3HE4B

Heterospecific coiled-coil pair synzip5:synzip6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
44
structure length
44
Chain Sequence
b'NTVKELKNYIQELEERNAELKNLKEHLKFAKAELEFELAAHKFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNZIP6
publication title A synthetic coiled-coil interactome provides heterospecific modules for molecular engineering.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 19
structure length 44
sequence length 44
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3he4B00
3M0DA 2R5DA 2WTYA 3NXSA 1HBWA 2W27A 5AW5B 4XE5B 5AVYB 3A7OA 3VN0A 2XZRA 3L37A 2Q3IA 1T2KD 3VMYA 3NFQA 3SWFA 1A02J 5AVSB 1S9KE 2Z5IA 2WPRA 3TK1A 1G2CB 3UIAA 1GD2E 5APXA 3MGNA 5AW2B 2E43A 2R32A 3M9BA 3O8ZA 4M3LA 1CSBA 4AYCA 1HUCA 1CZQA 1FAVA 5AVQB 4EOTA 3A2AA 3I5CA 3P8MC 2WT7B 3HTKA 4JYBA 5AW9B 2KP8A 2ZXEB 5APYA 5AW0B 2H7HA 2WT7A 5AW3B 5APWA 2ZFCA 1X8YA 1KQLA 2QM7A 5AW7B 4HYTB 3TNUB 1MV8A 3NMDA 1J2JB 3TNUA 2P67A 3KDPB 3VMZA 1GZLA 1YYCA 3L35A 1DH3A 3OAKA 2QM8A 3B8EB 4GT1A 3IR9A 2YO3A 3V4WA 3NTNA 5AW4B 3P7KA 5AW1B 2P7JA 5AVXB 5AVTB 4AUWA 3LIEA 5AW6B 4C46A 4KHXA 1NWQA 5AVRB 3TYYA 5AW8B 1GU4A 1HJBA 3HE5B 1T2KC 1MFZA 3M9HA 2WPSA 5APTA 1GTWA 1JUNA 1OXZA 3HE5A 5APUA 1GU5A 1A02F 3V5BA 3L36A 3VMXA 2JJLA 3M91A 3VYIA 2C9LY 2Q5UA 2N9BA 3M0AA 2YO2A 4DZOA 4B86A 3T97A 1GK4A 2YNYA 4C7NB 3VTPC 2BASA 1GK6A 5AVUB 2E42A 3KQGA 5AVWB 3A3YB 2Q7CA 3A5TA 1IO4A 1SLQA 1FOSF 2VRSA 2R3CA 2Z5HA 2XV5A 1FOSE 2WPQA 1CI6B 3MD0A 1H88A 1H89A 4GKGA 2C9NY 1CI6A 4AQRD 2R5BA 3HE4B 2W6AA 1HWTC 1JNMA 5AVZB 1H8AA 3HE4A 4I2LC 5APSA 1OWAA 2WWWA 5AVVB 4RESB 2P2UA 1NAFA 5CMZA 3LIDA 3M06A 3P32A 4JYCA 4C7NA 5APQA 1S9KD 1SP4A 2XU6A 4LC1A 1MUUA 5APVA 4I6MC 2IPPA 3V4QA
chains in the Genus database with same CATH superfamily
1NTZD 1D7MA 3Q1MA 3KYQA 1NTZG 4HJGH 3A7OA 3SSUA 1DEEG 4Y99B 3WU2H 2XNDH 3JSVC 3N7NA 3TK1A 4Z1MH 2R44A 3H1HD 1NTZK 2YKOA 2LXBA 3O8ZA 3PP5A 3H1HG 3HTKB 2POHA 3P8MC 1NHLA 2OQQA 2QRXA 5C39A 2KNCA 3L72J 3QWOC 5AW1B 1DIPA 4H44D 2IZ0A 2O3JA 4IFDK 1RE4A 1ZRTD 2QSIA 4GDOA 3B5NA 3CD6P 3CWBD 2C9LY 4DZOA 4K35A 3V2RA 1PV3A 1NTMJ 2KSJA 3CWBG 1SVFA 1GK6A 1NTKK 1VF5B 3FXEA 2WSFH 1SLQA 1LWUA 4YPCA 2HPCA 1OIPA 3G4SP 2M5AB 2R3CA 4IOIH 5KKZC 4GIFA 3RK3B 3EQ2A 3MIWA 1KILE 2K3RA 1M1JB 2KB7P 1LNQA 1FDMA 1J1DC 2KXPB 1ZR2A 2KS1A 1JY3N 3ABVC 2QEXP 1LT1A 2GA1A 1YTZI 2O01N 2R5DA 3NXSA 1USDA 4PJ0E 2CK3H 3GMAA 1OVVA 2KI7B 2NPSB 2RN0A 2BCCE 1BE3J 5KAIH 2JO1A 2IBZI 1DD4A 1S1CX 3H1JD 5KLVJ 1BCCJ 4JYBA 5APYA 1NKNA 1KORA 3H1JG 5AW7B 2OYHA 3HUSC 3RK2D 4PD4E 1KZUB 1QL2A 3P7KA 5BVZA 2E76C 4XFJA 1SQVE 4DT0A 3B5NB 1NAYA 1VQ6P 1KC8Q 3M91A 2ZJSE 2YIUB 1QL1A 1RF0A 4D6TJ 4GOEA 1FZCA 1KQSO 1NJIQ 1KILD 1LWUB 2HPCB 1X0TA 1W2BO 5CJ0A 4JQ0D 2Z5HA 2YXRB 1H89A 4AQRD 3BASA 1VQ7P 1M1KQ 2KS1B 2BEZF 1FE6A 3GHGA 1ZW0A 1LGHB 1KMIZ 3MP7B 1LTGC 1OW8A 3V4QA 3B71A 2O01J 2BCCD 3CX5E 2BCCG 2N1TA 1A02J 1HGZA 2IFMA 2NRGA 3AE2C 4PD4D 1HUCA 2ZXXA 1VQOP 4NPDA 1EZVI 1SQXE 5AW9B 4IL6X 5B5EE 2OYHB 1SQVD 2I8DA 5TJHA 4TT3H 4H0LB 2W90A 5GTHE 3F89A 1GZLA 1SQVG 2YO3A 1NTKJ 5CCHA 1N8RQ 1SQVK 3CXHI 4YXDC 3CWBJ 2AEMA 3U59A 5KJ7A 1IJDB 1FZCB 4L74A 5TISE 1KB9I 2Q7CA 3CCVP 5DJTB 3RBZA 2H89C 2HLOA 5CHXA 3WUUA 3HE4A 4I2LC 3CCMP 1VQKP 3CX5D 1YJWP 4PV1B 4YXWH 1AQ5A 1AVOA 1R8EA 2JWAA 2B89A 1KFNA 2OYOA 3CCRP 3HD7D 5B66E 2A45H 1N86A 5AVYB 2N1TB 1NTME 2HODA 1GDTA 2IYOA 3RL0B 1KYOH 1CZQA 3KZIH 5E79H 1PGOA 3B5ND 1K04A 3D6YA 1SQXK 2W6BA 1KFMA 3OAKA 5KTBA 3V4WA 3FX0A 2KUBA 3LIEA 1NWQA 2OYIC 2KLUA 1GU5A 1OX3A 3L36A 2N9BA 4WY4A 4H44C 2YXQB 2JR8A 3T97A 4C7NB 3VTPC 2OGUA 5KLVE 2ZAEB 3PHLA 2FXMA 3MD0A 2Y9YA 2C9NY 2A45I 5KLIC 3HE4B 1LTIC 3M0DC 1FZAA 3V6IA 1N7SA 2WSCJ 2P2UA 1NAFA 3M06A 2WQYC 1NTMD 1IFIA 2M3EA 1SFCD 1NTMG 2BCCJ 1Z56A 2WTYA 4I1LA 4H0LD 3IAOA 3FXDA 1KTMA 3CMAP 1AV1A 3E1IA 4D6TE 3I55P 1NTMK 2WSSH 2HODB 4EYYQ 1GMJA 1KYOE 5E79E 1URQA 3M9BA 2W8ZA 4EOTA 3PH0A 1UIIA 2FYUE 3AEBC 2QM7A 2ZT9D 1J1EB 1NKZB 1OW6A 2P67A 3E7KA 2H88C 3PRJA 1S5LX 1GL2D 2WSFJ 1S2EA 5AW6B 4UB6H 1FS0E 4KHXA 4UB8E 1BE3D 3RK2C 5KLVD 2D2CB 1BE3G 3VMXA 4WY4B 5KLVG 2J58A 1P84E 2WVRA 2B87B 1IFPA 5KLVK 1VPCA 3L73E 3OJAB 2N1TD 1K05A 1KILC 