3HE4B

Heterospecific coiled-coil pair synzip5:synzip6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
44
structure length
44
Chain Sequence
NTVKELKNYIQELEERNAELKNLKEHLKFAKAELEFELAAHKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A synthetic coiled-coil interactome provides heterospecific modules for molecular engineering.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords SYNZIP6
total genus 19
structure length 44
sequence length 44
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3he4B00
2N9BA 3HE5B 3HE4A 4LC1A 2W27A 1HJBA 3TNUA 5AVVB 5AW0B 2XU6A 1HBWA 5APVA 5APXA 3HTKA 2WPSA 2BASA 3M06A 3I5CA 3V4WA 3V5BA 3B8EB 1CI6A 3OAKA 2P67A 2VRSA 3KQGA 3P8MC 1MV8A 1GZLA 2Z5HA 4AYCA 5AW5B 4KHXA 2QM8A 3M9HA 1SP4A 3T97A 1HWTC 3TYYA 3VMYA 2Q3IA 3IR9A 1S9KE 3NXSA 3HE4B 1MUUA 2IPPA 4RESB 2WWWA 5AW1B 4M3LA 3A2AA 5AVSB 1SLQA 3P7KA 1IO4A 2C9LY 3O8ZA 5AVZB 5AW3B 5AVRB 4B86A 2P2UA 1T2KC 3VMXA 1GTWA 3A5TA 3M9BA 1GK4A 3VMZA 3TNUB 5APWA 1FAVA 2E42A 2R3CA 3NMDA 4I6MC 4C7NA 1A02F 2QM7A 3VYIA 2Q7CA 4GKGA 5AVTB 1T2KD 1JUNA 2H7HA 3L37A 3MD0A 1H8AA 4AQRD 3M91A 1OXZA 4AUWA 1GD2E 3M0DA 1JNMA 4GT1A 1A02J 5AVWB 4XE5B 2R5DA 3A7OA 1GK6A 2YO2A 4HYTB 2R5BA 1H88A 2ZFCA 2P7JA 3TK1A 5AW6B 4C7NB 1GU5A 2WPRA 1CZQA 2WPQA 1X8YA 1KQLA 3HE5A 1NAFA 3L36A 3M0AA 5APUA 4EOTA 1S9KD 1NWQA 3SWFA 1CSBA 5AVQB 2Z5IA 2XV5A 5APQA 1YYCA 1CI6B 5AW8B 5APTA 3V4QA 3LIEA 4JYBA 2JJLA 2KP8A 5APYA 1FOSF 1H89A 5AVYB 1HUCA 2R32A 2W6AA 2WT7B 2Q5UA 5AVUB 3MGNA 3KDPB 4C46A 1GU4A 3NFQA 3VN0A 2WT7A 3P32A 1DH3A 2WTYA 3L35A 3UIAA 5AVXB 5AW4B 2YNYA 2C9NY 3LIDA 3VTPC 1FOSE 1G2CB 5AW9B 1MFZA 5APSA 1OWAA 5AW2B 1J2JB 4I2LC 2YO3A 2E43A 3NTNA 2XZRA 2ZXEB 4JYCA 3A3YB 4DZOA 5AW7B 5CMZA
chains in the Genus database with same CATH superfamily
3HE5B 4ZKPA 2YMKA 3FXEA 4QMAA 4DOJA 1EDLA 1SQPG 3Q5RA 1NTZD 2NZ2A 3V2QA 4LC1A 3VP9A 3HUSA 1YTZI 1SQXE 2YKQA 1T6AA 1X22A 1HH0A 1NTMD 1UIIA 5AW0B 3RK3B 4DJGA 1HBWA 4BRYA 1YBKA 3CC7P 2J58A 1NYHA 3KQGA 4HH2A 1BSNA 4WVZA 3QH9A 1J1DB 2WPSA 1EXIA 1DD4A 2OYOA 2WVRA 3CXHD 4NPEA 1VF5B 1GL2C 4GOFA 1LTAC 3V2PA 2E76B 4HKZH 2VRSA 4IFMA 2MKVA 3CX5D 4AYCA 1NU1D 3D70A 2E75C 1RF0C 1MKMA 1Q82Q 5C39A 1VQLP 4KHXA 2IBZE 3SFEC 3WUUA 1QVFO 3M9HA 2QJKB 3T97A 2ZXXA 1DEBA 2O1JA 4H44D 1GW3A 3JCUH 4OWFA 2KLUA 1ZRTD 1SQVE 2IPPA 2WSFJ 2QE7H 5CCGD 1FC2C 2W6BA 2WWWA 4M3LA 3A2AA 2LXBA 2BEZF 2Q3EA 1LTJB 1N73A 4KT0J 4UB6E 5AVSB 5CCGA 1W2BO 2A06D 2UWJE 4H0LB 3TSIA 2Q6QA 2NPSA 4HB1A 4R4MA 3L4FA 4Y28J 1PPJE 5GTHH 1N7SC 1FDOA 1M90Q 1VQ9P 2JWAA 2FYUJ 1BGYD 1T2KC 3AE9C 1JY3O 2PFXA 3CXHH 4GIFA 5B5EH 3A5TA 1GTWA 1KFMA 1D7MA 1OX3A 2KNCB 2KXPB 4N3YB 3V6IA 1IFNA 3W67A 3L71E 5KJ7C 1FAVA 3L71J 1HVVA 1KN7A 1JMBA 1A02F 2GUSA 1BCCG 3A0BH 2QM7A 2IDBA 3L75J 2A45G 4WWIA 1M57D 2Q7CA 3VYIA 1T2KD 1LTTC 2OGUA 2ZT9D 1RF1B 3L37A 3MD0A 2I1KA 1NU1E 2K37A 4PV1D 1H8AA 1N86A 1KFNA 3H1JD 3I56P 3CWBD 2FXMA 2IBZD 3BASA 4IFFA 4WB4A 4AUWA 4JF7A 2A06E 1E79H 1JCCA 3M0DA 1SQQD 1SQQG 4GT1A 2KSEA 4ZKUA 1URQA 4WY4A 5TISE 4XE5B 2HPCA 1OW8A 1LWUA 4PD4H 2JDIH 1L4AC 1LTSC 1FDMA 4WY4D 3WU2H 1IFJA 1SQQK 1SVFA 3QWOC 1N7LA 2ZYAA 3HD7B 5AW6B 1GU5A 1SQXD 1NU1J 3A0BE 2WPQA 4YXWH 1HGZA 3HE5A 5APUA 3CI9A 1NTZE 2FFDB 2JEEA 1K04A 3KXDA 4ASWA 1CSBA 3BCCE 5AVQB 1LWUC 1NTZK 4PD4D 1KB9I 1LJ2A 1LT9A 1P84I 2WZ7A 3H1IE 3H1IJ 5CHXA 3CCLP 3CXHE 3FGAD 5B5EE 3TGUD 1CI6B 3TGUE 3ZDMA 1UIXA 3L75G 1BCCJ 4YTPC 1IK7A 2G3AA 3CL3D 4D6TG 2QJYC 5BU5A 3LIEA 3FXDA 1NTZG 1SQBE 1NTKK 2NRGA 4JYBA 4IL6H 1PV3A 1QL1A 2YIUB 3IN6A 4OGQC 3GLMA 3PTZA 2ZVNB 2R32A 2Q5UA 3AE2C 3H6PA 1OVRA 1KORA 1JY2N 4LLHA 1S5LX 4A7PA 2IX7C 3AE4C 3G3ZA 3JCUE 3P32A 3RK3C 4D6TE 2WT7A 3CCVP 1PIXA 1VQNP 1M7LA 5CJ4A 3L73D 3UIAA 2BEQD 2E75D 1J1DC 4UB8H 2AEFA 1FZFA 2C9NY 2B89A 3ABVC 3RGUA 1VF5C 2ZVOB 3AECC 3LIDA 2K88A 5KKZB 1FOSE 2FXOA 2E76C 3AEBC 3GG2A 1URQC 1VPCA 2KS1A 2M5AA 3H25A 5KAIE 1KC8Q 3MZWB 4W7YA 3NTNA 2Y0CA 2XZRA 2ZXEB 1KYOD 3H1LJ 2CPSA 1PP9G 4ASVA 2CPBA 1HTLC 1U7MA 5CMZA 1RY3A 2N9BA 2QVAA 2WQYC 4RO0A 3HE4A 1OMIA 1ZMEC 3L70J 2W27A 4PJ0E 4TLFA 5CBOA 5L8RJ 3MTUE 4D6TJ 3AEGC 2XU6A 1ZN5A 3CLQA 3L72D 5APVA 4H13C 1ZLLA 1BGYJ 3CMEP 1KYOH 3CX5E 1PPJG 1S4XA 4EI2A 