3HE4B

Heterospecific coiled-coil pair synzip5:synzip6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
44
structure length
44
Chain Sequence
NTVKELKNYIQELEERNAELKNLKEHLKFAKAELEFELAAHKFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A synthetic coiled-coil interactome provides heterospecific modules for molecular engineering.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords SYNZIP6
total genus 19
structure length 44
sequence length 44
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3he4B00
3TNUA 4C7NA 3A5TA 5AVUB 1IO4A 2Z5IA 5AVSB 5AVTB 3L35A 4XE5B 1A02J 2QM8A 1KQLA 1H88A 4JYCA 2Z5HA 1H89A 1FAVA 2R32A 2W6AA 2R3CA 2W27A 5AVYB 5AW6B 3SWFA 2WT7A 1GD2E 3VMYA 5AVVB 3VN0A 2P67A 4HYTB 3V4QA 1JUNA 2ZFCA 3M06A 4C7NB 2N9BA 5APWA 2WPRA 1GZLA 5AW4B 3A7OA 5AW5B 5APUA 5AW3B 1NWQA 4I6MC 3L37A 5AVWB 5AVXB 3L36A 3VMXA 1T2KC 3MD0A 2Q7CA 1SP4A 1H8AA 1GTWA 2E42A 2XU6A 1GU5A 5AW9B 3HE4B 5AVQB 3VYIA 3V4WA 2WPSA 3LIDA 2WPQA 4AQRD 1CI6B 5APVA 2ZXEB 2YNYA 2C9LY 2YO3A 4AUWA 3O8ZA 2BASA 3VMZA 2QM7A 2E43A 2R5BA 1YYCA 3P32A 1NAFA 3NFQA 5APQA 4AYCA 4GT1A 3TK1A 2P7JA 4KHXA 4GKGA 1FOSF 4DZOA 2WWWA 3M9HA 1GK4A 4EOTA 3IR9A 1SLQA 3B8EB 5CMZA 5AW2B 1S9KE 3NTNA 3A3YB 3T97A 3HE5A 2R5DA 1HBWA 1HJBA 2H7HA 1J2JB 3NXSA 1S9KD 5APYA 3LIEA 2KP8A 1A02F 3OAKA 5AW1B 3V5BA 5AW8B 1OXZA 1FOSE 4RESB 1T2KD 2P2UA 3NMDA 2WTYA 3I5CA 1OWAA 2YO2A 3M0AA 4LC1A 1MUUA 1HUCA 2JJLA 3M91A 1JNMA 1HWTC 3TYYA 5APSA 3MGNA 1MV8A 2VRSA 3HE4A 2XV5A 1G2CB 3UIAA 1GU4A 5APTA 2C9NY 2IPPA 3HTKA 1X8YA 3HE5B 2WT7B 4I2LC 1CZQA 3M0DA 3P7KA 5APXA 4B86A 5AW0B 4C46A 2XZRA 4M3LA 3TNUB 3VTPC 2Q3IA 1DH3A 3KQGA 3M9BA 3P8MC 5AVRB 4JYBA 3A2AA 5AVZB 2Q5UA 1CSBA 1CI6A 1GK6A 5AW7B 1MFZA 3KDPB
chains in the Genus database with same CATH superfamily
4N78D 5CCHA 1BCCJ 1NTKG 1SFCC 4IL6H 4LGDE 5KAIE 1NO4A 2WZ7A 2ZJSE 3L70G 3U59A 1VQKP 1KILE 1EXIA 3JCUH 2J59M 1LJ2A 5AVTB 1QVFO 5KLVE 3A0HH 1AJYA 1JY2O 1G1JA 1FC2C 1HJ0A 1NTZG 3Q3DA 1K8AQ 1HVVA 1JB0J 2QM8A 1KQLA 2Y0EA 4JYCA 1PGPA 5KLIB 1X22A 1LT9C 2W6AA 1LTGC 2YIUB 4RKUJ 2WT7A 2BEQD 1PL5A 5KTBA 3Q2YA 1BSHA 3IF4A 2KI7B 3BCCD 1SQPG 3CMAP 4MN4C 1RF1C 3WMM0 1SQQG 2A06E 3H1LJ 3V4QA 3ITKA 1L0LK 2GM4A 3CC7P 1JUNA 2ZFCA 3M06A 3RL0C 5CCHC 4HB1A 4OVNF 1HTLC 4XFJA 1URQA 3D6YA 1JY2P 1L2PA 2B89A 3TSIA 1H0TA 3Q1MA 3L72J 1AQTA 1XTCC 3G3ZA 3H1LD 1P84D 2A45I 4LLHA 1KB9D 2FYUK 2KLVA 1M8OB 2ZT9D 1VQPP 1NJIQ 1KYOE 1QLED 3CXHD 5AVWB 1EDJA 5AVXB 1LP1A 3L36A 3VMXA 4PJ0E 1KYOH 2E74C 4NPFX 1BGYJ 3CWBD 2OYHB 2QJKB 3M0DC 3TGUE 2XU6A 3H1IJ 5AVQB 2WSCH 1SVFA 2OTKE 2WPSA 3OJAB 3L72E 3CC2P 1ZN5A 2KUBA 4RO0A 5CCGA 3HUSA 3L73G 4AQRD 1SQXD 2IBZG 3MUDA 3VP8A 2ITAA 5APVA 1QVGO 3H1HD 2FFDC 1N7SC 2C9LY 3H1ID 1L0NK 1SQXK 2YO3A 2ZT9C 5EFWB 1BE3J 2BASA 1GL2D 3H1JJ 3JSVC 4OGQB 4OH8B 1NU1J 3VMZA 2I1JA 2Y9YA 1IFJA 1JO5A 2LXCB 2XDJA 2FY8A 2IYOA 1RF1B 5E79E 1URQB 1YYCA 1HGVA 1T8ZA 2K3RA 3CWBG 4W7ZA 3TGUG 1IK9A 3H1JD 5KJ7C 1ZW0A 1NU1D 4AYCA 2BCCG 2FXOA 2WSFH 3TK1A 2ZXXA 4OWFA 2NPSB 3L73E 2NPSC 3BRVB 1J1EB 4DZOA 4PV1B 4JF7A 4EOTA 1L4AD 1RF0A 5KLVJ 1ZLLA 3F5HA 5AW2B 1N7SD 3B8EB 3VP9A 2K9JA 3NTNA 1FZCC 4ZNCA 3WUUA 1JCCA 2UWJE 1SQXG 2R44A 1N7SA 1HBWA 2M3EA 1RF0C 4JQ0D 1T2KC 2B87B 1EDLA 3CWBE 1S9KD 1PP9G 4TLFA 1NAYA 5CJ0A 2MKVA 1S5LH 4RJTA 2O01J 1JY3N 1KB9H 1WMKA 1S3JA 5KJ7D 5AW1B 3V5BA 2K1AA 3PLNA 1KB9E 2QJPC 1SFCB 1BGYG 3GMAA 1OVVA 4L75A 3CCSP 4JBZA 1W2BO 4QMAA 2WTYA 1KYOD 2P1JA 1YJNP 4LC1A 2W6BA 4HJGH 5KAIH 1X0TA 4EDFA 2M5AB 3VMAA 3L74D 5B5EE 1DIPA 4L73A 1SQQE 2A06G 3HE4A 2VRSA 3N4XA 1BDCA 1KV4A 3G9RA 1GU4A 1PP9E 4UB6H 1LGHB 1UIIA 3V2NA 5TISH 2C9NY 2OARA 1NHLA 2OYOA 2ZYGA 3GHGC 3L75E 3CCQP 5L8RJ 3I55P 4B86A 3P7KA 1NKZB 3ABVC 1VQ7P 1L0LG 4IFDK 1GL2B 1YITP 2XZRA 5GTHE 1SQPK 4D6TJ 1N73C 2D2CC 1G2CA 1FZFA 3VTPC 2Q3IA 5GTIH 1URQD 2YXQB 2L91A 3M9BA 2SPZA 3P8MC 4NPEA 5CBOA 4IOIH 3RBZA 2FYUD 2L5GB 1YJ9P 3IAOA 4CPGA 4D6TD 3BATA 1UIXA 1SQVJ 1EDIA 1GMJA 1MZ9A 2KK7A 3L72G 1MFZA 3G71P 1R8EA 1FU1A 1JEKA 2IFNA 1VQ6P 3L70J 4PD4D 2QJPB 3KZIE 2PFXA 2FYUJ 1IO4A 2W8ZA 3IN6A 5AVSB 1PGJA 2FBWC 1SQVD 1ZRTE 3SFEC 2KSEA 2XNDH 1J1DB 1A02J 1PGQA 1VQ5P 3H1JE 1BE3E 1SQBD 1J1EC 3GHGA 1HGZA 