3D70A 1BSNA 1L4AC 2E75C 4A7PA 3RL0D 5L8RJ 3USSA 4GOFA 4D6TD 1NTKE 4I7ZC 1KYOD 3L75J 4I6MC 2IPPA 2QIWA 2JDIH 4D6TG 3E1RA 2GM4A 2W83C 2M5AA 1SQXJ 1G1IA 1K9MQ 3AE6C 4Y28J 1YJ9P 4OGQB 2FYUD 3TDKA 5CCHD 1URQB 4W7YA 2FYUG 1M1JA 3MZWB 1Q90D 3I5CA 3FGAD 5AW0B 4R4LA 4YTPC 2FYUK 1MV8A 5GTIH 3TNUA 2Q9IA 3H1LE 1YYCA 3L35A 1DH3A 2DW3A 2NPSA 1P84D 1T3UA 2E75B 1R5SA 4HH2A 3TYYA 1GTWA 1A02F 2OTKE 3AE5C 2JJLA 2QVAA 3M0AA 3L73D 3KHUA 1QVGO 3L73G 2XNXA 4ZKUA 1JY2O 1LTSC 1DD3A 1W2EA 3A3YB 4K3AA 1OZHA 1FOSE 1NTKD 3F5HA 1CI6A 1NTKG 3LW5J 5APSA 4U3FE 3LIDA 3W68A 1VQ8P 3AEEC 1FDIA 2O1JA 1QX8A 2XZRA 1T2KD 1S9KE 1G2CB 2A06E 4XA4A 1PGQA 3HD7C 5AW2B 2E43A 3CC7P 3H1LD 1Y9BA 1LTBC 2JWDA 3BCCE 2ZVNB 3H1LG 2ZXEB 4WY4D 2OARA 3WU2E 3AECC 1EXJA 3TNUB 2V7QJ 1HH0A 1FZFA 3KDPB 1JY3P 1VDFA 1ZN5A 4IFFA 1U57A 1VQ9P 2ITAA 3VOPA 1N7SD 5APTA 2WSEH 4PD4I 1GK4A 5KKZB 2BASA 2IBZE 1FOSF 4RKUJ 1PZQA 4U3FD 1QGKB 1CI6B 3CL3D 3KPEA 4U3FG 4JPZB 1J1DB 1URQD 1L0NJ 2YMKA 5CMZA 2G3AA 3RK3E 3GG2A 1S9KD 4LC1A 2A06D 2QJPC 2A06G 3CXHH 2FYUJ 3CCEP 1AQTA 1YQ4C 4L76A 1SFCC 2W6JH 4ASWA 1KV4A 3ITKA 1S4XA 3UIAA 5APXA 2P10A 1VQMP 1KB9H 1SQQE 3HUSB 1FZBA 1WRGA 1JEKA 3A0BH 1FJKA 2I1JA 2E76B 3CC2P 2E5TA 1N7LA 1U7JA 4H13C 4JF7A 3IR9A 1RF0C 5KAIE 3L75E 4N6JA 2ZT9C 5AVTB 3RBXA 2H43A 1HJBA 3MUDC 2IBZD 2HFED 1EDKA 2M0BA 4IL6H 1GL2C 1T8ZA 3L73J 4WWIA 2IBZG 2GUVA 1VL2A 1H0TA 1VF5D 2E74C 1G1JA 1IFMA 2C0WA 3KQGA 1LT9C 4RO0A 5AVWB 1IO4A 1EZVE 3U1AA 3RK3D 1JCCA 2V4HA 2W6AA 1LTJC 4N3YB 3VMAA 3N4XA 3G9RA 2K9YA 1VQPP 1N2DC 4C7NA 1SP4A 1BGYE 3G6EP 5APVA 2IFNA 1AFOA 1SQQD 2R3SA 2NZ2A 1WT6A 3VMYA 3SWFA 2NPSD 1SQQG 4W7ZA 3AE8C 1LTTC 1JM0A 1RQVA 3H1LJ 3G3ZA 3MGNA 1DX7A 1CSBA 2RH0A 1SQQK 3A2AA 1YQ3C 2FYNC 2KP8A 3Q5RA 3L75D 1Q81Q 3D71A 3JCUH 2FY8A 3L75G 3H25A 1HGVA 2PFXA 1M7LA 1SQXD 1K8AQ 2AXTH 3BRVB 1SQXG 2OYIA 1KN7A 3VP8A 2P7JA 4RJTA 1EDLA 3I56P 1JMMA 2M8RA 3M9HA 1EZVD 2Y9ZA 3BRTB 1M56D 1H0TB 1EZVG 2KOGA 4EDFA 2ZYAA 1VQNP 4U3FJ 3A5TA 3JC22 2JEEA 1HJ0A 3WUTA 2WPQA 3H1KE 1BGYD 1N73C 1GW3A 4IFMA 1FZGA 1BGYG 5KAFH 2E5YA 4DOJA 2L91A 2M3BA 5AVVB 1IFNA 4RESB 1RY3A 2XKMA 2IDBA 1LTAC 4W80A 2XU6A 1JCDA 1MUUA 2B87A 5H2FH 3BCCJ 1KQFB 2SPZA 5CCGA 1UIXA 3M9QA 4O9BA 4TLFA 2WPRA 1X9VA 3AEFC 1HTLC 1RH5B 4BWNA 2FBWC 2QG4A 5AW3B 1ZR4A 1L0NE 3S9OA 3C8VA 2FFDC 3TGUE 1JTHA 3MTUE 1Y47A 2OYIB 1RE3A 3B8EB 3KZIE 4C46A 1PPJE 4H44B 3L74E 1JUNA 3AEDC 1FJPA 1EDJA 3O6QA 1PGJA 3CI9A 3H1KD 2YO2A 4ZNCA 1QEXA 3H1KG 1OVRA 5AVUB 1QLED 3C9IA 5KLIB 1YI2P 2IZ1A 2FYZA 1Q82Q 2VRSA 2IX7C 1L4AA 3A0HH 1U7MA 2KSEA 1OFCX 4OH8B 2R5BA 1NO4A 3CCUP 1SQPE 1H8AA 3AE1C 2YKPA 1E79H 4PV1D 2Q3EA 5H2FE 4JYCA 3Q5PA 5BU5A 3GF7A 1SQQJ 2W27A 3H1HE 4XE5B 4BRYB 1MZ9A 3NFQA 3QH9A 2Z5IA 1HF9A 2A45G 1L0ND 2H8PD 2MKVA 3TGUD 3ZDMA 2L5GB 1L0NG 4Y99C 3V2QA 2Y0EA 3TGUG 1BSHA 3SWKA 2WSEJ 3V2PA 2K1AA 1NGMB 1PPJD 1JTHB 1RF1C 1L0NK 3CC4P 1PPJG 3RK2B 1Q2NA 3EFGA 1SQBJ 3BVHA 1G2CA 1BDDA 1T3JA 1PP9E 1ZLLA 1K73Q 5KJ7D 1OXZA 5APUA 3O6QB 1W5CE 1NU1E 2HR3A 3VP9A 4DCKA 4GODA 1SQPD 4UB6E 1KILB 1SQPG 4N78E 1L4AB 1BGYJ 4LLHA 3WUVA 1Y8AA 1VF5C 3H1IE 2RMZA 3AEGC 1SQPK 4I7ZB 5K5GB 2WSCH 4PJ0H 2Q6QA 1X22A 3RK3C 4NPEA 4ZKPA 1RF1B 5CJ4A 3B4SA 1JY3O 1M1JC 3L70E 2LKMA 1ZOYC 2N9YB 2ZYDA 1SS1A 3L37A 2Q3IA 3HD7A 3H1JE 4PD4H 4M3LA 1GW4A 4AYCA 3PLNA 1MKMA 4WB4A 2C0XA 2NPSC 1PFIA 1PP9D 2HG5D 1AVYA 1JB0J 1PP9G 3TF5A 1EQ7A 4EI2A 4CPGA 5CBOA 2GUSA 1NU1D 1T6AA 2PP6A 3H32A 1NU1G 2FXOA 2J5UA 2D2CD 5GTIE 3HUSA 3HE5A 4N78D 2FKWB 2AEJA 3H1KJ 4U7JA 4OVNF 1NU1K 1RE4C 2KZIA 1JY2N 3H1ID 4WVZA 1OVUA 3AE7C 3B5NC 4R4MA 3H1IG 2YIUC 1RQUA 1QVFO 2BEQD 2HYNA 2RKLA 5CCGD 1VQLP 1H88A 4GKGA 5EFWB 1LWUC 3CCJP 3L70D 3CX5H 4LGDE 1OWAA 1JY2P 2QA4P 1EC5A 1LJ2A 4JBZA 3L70G 2Q1KA 2QE7H 2Y0DA 3RGUA 1EXIA 1IZNB 3Q2YA 2XDJA 1SFCA 2Z4EA 3HD7B 2CPBA 4OGQD 3L71E 3VN0A 2KNCB 4DJGA 2K37A 5B5EH 2YMYA 4NPFX 3TGUJ 5GTHH 1TU3F 3P8CE 2H7HA 3CCLP 2PGDA 2WT7A 3BCCD 1S72P 1E5WA 1JMBA 3L74J 2G8YA 3BCCG 3R4YA 3VMZA 3TSIA 2OYHC 5AW4B 2LXCB 3MUDA 1L4AD 3H32B 4H0LC 2E75D 1L0LJ 1RHZB 1GL2A 1USEA 5TISH 2KIKA 3HE5B 3PTZA 3CX5I 2Q5UA 1LT9A 1SQPJ 1FBMA 2WMMA 2YKQA 3IN6A 2ZYGA 3EWKA 3CPWO 1HVVA 1NTZJ 1X79B 4MN4C 3IFMA 2KYVA 4L73A 