1R8EA 1N7SB 3B8EB 4EIJA 3D71A 1L0LG 1L4AD 2N1TA 2IFMA 3OAKA 2J59M 1NKNA 1URQD 2BCCD 1SQVJ 3D6ZA 1W5CE 4L73A 3H1KJ 1QVGO 4OGQD 3H1KD 2QM8A 2O1KA 2HFED 2V4HA 3L73E 1SP4A 1KB9E 1X0TA 2E5TA 1NKZB 1SFCC 1OVUA 2JKVA 2Q1KA 3IR9A 4N78E 3RL0B 2KI7B 1L0ND 3PJSK 4H44B 4JPZB 3WMM0 2HPCB 3CMAP 1MUUA 4DT0A 3N4XA 3AE3C 4RESB 1P84D 3TF5A 2IBZG 1NJIQ 1FZCB 1S1CX 1LTBC 1HGVA 2GUVA 1EDIA 1N73C 1PP9J 1FS0E 1SLQA 1XTCC 1GL2D 3U59A 2GA1A 2ZAEB 1IO4A 1IJDB 1QL2A 2AXCA 3H32A 2HR3A 3JC22 5CCHC 3W68A 3MIWA 5AW3B 1M56D 2OQQA 4I1LA 5AVRB 4B86A 4XFJA 2KUBA 3VMXA 3OW2O 1L4AB 3S4RA 5KLIC 3SWYA 2E74B 2W90A 1KQGB 2PAJA 3M9BA 3OA7A 4C7RA 1SQXG 1G1JA 3TNUB 2H43A 4I6MC 1SQPE 3BRTB 2FBWC 2YKOA 2ZYDA 2K9YA 2QJPC 3IAOA 3P8CD 3Q3DA 3GF7A 3H1KE 3VOPA 1BE3G 4IL6E 2DW3A 1U57A 2OTLP 3PHLA 3H1HE 1P84H 2HODA 1S5LH 1IK9A 2OYIB 4W80A 1VDFA 1GL2B 1JNMA 2J5UA 2L5GB 4D6TD 1N2DC 2QJYB 1MFTA 1AV1A 1PPJD 3JSVC 3CXHI 2R5DA 5E79E 3PH0A 2E75B 1EZVI 3A7OA 1P84E 1GK6A 2RKLA 4ZNCA 1L0NE 1R5SA 2IFNA 3CX5H 2BCCG 5KLVE 2FYUD 2YXQB 1BSHA 1N7SD 2P10A 2A45H 1AA0A 4C7NB 4TT3H 3Q5PA 2K9JB 1VQ6P 2OTJP 1Y47A 1CZQA 4EDFA 2Q9IA 3L36A 4EOTA 1RE4A 3B5ND 3HTKB 3L74E 3L71D 3M0AA 3O6QB 3SWKA 3G4SP 1YJNP 5CBNA 1NGMB 1LGHB 2FYUK 3MHVA 2KOGA 3RBXA 2FFDA 1BGYG 1OIPA 1ZV8A 1JTHA 1USDA 2P1JA 2AXTE 2QRXA 3G6EP 1H0TB 4UB8E 1RE3C 3H1JJ 5KAIH 3G9RA 2XDJA 3AEEC 3L74D 1VQMP 1EDJA 1PP9D 2C0WA 4OVNF 1USEA 2LKMA 3CX5I 5AVYB 1H89A 1HUCA 5KTBA 2W6AA 2OARA 1SQBK 3C1LA 3K5BA 3L72G 3MGNA 1VQ5P 1VQOP 1L0LK 1JY2O 1L2PA 1NTME 3NFQA 1ZRTE 1GU4A 4R4LA 3CCQP 2Y9ZA 5BU8B 1DH3A 1LTGC 3C9IA 2RN0A 1LT9C 2H89C 5DJUB 3RL0D 1W2EA 4Y99B 4H13D 2HLOA 1IFMA 1NTKD 2BCCJ 2MJZA 4GODA 1G2CB 1Q2NA 4L74A 3V2RA 3VTPC 1KILD 5APSA 4BXLA 1EQ7A 2JR8A 3BCCJ 3HD7D 2FYZA 3TDKA 3BCCD 4YXDC 2L91A 3U1CA 4I2LC 1DD3A 2I8DA 2M3EA 1NTKE 2WMMA 2YO3A 3TGUJ 1JO5A 1IFIA 1EC5A 4DZOA 2OTKE 3T97B 1FOSF 3CWBE 3R2PA 1YITP 2D2CC 4H44C 4K3AA 2ITAA 2KIKA 1NTZJ 2Y0EA 2FKWB 1HJBA 1FZCC 2YKPA 3TNUA 1OVVA 1N73B 5APXA 1VF5D 3I55P 1IC2A 3PP5A 4U3FE 2QEXP 1AQ5A 1BE3D 1RE3A 3WU2E 2E74D 3CD6P 3L73J 2O3JA 1CI6A 2W83C 4PD4E 3H1JE 2P67A 3EWKA 5TISH 3P8MC 4NPFX 1MV8A 2Z5HA 1SQPJ 2E74C 2HODB 3ITKA 4L75A 1WMKA 2KNCA 2Y0DA 1FZGA 4OGQB 2OYIA 4IFDK 4O9BA 1PL5A 1HWTC 3B5NB 1DIPA 2Q3IA 3E1IA 1S9KE 2QJPB 2QSIA 1J1EC 5GTIE 1LTIC 1BDCA 1BDDA 3HUSB 3GHGA 4PV1B 2NPSC 4YPCA 2W8ZA 3PRJA 1Q81Q 2XNXA 1K8AQ 4BRYB 1Y8AA 2BCCE 4XA4A 4EYYQ 1YJWP 3RK3D 1JY3N 3P7KA 2K9JA 3S9OA 2OYIC 3E1RA 2C9LY 3O8ZA 5KKZC 5AVZB 1KD1Q 4RJTA 1URQB 1RHZB 1Y9BA 1LP1A 2PRRA 1FZCA 2M5AB 2P2UA 3E7KA 3H32B 1YIJP 2GM4A 1EXJA 1S72P 1L0NK 2YXRB 1KQSO 1YTZT 2IYOA 2XKMA 3VMZA 2W6JH 1NO4A 3H1HG 3H1HD 3MP7B 1L4AA 3N7NA 1AVOA 3H1HJ 3RK3E 4U3FD 2O01N 4GOEA 1WRGA 2M8RA 1PGQA 3C8VA 4DCKA 3Q2YA 2WPVB 3VMAA 2KLVA 1JY3P 3BRVB 3AEFC 1JUNA 1FJKA 5CCGC 2P58A 1E5WA 2IZ1A 2KZJA 4AQRD 1HJ0A 1KILC 4LGDE 1SQVK 2ZJSE 2ZT9B 3GHGC 1OXZA 1RQVA 3RBZA 1SQXK 3CCUP 1X79B 1NHLA 2FYUG 4KJMA 4WBAA 3CCJP 1LT1A 1M1JB 1KILE 3L70E 4IL6X 2B87A 5KJ7A 2YO2A 4HYTB 4BWNA 5KLVJ 1EZVE 1WT6A 2ZFCA 3AE6C 3H1LE 1JEKA 3RL0C 1VQKP 2OYHB 1IFDA 3TK1A 3CC2P 1K05A 3A0HE 4HJGH 2K1AA 1GMJA 1ZOYC 2R3SA 2WPRA 1SQPD 1X8YA 3HRNA 1KQLA 1X9VA 1NAFA 3P8CE 4RKUJ 4N78D 1L0LJ 1KQFB 1YHQP 5B66E 1AVYA 1KZUB 1OW6A 3SWFA 1NWQA 2Z5IA 2XV5A 3L73G 4Z1MH 1AFOA 5TJHA 1FE6A 1AQTA 1PFIA 3M0DC 5M1BA 5AW8B 4OH8B 3RK2B 3USSA 2WSFH 3V4QA 1L0LE 5CJ0A 1SFCA 2B9BA 2JWDA 2JJLA 1EDKA 1NOHA 2RH0A 2WITA 2ZYGA 3R4YA 4UB6H 5APYA 5DJTB 2POHA 3KDPB 3H1LG 1EZVG 1EZVD 3KZIE 3SFDC 3VN0A 5GTIH 1M1KQ 3GMAA 3HD7A 2K3RA 1KILA 2WTYA 1Z56A 1LTJA 2IBZI 3B5NA 3L35A 3L70G 3CCSP 1LTJC 1M8OB 2FYUE 1ZR4A 1QX8A 1NAYA 3WUVA 2E5YA 1PP9E 3LW5H 1N7SA 1NTMK 3FX0A 1K9MQ 1K73Q 2N1TB 2NPSD 3L75D 3SSUA 5AW9B 1FZBA 1GL2A 1JB0J 2HYNA 3WUTA 1J2JB 3CCMP 1YQ4C 2N9YB 4I7ZC 5H2FH 1KMIZ 2AXTH 2PP6A 1JY2P 2FYNC 3AE1C 2M0BA 3BATA 1T3JA 1LP1B 2JP3A 1ZP0C 2O01H 3CC4P 2I1JA 3HUSC 4PV1C 2WSCJ 2WSCH 1KB9H 1OFCX 2R44A 2Z4EA 4CPGA 2QG4A 5AVVB 1RF1C 2O01J 1JMMA 2WSSH 3KYQA 3S1KA 3HTKA 1DEEG 3L72J 3U1AA 1RE4C 2H88C 1GDTA 5K5GB 2BASA 3M06A 2QIWA 3I5CA 3V4WA 5CCHD 3V5BA 1SQBG 2KK7A 3B71A 5KJ7D 1JTHB 2WSEJ 5E79H 2IZ0A 