2CPSA 2N1TA 4PV1C 2Z5HA 3RBXA 3H1HJ 2WSSH 3PJSK 4GIFA 1E79H 1LT1A 1KZUB 2E75C 4WY4D 2W27A 5AVYB 1QL1A 5AW6B 3CCUP 3BVHA 2O01N 3VMYA 2Y0DA 2OYIA 4H44D 1NGMB 3CXHH 1NTZJ 4N3YB 1U7JA 1LNQA 5CHXA 3OW2O 2AEJA 2FYZA 3MHVA 1S4XA 2IBZD 4C7NB 1MKMA 3H1HG 2N9BA 1SQXE 1NTZD 2WPRA 1GZLA 2A45H 3RK2D 2O1JA 5AW5B 2HYNA 1LTSC 3CPWO 2H88C 3H1KJ 3RL0D 4BXLA 2E75D 3PH0A 3CX5E 3L37A 3B5NB 4WY4C 2E5YA 1JM0A 3O6QA 3CXHI 1SQBK 3AECC 3L74J 1ZR4A 1Q7YQ 1PPJG 3A0BH 1EQ7A 1EDKA 3CX5H 1S5LE 3HTKB 1D7MA 3MD0A 1PZQA 1N7LA 4KT0J 2Q7CA 3S4RA 3SFDC 3HD7A 2E42A 2QEXP 1W5CE 5AW9B 1GU5A 2KSJA 3H25A 1LTIC 4N6JA 2E74B 3L4FA 3BRTB 1NYHA 1N2DC 1CI6B 2E76C 2N9YB 1FZBA 1S1CX 2PRRA 4PD4H 2NRGA 2O1KA 1RQVA 1OZHA 3BCCG 1VF5C 1RE4A 4H0LD 3H32A 4WY4B 4AUWA 5DJTB 1PV3A 3FXDA 1SQQD 2R5BA 3B71A 3GF7A 2E43A 3C8VA 3CCMP 1EZVE 1IZNB 1SQPD 2FYNC 2HFED 4HKZH 3G6EP 4L76A 4N78E 3QH9A 5APQA 1R5SA 2GA1A 1M7LA 1BCCE 1M1JC 2RKLA 2WQYC 4K3AA 3S9OA 4D6TE 1KQSO 2HODA 2P7JA 2O3JA 4KHXA 4HH2A 4UB8H 2BEZF 1Q81Q 1JMMA 2KYVA 2QJYC 1L4AA 1P84H 1FZGA 1SLQA 2KOGA 2IDBA 1S9KE 3L75J 3CXHE 4H13B 2Q1KA 1IK7A 4C7RA 5BU8B 2R5DA 3CWBJ 1L4AC 2K9YA 3AE2C 5B66E 5KLVK 1EC5A 1DD4A 2ZT9B 1FE6A 1FZCB 5BVZA 1YTZT 1RF1A 2KP8A 3H1JG 3OAKA 2Q3EA 3L70D 5KAFH 1OXZA 4R4LA 3OA7A 1SQXJ 4RESB 1ZV8A 3CMEP 1RE3C 3SWYA 1G1IA 1NU1E 4YTPC 2AEMA 1LT9A 3L71G 3NMDA 3MP7B 3D6ZA 1NTZK 3R2PA 1VPCA 3KZIH 1LTBC 1HUCA 2FKWB 2KLUA 3EFFK 1JMBA 2JO1A 3E7KA 4R4MA 1ZXGA 3H1IG 1GL2A 4TT3H 4IFMA 3H1KG 3MGNA 3RK3C 3TDKA 1IFNA 3G4SP 3WU2H 1USEA 1VF5B 2IPPA 3I56P 3B4SA 4A7PA 3AEGC 2GUVA 1KILD 1NTMG 4GODA 1NU1G 3AEFC 5AW0B 5GTHH 1SS1A 3L71E 5KLVD 4U3FE 4M3LA 1KFMA 2FYUE 2V7QJ 2IZ1A 2YKOA 3BASA 1PFIA 1NTZE 4DT0A 2LXBA 3L74G 3E1RA 5M1BA 3CCLP 3PHLA 5AVRB 3H1KD 1IJDB 3JCUE 1T6AA 3A2AA 2Q5UA 2IFMA 3H1LG 4UB6E 1E5WA 1GW3A 2N1TC 2J5UA 1Y47A 3FXEA 3B5NC 2D2CD 1X9VA 1LWUA 1CI6A 2IZ0A 1GK6A 1RE4C 2KZJA 2MJZA 1MFTA 2WMMA 2M8RA 3F89A 3TNUA 3C1LA 1AV1A 1JCDA 1FDOA 2OYIC 1FBMA 1FDMA 4IL6X 4U3FG 5AVUB 1OVUA 2QRXA 4H13D 5CCGC 1VQ4P 3L35A 2QG4A 1FS0E 1NH4A 2K37A 1ZMEC 1NOHA 2KIKA 3ZDMA 2WSFJ 5CBNA 2OYIB 1KYOI 3HRNA 4Y99C 1OW6A 5E79H 3RK3E 2LKMA 3RL0g 1FAVA 2ZYDA 2N1TD 3AE1C 2PGDA 1BCCG 1NTKJ 3CLQA 2POHA 4D6TG 1LTAC 4ZMDA 1SQQJ 1SQPJ 2P67A 2WITA 3VN0A 3B5NA 3CX5I 1WT6A 2I1KA 2GUSA 2ZVOB 3GG2A 4OGQC 2HLOA 3KHUA 3H6PA 1Y8AA 5APWA 2M0BA 4EYYQ 4W80A 2FFDB 1FJPA 1FZCA 1T3JA 5AW4B 2P58A 5APUA 5AW3B 2YKQA 2IBZE 1NWQA 4U7JA 2JEEA 3L75D 1KB9I 1KILA 2KS1B 5KAFE 1SQPE 1TU3F 5CJ4A 4ZKPA 3II6A 3PRJA 1L0ND 2G8YA 1M56D 2AEFA 2D2CB 3KYQA 3P8CE 1H8AA 1ZR2A 2HPCA 2IX7C 3V2QA 2PP6A 1N73B 1PP9D 1S2EA 2WSCJ 2DW3A 2WVRA 3HE4B 3LIDA 1SQBJ 3AE7C 3AE8C 3V2PA 2WPQA 1VQ8P 1VQOP 2ZXEB 2YNYA 1JY3P 2ZYAA 1JTHB 1KQGB 4UB8E 5BU5A 1NU1K 3O8ZA 3RL0B 1NTMK 3PP5A 4WWIA 1ZOYC 2HG5D 3AEAC 3Q5RA 2OTLP 1NTMJ 1SQVK 2ZVNB 3EFGA 3KPEA 3CD6P 3RK3B 3M9QA 4W7YA 2RN0A 5K5GB 5KKZB 1IFIA 2ZAEB 1PGOA 3P32A 2I8DA 4H0LC 1AVYA 1NAFA 2KXPB 3NFQA 3CCEP 2YIUC 1RH5B 1USDA 4GT1A 1U57A 1M1KQ 5TISE 2OYHA 2WWWA 2IBZI 1GK4A 3M9HA 1L0LD 3FX0A 3IR9A 1FZEA 1LTJB 5H2FE 4BRYB 2QA4P 2H43A 5B5EH 3A3YB 1NTKE 1VL2A 2FYNB 5KLIC 1GDTA 1LTTC 3HE5A 1DX7A 1HJBA 2H7HA 1J2JB 2H8PD 1JY3O 5KLVG 1T3UA 1OIPA 3P8CD 4GOFA 5APYA 3A0BE 1NTKD 3LIEA 3JC22 4WBAA 2BCCE 1A02F 1DD3A 1QX8A 3K5BA 2BCCJ 3C9IA 1K04A 3A0HE 1T2KD 2P2UA 1JTHA 3AEBC 3TGUJ 3KXDA 1KFNA 1OWAA 3GW6A 1OFCX 1SQVE 1ZRTD 3M0AA 3MIWA 1RQUA 4IL6E 2OYHC 3M91A 1JNMA 4NPDA 3TYYA 1DEEG 2JR8A 5APSA 4KJMA 1MV8A 4WB4A 1BSNA 2V4HA 5KKZC 3TGUD 1G2CB 3WU2E 2K9JB 2E76D 3MTUE 5APTA 2Q6QA 2B87A 3Q5SA 1K9MQ 1VF5D 2OQQA 1N7SB 2KB7P 1X8YA 3HTKA 1Z56A 1WRGA 1W2EA 1BGYE 3M0DA 4XA4A 1KILB 3AE9C 3EQ2A 2Y0CA 1YBKA 1YJWP 1JY2N 2JP3A 1CW5A 3V2RA 3TNUB 3HUSC 3CCRP 4I7ZC 2QJKC 5KJ7A 2AXTH 1FDIA 1AVOA 1DH3A 5TJHA 3AE5C 1SFCD 5AVZB 3H32B 3USSA 2M5AA 1BDDA 2OGUA 4EIJA 4BWNA 3R4YA 3CI9A 4DOJA 1YI2P 4JPZB 1KTMA 1LT9B 3UIAA 1H88A 1KD1Q 1KQFB 4C7NA 4U3FJ 1L0NJ 3W67A 4YXDC 1L0LE 4WY4A 3A5TA 2JWAA 4PD4I 1BGYD 2E5TA 2Z5IA 3B5ND 3LW5J 3CC4P 1QGKB 4PJ0H 4XE5B 2Z4EA 1AQ5A 1FJKA 1L4AB 2FXPA 3CCVP 3CX5D 3W68A 4H13C 1H89A 2R32A 1L0NG 1LTJC 1M1JB 2R3CA 3V6IA 3SWFA 1GD2E 1KORA 1JOCA 1RHZB 