2ZVOB 1FZCC 1LTJA 3AE9C 3C1LA 4L75A 2CPSA 1HWTC 3GW6A 3LW5H 3H1HJ 5B66H 1WMKA 2WWWA 1SQBE 3L71D 1YITP 1R5LA 2QJPB 1ZV8A 1NVOA 5APQA 1XTGB 3L71G 3FWLA 1SFCB 3GHGC 4PV1C 1NH4A 3P8CD 2QJYC 1L2PA 2LR2A 1GD2E 1FC2C 2P1JA 2R32A 2N1TC 1FAVA 1PP9J 2WT7B 3CXHE 1BDCA 4H13B 2O1KA 3RL0C 5APWA 2ZFCA 1KQLA 2V7QH 3NMDA 2ZT9B 2PRRA 4BXLA 1NU1J 1VQ4P 1FDOA 1KB9E 3SWYA 1GL2B 1CW5A 3RL0g 3D6ZA 3IF4A 2P58A 3A0BE 5AW8B 4QMAA 1MFZA 3S1KA 1YJNP 5CCHC 2E74B 3V5BA 3HRNA 3CLQA 1LT9B 3S4RA 3H1IJ 3V2NA 4OWFA 3L72E 1IFJA 3GHGB 2FXPA 3MHVA 5KJ7C 3GF3A 1SQBD 1N73A 1LTJB 2PAJA 2WZ7A 4IL6E 2QJYB 1SQBG 3AEAC 3L70J 1NYHA 1AJYA 1JNMA 1LP1A 4KJMA 2J59M 3PJSK 2KZJA 3GLMA 1SQBK 1YTZT 2UWJE 3CCSP 2I1KA 3H1JJ 3BATA 1IC2A 3M0DA 4HKZH 1HBWA 4C7RA 5AW5B 5BU8B 3CXHD 1DEBA 3H6PA 3KXDA 1OMIA 2FYNB 1IK9A 2FFDA 1KB9D 1YIJP 3SFDC 2O01H 2E76D 4UB8H 1M8OB 1YBKA 3AE4C 3OA7A 4BRYA 3SFEC 1FU1A 2QM8A 2B9BA 3II6A 1BE3E 1S3JA 3NTNA 1P84H 1J1EC 3L72D 1BCCE 4AUWA 2OTJP 3JCUE 3L72G 3WMM0 1T2KC 1OW7A 2AXTE 2WPVB 1YHQP 2QJKC 4B86A 2YNYA 1KYOI 2D2CC 3K5BA 2KLVA 4WY4C 1N73B 3EFFK 2K88A 1VQ5P 2Y0CA 3G71P 1FZEA 1LP1B 2AXCA 1ZP0C 3L71J 5CCGC 3W67A 2B88A 1L0LE 1N7SC 1PGPA 1S5LH 1JO5A 1PIXA 1ZXGA 4H13D 1KILA 2K9JA 1SQVJ 5CBNA 5KAFE 4ZMDA 5M1BA 1EDIA 1KD1Q 1NOHA 5AVSB 1NTZE 1P84I 5DJUB 2AEFA 4EIJA 3CCQP 1RE3C 5AVQB 2QJKB 2FFDB 4OGQC 3AE3C 1URQC 1RF1A 2E74D 1Q86Q 3HTKA 1BCCD 3R2PA 1Q7YQ 1X8YA 4HYTB 3T97B 1J2JB 1BCCG 3U1CA 1KQGB 4GT1A 3OW2O 5AVXB 4ASVA 1MFTA 5AVRB 1GU4A 4WBAA 2WPSA 3CMEP 1N7SB 2OTLP 3VYIA 2KK7A 1IK7A 3L74D 2JKVA 4HB1A 1M57D 3L74G 2E42A 3L4FA 1ZRTE 1AA0A 3FWNA 1XTCC 1PL5A 2XV5A 1L0LD 3CWBE 1JOCA 2JP3A 4KT0J 1L0LG 2IYPA 5AVZB 3Q3DA 2MJZA 1S5LE 2WITA 1ZMEC 1M90Q 3P32A 3Q5SA 1L0LK 3A0HE 1IFDA 2K9JB
chains in the Genus database with same CATH topology
1Z56A 2XDJA 3KYQA 2WTYA 4I1LA 1SFCA 2Z4EA 3HD7B 3A7OA 2CPBA 3E1IA 3VN0A 1WT6A 4Y99B 3VMYA 2YMYA 2NPSD 1NTMK 3SWFA 2HODB 3N7NA 3TK1A 4W7ZA 1LTTC 1URQA 3G3ZA 1NTZK 3MGNA 2YKOA 3M9BA 3O8ZA 1DX7A 1CSBA 3PP5A 4EOTA 3HTKB 3P8CE 1SQQK 2POHA 3A2AA 3P8MC 1NHLA 2KP8A 2H7HA 2WT7A 1E5WA 2QM7A 1J1EB 1NKZB 1HGVA 1M7LA 2P67A 3VMZA 3BRVB 3TSIA 1GL2D 2OYIA 2OYHC 5AW4B 3MUDA 5AW1B 3VP8A 2P7JA 1L4AD 3H32B 1GL2A 5AW6B 1JMMA 4KHXA 2M8RA 3RK2C 3HE5B 4IFDK 3M9HA 1RE4A 3BRTB 3VMXA 3B5NA 4WY4B 2C9LY 2Q5UA 1LT9A 2KOGA 4DZOA 2J58A 3V2RA 1FBMA 2YKQA 2KSJA 1SVFA 1GK6A 1NTKK 1HVVA 1X79B 3IFMA 3A5TA 2KYVA 1SLQA 2WSFH 1LWUA 5KLVK 2JEEA 2HPCA 1FZCC 1LTJA 2R3CA 1VPCA 4GIFA 2WPQA 3OJAB 2N1TD 1N73C 3RK3B 2CPSA 1GW3A 1KILC 1HWTC 3EQ2A 4IFMA 3MIWA 1FZGA 3LW5H 1L4AC 4DOJA 2M3BA 2WWWA 5AVVB 1M1JB 1IFNA 2KB7P 1RY3A 4RESB 3RL0D 1FDMA 1J1DC 2XKMA 1ZR2A 1ZV8A 1LTAC 1JY3N 5APQA 4W80A 2XU6A 1XTGB 1JCDA 1MUUA 4I6MC 2IPPA 1SFCB 1YTZI 3GHGC 2R5DA 2GM4A 1NH4A 3NXSA 3P8CD 1G1IA 5CCGA 3M9QA 4O9BA 2WPRA 1X9VA 5CCHD 1URQB 4W7YA 2NPSB 1GD2E 2P1JA 1M1JA 2R32A 1HTLC 2N1TC 1FAVA 3I5CA 2WT7B 4JYBA 5APYA 5AW0B 1NKNA 2O1KA 5AW3B 1ZR4A 3RL0C 2FYUK 5APWA 2ZFCA 5AW7B 1KQLA 2FFDC 1MV8A 2OYHA 1JTHA 3MTUE 3NMDA 3TNUA 2Q9IA 3HUSC 3RK2D 1YYCA 2OYIB 3L35A 1RE3A 1DH3A 1KZUB 3B8EB 1QL2A 3SWYA 3P7KA 2NPSA 5BVZA 1GL2B 1CW5A 4C46A 1T3UA 4HH2A 3TYYA 5AW8B 1MFZA 1GTWA 1JUNA 5CCHC 1A02F 3B5NB 3V5BA 3HRNA 3CLQA 1FJPA 2JJLA 3M91A 1LT9B 3V2NA 3M0AA 3CI9A 1QL1A 1RF0A 2YO2A 1IFJA 3GHGB 1FZCA 2XNXA 1KILD 5KJ7C 5AVUB 4ZKUA 1JY2O 1LWUB 1LTSC 3C9IA 1W2EA 3A3YB 2HPCB 1N73A 1LTJB 5CJ0A 2FYZA 2PAJA 2WZ7A 2VRSA 2Z5HA 1FOSE 2IX7C 1L4AA 1H89A 1CI6A 4AQRD 3BASA 4OH8B 2R5BA 1NO4A 1JNMA 1H8AA 5APSA 2YKPA 2J59M 1SQBK 1YTZT 3LIDA 3GHGA 4JYCA 1LGHB 2I1KA 3BATA 1LTGC 3V4QA 1IC2A 5BU5A 3M0DA 2O1JA 1HBWA 2W27A 4C7RA 5AW5B 4XE5B 2XZRA 5BU8B 1DEBA 3H6PA 1T2KD 1MZ9A 2N1TA 3NFQA 1A02J 1S9KE 1HGZA 2Z5IA 1G2CB 2A45G 2IFMA 2H8PD 1IK9A 4XA4A 3HD7C 5AW2B 2E43A 2L5GB 1LTBC 1HUCA 4Y99C 3V2QA 2FFDA 5AW9B 2ZXEB 4WY4D 2O01H 3V2PA 2OARA 2OYHB 1JTHB 3TNUB 1RF1C 1L0NK 1HH0A 1FZFA 3OA7A 3KDPB 1GZLA 1FU1A 2QM8A 3RK2B 3EFGA 3II6A 2YO3A 3BVHA 3NTNA 1G2CA 1J1EC 1JY3P 1VDFA 1ZN5A 1T3JA 5CCHA 4AUWA 4IFFA 1ZLLA 1SQVK 3WMM0 1T2KC 3VOPA 1N7SD 5KJ7D 5APTA 2WSEH 1OXZA 5APUA 3U59A 5KJ7A 1IJDB 4B86A 1FZCB 3VP9A 1GK4A 2YNYA 2BASA 