4WY4B 1FZEA 2KS1B 1R5LA 2LR2A 3EQ2A 1TU3F 1GZLA 1NVOA 1QLED 1SQBJ 3IF4A 3L75E 4MN4C 5AW5B 2HG5D 3TGUG 3H1ID 1S5LE 3H1IG 4IOIH 4ZMDA 3BCCG 3TYYA 3VMYA 3PLNA 1L0NJ 2Y9YA 5EFWB 3AE8C 2RMZA 1M1JA 3NXSA 3HE4B 2G8YA 1FBMA 1BCCD 1GW4A 1PGOA 3HD7C 5KAFH 3EFFK 3Q1MA 5AW1B 1SQQJ 2FFDC 2C0XA 3RL0g 1G1IA 1LT9B 3AE5C 3GHGB 3H1JG 1FDIA 4Y99C 1JCDA 1SFCD 1SQPK 3LW5J 2XNDH 1BE3J 1G2CA 1PZQA 3Q5SA 1M1JC 4U3FG 1FJPA 1SQQE 1VQ7P 1OZHA 1U7JA 2A06G 1VQPP 1VQ4P 4K35A 1GK4A 2YIUC 3CCEP 4JQ0D 3AE7C 1N8RQ 5APWA 1NU1G 2D2CB 2CK3H 2QJKC 2R3CA 3NMDA 1RF1A 2OYHC 4C7NA 2E42A 2FY8A 1NTKJ 3M9QA 1KB9D 1S2EA 3CWBG 4NPDA 1QGKB 4GKGA 1BCCE 5AVTB 2H7HA 3H1LD 1NTKG 1VL2A 2B88A 3RK2D 3CPWO 2SPZA 1NU1K 2V7QH 3L71G 3M91A 4JBZA 1JM0A 3L70D 4H0LC 1H0TA 1GD2E 1FZAA 1KYOE 3RK2C 5CCHA 3II6A 4GDOA 1A02J 5AVWB 1OW7A 1XTGB 2FXPA 2KYVA 2M3BA 1NTMJ 1ZXGA 3F5HA 3KHUA 3MUDC 4H0LD 1RH5B 2AEMA 2E76D 1ZR2A 1T8ZA 2R5BA 1H88A 1NTMG 3B5NC 3D6YA 3A0HH 2B87B 2QA4P 3L72E 2P7JA 3G71P 5AW4B 1J1EB 1PGJA 4U7JA 1SQVD 1SQVG 2N1TD 2NPSB 1Q86Q 2OYHA 4PJ0H 1S9KD 1DX7A 3CCRP 1KV4A 4H13B 3MUDA 1YJ9P 3B4SA 1ZW0A 5APQA 2N1TC 1Q90D 2H8PD 1IZNB 1YYCA 1BGYE 5H2FE 5APTA 3IFMA 3CWBJ 4I7ZB 2V7QJ 5KLVK 3L74J 4PD4I 2IYPA 2KSJA 3FWLA 3L74G 1T3UA 3BVHA 2FYNB 1VQ8P 1PGPA 2KP8A 1Q7YQ 2YMYA 3V2NA 3KZIH 5BVZA 2PGDA 3EFGA 4N6JA 1RF0A 1SFCB 5AVUB 2WT7B 4C46A 1NH4A 5KLVG 5KLVD 1L0NG 1QEXA 1RQUA 1CW5A 5KAFE 4L76A 3FWNA 2JO1A 2WSEH 1YI2P 1S3JA 2KZIA 1SQXJ 3AEDC 3O6QA 1KILB 2LXCB 3GF3A 5AVXB 1IFPA 1KYOI 1JOCA 1LNQA 1LWUB 2YNYA 2ZT9C 3F89A 1FU1A 1SQBD 3KPEA 3VP8A 4U3FJ 4WY4C 1YQ3C 5GTHE 1L0LD 1AJYA 1MFZA 1KTMA 4W7ZA 1OWAA 1SS1A 2D2CD 5AW2B 5B66H 3AEAC 3OJAB 2AEJA 2E43A 3GW6A 1MZ9A 1BE3E 4JYCA 2KB7P 3H1KG 3A3YB 2A45I 5KLIB 1HF9A 5AW7B
chains in the Genus database with same CATH topology
3HE5B 4ZKPA 4DOJA 3V2QA 3VP9A 4LC1A 3HUSA 1YTZI 2YKQA 1HH0A 5AW0B 3RK3B 1HBWA 2J58A 4HH2A 1J1DB 2WPSA 1GL2C 1LTAC 3V2PA 2VRSA 4IFMA 4AYCA 1RF0C 4KHXA 3M9HA 3T97A 1DEBA 2O1JA 1GW3A 2IPPA 5CCGD 2WWWA 2W6BA 4M3LA 3A2AA 1LTJB 1N73A 5CCGA 5AVSB 3TSIA 2NPSA 3L4FA 1N7SC 1T2KC 1JY3O 4GIFA 3A5TA 1GTWA 1KFMA 4N3YB 1IFNA 5KJ7C 1FAVA 1HVVA 1A02F 2GUSA 2QM7A 3VYIA 2A45G 2Q7CA 1T2KD 1LTTC 1RF1B 3L37A 3MD0A 2I1KA 1H8AA 1N86A 1KFNA 4IFFA 2FXMA 3BASA 4WB4A 4AUWA 4JF7A 3M0DA 1JCCA 4GT1A 4ZKUA 1URQA 4WY4A 4XE5B 2HPCA 1LWUA 1L4AC 1LTSC 1FDMA 4WY4D 1IFJA 1SQQK 1SVFA 1N7LA 3HD7B 5AW6B 1GU5A 2WPQA 1HGZA 3HE5A 5APUA 3CI9A 2FFDB 2JEEA 1CSBA 5AVQB 1LWUC 1NTZK 5CHXA 1LT9A 2WZ7A 1CI6B 3CL3D 5BU5A 3LIEA 4JYBA 1NTKK 1QL1A 2R32A 2Q5UA 3H6PA 1JY2N 4LLHA 2IX7C 3G3ZA 2WT7A 3P32A 3RK3C 1M7LA 5CJ4A 3UIAA 1J1DC 1FZFA 2C9NY 3LIDA 1FOSE 1URQC 1VPCA 4W7YA 3NTNA 2XZRA 2ZXEB 2CPSA 2CPBA 1HTLC 5CMZA 1RY3A 2N9BA 3HE4A 2W27A 3MTUE 2XU6A 1ZN5A 3CLQA 5APVA 1ZLLA 1N7SB 3B8EB 4EIJA 1L4AD 2N1TA 2IFMA 3OAKA 2J59M 1NKNA 1URQD 2QM8A 2O1KA 2HFED 1SP4A 1NKZB 1SFCC 3WMM0 3IR9A 4N78E 3RL0B 2HPCB 1MUUA 3N4XA 4RESB 1FZCB 1LTBC 1HGVA 2GUVA 1N73C 1XTCC 1SLQA 3U59A 1GL2D 1IO4A 1IJDB 1QL2A 3H32A 5CCHC 3MIWA 5AW3B 4I1LA 5AVRB 4B86A 3VMXA 1L4AB 3SWYA 3M9BA 3OA7A 2PAJA 4C7RA 3TNUB 1G1JA 2H43A 4I6MC 3BRTB 3P8CD 2YKOA 3VOPA 2HODA 1IK9A 2OYIB 4W80A 1VDFA 1GL2B 1JNMA 2L5GB 1N2DC 2R5DA 3A7OA 1GK6A 2IFNA 1N7SD 2A45H 4C7NB 1CZQA 2Q9IA 3L36A 4EOTA 1RE4A 3B5ND 3HTKB 3M0AA 1LGHB 2FYUK 2KOGA 2FFDA 1ZV8A 1JTHA 2P1JA 1RE3C 2XDJA 2C0WA 1H89A 2LKMA 5AVYB 1HUCA 5KTBA 2W6AA 2OARA 1SQBK 3MGNA 1L0LK 1JY2O 1GU4A 3NFQA 5BU8B 1DH3A 1LTGC 3C9IA 1LT9C 3RL0D 1W2EA 4Y99B 2HLOA 1IFMA 2MJZA 3VTPC 3U1CA 1G2CB 1FZCA 3V2RA 1KILD 5APSA 1EQ7A 3HD7D 2FYZA 2GM4A 4I2LC 2YO3A 1JO5A 1IFIA 4DZOA 1FOSF 3R2PA 2FKWB 1HJBA 1FZCC 2YKPA 3TNUA 1N73B 5APXA 1IC2A 3PP5A 1AQ5A 1RE3A 1CI6A 2P67A 3P8MC 1MV8A 2Z5HA 1FZGA 2HODB 4IFDK 2OYIA 4O9BA 1HWTC 3B5NB 2Q3IA 3E1IA 1S9KE 1J1EC 1LTIC 3HUSB 3GHGA 2NPSC 2XNXA 4XA4A 3RK3D 1JY3N 3P7KA 2OYIC 2C9LY 3O8ZA 5AVZB 1URQB 2P2UA 3H32B 1L0NK 1YTZT 2XKMA 3VMZA 3N7NA 1NO4A 1L4AA 1WRGA 2M8RA 2KLVA 1JY3P 3BRVB 1JUNA 1FJKA 5CCGC 1E5WA 4AQRD 1KILC 4LGDE 1SQVK 3GHGC 1OXZA 1SQXK 1X79B 1NHLA 4WBAA 1M1JB 5KJ7A 2YO2A 4HYTB 2ZFCA 1WT6A 3RL0C 2OYHB 1IFDA 3TK1A 2WPRA 3HRNA 3P8CE 1X8YA 1KQLA 1X9VA 