ACI A;  1ZK8 A;  3BTL A;  2RHA A;  3BR0 A;  2DG7 A;  2NS8 A;  2XPW A;  1ZKG A;  2G3B A;  5FKN A;  3O8H A;  3ON4 A;  4NEL A;  4B1R A;  4D7N A;  1RPW A;  2TRT A;  4W97 A;  4D7M A;  4MXM A;  3AQT A;  5HBU A;  3ON2 A;  1Z0X A;  1JTX A;  3HTH A;  5K7Z A;  4M3G A;  2DTZ A;  3MVP A;  5AQC A;  2Q24 A;  5FKM A;  3ZQG A;  5F0C A;  3T6N A;  3NPI A;  5D1R A;  3CDL A;  2RAE A;  2Y30 A;  1QPI A;  5CW8 A;  5J1R A;  3IUV A;  2IBD A;  5HSZ A;  1JUS A;  5FKO A;  4B3A A;  3C2B A;  3NI7 A;  5K58 A;  3VVY A;  2ZCN A;  2QCO A;  5C4Y A;  2ZCX A;  2OER A;  3S5R A;  3ZQL A;  2Y2Z A;  5GPA A;  3KKD A;  5D18 A;  1RKT A;  4XK4 A;  2ZCM A;  2F07 A;  2IAI A;  3VOK A;  2ZB9 A;  2XPU A;  3BTJ A;  3CRJ A;  3NNR A;  5F0F A;  2HYT A;  1SGM A;  2FJ1 A;  2IEK A;  3P9T A;  2GEN A;  2WGB A;  4ABZ A;  3BR6 A;  2QTQ A;  3FIW A;  3TP3 A;  3BCG A;  5EZH A;  3WHC A;  2O7O A;  5EZG A;  1JT6 A;  1ORK A;  5EYR A;  5F04 A;  5HAW A;  3F0C A;  2HKU A;  4M3E A;  4GFL A;  3G7R A;  5F27 A;  2ZOY A;  3ZQH A;  4GCL A;  3QKX A;  2UXI A;  3COL A;  3LHQ A;  2QOP A;  2XGC A;  2YVE A;  4AF5 A;  4YZE A;  2QIB A;  3O8G A;  2OF7 A;  3QPL A;  2QWT A;  1U9O A;  3ZQI A;  2G0E A;  3Q3S A;  3HE0 A;  5GP9 A;  3DEW A;  3V6G A;  3LSJ A;  3VVX A;  2JK3 A;  3O60 A;  5CXI A;  5DAJ A;  3SFI A;  3DCF A;  3KNW A;  3C07 A;  3MNL A;  3LWJ A;  4GFK A;  3F1B A;  3KZ9 A;  2NP3 A;  4I6Z A;  4W1U A;  4D5C A;  5K7H A;  2FD5 A;  4M3B A;  5FKL A;  1VI0 A;  3BR3 A;  5D19 A;  4CGR A;  3ANG A;  5F1J A;  5GPC A;  5FGL A;  3G1L A;  3LJL A;  3HIM A;  3GZI A;  3VOX A;  3SDG A;  4MO7 A;  4ME9 A;  3BHQ A;  3BJB A;  2G7G A;  5H9T A;  5IP6 A;  2RAS A;  5K7F A;  3VIB A;  2IU5 A;  4V2F A;  2X9D A;  3FK7 A;  2ID3 A;  4AC6 A;  3B6C A;  3WHB A;  4UDS A;  3BT9 A;  4JYK A;  5IOY A;  3CCY A;  4KWA A;  4D5F A;  1UI5 A;  2NP5 A;  2NX4 A;  3CJD A;  1QVU A;  3E7Q A;  3V78 A;  1JUP A;  4JKZ A;  3LSR A;  2VPR A;  4DW6 A;  1JT0 A;  4ICH A;  3FK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...