2KLVA 4WY4C 1N73B 2Q7CA 1KILB 1FOSF 4N78E 1L4AB 4LLHA 1CI6B 2HLOA 3CL3D 3KPEA 5CHXA 1J1DB 1FZEA 1URQD 1SQPK 3HE4A 4I2LC 2WSCH 5CCGC 5CMZA 3RK3C 1N7SC 1AQ5A 4ZKPA 1S9KD 1RF1B 1JO5A 4LC1A 5CJ4A 1JY3O 1M1JC 1KILA 1KFNA 2LKMA 3HD7D 2A45H 1N86A 5AVYB 2N1TB 3L37A 2Q3IA 3HD7A 1SFCC 1NOHA 5AVSB 2HODA 1GDTA 3UIAA 5APXA 4M3LA 3RL0B 1GW4A 4EIJA 4AYCA 1CZQA 1RE3C 5AVQB 2FFDB 4WB4A 2C0XA 1URQC 1RF1A 3B5ND 1FZBA 3HUSB 2NPSC 3HTKA 1PFIA 1WRGA 1SQXK 2HG5D 2W6BA 3R2PA 1FJKA 2I1JA 1X8YA 4HYTB 1J2JB 3U1CA 1N7LA 1EQ7A 1KFMA 4JF7A 2GUSA 3OAKA 5KTBA 4GT1A 3IR9A 3V4WA 1RF0C 5AVXB 4N6JA 2PP6A 3H32A 5AVTB 3LIEA 2H43A 1NWQA 5AVRB 2OYIC 1GU4A 1HJBA 4WBAA 2WPSA 2HFED 3HUSA 3HE5A 1GU5A 4N78D 1GL2C 2FKWB 1N7SB 1T8ZA 3L36A 3VYIA 2GUVA 2N9BA 1NU1K 4WY4A 1RE4C 1JY2N 3T97A 4C7NB 3B5NC 1G1JA 3VTPC 1IFMA 2E42A 2C0WA 3KQGA 1LT9C 5AVWB 3L4FA 1IO4A 1XTCC 2HYNA 3U1AA 2FXMA 2XV5A 5CCGD 3RK3D 3MD0A 1JOCA 1H88A 4GKGA 2A45I 2C9NY 1JCCA 1LWUC 3HE4B 1LTIC 2W6AA 3M0DC 1FZAA 1LTJC 5AVZB 4N3YB 1N7SA 4LGDE 1OWAA 2MJZA 1JY2P 3N4XA 2WITA 2P2UA 1NAFA 3M06A 1N2DC 3P32A 1IFIA 4C7NA 1L0LK 1SP4A 1SFCD 1IFDA 5APVA 2IFNA 1AFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0D A;  2R5D A;  2WTY A;  3NXS A;  1HBW A;  2W27 A;  5AW5 B;  4XE5 B;  5AVY B;  3A7O A;  3VN0 A;  2XZR A;  3L37 A;  2Q3I A;  1T2K D;  3VMY A;  3NFQ A;  3SWF A;  1A02 J;  5AVS B;  1S9K E;  2Z5I A;  2WPR A;  3TK1 A;  1G2C B;  3UIA A;  1GD2 E;  5APX A;  3MGN A;  5AW2 B;  2E43 A;  2R32 A;  3M9B A;  3O8Z A;  4M3L A;  1CSB A;  4AYC A;  1HUC A;  1CZQ A;  1FAV A;  5AVQ B;  4EOT A;  3A2A A;  3I5C A;  3P8M C;  2WT7 B;  3HTK A;  4JYB A;  5AW9 B;  2KP8 A;  2ZXE B;  5APY A;  5AW0 B;  2H7H A;  2WT7 A;  5AW3 B;  5APW A;  2ZFC A;  1X8Y A;  1KQL A;  2QM7 A;  5AW7 B;  4HYT B;  3TNU B;  1MV8 A;  3NMD A;  1J2J B;  3TNU A;  2P67 A;  3KDP B;  3VMZ A;  1GZL A;  1YYC A;  3L35 A;  1DH3 A;  3OAK A;  2QM8 A;  3B8E B;  4GT1 A;  3IR9 A;  2YO3 A;  3V4W A;  3NTN A;  5AW4 B;  3P7K A;  5AW1 B;  2P7J A;  5AVX B;  5AVT B;  4AUW A;  3LIE A;  5AW6 B;  4C46 A;  4KHX A;  1NWQ A;  5AVR B;  3TYY A;  5AW8 B;  1GU4 A;  1HJB A;  3HE5 B;  1T2K C;  1MFZ A;  3M9H A;  2WPS A;  5APT A;  1GTW A;  1JUN A;  1OXZ A;  3HE5 A;  5APU A;  1GU5 A;  1A02 F;  3V5B A;  3L36 A;  3VMX A;  2JJL A;  3M91 A;  3VYI A;  2C9L Y;  2Q5U A;  2N9B A;  3M0A A;  2YO2 A;  4DZO A;  4B86 A;  3T97 A;  1GK4 A;  2YNY A;  4C7N B;  3VTP C;  2BAS A;  1GK6 A;  5AVU B;  2E42 A;  3KQG A;  5AVW B;  3A3Y B;  2Q7C A;  3A5T A;  1IO4 A;  1SLQ A;  1FOS F;  2VRS A;  2R3C A;  2Z5H A;  2XV5 A;  1FOS E;  2WPQ A;  1CI6 B;  3MD0 A;  1H88 A;  1H89 A;  4GKG A;  2C9N Y;  1CI6 A;  4AQR D;  2R5B A;  3HE4 B;  2W6A A;  1HWT C;  1JNM A;  5AVZ B;  1H8A A;  3HE4 A;  4I2L C;  5APS A;  1OWA A;  2WWW A;  5AVV B;  4RES B;  2P2U A;  1NAF A;  5CMZ A;  3LID A;  3M06 A;  3P32 A;  4JYC A;  4C7N A;  5APQ A;  1S9K D;  1SP4 A;  2XU6 A;  4LC1 A;  1MUU A;  5APV A;  4I6M C;  2IPP A;  3V4Q A; 
#chains in the Genus database with same CATH topology
 1NTZ D;  1D7M A;  3Q1M A;  3KYQ A;  1NTZ G;  4HJG H;  3A7O A;  3SSU A;  1DEE G;  4Y99 B;  3WU2 H;  2XND H;  3JSV C;  3N7N A;  3TK1 A;  4Z1M H;  2R44 A;  3H1H D;  1NTZ K;  2YKO A;  2LXB A;  3O8Z A;  3PP5 A;  3H1H G;  3HTK B;  2POH A;  3P8M C;  1NHL A;  2OQQ A;  2QRX A;  5C39 A;  2KNC A;  3L72 J;  3QWO C;  5AW1 B;  1DIP A;  4H44 D;  2IZ0 A;  2O3J A;  4IFD K;  1RE4 A;  1ZRT D;  2QSI A;  4GDO A;  3B5N A;  3CD6 P;  3CWB D;  2C9L Y;  4DZO A;  4K35 A;  3V2R A;  1PV3 A;  1NTM J;  2KSJ A;  3CWB G;  1SVF A;  1GK6 A;  1NTK K;  1VF5 B;  3FXE A;  2WSF H;  1SLQ A;  1LWU A;  4YPC A;  2HPC A;  1OIP A;  3G4S P;  2M5A B;  2R3C A;  4IOI H;  5KKZ C;  4GIF A;  3RK3 B;  3EQ2 A;  3MIW A;  1KIL E;  2K3R A;  1M1J B;  2KB7 P;  1LNQ A;  1FDM A;  1J1D C;  2KXP B;  1ZR2 A;  2KS1 A;  1JY3 N;  3ABV C;  2QEX P;  1LT1 A;  2GA1 A;  1YTZ I;  2O01 N;  2R5D A;  3NXS A;  1USD A;  4PJ0 E;  2CK3 H;  3GMA A;  1OVV A;  2KI7 B;  2NPS B;  2RN0 A;  2BCC E;  1BE3 J;  5KAI H;  2JO1 A;  2IBZ I;  1DD4 A;  1S1C X;  3H1J D;  5KLV J;  1BCC J;  4JYB A;  5APY A;  1NKN A;  1KOR A;  3H1J G;  5AW7 B;  2OYH A;  