1NAFA 4N78D 1NWQA 3SWFA 1KZUB 2Z5IA 2XV5A 1PFIA 3M0DC 5AW8B 4OH8B 3RK2B 2WSFH 3V4QA 5CJ0A 1SFCA 2JJLA 5APYA 1NOHA 2WITA 2POHA 3KDPB 3VN0A 3HD7A 1KILA 2WTYA 1Z56A 1LTJA 3B5NA 3L35A 1LTJC 1ZR4A 3LW5H 1N7SA 1NTMK 2N1TB 2NPSD 5AW9B 1FZBA 1GL2A 2HYNA 1J2JB 2PP6A 3BATA 1JY2P 1T3JA 2O01H 2I1JA 3HUSC 2WSCH 2Z4EA 5AVVB 1RF1C 1JMMA 3KYQA 3HTKA 3U1AA 1RE4C 1GDTA 2BASA 3M06A 3I5CA 3V4WA 5CCHD 3V5BA 5KJ7D 1JTHB 4WY4B 3KQGA 1FZEA 3EQ2A 1GZLA 5AW5B 2HG5D 3TYYA 3VMYA 3NXSA 1M1JA 3HE4B 3HD7C 1FBMA 1GW4A 5AW1B 2FFDC 2C0XA 1G1IA 1LT9B 3GHGB 4Y99C 1JCDA 1SFCD 1SQPK 1G2CA 1FJPA 1M1JC 1GK4A 5APWA 2OYHC 2E42A 2R3CA 3NMDA 1RF1A 4C7NA 3M9QA 4GKGA 5AVTB 2H7HA 3RK2D 1NU1K 3M91A 1GD2E 1FZAA 3RK2C 5CCHA 3II6A 1A02J 5AVWB 1XTGB 2KYVA 2M3BA 1ZR2A 1T8ZA 2R5BA 1H88A 3B5NC 2P7JA 1J1EB 2N1TD 2NPSB 2OYHA 1S9KD 1DX7A 3MUDA 5APQA 2N1TC 2H8PD 1YYCA 5APTA 3IFMA 5KLVK 2KSJA 3BVHA 1T3UA 2KP8A 2YMYA 3V2NA 5BVZA 3EFGA 4N6JA 1RF0A 1SFCB 5AVUB 2WT7B 4C46A 1NH4A 1CW5A 2WSEH 1KILB 5AVXB 5AW4B 1LWUB 2YNYA 1JOCA 3VP8A 1FU1A 3KPEA 4WY4C 1MFZA 4W7ZA 1OWAA 5AW2B 3OJAB 2E43A 1MZ9A 4JYCA 2KB7P 3A3YB 2A45I 1AFOA 5AW7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9B A;  3HE5 B;  3HE4 A;  4LC1 A;  2W27 A;  1HJB A;  3TNU A;  5AVV B;  5AW0 B;  2XU6 A;  1HBW A;  5APV A;  5APX A;  3HTK A;  2WPS A;  2BAS A;  3M06 A;  3I5C A;  3V4W A;  3V5B A;  3B8E B;  1CI6 A;  3OAK A;  2P67 A;  2VRS A;  3KQG A;  3P8M C;  1MV8 A;  1GZL A;  2Z5H A;  4AYC A;  5AW5 B;  4KHX A;  2QM8 A;  3M9H A;  1SP4 A;  3T97 A;  1HWT C;  3TYY A;  3VMY A;  2Q3I A;  3IR9 A;  1S9K E;  3NXS A;  3HE4 B;  1MUU A;  2IPP A;  4RES B;  2WWW A;  5AW1 B;  4M3L A;  3A2A A;  5AVS B;  1SLQ A;  3P7K A;  1IO4 A;  2C9L Y;  3O8Z A;  5AVZ B;  5AW3 B;  5AVR B;  4B86 A;  2P2U A;  1T2K C;  3VMX A;  1GTW A;  3A5T A;  3M9B A;  1GK4 A;  3VMZ A;  3TNU B;  5APW A;  1FAV A;  2E42 A;  2R3C A;  3NMD A;  4I6M C;  4C7N A;  1A02 F;  2QM7 A;  3VYI A;  2Q7C A;  4GKG A;  5AVT B;  1T2K D;  1JUN A;  2H7H A;  3L37 A;  3MD0 A;  1H8A A;  4AQR D;  3M91 A;  1OXZ A;  4AUW A;  1GD2 E;  3M0D A;  1JNM A;  4GT1 A;  1A02 J;  5AVW B;  4XE5 B;  2R5D A;  3A7O A;  1GK6 A;  2YO2 A;  4HYT B;  2R5B A;  1H88 A;  2ZFC A;  2P7J A;  3TK1 A;  5AW6 B;  4C7N B;  1GU5 A;  2WPR A;  1CZQ A;  2WPQ A;  1X8Y A;  1KQL A;  3HE5 A;  1NAF A;  3L36 A;  3M0A A;  5APU A;  4EOT A;  1S9K D;  1NWQ A;  3SWF A;  1CSB A;  5AVQ B;  2Z5I A;  2XV5 A;  5APQ A;  1YYC A;  1CI6 B;  5AW8 B;  5APT A;  3V4Q A;  3LIE A;  4JYB A;  2JJL A;  2KP8 A;  5APY A;  1FOS F;  1H89 A;  5AVY B;  1HUC A;  2R32 A;  2W6A A;  2WT7 B;  2Q5U A;  5AVU B;  3MGN A;  3KDP B;  4C46 A;  1GU4 A;  3NFQ A;  3VN0 A;  2WT7 A;  3P32 A;  1DH3 A;  2WTY A;  3L35 A;  3UIA A;  5AVX B;  5AW4 B;  2YNY A;  2C9N Y;  3LID A;  3VTP C;  1FOS E;  1G2C B;  5AW9 B;  1MFZ A;  5APS A;  1OWA A;  5AW2 B;  1J2J B;  4I2L C;  2YO3 A;  2E43 A;  3NTN A;  2XZR A;  2ZXE B;  4JYC A;  3A3Y B;  4DZO A;  5AW7 B;  5CMZ A; 
#chains in the Genus database with same CATH topology
 3HE5 B;  4ZKP A;  2YMK A;  3FXE A;  4QMA A;  4DOJ A;  1EDL A;  1SQP G;  3Q5R A;  1NTZ D;  2NZ2 A;  3V2Q A;  4LC1 A;  3VP9 A;  3HUS A;  1YTZ I;  1SQX E;  2YKQ A;  1T6A A;  1X22 A;  1HH0 A;  1NTM D;  1UII A;  5AW0 B;  3RK3 B;  4DJG A;  1HBW A;  4BRY A;  1YBK A;  3CC7 P;  2J58 A;  1NYH A;  3KQG A;  4HH2 A;  1BSN A;  4WVZ A;  3QH9 A;  1J1D B;  2WPS A;  1EXI A;  1DD4 A;  2OYO A;  2WVR A;  3CXH D;  4NPE A;  1VF5 B;  1GL2 C;  4GOF A;  1LTA C;  3V2P A;  2E76 B;  4HKZ H;  2VRS A;  4IFM A;  2MKV A;  3CX5 D;  4AYC A;  1NU1 D;  3D70 A;  2E75 C;  1RF0 C;  1MKM A;  1Q82 Q;  5C39 A;  1VQL P;  4KHX A;  2IBZ E;  3SFE C;  3WUU A;  1QVF O;  3M9H A;  2QJK B;  3T97 A;  2ZXX A;  1DEB A;  2O1J A;  4H44 D;  1GW3 A;  3JCU H;  4OWF A;  2KLU A;  1ZRT D;  1SQV E;  2IPP A;  2WSF J;  2QE7 H;  5CCG D;  1FC2 C;  2W6B A;  2WWW A;  4M3L A;  3A2A A;  2LXB A;  2BEZ F;  2Q3E A;  1LTJ B;  1N73 A;  4KT0 J;  4UB6 E;  5AVS B;  5CCG A;  1W2B O;  2A06 D;  2UWJ E;  4H0L B;  3TSI A;  2Q6Q A;  2NPS A;  4HB1 A;  4R4M A;  3L4F A;  4Y28 J;  1PPJ E;  5GTH H;  1N7S C;  1FDO A;  1M90 Q;  1VQ9 P;  2JWA A;  