5CCHD 1KMIZ 1NTMD 2E75B 1S72P 3WUTA 3D71A 5AVVB 1YHQP 2NPSD 1LWUB 1PPJE 3RK3D 3VOPA 2Y9ZA 4ASVA 4HYTB 1P84E 1R5LA 1SFCA 3LW5H 4H0LB 4L74A 3TF5A 1URQC 2CK3H 2K88A 2E76B 3L73D 1KILC 2BCCD 1HH0A 2QVAA 3A7OA 3U1AA 1AA0A 2E74D 2C0XA 1L0LJ 2QSIA 4OGQD 1FZAA 1L0NE 1VQNP 4H44B 2YMKA 4I6MC 2NZ2A 2XKMA 1Q82Q 1IFPA 2FYUG 2IYPA 2N1TB 4ZKUA 2C0WA 2QE7H 1N73A 3PTZA 2HPCB 3L74E 1K73Q 2WSEH 2LR2A 1VDFA 1SQVG 3RGUA 3T97B 2R3SA 1SP4A 1RE3A 1OX3A 2A45G 4GOEA 1GTWA 3AE4C 5H2FH 1XTGB 3H1HE 2J58A 4ASWA 3V4WA 2QIWA 1SQQK 1GL2C 4PV1D 3SSUA 3CL3D 1X79B 3FWLA 4Y28J 2WPVB 1LP1B 3E1IA 2KNCB 2YMYA 3MUDC 3O6QB 2HODB 1IFMA 2PAJA 1K05A 2B88A 3L71D 4H44C 4IFFA 3L75G 2O01H 1M90Q 2QM7A 1PIXA 4DJGA 1BCCD 4GDOA 1Q2NA 1Q90D 1N8RQ 2YXRB 3L71J 2CPBA 1RY3A 2QJYB 3GLMA 4Y99B 1LWUC 1NTKK 3FWNA 3HD7B 4GKGA 3Q5PA 1KC8Q 2Q9IA 4DCKA 2WT7B 1FOSF 1IC2A 2OTJP 3SWKA 1OW8A 3BCCE 5CMZA 3FGAD 2AXCA 2NPSA 2RH0A 3BCCJ 2B9BA 2FXMA 3IFMA 2A06D 3H1IE 3T97A 3H1KE 1EZVG 5C39A 1J1DC 2XNXA 3NXSA 2HR3A 2KZIA 2W90A 3EWKA 1PP9J 3AEEC 4K35A 1QEXA 3CCJP 1H0TB 5GTIE 4O9BA 1VQLP 1BE3G 1HF9A 4U3FD 3AEDC 3L72D 5AW8B 1FOSE 2YKPA 1NTME 3HD7C 1AFOA 2V7QH 3AE6C 3WUVA 1M57D 3I5CA 1Q86Q 2YO2A 2FFDA 4I1LA 5B66H 1MUUA 1YQ3C 5CCGD 3HUSB 1YIJP 1SQBG 1KN7A 2JJLA 3MZWB 1YQ4C 1IFDA 1NKNA 1HWTC 1VQ9P 1M1JA 2W6JH 2WSEJ 1P84I 2XV5A 1EZVD 3QWOC 3RK2B 1Y9BA 1LTJA 3H1LE 4I7ZB 4BRYA 2RMZA 1OVRA 3N7NA 3HE5B 2JKVA 3S1KA 2H89C 2AXTE 4YPCA 4I2LC 1NVOA 1CZQA 1S5LX 2KS1A 5APXA 3RK2C 1N86A 5DJUB 3HD7D 3GHGB 4C46A 1VQMP 3L70E 1EXJA 3GF3A 2JWDA 1BE3D 1SQBE 1YTZI 3VYIA 3AE3C 4Z1MH 3D70A 1ZP0C 3L73J 3KQGA 1OW7A 2W83C 2P10A 4JYBA 4PD4E 4EI2A 3U1CA 1U7MA 1GW4A 1CSBA 1DEBA 2M3BA 1EZVI 4WVZA 1OMIA 1PPJD 1QL2A 2G3AA 2KNCA 4YXWH 5AW7B 3KDPB 2JDIH
chains in the Genus database with same CATH topology
5CCHA 1SFCC 4LGDE 1NO4A 2WZ7A 3U59A 2J59M 5AVTB 1JY2O 1G1JA 1HVVA 2QM8A 1KQLA 4JYCA 1LT9C 2W6AA 1LTGC 2WT7A 5KTBA 1RF1C 3WMM0 3V4QA 2GM4A 1L0LK 1JUNA 2ZFCA 3M06A 3RL0C 5CCHC 1HTLC 1URQA 1JY2P 3TSIA 3G3ZA 1XTCC 2A45I 2FYUK 2KLVA 5AVWB 5AVXB 3L36A 3VMXA 2OYHB 3M0DC 2XU6A 5AVQB 2WSCH 1SVFA 3OJAB 2WPSA 1ZN5A 5CCGA 3HUSA 4AQRD 3MUDA 3VP8A 5APVA 2FFDC 2C9LY 1N7SC 1L0NK 1SQXK 2YO3A 2BASA 1GL2D 3VMZA 4OH8B 2I1JA 1IFJA 2XDJA 1RF1B 1URQB 1YYCA 1HGVA 1T8ZA 4W7ZA 1IK9A 5KJ7C 4AYCA 3TK1A 2WSFH 2NPSB 2NPSC 3BRVB 1J1EB 4DZOA 4JF7A 4EOTA 1L4AD 1RF0A 1ZLLA 5AW2B 1N7SD 3B8EB 3VP9A 1FZCC 3NTNA 1JCCA 1N7SA 1HBWA 1RF0C 1S9KD 5CJ4A 5CJ0A 1JY3N 5KJ7D 5AW1B 3V5BA 1SFCB 2WTYA 2P1JA 4LC1A 2W6BA 3HE4A 2VRSA 3N4XA 1GU4A 1LGHB 3V2NA 2C9NY 2OARA 1NHLA 3GHGC 4B86A 3P7KA 1NKZB 4IFDK 1GL2B 2XZRA 1SQPK 1N73C 1FZFA 1G2CA 3VTPC 2Q3IA 1URQD 3M9BA 3P8MC 2L5GB 3BATA 1MZ9A 1MFZA 1FU1A 2IFNA 1IO4A 5AVSB 1J1DB 1A02J 3GHGA 1J1EC 1HGZA 2CPSA 2N1TA 1H88A 2Z5HA 4GIFA 4WY4D 1KZUB 5AVYB 1JO5A 2W27A 5AW6B 1QL1A 3BVHA 2OYIA 3VMYA 4N3YB 5CHXA 2FYZA 4C7NB 2N9BA 2WPRA 1GZLA 2A45H 3RK2D 2O1JA 5AW5B 2HYNA 1LTSC 3RL0D 4WY4C 3L37A 3B5NB 1SQBK 1ZR4A 1EQ7A 3HTKB 3MD0A 4N78D 2Q7CA 1T2KC 1N7LA 3HD7A 2E42A 1GU5A 5AW9B 2KSJA 1LTIC 4N6JA 3L4FA 3BRTB 1N2DC 1CI6B 1FZBA 2O1KA 4WY4B 4AUWA 1RE4A 3H32A 2E43A 2R5BA 2HFED 4N78E 5APQA 1M7LA 1M1JC 2HODA 2P7JA 4KHXA 4HH2A 1JMMA 2KYVA 1L4AA 1FZGA 1SLQA 2KOGA 1S9KE 5BU8B 4C7RA 2R5DA 1L4AC 5KLVK 1FZCB 5BVZA 1YTZT 1RF1A 2KP8A 3OAKA 1OXZA 3OA7A 4RESB 1ZV8A 1RE3C 3SWYA 1G1IA 3NMDA 1LT9A 1NTZK 3R2PA 1VPCA 4LLHA 1LTBC 1HUCA 2FKWB 1GL2A 4IFMA 3MGNA 3RK3C 1IFNA 2IPPA 2GUVA 1KILD 5AW0B 4M3LA 1KFMA 2YKOA 3BASA 1PFIA 5AVRB 1IJDB 3A2AA 2Q5UA 2IFMA 1E5WA 1GW3A 2N1TC 3B5NC 1LWUA 1X9VA 2MJZA 1CI6A 1GK6A 1RE4C 2M8RA 3TNUA 1JCDA 2OYIC 1FBMA 1FDMA 5AVUB 5CCGC 3L35A 1NH4A 1NOHA 2OYIB 3HRNA 4Y99C 2LKMA 1FAVA 2N1TD 3CLQA 2POHA 1LTAC 3VN0A 2P67A 2WITA 3B5NA 1WT6A 2I1KA 2GUSA 2HLOA 3H6PA 5APWA 4W80A 2FFDB 1FJPA 1FZCA 1T3JA 5AW4B 5APUA 5AW3B 2YKQA 1NWQA 2JEEA 1KILA 4ZKPA 3II6A 3KYQA 1H8AA 3P8CE 2HPCA 1N73B 1ZR2A 2IX7C 3V2QA 2PP6A 3HE4B 3VYIA 3V2PA 3LIDA 2WPQA 2ZXEB 2YNYA 1JY3P 1JTHB 5BU5A 1NU1K 3O8ZA 3RL0B 1NTMK 3PP5A 2HG5D 3EFGA 1SQVK 3KPEA 3RK3B 3M9QA 4W7YA 1IFIA 3P32A 1NAFA 3NFQA 4GT1A 2OYHA 2WWWA 3M9HA 1GK4A 3IR9A 1FZEA 1LTJB 2H43A 3A3YB 1GDTA 