3HUS C;  3RK2 D;  4PD4 E;  1KZU B;  1QL2 A;  3P7K A;  5BVZ A;  2E76 C;  4XFJ A;  1SQV E;  4DT0 A;  3B5N B;  1NAY A;  1VQ6 P;  1KC8 Q;  3M91 A;  2ZJS E;  2YIU B;  1QL1 A;  1RF0 A;  4D6T J;  4GOE A;  1FZC A;  1KQS O;  1NJI Q;  1KIL D;  1LWU B;  2HPC B;  1X0T A;  1W2B O;  5CJ0 A;  4JQ0 D;  2Z5H A;  2YXR B;  1H89 A;  4AQR D;  3BAS A;  1VQ7 P;  1M1K Q;  2KS1 B;  2BEZ F;  1FE6 A;  3GHG A;  1ZW0 A;  1LGH B;  1KMI Z;  3MP7 B;  1LTG C;  1OW8 A;  3V4Q A;  3B71 A;  2O01 J;  2BCC D;  3CX5 E;  2BCC G;  2N1T A;  1A02 J;  1HGZ A;  2IFM A;  2NRG A;  3AE2 C;  4PD4 D;  1HUC A;  2ZXX A;  1VQO P;  4NPD A;  1EZV I;  1SQX E;  5AW9 B;  4IL6 X;  5B5E E;  2OYH B;  1SQV D;  2I8D A;  5TJH A;  4TT3 H;  4H0L B;  2W90 A;  5GTH E;  3F89 A;  1GZL A;  1SQV G;  2YO3 A;  1NTK J;  5CCH A;  1N8R Q;  1SQV K;  3CXH I;  4YXD C;  3CWB J;  2AEM A;  3U59 A;  5KJ7 A;  1IJD B;  1FZC B;  4L74 A;  5TIS E;  1KB9 I;  2Q7C A;  3CCV P;  5DJT B;  3RBZ A;  2H89 C;  2HLO A;  5CHX A;  3WUU A;  3HE4 A;  4I2L C;  3CCM P;  1VQK P;  3CX5 D;  1YJW P;  4PV1 B;  4YXW H;  1AQ5 A;  1AVO A;  1R8E A;  2JWA A;  2B89 A;  1KFN A;  2OYO A;  3CCR P;  3HD7 D;  5B66 E;  2A45 H;  1N86 A;  5AVY B;  2N1T B;  1NTM E;  2HOD A;  1GDT A;  2IYO A;  3RL0 B;  1KYO H;  1CZQ A;  3KZI H;  5E79 H;  1PGO A;  3B5N D;  1K04 A;  3D6Y A;  1SQX K;  2W6B A;  1KFM A;  3OAK A;  5KTB A;  3V4W A;  3FX0 A;  2KUB A;  3LIE A;  1NWQ A;  2OYI C;  2KLU A;  1GU5 A;  1OX3 A;  3L36 A;  2N9B A;  4WY4 A;  4H44 C;  2YXQ B;  2JR8 A;  3T97 A;  4C7N B;  3VTP C;  2OGU A;  5KLV E;  2ZAE B;  3PHL A;  2FXM A;  3MD0 A;  2Y9Y A;  2C9N Y;  2A45 I;  5KLI C;  3HE4 B;  1LTI C;  3M0D C;  1FZA A;  3V6I A;  1N7S A;  2WSC J;  2P2U A;  1NAF A;  3M06 A;  2WQY C;  1NTM D;  1IFI A;  2M3E A;  1SFC D;  1NTM G;  2BCC J;  1Z56 A;  2WTY A;  4I1L A;  4H0L D;  3IAO A;  3FXD A;  1KTM A;  3CMA P;  1AV1 A;  3E1I A;  4D6T E;  3I55 P;  1NTM K;  2WSS H;  2HOD B;  4EYY Q;  1GMJ A;  1KYO E;  5E79 E;  1URQ A;  3M9B A;  2W8Z A;  4EOT A;  3PH0 A;  1UII A;  2FYU E;  3AEB C;  2QM7 A;  2ZT9 D;  1J1E B;  1NKZ B;  1OW6 A;  2P67 A;  3E7K A;  2H88 C;  3PRJ A;  1S5L X;  1GL2 D;  2WSF J;  1S2E A;  5AW6 B;  4UB6 H;  1FS0 E;  4KHX A;  4UB8 E;  1BE3 D;  3RK2 C;  5KLV D;  2D2C B;  1BE3 G;  3VMX A;  4WY4 B;  5KLV G;  2J58 A;  1P84 E;  2WVR A;  2B87 B;  1IFP A;  5KLV K;  1VPC A;  3L73 E;  3OJA B;  2N1T D;  1K05 A;  1KIL C;  3D70 A;  1BSN A;  1L4A C;  2E75 C;  4A7P A;  3RL0 D;  5L8R J;  3USS A;  4GOF A;  4D6T D;  1NTK E;  4I7Z C;  1KYO D;  3L75 J;  4I6M C;  2IPP A;  2QIW A;  2JDI H;  4D6T G;  3E1R A;  2GM4 A;  2W83 C;  2M5A A;  1SQX J;  1G1I A;  1K9M Q;  3AE6 C;  4Y28 J;  1YJ9 P;  4OGQ B;  2FYU D;  3TDK A;  5CCH D;  1URQ B;  4W7Y A;  2FYU G;  1M1J A;  3MZW B;  1Q90 D;  3I5C A;  3FGA D;  5AW0 B;  4R4L A;  4YTP C;  2FYU K;  1MV8 A;  5GTI H;  3TNU A;  2Q9I A;  3H1L E;  1YYC A;  3L35 A;  1DH3 A;  2DW3 A;  2NPS A;  1P84 D;  1T3U A;  2E75 B;  1R5S A;  4HH2 A;  3TYY A;  1GTW A;  1A02 F;  2OTK E;  3AE5 C;  2JJL A;  2QVA A;  3M0A A;  3L73 D;  3KHU A;  1QVG O;  3L73 G;  2XNX A;  4ZKU A;  1JY2 O;  1LTS C;  1DD3 A;  1W2E A;  3A3Y B;  4K3A A;  1OZH A;  1FOS E;  1NTK D;  3F5H A;  1CI6 A;  1NTK G;  3LW5 J;  5APS A;  4U3F E;  3LID A;  3W68 A;  1VQ8 P;  3AEE C;  1FDI A;  2O1J A;  1QX8 A;  2XZR A;  1T2K D;  1S9K E;  1G2C B;  2A06 E;  4XA4 A;  1PGQ A;  3HD7 C;  5AW2 B;  2E43 A;  3CC7 P;  3H1L D;  1Y9B A;  1LTB C;  2JWD A;  3BCC E;  2ZVN B;  3H1L G;  2ZXE B;  4WY4 D;  2OAR A;  3WU2 E;  3AEC C;  1EXJ A;  3TNU B;  2V7Q J;  1HH0 A;  1FZF A;  3KDP B;  1JY3 P;  1VDF A;  1ZN5 A;  4IFF A;  1U57 A;  1VQ9 P;  2ITA A;  3VOP A;  1N7S D;  5APT A;  2WSE H;  4PD4 I;  1GK4 A;  5KKZ B;  2BAS A;  2IBZ E;  1FOS F;  4RKU J;  1PZQ A;  4U3F D;  1QGK B;  1CI6 B;  3CL3 D;  3KPE A;  4U3F G;  4JPZ B;  1J1D B;  1URQ D;  1L0N J;  2YMK A;  5CMZ A;  2G3A A;  3RK3 E;  3GG2 A;  1S9K D;  4LC1 A;  2A06 D;  2QJP C;  2A06 G;  3CXH H;  2FYU J;  3CCE P;  1AQT A;  1YQ4 C;  4L76 A;  1SFC C;  2W6J H;  4ASW A;  1KV4 A;  3ITK A;  1S4X A;  3UIA A;  5APX A;  2P10 A;  1VQM P;  1KB9 H;  1SQQ E;  3HUS B;  1FZB A;  