2FYU J;  1BGY D;  1T2K C;  3AE9 C;  1JY3 O;  2PFX A;  3CXH H;  4GIF A;  5B5E H;  3A5T A;  1GTW A;  1KFM A;  1D7M A;  1OX3 A;  2KNC B;  2KXP B;  4N3Y B;  3V6I A;  1IFN A;  3W67 A;  3L71 E;  5KJ7 C;  1FAV A;  3L71 J;  1HVV A;  1KN7 A;  1JMB A;  1A02 F;  2GUS A;  1BCC G;  3A0B H;  2QM7 A;  2IDB A;  3L75 J;  2A45 G;  4WWI A;  1M57 D;  2Q7C A;  3VYI A;  1T2K D;  1LTT C;  2OGU A;  2ZT9 D;  1RF1 B;  3L37 A;  3MD0 A;  2I1K A;  1NU1 E;  2K37 A;  4PV1 D;  1H8A A;  1N86 A;  1KFN A;  3H1J D;  3I56 P;  3CWB D;  2FXM A;  2IBZ D;  3BAS A;  4IFF A;  4WB4 A;  4AUW A;  4JF7 A;  2A06 E;  1E79 H;  1JCC A;  3M0D A;  1SQQ D;  1SQQ G;  4GT1 A;  2KSE A;  4ZKU A;  1URQ A;  4WY4 A;  5TIS E;  4XE5 B;  2HPC A;  1OW8 A;  1LWU A;  4PD4 H;  2JDI H;  1L4A C;  1LTS C;  1FDM A;  4WY4 D;  3WU2 H;  1IFJ A;  1SQQ K;  1SVF A;  3QWO C;  1N7L A;  2ZYA A;  3HD7 B;  5AW6 B;  1GU5 A;  1SQX D;  1NU1 J;  3A0B E;  2WPQ A;  4YXW H;  1HGZ A;  3HE5 A;  5APU A;  3CI9 A;  1NTZ E;  2FFD B;  2JEE A;  1K04 A;  3KXD A;  4ASW A;  1CSB A;  3BCC E;  5AVQ B;  1LWU C;  1NTZ K;  4PD4 D;  1KB9 I;  1LJ2 A;  1LT9 A;  1P84 I;  2WZ7 A;  3H1I E;  3H1I J;  5CHX A;  3CCL P;  3CXH E;  3FGA D;  5B5E E;  3TGU D;  1CI6 B;  3TGU E;  3ZDM A;  1UIX A;  3L75 G;  1BCC J;  4YTP C;  1IK7 A;  2G3A A;  3CL3 D;  4D6T G;  2QJY C;  5BU5 A;  3LIE A;  3FXD A;  1NTZ G;  1SQB E;  1NTK K;  2NRG A;  4JYB A;  4IL6 H;  1PV3 A;  1QL1 A;  2YIU B;  3IN6 A;  4OGQ C;  3GLM A;  3PTZ A;  2ZVN B;  2R32 A;  2Q5U A;  3AE2 C;  3H6P A;  1OVR A;  1KOR A;  1JY2 N;  4LLH A;  1S5L X;  4A7P A;  2IX7 C;  3AE4 C;  3G3Z A;  3JCU E;  3P32 A;  3RK3 C;  4D6T E;  2WT7 A;  3CCV P;  1PIX A;  1VQN P;  1M7L A;  5CJ4 A;  3L73 D;  3UIA A;  2BEQ D;  2E75 D;  1J1D C;  4UB8 H;  2AEF A;  1FZF A;  2C9N Y;  2B89 A;  3ABV C;  3RGU A;  1VF5 C;  2ZVO B;  3AEC C;  3LID A;  2K88 A;  5KKZ B;  1FOS E;  2FXO A;  2E76 C;  3AEB C;  3GG2 A;  1URQ C;  1VPC A;  2KS1 A;  2M5A A;  3H25 A;  5KAI E;  1KC8 Q;  3MZW B;  4W7Y A;  3NTN A;  2Y0C A;  2XZR A;  2ZXE B;  1KYO D;  3H1L J;  2CPS A;  1PP9 G;  4ASV A;  2CPB A;  1HTL C;  1U7M A;  5CMZ A;  1RY3 A;  2N9B A;  2QVA A;  2WQY C;  4RO0 A;  3HE4 A;  1OMI A;  1ZME C;  3L70 J;  2W27 A;  4PJ0 E;  4TLF A;  5CBO A;  5L8R J;  3MTU E;  4D6T J;  3AEG C;  2XU6 A;  1ZN5 A;  3CLQ A;  3L72 D;  5APV A;  4H13 C;  1ZLL A;  1BGY J;  3CME P;  1KYO H;  3CX5 E;  1PPJ G;  1S4X A;  4EI2 A;  1R8E A;  1N7S B;  3B8E B;  4EIJ A;  3D71 A;  1L0L G;  1L4A D;  2N1T A;  2IFM A;  3OAK A;  2J59 M;  1NKN A;  1URQ D;  2BCC D;  1SQV J;  3D6Z A;  1W5C E;  4L73 A;  3H1K J;  1QVG O;  4OGQ D;  3H1K D;  2QM8 A;  2O1K A;  2HFE D;  2V4H A;  3L73 E;  1SP4 A;  1KB9 E;  1X0T A;  2E5T A;  1NKZ B;  1SFC C;  1OVU A;  2JKV A;  2Q1K A;  3IR9 A;  4N78 E;  3RL0 B;  2KI7 B;  1L0N D;  3PJS K;  4H44 B;  4JPZ B;  3WMM 0;  2HPC B;  3CMA P;  1MUU A;  4DT0 A;  3N4X A;  3AE3 C;  4RES B;  1P84 D;  3TF5 A;  2IBZ G;  1NJI Q;  1FZC B;  1S1C X;  1LTB C;  1HGV A;  2GUV A;  1EDI A;  1N73 C;  1PP9 J;  1FS0 E;  1SLQ A;  1XTC C;  1GL2 D;  3U59 A;  2GA1 A;  2ZAE B;  1IO4 A;  1IJD B;  1QL2 A;  2AXC A;  3H32 A;  2HR3 A;  3JC2 2;  5CCH C;  3W68 A;  3MIW A;  5AW3 B;  1M56 D;  2OQQ A;  4I1L A;  5AVR B;  4B86 A;  4XFJ A;  2KUB A;  3VMX A;  3OW2 O;  1L4A B;  3S4R A;  5KLI C;  3SWY A;  2E74 B;  2W90 A;  1KQG B;  2PAJ A;  3M9B A;  3OA7 A;  4C7R A;  1SQX G;  1G1J A;  3TNU B;  2H43 A;  4I6M C;  1SQP E;  3BRT B;  2FBW C;  2YKO A;  2ZYD A;  2K9Y A;  2QJP C;  3IAO A;  3P8C D;  3Q3D A;  3GF7 A;  3H1K E;  3VOP A;  1BE3 G;  4IL6 E;  2DW3 A;  1U57 A;  2OTL P;  3PHL A;  3H1H E;  1P84 H;  2HOD A;  1S5L H;  1IK9 A;  2OYI B;  4W80 A;  1VDF A;  1GL2 B;  1JNM A;  2J5U A;  2L5G B;  4D6T D;  1N2D C;  2QJY B;  1MFT A;  1AV1 A;  1PPJ D;  3JSV C;  3CXH I;  2R5D A;  5E79 E;  3PH0 A;  2E75 B;  1EZV I;  3A7O A;  1P84 E;  1GK6 A;  2RKL A;  4ZNC A;  1L0N E;  1R5S A;  2IFN A;  3CX5 H;  2BCC G;  5KLV E;  2FYU D;  2YXQ B;  1BSH A;  1N7S D;  2P10 A;  2A45 H;  1AA0 A;  4C7N B;  4TT3 H;  3Q5P A;  2K9J B;  1VQ6 P;  2OTJ P;  1Y47 A;  1CZQ A;  4EDF A;  2Q9I A;  3L36 A;  4EOT A;  1RE4 A;  3B5N D;  