1LTTC 3HE5A 1DX7A 1HJBA 2H7HA 1J2JB 2H8PD 1JY3O 1T3UA 3P8CD 5APYA 3LIEA 4WBAA 1A02F 3C9IA 1T2KD 2P2UA 1JTHA 1KFNA 1OWAA 3M0AA 3MIWA 2OYHC 3M91A 1JNMA 3TYYA 5APSA 1MV8A 4WB4A 1G2CB 3MTUE 5APTA 3HTKA 1N7SB 2KB7P 1X8YA 1Z56A 1WRGA 1W2EA 3M0DA 4XA4A 1KILB 3EQ2A 1JY2N 1CW5A 3V2RA 3TNUB 3HUSC 5KJ7A 1DH3A 1SFCD 5AVZB 3H32B 4EIJA 3CI9A 4DOJA 1LT9B 3UIAA 4C7NA 4WY4A 3A5TA 2Z5IA 3B5ND 4XE5B 2Z4EA 1AQ5A 1FJKA 1L4AB 1H89A 2R32A 1LTJC 1M1JB 2R3CA 3SWFA 1GD2E 1JOCA 5CCHD 5AVVB 2NPSD 1LWUB 3VOPA 3RK3D 4HYTB 1SFCA 3LW5H 1URQC 1KILC 3A7OA 1HH0A 3U1AA 2C0XA 1FZAA 4I6MC 2XKMA 4ZKUA 1N73A 2N1TB 2HPCB 2C0WA 2WSEH 1VDFA 1SP4A 1RE3A 2A45G 1GTWA 1XTGB 2J58A 3V4WA 1SQQK 1GL2C 3CL3D 1X79B 3E1IA 2YMYA 2HODB 1IFMA 2PAJA 4IFFA 2O01H 2QM7A 2CPBA 1RY3A 4Y99B 1LWUC 1NTKK 3HD7B 1FOSF 4GKGA 2Q9IA 1IC2A 5CMZA 2NPSA 3IFMA 2FXMA 3T97A 1J1DC 2XNXA 3NXSA 4O9BA 5AW8B 1FOSE 2YKPA 1AFOA 3HD7C 3I5CA 2YO2A 2FFDA 4I1LA 1MUUA 5CCGD 3HUSB 2JJLA 1HWTC 1IFDA 1NKNA 1M1JA 2XV5A 3RK2B 1LTJA 3N7NA 3HE5B 2WT7B 4I2LC 1CZQA 5APXA 3RK2C 1N86A 3HD7D 3GHGB 4C46A 1YTZI 3KQGA 4JYBA 3U1CA 1GW4A 1CSBA 1DEBA 2M3BA 1QL2A 5AW7B 3KDPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TNU A;  4C7N A;  3A5T A;  5AVU B;  1IO4 A;  2Z5I A;  5AVS B;  5AVT B;  3L35 A;  4XE5 B;  1A02 J;  2QM8 A;  1KQL A;  1H88 A;  4JYC A;  2Z5H A;  1H89 A;  1FAV A;  2R32 A;  2W6A A;  2R3C A;  2W27 A;  5AVY B;  5AW6 B;  3SWF A;  2WT7 A;  1GD2 E;  3VMY A;  5AVV B;  3VN0 A;  2P67 A;  4HYT B;  3V4Q A;  1JUN A;  2ZFC A;  3M06 A;  4C7N B;  2N9B A;  5APW A;  2WPR A;  1GZL A;  5AW4 B;  3A7O A;  5AW5 B;  5APU A;  5AW3 B;  1NWQ A;  4I6M C;  3L37 A;  5AVW B;  5AVX B;  3L36 A;  3VMX A;  1T2K C;  3MD0 A;  2Q7C A;  1SP4 A;  1H8A A;  1GTW A;  2E42 A;  2XU6 A;  1GU5 A;  5AW9 B;  3HE4 B;  5AVQ B;  3VYI A;  3V4W A;  2WPS A;  3LID A;  2WPQ A;  4AQR D;  1CI6 B;  5APV A;  2ZXE B;  2YNY A;  2C9L Y;  2YO3 A;  4AUW A;  3O8Z A;  2BAS A;  3VMZ A;  2QM7 A;  2E43 A;  2R5B A;  1YYC A;  3P32 A;  1NAF A;  3NFQ A;  5APQ A;  4AYC A;  4GT1 A;  3TK1 A;  2P7J A;  4KHX A;  4GKG A;  1FOS F;  4DZO A;  2WWW A;  3M9H A;  1GK4 A;  4EOT A;  3IR9 A;  1SLQ A;  3B8E B;  5CMZ A;  5AW2 B;  1S9K E;  3NTN A;  3A3Y B;  3T97 A;  3HE5 A;  2R5D A;  1HBW A;  1HJB A;  2H7H A;  1J2J B;  3NXS A;  1S9K D;  5APY A;  3LIE A;  2KP8 A;  1A02 F;  3OAK A;  5AW1 B;  3V5B A;  5AW8 B;  1OXZ A;  1FOS E;  4RES B;  1T2K D;  2P2U A;  3NMD A;  2WTY A;  3I5C A;  1OWA A;  2YO2 A;  3M0A A;  4LC1 A;  1MUU A;  1HUC A;  2JJL A;  3M91 A;  1JNM A;  1HWT C;  3TYY A;  5APS A;  3MGN A;  1MV8 A;  2VRS A;  3HE4 A;  2XV5 A;  1G2C B;  3UIA A;  1GU4 A;  5APT A;  2C9N Y;  2IPP A;  3HTK A;  1X8Y A;  3HE5 B;  2WT7 B;  4I2L C;  1CZQ A;  3M0D A;  3P7K A;  5APX A;  4B86 A;  5AW0 B;  4C46 A;  2XZR A;  4M3L A;  3TNU B;  3VTP C;  2Q3I A;  1DH3 A;  3KQG A;  3M9B A;  3P8M C;  5AVR B;  4JYB A;  3A2A A;  5AVZ B;  2Q5U A;  1CSB A;  1CI6 A;  1GK6 A;  5AW7 B;  1MFZ A;  3KDP B; 
#chains in the Genus database with same CATH topology
 4N78 D;  5CCH A;  1BCC J;  1NTK G;  1SFC C;  4IL6 H;  4LGD E;  5KAI E;  1NO4 A;  2WZ7 A;  2ZJS E;  3L70 G;  3U59 A;  1VQK P;  1KIL E;  1EXI A;  3JCU H;  2J59 M;  1LJ2 A;  5AVT B;  1QVF O;  5KLV E;  3A0H H;  1AJY A;  1JY2 O;  1G1J A;  1FC2 C;  1HJ0 A;  1NTZ G;  3Q3D A;  1K8A Q;  1HVV A;  1JB0 J;  2QM8 A;  1KQL A;  2Y0E A;  4JYC A;  1PGP A;  5KLI B;  1X22 A;  1LT9 C;  2W6A A;  1LTG C;  2YIU B;  4RKU J;  2WT7 A;  2BEQ D;  1PL5 A;  5KTB A;  3Q2Y A;  1BSH A;  3IF4 A;  2KI7 B;  3BCC D;  1SQP G;  3CMA P;  4MN4 C;  1RF1 C;  3WMM 0;  1SQQ G;  2A06 E;  3H1L J;  3V4Q A;  3ITK A;  1L0L K;  2GM4 A;  3CC7 P;  1JUN A;  2ZFC A;  3M06 A;  3RL0 C;  5CCH C;  4HB1 A;  4OVN F;  1HTL C;  4XFJ A;  1URQ A;  3D6Y A;  1JY2 P;  1L2P A;  2B89 A;  3TSI A;  1H0T A;  3Q1M A;  3L72 J;  1AQT A;  1XTC C;  3G3Z A;  3H1L D;  1P84 D;  2A45 I;  4LLH A;  1KB9 D;  2FYU K;  2KLV A;  1M8O B;  2ZT9 D;  1VQP P;  1NJI Q;  1KYO E;  1QLE D;  3CXH D;  5AVW B;  1EDJ A;  5AVX B;  1LP1 A;  3L36 A;  3VMX A;  4PJ0 E;  1KYO H;  2E74 C;  4NPF X;  1BGY J;  3CWB D;  2OYH B;  2QJK B;  3M0D C;  3TGU E;  2XU6 A;  