1WRG A;  1JEK A;  3A0B H;  1FJK A;  2I1J A;  2E76 B;  3CC2 P;  2E5T A;  1N7L A;  1U7J A;  4H13 C;  4JF7 A;  3IR9 A;  1RF0 C;  5KAI E;  3L75 E;  4N6J A;  2ZT9 C;  5AVT B;  3RBX A;  2H43 A;  1HJB A;  3MUD C;  2IBZ D;  2HFE D;  1EDK A;  2M0B A;  4IL6 H;  1GL2 C;  1T8Z A;  3L73 J;  4WWI A;  2IBZ G;  2GUV A;  1VL2 A;  1H0T A;  1VF5 D;  2E74 C;  1G1J A;  1IFM A;  2C0W A;  3KQG A;  1LT9 C;  4RO0 A;  5AVW B;  1IO4 A;  1EZV E;  3U1A A;  3RK3 D;  1JCC A;  2V4H A;  2W6A A;  1LTJ C;  4N3Y B;  3VMA A;  3N4X A;  3G9R A;  2K9Y A;  1VQP P;  1N2D C;  4C7N A;  1SP4 A;  1BGY E;  3G6E P;  5APV A;  2IFN A;  1AFO A;  1SQQ D;  2R3S A;  2NZ2 A;  1WT6 A;  3VMY A;  3SWF A;  2NPS D;  1SQQ G;  4W7Z A;  3AE8 C;  1LTT C;  1JM0 A;  1RQV A;  3H1L J;  3G3Z A;  3MGN A;  1DX7 A;  1CSB A;  2RH0 A;  1SQQ K;  3A2A A;  1YQ3 C;  2FYN C;  2KP8 A;  3Q5R A;  3L75 D;  1Q81 Q;  3D71 A;  3JCU H;  2FY8 A;  3L75 G;  3H25 A;  1HGV A;  2PFX A;  1M7L A;  1SQX D;  1K8A Q;  2AXT H;  3BRV B;  1SQX G;  2OYI A;  1KN7 A;  3VP8 A;  2P7J A;  4RJT A;  1EDL A;  3I56 P;  1JMM A;  2M8R A;  3M9H A;  1EZV D;  2Y9Z A;  3BRT B;  1M56 D;  1H0T B;  1EZV G;  2KOG A;  4EDF A;  2ZYA A;  1VQN P;  4U3F J;  3A5T A;  3JC2 2;  2JEE A;  1HJ0 A;  3WUT A;  2WPQ A;  3H1K E;  1BGY D;  1N73 C;  1GW3 A;  4IFM A;  1FZG A;  1BGY G;  5KAF H;  2E5Y A;  4DOJ A;  2L91 A;  2M3B A;  5AVV B;  1IFN A;  4RES B;  1RY3 A;  2XKM A;  2IDB A;  1LTA C;  4W80 A;  2XU6 A;  1JCD A;  1MUU A;  2B87 A;  5H2F H;  3BCC J;  1KQF B;  2SPZ A;  5CCG A;  1UIX A;  3M9Q A;  4O9B A;  4TLF A;  2WPR A;  1X9V A;  3AEF C;  1HTL C;  1RH5 B;  4BWN A;  2FBW C;  2QG4 A;  5AW3 B;  1ZR4 A;  1L0N E;  3S9O A;  3C8V A;  2FFD C;  3TGU E;  1JTH A;  3MTU E;  1Y47 A;  2OYI B;  1RE3 A;  3B8E B;  3KZI E;  4C46 A;  1PPJ E;  4H44 B;  3L74 E;  1JUN A;  3AED C;  1FJP A;  1EDJ A;  3O6Q A;  1PGJ A;  3CI9 A;  3H1K D;  2YO2 A;  4ZNC A;  1QEX A;  3H1K G;  1OVR A;  5AVU B;  1QLE D;  3C9I A;  5KLI B;  1YI2 P;  2IZ1 A;  2FYZ A;  1Q82 Q;  2VRS A;  2IX7 C;  1L4A A;  3A0H H;  1U7M A;  2KSE A;  1OFC X;  4OH8 B;  2R5B A;  1NO4 A;  3CCU P;  1SQP E;  1H8A A;  3AE1 C;  2YKP A;  1E79 H;  4PV1 D;  2Q3E A;  5H2F E;  4JYC A;  3Q5P A;  5BU5 A;  3GF7 A;  1SQQ J;  2W27 A;  3H1H E;  4XE5 B;  4BRY B;  1MZ9 A;  3NFQ A;  3QH9 A;  2Z5I A;  1HF9 A;  2A45 G;  1L0N D;  2H8P D;  2MKV A;  3TGU D;  3ZDM A;  2L5G B;  1L0N G;  4Y99 C;  3V2Q A;  2Y0E A;  3TGU G;  1BSH A;  3SWK A;  2WSE J;  3V2P A;  2K1A A;  1NGM B;  1PPJ D;  1JTH B;  1RF1 C;  1L0N K;  3CC4 P;  1PPJ G;  3RK2 B;  1Q2N A;  3EFG A;  1SQB J;  3BVH A;  1G2C A;  1BDD A;  1T3J A;  1PP9 E;  1ZLL A;  1K73 Q;  5KJ7 D;  1OXZ A;  5APU A;  3O6Q B;  1W5C E;  1NU1 E;  2HR3 A;  3VP9 A;  4DCK A;  4GOD A;  1SQP D;  4UB6 E;  1KIL B;  1SQP G;  4N78 E;  1L4A B;  1BGY J;  4LLH A;  3WUV A;  1Y8A A;  1VF5 C;  3H1I E;  2RMZ A;  3AEG C;  1SQP K;  4I7Z B;  5K5G B;  2WSC H;  4PJ0 H;  2Q6Q A;  1X22 A;  3RK3 C;  4NPE A;  4ZKP A;  1RF1 B;  5CJ4 A;  3B4S A;  1JY3 O;  1M1J C;  3L70 E;  2LKM A;  1ZOY C;  2N9Y B;  2ZYD A;  1SS1 A;  3L37 A;  2Q3I A;  3HD7 A;  3H1J E;  4PD4 H;  4M3L A;  1GW4 A;  4AYC A;  3PLN A;  1MKM A;  4WB4 A;  2C0X A;  2NPS C;  1PFI A;  1PP9 D;  2HG5 D;  1AVY A;  1JB0 J;  1PP9 G;  3TF5 A;  1EQ7 A;  4EI2 A;  4CPG A;  5CBO A;  2GUS A;  1NU1 D;  1T6A A;  2PP6 A;  3H32 A;  1NU1 G;  2FXO A;  2J5U A;  2D2C D;  5GTI E;  3HUS A;  3HE5 A;  4N78 D;  2FKW B;  2AEJ A;  3H1K J;  4U7J A;  4OVN F;  1NU1 K;  1RE4 C;  2KZI A;  1JY2 N;  3H1I D;  4WVZ A;  1OVU A;  3AE7 C;  3B5N C;  4R4M A;  3H1I G;  2YIU C;  1RQU A;  1QVF O;  2BEQ D;  2HYN A;  2RKL A;  5CCG D;  1VQL P;  1H88 A;  4GKG A;  5EFW B;  1LWU C;  3CCJ P;  3L70 D;  3CX5 H;  4LGD E;  1OWA A;  1JY2 P;  2QA4 P;  1EC5 A;  1LJ2 A;  4JBZ A;  3L70 G;  2Q1K A;  2QE7 H;  2Y0D A;  3RGU A;  1EXI A;  1IZN B;  3Q2Y A;  2XDJ A;  1SFC A;  2Z4E A;  3HD7 B;  2CPB A;  4OGQ D;  3L71 E;  3VN0 A;  2KNC B;  4DJG A;  2K37 A;  5B5E H;  2YMY A;  4NPF X;  3TGU J;  5GTH H;  1TU3 F;  3P8C E;  2H7H A;  3CCL P;  2PGD A;  2WT7 A;  3BCC D;  1S72 P;  1E5W A;  1JMB A;  3L74 J;  2G8Y A;  3BCC G;  3R4Y