3HTK B;  3L74 E;  3L71 D;  3M0A A;  3O6Q B;  3SWK A;  3G4S P;  1YJN P;  5CBN A;  1NGM B;  1LGH B;  2FYU K;  3MHV A;  2KOG A;  3RBX A;  2FFD A;  1BGY G;  1OIP A;  1ZV8 A;  1JTH A;  1USD A;  2P1J A;  2AXT E;  2QRX A;  3G6E P;  1H0T B;  4UB8 E;  1RE3 C;  3H1J J;  5KAI H;  3G9R A;  2XDJ A;  3AEE C;  3L74 D;  1VQM P;  1EDJ A;  1PP9 D;  2C0W A;  4OVN F;  1USE A;  2LKM A;  3CX5 I;  5AVY B;  1H89 A;  1HUC A;  5KTB A;  2W6A A;  2OAR A;  1SQB K;  3C1L A;  3K5B A;  3L72 G;  3MGN A;  1VQ5 P;  1VQO P;  1L0L K;  1JY2 O;  1L2P A;  1NTM E;  3NFQ A;  1ZRT E;  1GU4 A;  4R4L A;  3CCQ P;  2Y9Z A;  5BU8 B;  1DH3 A;  1LTG C;  3C9I A;  2RN0 A;  1LT9 C;  2H89 C;  5DJU B;  3RL0 D;  1W2E A;  4Y99 B;  4H13 D;  2HLO A;  1IFM A;  1NTK D;  2BCC J;  2MJZ A;  4GOD A;  1G2C B;  1Q2N A;  4L74 A;  3V2R A;  3VTP C;  1KIL D;  5APS A;  4BXL A;  1EQ7 A;  2JR8 A;  3BCC J;  3HD7 D;  2FYZ A;  3TDK A;  3BCC D;  4YXD C;  2L91 A;  3U1C A;  4I2L C;  1DD3 A;  2I8D A;  2M3E A;  1NTK E;  2WMM A;  2YO3 A;  3TGU J;  1JO5 A;  1IFI A;  1EC5 A;  4DZO A;  2OTK E;  3T97 B;  1FOS F;  3CWB E;  3R2P A;  1YIT P;  2D2C C;  4H44 C;  4K3A A;  2ITA A;  2KIK A;  1NTZ J;  2Y0E A;  2FKW B;  1HJB A;  1FZC C;  2YKP A;  3TNU A;  1OVV A;  1N73 B;  5APX A;  1VF5 D;  3I55 P;  1IC2 A;  3PP5 A;  4U3F E;  2QEX P;  1AQ5 A;  1BE3 D;  1RE3 A;  3WU2 E;  2E74 D;  3CD6 P;  3L73 J;  2O3J A;  1CI6 A;  2W83 C;  4PD4 E;  3H1J E;  2P67 A;  3EWK A;  5TIS H;  3P8M C;  4NPF X;  1MV8 A;  2Z5H A;  1SQP J;  2E74 C;  2HOD B;  3ITK A;  4L75 A;  1WMK A;  2KNC A;  2Y0D A;  1FZG A;  4OGQ B;  2OYI A;  4IFD K;  4O9B A;  1PL5 A;  1HWT C;  3B5N B;  1DIP A;  2Q3I A;  3E1I A;  1S9K E;  2QJP B;  2QSI A;  1J1E C;  5GTI E;  1LTI C;  1BDC A;  1BDD A;  3HUS B;  3GHG A;  4PV1 B;  2NPS C;  4YPC A;  2W8Z A;  3PRJ A;  1Q81 Q;  2XNX A;  1K8A Q;  4BRY B;  1Y8A A;  2BCC E;  4XA4 A;  4EYY Q;  1YJW P;  3RK3 D;  1JY3 N;  3P7K A;  2K9J A;  3S9O A;  2OYI C;  3E1R A;  2C9L Y;  3O8Z A;  5KKZ C;  5AVZ B;  1KD1 Q;  4RJT A;  1URQ B;  1RHZ B;  1Y9B A;  1LP1 A;  2PRR A;  1FZC A;  2M5A B;  2P2U A;  3E7K A;  3H32 B;  1YIJ P;  2GM4 A;  1EXJ A;  1S72 P;  1L0N K;  2YXR B;  1KQS O;  1YTZ T;  2IYO A;  2XKM A;  3VMZ A;  2W6J H;  1NO4 A;  3H1H G;  3H1H D;  3MP7 B;  1L4A A;  3N7N A;  1AVO A;  3H1H J;  3RK3 E;  4U3F D;  2O01 N;  4GOE A;  1WRG A;  2M8R A;  1PGQ A;  3C8V A;  4DCK A;  3Q2Y A;  2WPV B;  3VMA A;  2KLV A;  1JY3 P;  3BRV B;  3AEF C;  1JUN A;  1FJK A;  5CCG C;  2P58 A;  1E5W A;  2IZ1 A;  2KZJ A;  4AQR D;  1HJ0 A;  1KIL C;  4LGD E;  1SQV K;  2ZJS E;  2ZT9 B;  3GHG C;  1OXZ A;  1RQV A;  3RBZ A;  1SQX K;  3CCU P;  1X79 B;  1NHL A;  2FYU G;  4KJM A;  4WBA A;  3CCJ P;  1LT1 A;  1M1J B;  1KIL E;  3L70 E;  4IL6 X;  2B87 A;  5KJ7 A;  2YO2 A;  4HYT B;  4BWN A;  5KLV J;  1EZV E;  1WT6 A;  2ZFC A;  3AE6 C;  3H1L E;  1JEK A;  3RL0 C;  1VQK P;  2OYH B;  1IFD A;  3TK1 A;  3CC2 P;  1K05 A;  3A0H E;  4HJG H;  2K1A A;  1GMJ A;  1ZOY C;  2R3S A;  2WPR A;  1SQP D;  1X8Y A;  3HRN A;  1KQL A;  1X9V A;  1NAF A;  3P8C E;  4RKU J;  4N78 D;  1L0L J;  1KQF B;  1YHQ P;  5B66 E;  1AVY A;  1KZU B;  1OW6 A;  3SWF A;  1NWQ A;  2Z5I A;  2XV5 A;  3L73 G;  4Z1M H;  1AFO A;  5TJH A;  1FE6 A;  1AQT A;  1PFI A;  3M0D C;  5M1B A;  5AW8 B;  4OH8 B;  3RK2 B;  3USS A;  2WSF H;  3V4Q A;  1L0L E;  5CJ0 A;  1SFC A;  2B9B A;  2JWD A;  2JJL A;  1EDK A;  1NOH A;  2RH0 A;  2WIT A;  2ZYG A;  3R4Y A;  4UB6 H;  5APY A;  5DJT B;  2POH A;  3KDP B;  3H1L G;  1EZV G;  1EZV D;  3KZI E;  3SFD C;  3VN0 A;  5GTI H;  1M1K Q;  3GMA A;  3HD7 A;  2K3R A;  1KIL A;  2WTY A;  1Z56 A;  1LTJ A;  2IBZ I;  3B5N A;  3L35 A;  3L70 G;  3CCS P;  1LTJ C;  1M8O B;  2FYU E;  1ZR4 A;  1QX8 A;  1NAY A;  3WUV A;  2E5Y A;  1PP9 E;  3LW5 H;  1N7S A;  1NTM K;  3FX0 A;  1K9M Q;  1K73 Q;  2N1T B;  2NPS D;  3L75 D;  3SSU A;  5AW9 B;  1FZB A;  1GL2 A;  1JB0 J;  2HYN A;  3WUT A;  1J2J B;  3CCM P;  1YQ4 C;  2N9Y B;  4I7Z C;  5H2F H;  1KMI Z;  2AXT H;  2PP6 A;  1JY2 P;  2FYN C;  3AE1 C;  2M0B A;  3BAT A;  1T3J A;  1LP1 B;  2JP3 A;  1ZP0 C;  2O01 H;  3CC4 P;  2I1J A;  3HUS C;  4PV1 C;  2WSC J;  2WSC H;  