3H1I J;  5AVQ B;  2WSC H;  1SVF A;  2OTK E;  2WPS A;  3OJA B;  3L72 E;  3CC2 P;  1ZN5 A;  2KUB A;  4RO0 A;  5CCG A;  3HUS A;  3L73 G;  4AQR D;  1SQX D;  2IBZ G;  3MUD A;  3VP8 A;  2ITA A;  5APV A;  1QVG O;  3H1H D;  2FFD C;  1N7S C;  2C9L Y;  3H1I D;  1L0N K;  1SQX K;  2YO3 A;  2ZT9 C;  5EFW B;  1BE3 J;  2BAS A;  1GL2 D;  3H1J J;  3JSV C;  4OGQ B;  4OH8 B;  1NU1 J;  3VMZ A;  2I1J A;  2Y9Y A;  1IFJ A;  1JO5 A;  2LXC B;  2XDJ A;  2FY8 A;  2IYO A;  1RF1 B;  5E79 E;  1URQ B;  1YYC A;  1HGV A;  1T8Z A;  2K3R A;  3CWB G;  4W7Z A;  3TGU G;  1IK9 A;  3H1J D;  5KJ7 C;  1ZW0 A;  1NU1 D;  4AYC A;  2BCC G;  2FXO A;  2WSF H;  3TK1 A;  2ZXX A;  4OWF A;  2NPS B;  3L73 E;  2NPS C;  3BRV B;  1J1E B;  4DZO A;  4PV1 B;  4JF7 A;  4EOT A;  1L4A D;  1RF0 A;  5KLV J;  1ZLL A;  3F5H A;  5AW2 B;  1N7S D;  3B8E B;  3VP9 A;  2K9J A;  3NTN A;  1FZC C;  4ZNC A;  3WUU A;  1JCC A;  2UWJ E;  1SQX G;  2R44 A;  1N7S A;  1HBW A;  2M3E A;  1RF0 C;  4JQ0 D;  1T2K C;  2B87 B;  1EDL A;  3CWB E;  1S9K D;  1PP9 G;  4TLF A;  1NAY A;  5CJ0 A;  2MKV A;  1S5L H;  4RJT A;  2O01 J;  1JY3 N;  1KB9 H;  1WMK A;  1S3J A;  5KJ7 D;  5AW1 B;  3V5B A;  2K1A A;  3PLN A;  1KB9 E;  2QJP C;  1SFC B;  1BGY G;  3GMA A;  1OVV A;  4L75 A;  3CCS P;  4JBZ A;  1W2B O;  4QMA A;  2WTY A;  1KYO D;  2P1J A;  1YJN P;  4LC1 A;  2W6B A;  4HJG H;  5KAI H;  1X0T A;  4EDF A;  2M5A B;  3VMA A;  3L74 D;  5B5E E;  1DIP A;  4L73 A;  1SQQ E;  2A06 G;  3HE4 A;  2VRS A;  3N4X A;  1BDC A;  1KV4 A;  3G9R A;  1GU4 A;  1PP9 E;  4UB6 H;  1LGH B;  1UII A;  3V2N A;  5TIS H;  2C9N Y;  2OAR A;  1NHL A;  2OYO A;  2ZYG A;  3GHG C;  3L75 E;  3CCQ P;  5L8R J;  3I55 P;  4B86 A;  3P7K A;  1NKZ B;  3ABV C;  1VQ7 P;  1L0L G;  4IFD K;  1GL2 B;  1YIT P;  2XZR A;  5GTH E;  1SQP K;  4D6T J;  1N73 C;  2D2C C;  1G2C A;  1FZF A;  3VTP C;  2Q3I A;  5GTI H;  1URQ D;  2YXQ B;  2L91 A;  3M9B A;  2SPZ A;  3P8M C;  4NPE A;  5CBO A;  4IOI H;  3RBZ A;  2FYU D;  2L5G B;  1YJ9 P;  3IAO A;  4CPG A;  4D6T D;  3BAT A;  1UIX A;  1SQV J;  1EDI A;  1GMJ A;  1MZ9 A;  2KK7 A;  3L72 G;  1MFZ A;  3G71 P;  1R8E A;  1FU1 A;  1JEK A;  2IFN A;  1VQ6 P;  3L70 J;  4PD4 D;  2QJP B;  3KZI E;  2PFX A;  2FYU J;  1IO4 A;  2W8Z A;  3IN6 A;  5AVS B;  1PGJ A;  2FBW C;  1SQV D;  1ZRT E;  3SFE C;  2KSE A;  2XND H;  1J1D B;  1A02 J;  1PGQ A;  1VQ5 P;  3H1J E;  1BE3 E;  1SQB D;  1J1E C;  3GHG A;  1HGZ A;  2CPS A;  2N1T A;  4PV1 C;  2Z5H A;  3RBX A;  3H1H J;  2WSS H;  3PJS K;  4GIF A;  1E79 H;  1LT1 A;  1KZU B;  2E75 C;  4WY4 D;  2W27 A;  5AVY B;  1QL1 A;  5AW6 B;  3CCU P;  3BVH A;  2O01 N;  3VMY A;  2Y0D A;  2OYI A;  4H44 D;  1NGM B;  3CXH H;  1NTZ J;  4N3Y B;  1U7J A;  1LNQ A;  5CHX A;  3OW2 O;  2AEJ A;  2FYZ A;  3MHV A;  1S4X A;  2IBZ D;  4C7N B;  1MKM A;  3H1H G;  2N9B A;  1SQX E;  1NTZ D;  2WPR A;  1GZL A;  2A45 H;  3RK2 D;  2O1J A;  5AW5 B;  2HYN A;  1LTS C;  3CPW O;  2H88 C;  3H1K J;  3RL0 D;  4BXL A;  2E75 D;  3PH0 A;  3CX5 E;  3L37 A;  3B5N B;  4WY4 C;  2E5Y A;  1JM0 A;  3O6Q A;  3CXH I;  1SQB K;  3AEC C;  3L74 J;  1ZR4 A;  1Q7Y Q;  1PPJ G;  3A0B H;  1EQ7 A;  1EDK A;  3CX5 H;  1S5L E;  3HTK B;  1D7M A;  3MD0 A;  1PZQ A;  1N7L A;  4KT0 J;  2Q7C A;  3S4R A;  3SFD C;  3HD7 A;  2E42 A;  2QEX P;  1W5C E;  5AW9 B;  1GU5 A;  2KSJ A;  3H25 A;  1LTI C;  4N6J A;  2E74 B;  3L4F A;  3BRT B;  1NYH A;  1N2D C;  1CI6 B;  2E76 C;  2N9Y B;  1FZB A;  1S1C X;  2PRR A;  4PD4 H;  2NRG A;  2O1K A;  1RQV A;  1OZH A;  3BCC G;  1VF5 C;  1RE4 A;  4H0L D;  3H32 A;  4WY4 B;  4AUW A;  5DJT B;  1PV3 A;  3FXD A;  1SQQ D;  2R5B A;  3B71 A;  3GF7 A;  2E43 A;  3C8V A;  3CCM P;  1EZV E;  1IZN B;  1SQP D;  2FYN C;  2HFE D;  4HKZ H;  3G6E P;  4L76 A;  4N78 E;  3QH9 A;  5APQ A;  1R5S A;  2GA1 A;  1M7L A;  1BCC E;  1M1J C;  2RKL A;  2WQY C;  4K3A A;  3S9O A;  4D6T E;  1KQS O;  2HOD A;  2P7J A;  2O3J A;  4KHX A;  4HH2 A;  4UB8 H;  2BEZ F;  1Q81 Q;  1JMM A;  2KYV A;  2QJY C;  1L4A A;  1P84 H;  1FZG A;  1SLQ A;  2KOG A;  2IDB A;  1S9K E;  3L75 J;  3CXH E;  4H13 B;  2Q1K A;  1IK7 A;  4C7R A;  5BU8 B;  2R5D A;  3CWB J;  1L4A C;  2K9Y A;  3AE2 C;  5B66 E;  5KLV K;  