A;  3VMZ A;  3TSI A;  2OYH C;  5AW4 B;  2LXC B;  3MUD A;  1L4A D;  3H32 B;  4H0L C;  2E75 D;  1L0L J;  1RHZ B;  1GL2 A;  1USE A;  5TIS H;  2KIK A;  3HE5 B;  3PTZ A;  3CX5 I;  2Q5U A;  1LT9 A;  1SQP J;  1FBM A;  2WMM A;  2YKQ A;  3IN6 A;  2ZYG A;  3EWK A;  3CPW O;  1HVV A;  1NTZ J;  1X79 B;  4MN4 C;  3IFM A;  2KYV A;  4L73 A;  2ZVO B;  1FZC C;  1LTJ A;  3AE9 C;  3C1L A;  4L75 A;  2CPS A;  1HWT C;  3GW6 A;  3LW5 H;  3H1H J;  5B66 H;  1WMK A;  2WWW A;  1SQB E;  3L71 D;  1YIT P;  1R5L A;  2QJP B;  1ZV8 A;  1NVO A;  5APQ A;  1XTG B;  3L71 G;  3FWL A;  1SFC B;  3GHG C;  4PV1 C;  1NH4 A;  3P8C D;  2QJY C;  1L2P A;  2LR2 A;  1GD2 E;  1FC2 C;  2P1J A;  2R32 A;  2N1T C;  1FAV A;  1PP9 J;  2WT7 B;  3CXH E;  1BDC A;  4H13 B;  2O1K A;  3RL0 C;  5APW A;  2ZFC A;  1KQL A;  2V7Q H;  3NMD A;  2ZT9 B;  2PRR A;  4BXL A;  1NU1 J;  1VQ4 P;  1FDO A;  1KB9 E;  3SWY A;  1GL2 B;  1CW5 A;  3RL0 g;  3D6Z A;  3IF4 A;  2P58 A;  3A0B E;  5AW8 B;  4QMA A;  1MFZ A;  3S1K A;  1YJN P;  5CCH C;  2E74 B;  3V5B A;  3HRN A;  3CLQ A;  1LT9 B;  3S4R A;  3H1I J;  3V2N A;  4OWF A;  3L72 E;  1IFJ A;  3GHG B;  2FXP A;  3MHV A;  5KJ7 C;  3GF3 A;  1SQB D;  1N73 A;  1LTJ B;  2PAJ A;  2WZ7 A;  4IL6 E;  2QJY B;  1SQB G;  3AEA C;  3L70 J;  1NYH A;  1AJY A;  1JNM A;  1LP1 A;  4KJM A;  2J59 M;  3PJS K;  2KZJ A;  3GLM A;  1SQB K;  1YTZ T;  2UWJ E;  3CCS P;  2I1K A;  3H1J J;  3BAT A;  1IC2 A;  3M0D A;  4HKZ H;  1HBW A;  4C7R A;  5AW5 B;  5BU8 B;  3CXH D;  1DEB A;  3H6P A;  3KXD A;  1OMI A;  2FYN B;  1IK9 A;  2FFD A;  1KB9 D;  1YIJ P;  3SFD C;  2O01 H;  2E76 D;  4UB8 H;  1M8O B;  1YBK A;  3AE4 C;  3OA7 A;  4BRY A;  3SFE C;  1FU1 A;  2QM8 A;  2B9B A;  3II6 A;  1BE3 E;  1S3J A;  3NTN A;  1P84 H;  1J1E C;  3L72 D;  1BCC E;  4AUW A;  2OTJ P;  3JCU E;  3L72 G;  3WMM 0;  1T2K C;  1OW7 A;  2AXT E;  2WPV B;  1YHQ P;  2QJK C;  4B86 A;  2YNY A;  1KYO I;  2D2C C;  3K5B A;  2KLV A;  4WY4 C;  1N73 B;  3EFF K;  2K88 A;  1VQ5 P;  2Y0C A;  3G71 P;  1FZE A;  1LP1 B;  2AXC A;  1ZP0 C;  3L71 J;  5CCG C;  3W67 A;  2B88 A;  1L0L E;  1N7S C;  1PGP A;  1S5L H;  1JO5 A;  1PIX A;  1ZXG A;  4H13 D;  1KIL A;  2K9J A;  1SQV J;  5CBN A;  5KAF E;  4ZMD A;  5M1B A;  1EDI A;  1KD1 Q;  1NOH A;  5AVS B;  1NTZ E;  1P84 I;  5DJU B;  2AEF A;  4EIJ A;  3CCQ P;  1RE3 C;  5AVQ B;  2QJK B;  2FFD B;  4OGQ C;  3AE3 C;  1URQ C;  1RF1 A;  2E74 D;  1Q86 Q;  3HTK A;  1BCC D;  3R2P A;  1Q7Y Q;  1X8Y A;  4HYT B;  3T97 B;  1J2J B;  1BCC G;  3U1C A;  1KQG B;  4GT1 A;  3OW2 O;  5AVX B;  4ASV A;  1MFT A;  5AVR B;  1GU4 A;  4WBA A;  2WPS A;  3CME P;  1N7S B;  2OTL P;  3VYI A;  2KK7 A;  1IK7 A;  3L74 D;  2JKV A;  4HB1 A;  1M57 D;  3L74 G;  2E42 A;  3L4F A;  1ZRT E;  1AA0 A;  3FWN A;  1XTC C;  1PL5 A;  2XV5 A;  1L0L D;  3CWB E;  1JOC A;  2JP3 A;  4KT0 J;  1L0L G;  2IYP A;  5AVZ B;  3Q3D A;  2MJZ A;  1S5L E;  2WIT A;  1ZME C;  1M90 Q;  3P32 A;  3Q5S A;  1L0L K;  3A0H E;  1IFD A;  2K9J B; 
#chains in the Genus database with same CATH homology
 1Z56 A;  2XDJ A;  3KYQ A;  2WTY A;  4I1L A;  1SFC A;  2Z4E A;  3HD7 B;  3A7O A;  2CPB A;  3E1I A;  3VN0 A;  1WT6 A;  4Y99 B;  3VMY A;  2YMY A;  2NPS D;  1NTM K;  3SWF A;  2HOD B;  3N7N A;  3TK1 A;  4W7Z A;  1LTT C;  1URQ A;  3G3Z A;  1NTZ K;  3MGN A;  2YKO A;  3M9B A;  3O8Z A;  1DX7 A;  1CSB A;  3PP5 A;  4EOT A;  3HTK B;  3P8C E;  1SQQ K;  2POH A;  3A2A A;  3P8M C;  1NHL A;  2KP8 A;  2H7H A;  2WT7 A;  1E5W A;  2QM7 A;  1J1E B;  1NKZ B;  1HGV A;  1M7L A;  2P67 A;  3VMZ A;  3BRV B;  3TSI A;  1GL2 D;  2OYI A;  2OYH C;  5AW4 B;  3MUD A;  5AW1 B;  3VP8 A;  2P7J A;  1L4A D;  3H32 B;  1GL2 A;  5AW6 B;  1JMM A;  4KHX A;  2M8R A;  3RK2 C;  3HE5 B;  4IFD K;  3M9H A;  1RE4 A;  3BRT B;  3VMX A;  3B5N A;  4WY4 B;  2C9L Y;  2Q5U A;  1LT9 A;  2KOG A;  4DZO A;  2J58 A;  3V2R A;  1FBM A;  2YKQ A;  2KSJ A;  1SVF A;  1GK6 A;  1NTK K;  1HVV A;  1X79 B;  3IFM A;  3A5T A;  2KYV A;  1SLQ A;  2WSF H;  1LWU A;  5KLV K;  2JEE A;  2HPC A;  1FZC C;  1LTJ A;  2R3C A;  1VPC A;  4GIF A;  2WPQ A;  3OJA B;  2N1T D;  1N73 C;  3RK3 B;  2CPS A;  1GW3 A;  1KIL C;  1HWT C;  3EQ2 A;  4IFM A;  3MIW