1KB9 H;  1OFC X;  2R44 A;  2Z4E A;  4CPG A;  2QG4 A;  5AVV B;  1RF1 C;  2O01 J;  1JMM A;  2WSS H;  3KYQ A;  3S1K A;  3HTK A;  1DEE G;  3L72 J;  3U1A A;  1RE4 C;  2H88 C;  1GDT A;  5K5G B;  2BAS A;  3M06 A;  2QIW A;  3I5C A;  3V4W A;  5CCH D;  3V5B A;  1SQB G;  2KK7 A;  3B71 A;  5KJ7 D;  1JTH B;  2WSE J;  5E79 H;  2IZ0 A;  4WY4 B;  1FZE A;  2KS1 B;  1R5L A;  2LR2 A;  3EQ2 A;  1TU3 F;  1GZL A;  1NVO A;  1QLE D;  1SQB J;  3IF4 A;  3L75 E;  4MN4 C;  5AW5 B;  2HG5 D;  3TGU G;  3H1I D;  1S5L E;  3H1I G;  4IOI H;  4ZMD A;  3BCC G;  3TYY A;  3VMY A;  3PLN A;  1L0N J;  2Y9Y A;  5EFW B;  3AE8 C;  2RMZ A;  1M1J A;  3NXS A;  3HE4 B;  2G8Y A;  1FBM A;  1BCC D;  1GW4 A;  1PGO A;  3HD7 C;  5KAF H;  3EFF K;  3Q1M A;  5AW1 B;  1SQQ J;  2FFD C;  2C0X A;  3RL0 g;  1G1I A;  1LT9 B;  3AE5 C;  3GHG B;  3H1J G;  1FDI A;  4Y99 C;  1JCD A;  1SFC D;  1SQP K;  3LW5 J;  2XND H;  1BE3 J;  1G2C A;  1PZQ A;  3Q5S A;  1M1J C;  4U3F G;  1FJP A;  1SQQ E;  1VQ7 P;  1OZH A;  1U7J A;  2A06 G;  1VQP P;  1VQ4 P;  4K35 A;  1GK4 A;  2YIU C;  3CCE P;  4JQ0 D;  3AE7 C;  1N8R Q;  5APW A;  1NU1 G;  2D2C B;  2CK3 H;  2QJK C;  2R3C A;  3NMD A;  1RF1 A;  2OYH C;  4C7N A;  2E42 A;  2FY8 A;  1NTK J;  3M9Q A;  1KB9 D;  1S2E A;  3CWB G;  4NPD A;  1QGK B;  4GKG A;  1BCC E;  5AVT B;  2H7H A;  3H1L D;  1NTK G;  1VL2 A;  2B88 A;  3RK2 D;  3CPW O;  2SPZ A;  1NU1 K;  2V7Q H;  3L71 G;  3M91 A;  4JBZ A;  1JM0 A;  3L70 D;  4H0L C;  1H0T A;  1GD2 E;  1FZA A;  1KYO E;  3RK2 C;  5CCH A;  3II6 A;  4GDO A;  1A02 J;  5AVW B;  1OW7 A;  1XTG B;  2FXP A;  2KYV A;  2M3B A;  1NTM J;  1ZXG A;  3F5H A;  3KHU A;  3MUD C;  4H0L D;  1RH5 B;  2AEM A;  2E76 D;  1ZR2 A;  1T8Z A;  2R5B A;  1H88 A;  1NTM G;  3B5N C;  3D6Y A;  3A0H H;  2B87 B;  2QA4 P;  3L72 E;  2P7J A;  3G71 P;  5AW4 B;  1J1E B;  1PGJ A;  4U7J A;  1SQV D;  1SQV G;  2N1T D;  2NPS B;  1Q86 Q;  2OYH A;  4PJ0 H;  1S9K D;  1DX7 A;  3CCR P;  1KV4 A;  4H13 B;  3MUD A;  1YJ9 P;  3B4S A;  1ZW0 A;  5APQ A;  2N1T C;  1Q90 D;  2H8P D;  1IZN B;  1YYC A;  1BGY E;  5H2F E;  5APT A;  3IFM A;  3CWB J;  4I7Z B;  2V7Q J;  5KLV K;  3L74 J;  4PD4 I;  2IYP A;  2KSJ A;  3FWL A;  3L74 G;  1T3U A;  3BVH A;  2FYN B;  1VQ8 P;  1PGP A;  2KP8 A;  1Q7Y Q;  2YMY A;  3V2N A;  3KZI H;  5BVZ A;  2PGD A;  3EFG A;  4N6J A;  1RF0 A;  1SFC B;  5AVU B;  2WT7 B;  4C46 A;  1NH4 A;  5KLV G;  5KLV D;  1L0N G;  1QEX A;  1RQU A;  1CW5 A;  5KAF E;  4L76 A;  3FWN A;  2JO1 A;  2WSE H;  1YI2 P;  1S3J A;  2KZI A;  1SQX J;  3AED C;  3O6Q A;  1KIL B;  2LXC B;  3GF3 A;  5AVX B;  1IFP A;  1KYO I;  1JOC A;  1LNQ A;  1LWU B;  2YNY A;  2ZT9 C;  3F89 A;  1FU1 A;  1SQB D;  3KPE A;  3VP8 A;  4U3F J;  4WY4 C;  1YQ3 C;  5GTH E;  1L0L D;  1AJY A;  1MFZ A;  1KTM A;  4W7Z A;  1OWA A;  1SS1 A;  2D2C D;  5AW2 B;  5B66 H;  3AEA C;  3OJA B;  2AEJ A;  2E43 A;  3GW6 A;  1MZ9 A;  1BE3 E;  4JYC A;  2KB7 P;  3H1K G;  3A3Y B;  2A45 I;  5KLI B;  1HF9 A;  5AW7 B; 
#chains in the Genus database with same CATH homology
 3HE5 B;  4ZKP A;  4DOJ A;  3V2Q A;  3VP9 A;  4LC1 A;  3HUS A;  1YTZ I;  2YKQ A;  1HH0 A;  5AW0 B;  3RK3 B;  1HBW A;  2J58 A;  4HH2 A;  1J1D B;  2WPS A;  1GL2 C;  1LTA C;  3V2P A;  2VRS A;  4IFM A;  4AYC A;  1RF0 C;  4KHX A;  3M9H A;  3T97 A;  1DEB A;  2O1J A;  1GW3 A;  2IPP A;  5CCG D;  2WWW A;  2W6B A;  4M3L A;  3A2A A;  1LTJ B;  1N73 A;  5CCG A;  5AVS B;  3TSI A;  2NPS A;  3L4F A;  1N7S C;  1T2K C;  1JY3 O;  4GIF A;  3A5T A;  1GTW A;  1KFM A;  4N3Y B;  1IFN A;  5KJ7 C;  1FAV A;  1HVV A;  1A02 F;  2GUS A;  2QM7 A;  3VYI A;  2A45 G;  2Q7C A;  1T2K D;  1LTT C;  1RF1 B;  3L37 A;  3MD0 A;  2I1K A;  1H8A A;  1N86 A;  1KFN A;  4IFF A;  2FXM A;  3BAS A;  4WB4 A;  4AUW A;  4JF7 A;  3M0D A;  1JCC A;  4GT1 A;  4ZKU A;  1URQ A;  4WY4 A;  4XE5 B;  2HPC A;  1LWU A;  1L4A C;  1LTS C;  1FDM A;  4WY4 D;  1IFJ A;  1SQQ K;  1SVF A;  1N7L A;  3HD7 B;  5AW6 B;  1GU5 A;  2WPQ A;  1HGZ A;  3HE5 A;  5APU A;  3CI9 A;  2FFD B;  2JEE A;  1CSB A;  5AVQ B;  1LWU C;  1NTZ K;  5CHX A;  1LT9 A;  2WZ7 A;  1CI6 B;  3CL3 D;  5BU5 A;  3LIE A;  4JYB A;  1NTK K;  1QL1 A;  2R32 A;  2Q5U A;  3H6P