1EC5 A;  1DD4 A;  2ZT9 B;  1FE6 A;  1FZC B;  5BVZ A;  1YTZ T;  1RF1 A;  2KP8 A;  3H1J G;  3OAK A;  2Q3E A;  3L70 D;  5KAF H;  1OXZ A;  4R4L A;  3OA7 A;  1SQX J;  4RES B;  1ZV8 A;  3CME P;  1RE3 C;  3SWY A;  1G1I A;  1NU1 E;  4YTP C;  2AEM A;  1LT9 A;  3L71 G;  3NMD A;  3MP7 B;  3D6Z A;  1NTZ K;  3R2P A;  1VPC A;  3KZI H;  1LTB C;  1HUC A;  2FKW B;  2KLU A;  3EFF K;  1JMB A;  2JO1 A;  3E7K A;  4R4M A;  1ZXG A;  3H1I G;  1GL2 A;  4TT3 H;  4IFM A;  3H1K G;  3MGN A;  3RK3 C;  3TDK A;  1IFN A;  3G4S P;  3WU2 H;  1USE A;  1VF5 B;  2IPP A;  3I56 P;  3B4S A;  4A7P A;  3AEG C;  2GUV A;  1KIL D;  1NTM G;  4GOD A;  1NU1 G;  3AEF C;  5AW0 B;  5GTH H;  1SS1 A;  3L71 E;  5KLV D;  4U3F E;  4M3L A;  1KFM A;  2FYU E;  2V7Q J;  2IZ1 A;  2YKO A;  3BAS A;  1PFI A;  1NTZ E;  4DT0 A;  2LXB A;  3L74 G;  3E1R A;  5M1B A;  3CCL P;  3PHL A;  5AVR B;  3H1K D;  1IJD B;  3JCU E;  1T6A A;  3A2A A;  2Q5U A;  2IFM A;  3H1L G;  4UB6 E;  1E5W A;  1GW3 A;  2N1T C;  2J5U A;  1Y47 A;  3FXE A;  3B5N C;  2D2C D;  1X9V A;  1LWU A;  1CI6 A;  2IZ0 A;  1GK6 A;  1RE4 C;  2KZJ A;  2MJZ A;  1MFT A;  2WMM A;  2M8R A;  3F89 A;  3TNU A;  3C1L A;  1AV1 A;  1JCD A;  1FDO A;  2OYI C;  1FBM A;  1FDM A;  4IL6 X;  4U3F G;  5AVU B;  1OVU A;  2QRX A;  4H13 D;  5CCG C;  1VQ4 P;  3L35 A;  2QG4 A;  1FS0 E;  1NH4 A;  2K37 A;  1ZME C;  1NOH A;  2KIK A;  3ZDM A;  2WSF J;  5CBN A;  2OYI B;  1KYO I;  3HRN A;  4Y99 C;  1OW6 A;  5E79 H;  3RK3 E;  2LKM A;  3RL0 g;  1FAV A;  2ZYD A;  2N1T D;  3AE1 C;  2PGD A;  1BCC G;  1NTK J;  3CLQ A;  2POH A;  4D6T G;  1LTA C;  4ZMD A;  1SQQ J;  1SQP J;  2P67 A;  2WIT A;  3VN0 A;  3B5N A;  3CX5 I;  1WT6 A;  2I1K A;  2GUS A;  2ZVO B;  3GG2 A;  4OGQ C;  2HLO A;  3KHU A;  3H6P A;  1Y8A A;  5APW A;  2M0B A;  4EYY Q;  4W80 A;  2FFD B;  1FJP A;  1FZC A;  1T3J A;  5AW4 B;  2P58 A;  5APU A;  5AW3 B;  2YKQ A;  2IBZ E;  1NWQ A;  4U7J A;  2JEE A;  3L75 D;  1KB9 I;  1KIL A;  2KS1 B;  5KAF E;  1SQP E;  1TU3 F;  5CJ4 A;  4ZKP A;  3II6 A;  3PRJ A;  1L0N D;  2G8Y A;  1M56 D;  2AEF A;  2D2C B;  3KYQ A;  3P8C E;  1H8A A;  1ZR2 A;  2HPC A;  2IX7 C;  3V2Q A;  2PP6 A;  1N73 B;  1PP9 D;  1S2E A;  2WSC J;  2DW3 A;  2WVR A;  3HE4 B;  3LID A;  1SQB J;  3AE7 C;  3AE8 C;  3V2P A;  2WPQ A;  1VQ8 P;  1VQO P;  2ZXE B;  2YNY A;  1JY3 P;  2ZYA A;  1JTH B;  1KQG B;  4UB8 E;  5BU5 A;  1NU1 K;  3O8Z A;  3RL0 B;  1NTM K;  3PP5 A;  4WWI A;  1ZOY C;  2HG5 D;  3AEA C;  3Q5R A;  2OTL P;  1NTM J;  1SQV K;  2ZVN B;  3EFG A;  3KPE A;  3CD6 P;  3RK3 B;  3M9Q A;  4W7Y A;  2RN0 A;  5K5G B;  5KKZ B;  1IFI A;  2ZAE B;  1PGO A;  3P32 A;  2I8D A;  4H0L C;  1AVY A;  1NAF A;  2KXP B;  3NFQ A;  3CCE P;  2YIU C;  1RH5 B;  1USD A;  4GT1 A;  1U57 A;  1M1K Q;  5TIS E;  2OYH A;  2WWW A;  2IBZ I;  1GK4 A;  3M9H A;  1L0L D;  3FX0 A;  3IR9 A;  1FZE A;  1LTJ B;  5H2F E;  4BRY B;  2QA4 P;  2H43 A;  5B5E H;  3A3Y B;  1NTK E;  1VL2 A;  2FYN B;  5KLI C;  1GDT A;  1LTT C;  3HE5 A;  1DX7 A;  1HJB A;  2H7H A;  1J2J B;  2H8P D;  1JY3 O;  5KLV G;  1T3U A;  1OIP A;  3P8C D;  4GOF A;  5APY A;  3A0B E;  1NTK D;  3LIE A;  3JC2 2;  4WBA A;  2BCC E;  1A02 F;  1DD3 A;  1QX8 A;  3K5B A;  2BCC J;  3C9I A;  1K04 A;  3A0H E;  1T2K D;  2P2U A;  1JTH A;  3AEB C;  3TGU J;  3KXD A;  1KFN A;  1OWA A;  3GW6 A;  1OFC X;  1SQV E;  1ZRT D;  3M0A A;  3MIW A;  1RQU A;  4IL6 E;  2OYH C;  3M91 A;  1JNM A;  4NPD A;  3TYY A;  1DEE G;  2JR8 A;  5APS A;  4KJM A;  1MV8 A;  4WB4 A;  1BSN A;  2V4H A;  5KKZ C;  3TGU D;  1G2C B;  3WU2 E;  2K9J B;  2E76 D;  3MTU E;  5APT A;  2Q6Q A;  2B87 A;  3Q5S A;  1K9M Q;  1VF5 D;  2OQQ A;  1N7S B;  2KB7 P;  1X8Y A;  3HTK A;  1Z56 A;  1WRG A;  1W2E A;  1BGY E;  3M0D A;  4XA4 A;  1KIL B;  3AE9 C;  3EQ2 A;  2Y0C A;  1YBK A;  1YJW P;  1JY2 N;  2JP3 A;  1CW5 A;  3V2R A;  3TNU B;  3HUS C;  3CCR P;  4I7Z C;  2QJK C;  5KJ7 A;  2AXT H;  1FDI A;  1AVO A;  1DH3 A;  5TJH A;  3AE5 C;  1SFC D;  5AVZ B;  3H32 B;  3USS A;  2M5A A;  1BDD A;  2OGU A;  4EIJ A;  4BWN A;  3R4Y A;  3CI9 A;  4DOJ A;  1YI2 P;  4JPZ B;  1KTM A;  1LT9 B;  3UIA A;  1H88 A;  1KD1 Q;  1KQF B;  4C7N A;  4U3F J;  1L0N J;  3W67 A;  