A;  1FZG A;  3LW5 H;  1L4A C;  4DOJ A;  2M3B A;  2WWW A;  5AVV B;  1M1J B;  1IFN A;  2KB7 P;  1RY3 A;  4RES B;  3RL0 D;  1FDM A;  1J1D C;  2XKM A;  1ZR2 A;  1ZV8 A;  1LTA C;  1JY3 N;  5APQ A;  4W80 A;  2XU6 A;  1XTG B;  1JCD A;  1MUU A;  4I6M C;  2IPP A;  1SFC B;  1YTZ I;  3GHG C;  2R5D A;  2GM4 A;  1NH4 A;  3NXS A;  3P8C D;  1G1I A;  5CCG A;  3M9Q A;  4O9B A;  2WPR A;  1X9V A;  5CCH D;  1URQ B;  4W7Y A;  2NPS B;  1GD2 E;  2P1J A;  1M1J A;  2R32 A;  1HTL C;  2N1T C;  1FAV A;  3I5C A;  2WT7 B;  4JYB A;  5APY A;  5AW0 B;  1NKN A;  2O1K A;  5AW3 B;  1ZR4 A;  3RL0 C;  2FYU K;  5APW A;  2ZFC A;  5AW7 B;  1KQL A;  2FFD C;  1MV8 A;  2OYH A;  1JTH A;  3MTU E;  3NMD A;  3TNU A;  2Q9I A;  3HUS C;  3RK2 D;  1YYC A;  2OYI B;  3L35 A;  1RE3 A;  1DH3 A;  1KZU B;  3B8E B;  1QL2 A;  3SWY A;  3P7K A;  2NPS A;  5BVZ A;  1GL2 B;  1CW5 A;  4C46 A;  1T3U A;  4HH2 A;  3TYY A;  5AW8 B;  1MFZ A;  1GTW A;  1JUN A;  5CCH C;  1A02 F;  3B5N B;  3V5B A;  3HRN A;  3CLQ A;  1FJP A;  2JJL A;  3M91 A;  1LT9 B;  3V2N A;  3M0A A;  3CI9 A;  1QL1 A;  1RF0 A;  2YO2 A;  1IFJ A;  3GHG B;  1FZC A;  2XNX A;  1KIL D;  5KJ7 C;  5AVU B;  4ZKU A;  1JY2 O;  1LWU B;  1LTS C;  3C9I A;  1W2E A;  3A3Y B;  2HPC B;  1N73 A;  1LTJ B;  5CJ0 A;  2FYZ A;  2PAJ A;  2WZ7 A;  2VRS A;  2Z5H A;  1FOS E;  2IX7 C;  1L4A A;  1H89 A;  1CI6 A;  4AQR D;  3BAS A;  4OH8 B;  2R5B A;  1NO4 A;  1JNM A;  1H8A A;  5APS A;  2YKP A;  2J59 M;  1SQB K;  1YTZ T;  3LID A;  3GHG A;  4JYC A;  1LGH B;  2I1K A;  3BAT A;  1LTG C;  3V4Q A;  1IC2 A;  5BU5 A;  3M0D A;  2O1J A;  1HBW A;  2W27 A;  4C7R A;  5AW5 B;  4XE5 B;  2XZR A;  5BU8 B;  1DEB A;  3H6P A;  1T2K D;  1MZ9 A;  2N1T A;  3NFQ A;  1A02 J;  1S9K E;  1HGZ A;  2Z5I A;  1G2C B;  2A45 G;  2IFM A;  2H8P D;  1IK9 A;  4XA4 A;  3HD7 C;  5AW2 B;  2E43 A;  2L5G B;  1LTB C;  1HUC A;  4Y99 C;  3V2Q A;  2FFD A;  5AW9 B;  2ZXE B;  4WY4 D;  2O01 H;  3V2P A;  2OAR A;  2OYH B;  1JTH B;  3TNU B;  1RF1 C;  1L0N K;  1HH0 A;  1FZF A;  3OA7 A;  3KDP B;  1GZL A;  1FU1 A;  2QM8 A;  3RK2 B;  3EFG A;  3II6 A;  2YO3 A;  3BVH A;  3NTN A;  1G2C A;  1J1E C;  1JY3 P;  1VDF A;  1ZN5 A;  1T3J A;  5CCH A;  4AUW A;  4IFF A;  1ZLL A;  1SQV K;  3WMM 0;  1T2K C;  3VOP A;  1N7S D;  5KJ7 D;  5APT A;  2WSE H;  1OXZ A;  5APU A;  3U59 A;  5KJ7 A;  1IJD B;  4B86 A;  1FZC B;  3VP9 A;  1GK4 A;  2YNY A;  2BAS A;  2KLV A;  4WY4 C;  1N73 B;  2Q7C A;  1KIL B;  1FOS F;  4N78 E;  1L4A B;  4LLH A;  1CI6 B;  2HLO A;  3CL3 D;  3KPE A;  5CHX A;  1J1D B;  1FZE A;  1URQ D;  1SQP K;  3HE4 A;  4I2L C;  2WSC H;  5CCG C;  5CMZ A;  3RK3 C;  1N7S C;  1AQ5 A;  4ZKP A;  1S9K D;  1RF1 B;  1JO5 A;  4LC1 A;  5CJ4 A;  1JY3 O;  1M1J C;  1KIL A;  1KFN A;  2LKM A;  3HD7 D;  2A45 H;  1N86 A;  5AVY B;  2N1T B;  3L37 A;  2Q3I A;  3HD7 A;  1SFC C;  1NOH A;  5AVS B;  2HOD A;  1GDT A;  3UIA A;  5APX A;  4M3L A;  3RL0 B;  1GW4 A;  4EIJ A;  4AYC A;  1CZQ A;  1RE3 C;  5AVQ B;  2FFD B;  4WB4 A;  2C0X A;  1URQ C;  1RF1 A;  3B5N D;  1FZB A;  3HUS B;  2NPS C;  3HTK A;  1PFI A;  1WRG A;  1SQX K;  2HG5 D;  2W6B A;  3R2P A;  1FJK A;  2I1J A;  1X8Y A;  4HYT B;  1J2J B;  3U1C A;  1N7L A;  1EQ7 A;  1KFM A;  4JF7 A;  2GUS A;  3OAK A;  5KTB A;  4GT1 A;  3IR9 A;  3V4W A;  1RF0 C;  5AVX B;  4N6J A;  2PP6 A;  3H32 A;  5AVT B;  3LIE A;  2H43 A;  1NWQ A;  5AVR B;  2OYI C;  1GU4 A;  1HJB A;  4WBA A;  2WPS A;  2HFE D;  3HUS A;  3HE5 A;  1GU5 A;  4N78 D;  1GL2 C;  2FKW B;  1N7S B;  1T8Z A;  3L36 A;  3VYI A;  2GUV A;  2N9B A;  1NU1 K;  4WY4 A;  1RE4 C;  1JY2 N;  3T97 A;  4C7N B;  3B5N C;  1G1J A;  3VTP C;  1IFM A;  2E42 A;  2C0W A;  3KQG A;  1LT9 C;  5AVW B;  3L4F A;  1IO4 A;  1XTC C;  2HYN A;  3U1A A;  2FXM A;  2XV5 A;  5CCG D;  3RK3 D;  3MD0 A;  1JOC A;  1H88 A;  4GKG A;  2A45 I;  2C9N Y;  1JCC A;  1LWU C;  3HE4 B;  1LTI C;  2W6A A;  3M0D C;  1FZA A;  1LTJ C;  5AVZ B;  4N3Y B;  1N7S A;  4LGD E;  1OWA A;  2MJZ A;  1JY2 P;  3N4X A;  2WIT A;  2P2U A;  1NAF A;  3M06 A;  1N2D C;  3P32 A;  1IFI A;  4C7N A;  1L0L K;  1SP4 A;  1SFC D;  1IFD A;  5APV A;  2IFN A;  1AFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...