A;  1JY2 N;  4LLH A;  2IX7 C;  3G3Z A;  2WT7 A;  3P32 A;  3RK3 C;  1M7L A;  5CJ4 A;  3UIA A;  1J1D C;  1FZF A;  2C9N Y;  3LID A;  1FOS E;  1URQ C;  1VPC A;  4W7Y A;  3NTN A;  2XZR A;  2ZXE B;  2CPS A;  2CPB A;  1HTL C;  5CMZ A;  1RY3 A;  2N9B A;  3HE4 A;  2W27 A;  3MTU E;  2XU6 A;  1ZN5 A;  3CLQ A;  5APV A;  1ZLL A;  1N7S B;  3B8E B;  4EIJ A;  1L4A D;  2N1T A;  2IFM A;  3OAK A;  2J59 M;  1NKN A;  1URQ D;  2QM8 A;  2O1K A;  2HFE D;  1SP4 A;  1NKZ B;  1SFC C;  3WMM 0;  3IR9 A;  4N78 E;  3RL0 B;  2HPC B;  1MUU A;  3N4X A;  4RES B;  1FZC B;  1LTB C;  1HGV A;  2GUV A;  1N73 C;  1XTC C;  1SLQ A;  3U59 A;  1GL2 D;  1IO4 A;  1IJD B;  1QL2 A;  3H32 A;  5CCH C;  3MIW A;  5AW3 B;  4I1L A;  5AVR B;  4B86 A;  3VMX A;  1L4A B;  3SWY A;  3M9B A;  3OA7 A;  2PAJ A;  4C7R A;  3TNU B;  1G1J A;  2H43 A;  4I6M C;  3BRT B;  3P8C D;  2YKO A;  3VOP A;  2HOD A;  1IK9 A;  2OYI B;  4W80 A;  1VDF A;  1GL2 B;  1JNM A;  2L5G B;  1N2D C;  2R5D A;  3A7O A;  1GK6 A;  2IFN A;  1N7S D;  2A45 H;  4C7N B;  1CZQ A;  2Q9I A;  3L36 A;  4EOT A;  1RE4 A;  3B5N D;  3HTK B;  3M0A A;  1LGH B;  2FYU K;  2KOG A;  2FFD A;  1ZV8 A;  1JTH A;  2P1J A;  1RE3 C;  2XDJ A;  2C0W A;  1H89 A;  2LKM A;  5AVY B;  1HUC A;  5KTB A;  2W6A A;  2OAR A;  1SQB K;  3MGN A;  1L0L K;  1JY2 O;  1GU4 A;  3NFQ A;  5BU8 B;  1DH3 A;  1LTG C;  3C9I A;  1LT9 C;  3RL0 D;  1W2E A;  4Y99 B;  2HLO A;  1IFM A;  2MJZ A;  3VTP C;  3U1C A;  1G2C B;  1FZC A;  3V2R A;  1KIL D;  5APS A;  1EQ7 A;  3HD7 D;  2FYZ A;  2GM4 A;  4I2L C;  2YO3 A;  1JO5 A;  1IFI A;  4DZO A;  1FOS F;  3R2P A;  2FKW B;  1HJB A;  1FZC C;  2YKP A;  3TNU A;  1N73 B;  5APX A;  1IC2 A;  3PP5 A;  1AQ5 A;  1RE3 A;  1CI6 A;  2P67 A;  3P8M C;  1MV8 A;  2Z5H A;  1FZG A;  2HOD B;  4IFD K;  2OYI A;  4O9B A;  1HWT C;  3B5N B;  2Q3I A;  3E1I A;  1S9K E;  1J1E C;  1LTI C;  3HUS B;  3GHG A;  2NPS C;  2XNX A;  4XA4 A;  3RK3 D;  1JY3 N;  3P7K A;  2OYI C;  2C9L Y;  3O8Z A;  5AVZ B;  1URQ B;  2P2U A;  3H32 B;  1L0N K;  1YTZ T;  2XKM A;  3VMZ A;  3N7N A;  1NO4 A;  1L4A A;  1WRG A;  2M8R A;  2KLV A;  1JY3 P;  3BRV B;  1JUN A;  1FJK A;  5CCG C;  1E5W A;  4AQR D;  1KIL C;  4LGD E;  1SQV K;  3GHG C;  1OXZ A;  1SQX K;  1X79 B;  1NHL A;  4WBA A;  1M1J B;  5KJ7 A;  2YO2 A;  4HYT B;  2ZFC A;  1WT6 A;  3RL0 C;  2OYH B;  1IFD A;  3TK1 A;  2WPR A;  3HRN A;  3P8C E;  1X8Y A;  1KQL A;  1X9V A;  1NAF A;  4N78 D;  1NWQ A;  3SWF A;  1KZU B;  2Z5I A;  2XV5 A;  1PFI A;  3M0D C;  5AW8 B;  4OH8 B;  3RK2 B;  2WSF H;  3V4Q A;  5CJ0 A;  1SFC A;  2JJL A;  5APY A;  1NOH A;  2WIT A;  2POH A;  3KDP B;  3VN0 A;  3HD7 A;  1KIL A;  2WTY A;  1Z56 A;  1LTJ A;  3B5N A;  3L35 A;  1LTJ C;  1ZR4 A;  3LW5 H;  1N7S A;  1NTM K;  2N1T B;  2NPS D;  5AW9 B;  1FZB A;  1GL2 A;  2HYN A;  1J2J B;  2PP6 A;  3BAT A;  1JY2 P;  1T3J A;  2O01 H;  2I1J A;  3HUS C;  2WSC H;  2Z4E A;  5AVV B;  1RF1 C;  1JMM A;  3KYQ A;  3HTK A;  3U1A A;  1RE4 C;  1GDT A;  2BAS A;  3M06 A;  3I5C A;  3V4W A;  5CCH D;  3V5B A;  5KJ7 D;  1JTH B;  4WY4 B;  3KQG A;  1FZE A;  3EQ2 A;  1GZL A;  5AW5 B;  2HG5 D;  3TYY A;  3VMY A;  3NXS A;  1M1J A;  3HE4 B;  3HD7 C;  1FBM A;  1GW4 A;  5AW1 B;  2FFD C;  2C0X A;  1G1I A;  1LT9 B;  3GHG B;  4Y99 C;  1JCD A;  1SFC D;  1SQP K;  1G2C A;  1FJP A;  1M1J C;  1GK4 A;  5APW A;  2OYH C;  2E42 A;  2R3C A;  3NMD A;  1RF1 A;  4C7N A;  3M9Q A;  4GKG A;  5AVT B;  2H7H A;  3RK2 D;  1NU1 K;  3M91 A;  1GD2 E;  1FZA A;  3RK2 C;  5CCH A;  3II6 A;  1A02 J;  5AVW B;  1XTG B;  2KYV A;  2M3B A;  1ZR2 A;  1T8Z A;  2R5B A;  1H88 A;  3B5N C;  2P7J A;  1J1E B;  2N1T D;  2NPS B;  2OYH A;  1S9K D;  1DX7 A;  3MUD A;  5APQ A;  2N1T C;  2H8P D;  1YYC A;  5APT A;  3IFM A;  5KLV K;  2KSJ A;  3BVH A;  1T3U A;  2KP8 A;  2YMY A;  3V2N A;  5BVZ A;  3EFG A;  4N6J A;  1RF0 A;  1SFC B;  5AVU B;  2WT7 B;  4C46 A;  1NH4 A;  1CW5 A;  2WSE H;  1KIL B;  5AVX B;  5AW4 B;  1LWU B;  2YNY A;  1JOC A;  3VP8 A;  1FU1 A;  3KPE A;  4WY4 C;  1MFZ A;  4W7Z A;  1OWA A;  5AW2 B;  3OJA B;  2E43 A;  1MZ9 A;  4JYC A;  2KB7 P;  3A3Y B;  2A45 I;  1AFO A;  5AW7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...