4YXD C;  1L0L E;  4WY4 A;  3A5T A;  2JWA A;  4PD4 I;  1BGY D;  2E5T A;  2Z5I A;  3B5N D;  3LW5 J;  3CC4 P;  1QGK B;  4PJ0 H;  4XE5 B;  2Z4E A;  1AQ5 A;  1FJK A;  1L4A B;  2FXP A;  3CCV P;  3CX5 D;  3W68 A;  4H13 C;  1H89 A;  2R32 A;  1L0N G;  1LTJ C;  1M1J B;  2R3C A;  3V6I A;  3SWF A;  1GD2 E;  1KOR A;  1JOC A;  1RHZ B;  5CCH D;  1KMI Z;  1NTM D;  2E75 B;  1S72 P;  3WUT A;  3D71 A;  5AVV B;  1YHQ P;  2NPS D;  1LWU B;  1PPJ E;  3RK3 D;  3VOP A;  2Y9Z A;  4ASV A;  4HYT B;  1P84 E;  1R5L A;  1SFC A;  3LW5 H;  4H0L B;  4L74 A;  3TF5 A;  1URQ C;  2CK3 H;  2K88 A;  2E76 B;  3L73 D;  1KIL C;  2BCC D;  1HH0 A;  2QVA A;  3A7O A;  3U1A A;  1AA0 A;  2E74 D;  2C0X A;  1L0L J;  2QSI A;  4OGQ D;  1FZA A;  1L0N E;  1VQN P;  4H44 B;  2YMK A;  4I6M C;  2NZ2 A;  2XKM A;  1Q82 Q;  1IFP A;  2FYU G;  2IYP A;  2N1T B;  4ZKU A;  2C0W A;  2QE7 H;  1N73 A;  3PTZ A;  2HPC B;  3L74 E;  1K73 Q;  2WSE H;  2LR2 A;  1VDF A;  1SQV G;  3RGU A;  3T97 B;  2R3S A;  1SP4 A;  1RE3 A;  1OX3 A;  2A45 G;  4GOE A;  1GTW A;  3AE4 C;  5H2F H;  1XTG B;  3H1H E;  2J58 A;  4ASW A;  3V4W A;  2QIW A;  1SQQ K;  1GL2 C;  4PV1 D;  3SSU A;  3CL3 D;  1X79 B;  3FWL A;  4Y28 J;  2WPV B;  1LP1 B;  3E1I A;  2KNC B;  2YMY A;  3MUD C;  3O6Q B;  2HOD B;  1IFM A;  2PAJ A;  1K05 A;  2B88 A;  3L71 D;  4H44 C;  4IFF A;  3L75 G;  2O01 H;  1M90 Q;  2QM7 A;  1PIX A;  4DJG A;  1BCC D;  4GDO A;  1Q2N A;  1Q90 D;  1N8R Q;  2YXR B;  3L71 J;  2CPB A;  1RY3 A;  2QJY B;  3GLM A;  4Y99 B;  1LWU C;  1NTK K;  3FWN A;  3HD7 B;  4GKG A;  3Q5P A;  1KC8 Q;  2Q9I A;  4DCK A;  2WT7 B;  1FOS F;  1IC2 A;  2OTJ P;  3SWK A;  1OW8 A;  3BCC E;  5CMZ A;  3FGA D;  2AXC A;  2NPS A;  2RH0 A;  3BCC J;  2B9B A;  2FXM A;  3IFM A;  2A06 D;  3H1I E;  3T97 A;  3H1K E;  1EZV G;  5C39 A;  1J1D C;  2XNX A;  3NXS A;  2HR3 A;  2KZI A;  2W90 A;  3EWK A;  1PP9 J;  3AEE C;  4K35 A;  1QEX A;  3CCJ P;  1H0T B;  5GTI E;  4O9B A;  1VQL P;  1BE3 G;  1HF9 A;  4U3F D;  3AED C;  3L72 D;  5AW8 B;  1FOS E;  2YKP A;  1NTM E;  3HD7 C;  1AFO A;  2V7Q H;  3AE6 C;  3WUV A;  1M57 D;  3I5C A;  1Q86 Q;  2YO2 A;  2FFD A;  4I1L A;  5B66 H;  1MUU A;  1YQ3 C;  5CCG D;  3HUS B;  1YIJ P;  1SQB G;  1KN7 A;  2JJL A;  3MZW B;  1YQ4 C;  1IFD A;  1NKN A;  1HWT C;  1VQ9 P;  1M1J A;  2W6J H;  2WSE J;  1P84 I;  2XV5 A;  1EZV D;  3QWO C;  3RK2 B;  1Y9B A;  1LTJ A;  3H1L E;  4I7Z B;  4BRY A;  2RMZ A;  1OVR A;  3N7N A;  3HE5 B;  2JKV A;  3S1K A;  2H89 C;  2AXT E;  4YPC A;  4I2L C;  1NVO A;  1CZQ A;  1S5L X;  2KS1 A;  5APX A;  3RK2 C;  1N86 A;  5DJU B;  3HD7 D;  3GHG B;  4C46 A;  1VQM P;  3L70 E;  1EXJ A;  3GF3 A;  2JWD A;  1BE3 D;  1SQB E;  1YTZ I;  3VYI A;  3AE3 C;  4Z1M H;  3D70 A;  1ZP0 C;  3L73 J;  3KQG A;  1OW7 A;  2W83 C;  2P10 A;  4JYB A;  4PD4 E;  4EI2 A;  3U1C A;  1U7M A;  1GW4 A;  1CSB A;  1DEB A;  2M3B A;  1EZV I;  4WVZ A;  1OMI A;  1PPJ D;  1QL2 A;  2G3A A;  2KNC A;  4YXW H;  5AW7 B;  3KDP B;  2JDI H; 
#chains in the Genus database with same CATH homology
 5CCH A;  1SFC C;  4LGD E;  1NO4 A;  2WZ7 A;  3U59 A;  2J59 M;  5AVT B;  1JY2 O;  1G1J A;  1HVV A;  2QM8 A;  1KQL A;  4JYC A;  1LT9 C;  2W6A A;  1LTG C;  2WT7 A;  5KTB A;  1RF1 C;  3WMM 0;  3V4Q A;  2GM4 A;  1L0L K;  1JUN A;  2ZFC A;  3M06 A;  3RL0 C;  5CCH C;  1HTL C;  1URQ A;  1JY2 P;  3TSI A;  3G3Z A;  1XTC C;  2A45 I;  2FYU K;  2KLV A;  5AVW B;  5AVX B;  3L36 A;  3VMX A;  2OYH B;  3M0D C;  2XU6 A;  5AVQ B;  2WSC H;  1SVF A;  3OJA B;  2WPS A;  1ZN5 A;  5CCG A;  3HUS A;  4AQR D;  3MUD A;  3VP8 A;  5APV A;  2FFD C;  2C9L Y;  1N7S C;  1L0N K;  1SQX K;  2YO3 A;  2BAS A;  1GL2 D;  3VMZ A;  4OH8 B;  2I1J A;  1IFJ A;  2XDJ A;  1RF1 B;  1URQ B;  1YYC A;  1HGV A;  1T8Z A;  4W7Z A;  1IK9 A;  5KJ7 C;  4AYC A;  3TK1 A;  2WSF H;  2NPS B;  2NPS C;  3BRV B;  1J1E B;  4DZO A;  4JF7 A;  4EOT A;  1L4A D;  1RF0 A;  1ZLL A;  5AW2 B;  1N7S D;  3B8E B;  3VP9 A;  1FZC C;  3NTN A;  1JCC A;  1N7S A;  1HBW A;  1RF0 C;  1S9K D;  5CJ4 A;  5CJ0 A;  1JY3 N;  5KJ7 D;  5AW1 B;  3V5B A;  1SFC B;  2WTY A;  2P1J A;  4LC1 A;  2W6B A;  3HE4 A;  2VRS A;  3N4X A;  1GU4 A;  1LGH B;  3V2N A;  2C9N Y;  2OAR A;  1NHL A;  3GHG C;  4B86 A;  3P7K A;  1NKZ B;  4IFD K;  1GL2 B;  2XZR A;  1SQP K;  1N73 C;  1FZF A;  1G2C A;  3VTP C;  2Q3I A;  1URQ D;  3M9B A;  3P8M C;  2L5G B;  3BAT A;  1MZ9 A;  1MFZ A;  1FU1 A;  2IFN A;  1IO4 A;  5AVS B;  1J1D B;  1A02 J;  3GHG A;  1J1E C;  1HGZ A;  2CPS A;  2N1T A;  1H88 A;  2Z5H A;  4GIF A;  4WY4 D;  1KZU B;  5AVY B;  1JO5 A;  2W27 A;  5AW6 B;  1QL1 A;  3BVH A;  2OYI A;  3VMY A;  4N3Y B;  5CHX A;  2FYZ A;  4C7N B;  2N9B A;  2WPR A;  1GZL A;  2A45 H;  3RK2 D;  2O1J A;  5AW5 B;  2HYN A;  1LTS C;  3RL0 D;  4WY4 C;  3L37 A;  3B5N B;  1SQB K;  1ZR4 A;  1EQ7 A;  3HTK B;  3MD0 A;  4N78 D;  2Q7C A;  1T2K C;  1N7L A;  3HD7 A;  2E42 A;  1GU5 A;  5AW9 B;  2KSJ A;  1LTI C;  4N6J A;  3L4F A;  3BRT B;  1N2D C;  1CI6 B;  1FZB A;  2O1K A;  4WY4 B;  4AUW A;  1RE4 A;  3H32 A;  2E43 A;  2R5B A;  2HFE D;  4N78 E;  5APQ A;  1M7L A;  1M1J C;  2HOD A;  2P7J A;  4KHX A;  4HH2 A;  1JMM A;  2KYV A;  1L4A A;  1FZG A;  1SLQ A;  2KOG A;  1S9K E;  5BU8 B;  4C7R A;  2R5D A;  1L4A C;  5KLV K;  1FZC B;  5BVZ A;  1YTZ T;  1RF1 A;  2KP8 A;  3OAK A;  1OXZ A;  3OA7 A;  4RES B;  1ZV8 A;  1RE3 C;  3SWY A;  1G1I A;  3NMD A;  1LT9 A;  1NTZ K;  3R2P A;  1VPC A;  4LLH A;  1LTB C;  1HUC A;  2FKW B;  1GL2 A;  4IFM A;  3MGN A;  3RK3 C;  1IFN A;  2IPP A;  2GUV A;  1KIL D;  5AW0 B;  4M3L A;  1KFM A;  2YKO A;  3BAS A;  1PFI A;  5AVR B;  1IJD B;  3A2A A;  2Q5U A;  2IFM A;  1E5W A;  1GW3 A;  2N1T C;  3B5N C;  1LWU A;  1X9V A;  2MJZ A;  1CI6 A;  1GK6 A;  1RE4 C;  2M8R A;  3TNU A;  1JCD A;  2OYI C;  1FBM A;  1FDM A;  5AVU B;  5CCG C;  3L35 A;  1NH4 A;  1NOH A;  2OYI B;  3HRN A;  4Y99 C;  2LKM A;  1FAV A;  2N1T D;  3CLQ A;  2POH A;  1LTA C;  3VN0 A;  2P67 A;  2WIT A;  3B5N A;  1WT6 A;  2I1K A;  2GUS A;  2HLO A;  3H6P A;  5APW A;  4W80 A;  2FFD B;  1FJP A;  1FZC A;  1T3J A;  5AW4 B;  5APU A;  5AW3 B;  2YKQ A;  1NWQ A;  2JEE A;  1KIL A;  4ZKP A;  3II6 A;  3KYQ A;  1H8A A;  3P8C E;  2HPC A;  1N73 B;  1ZR2 A;  2IX7 C;  3V2Q A;  2PP6 A;  3HE4 B;  3VYI A;  3V2P A;  3LID A;  2WPQ A;  2ZXE B;  2YNY A;  1JY3 P;  1JTH B;  5BU5 A;  1NU1 K;  3O8Z A;  3RL0 B;  1NTM K;  3PP5 A;  2HG5 D;  3EFG A;  1SQV K;  3KPE A;  3RK3 B;  3M9Q A;  4W7Y A;  1IFI A;  3P32 A;  1NAF A;  3NFQ A;  4GT1 A;  2OYH A;  2WWW A;  3M9H A;  1GK4 A;  3IR9 A;  1FZE A;  1LTJ B;  2H43 A;  3A3Y B;  1GDT A;  1LTT C;  3HE5 A;  1DX7 A;  1HJB A;  2H7H A;  1J2J B;  2H8P D;  1JY3 O;  1T3U A;  3P8C D;  5APY A;  3LIE A;  4WBA A;  1A02 F;  3C9I A;  1T2K D;  2P2U A;  1JTH A;  1KFN A;  1OWA A;  3M0A A;  3MIW A;  2OYH C;  3M91 A;  1JNM A;  3TYY A;  5APS A;  1MV8 A;  4WB4 A;  1G2C B;  3MTU E;  5APT A;  3HTK A;  1N7S B;  2KB7 P;  1X8Y A;  1Z56 A;  1WRG A;  1W2E A;  3M0D A;  4XA4 A;  1KIL B;  3EQ2 A;  1JY2 N;  1CW5 A;  3V2R A;  3TNU B;  3HUS C;  5KJ7 A;  1DH3 A;  1SFC D;  5AVZ B;  3H32 B;  4EIJ A;  3CI9 A;  4DOJ A;  1LT9 B;  3UIA A;  4C7N A;  4WY4 A;  3A5T A;  2Z5I A;  3B5N D;  4XE5 B;  2Z4E A;  1AQ5 A;  1FJK A;  1L4A B;  1H89 A;  2R32 A;  1LTJ C;  1M1J B;  2R3C A;  3SWF A;  1GD2 E;  1JOC A;  5CCH D;  5AVV B;  2NPS D;  1LWU B;  3VOP A;  3RK3 D;  4HYT B;  1SFC A;  3LW5 H;  1URQ C;  1KIL C;  3A7O A;  1HH0 A;  3U1A A;  2C0X A;  1FZA A;  4I6M C;  2XKM A;  4ZKU A;  1N73 A;  2N1T B;  2HPC B;  2C0W A;  2WSE H;  1VDF A;  1SP4 A;  1RE3 A;  2A45 G;  1GTW A;  1XTG B;  2J58 A;  3V4W A;  1SQQ K;  1GL2 C;  3CL3 D;  1X79 B;  3E1I A;  2YMY A;  2HOD B;  1IFM A;  2PAJ A;  4IFF A;  2O01 H;  2QM7 A;  2CPB A;  1RY3 A;  4Y99 B;  1LWU C;  1NTK K;  3HD7 B;  1FOS F;  4GKG A;  2Q9I A;  1IC2 A;  5CMZ A;  2NPS A;  3IFM A;  2FXM A;  3T97 A;  1J1D C;  2XNX A;  3NXS A;  4O9B A;  5AW8 B;  1FOS E;  2YKP A;  1AFO A;  3HD7 C;  3I5C A;  2YO2 A;  2FFD A;  4I1L A;  1MUU A;  5CCG D;  3HUS B;  2JJL A;  1HWT C;  1IFD A;  1NKN A;  1M1J A;  2XV5 A;  3RK2 B;  1LTJ A;  3N7N A;  3HE5 B;  2WT7 B;  4I2L C;  1CZQ A;  5APX A;  3RK2 C;  1N86 A;  3HD7 D;  3GHG B;  4C46 A;  1YTZ I;  3KQG A;  4JYB A;  3U1C A;  1GW4 A;  1CSB A;  1DEB A;  2M3B A;  1QL2 A;  5AW7 B;  3KDP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...