3HE6C

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta8.2 nkt tcr
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
205
structure length
203
Chain Sequence
b'TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 38
structure length 203
sequence length 205
ec nomenclature
pdb deposition date 2009-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he6C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he6C02
5K59E 5HHXL 2FJHA 4LSVL 2KUTA 3QUMB 5HHPA 1M7XA 3DUUA 3PGCB 1A4KB 5IBTL 3LMJH 4FXGB 5C6TH 1XGTA 2W60A 4KK8D 3P0YH 4P4RB 3AREC 4ZYKA 2VLMD 5ISZB 2D0FA 3CDYA 4K7PY 5BS0D 3VGFA 1A6UH 1IGMH 4JQVA 4QWWC 4F57L 5CBAB 5J11C 1HINL 5AUMA 2YPVL 1JNLH 4PJXE 3RGVB 3IKCA 4BJLA 3QIWB 4EUPG 4HAGA 4E9LA 1OM3L 3EO0A 2WQ8A 4PJ8A 3SJVA 3MLZH 3GGWA 3WIHH 4EDWH 3CFBA 1KB5L 1V5JA 4I8DA 4KDTA 2OXGA 1OLZA 2MHAA 1MLCA 1H3VA 3GSQA 5DUMH 5T1LB 3TIDB 1CD1A 2IC2A 1Q9OB 1KC5L 1QSFB 3DRQA 3MRRA 1K4CA 4XCFL 2AXHA 3G6JA 2PYED 1UYWH 1OSPL 4KZDH 2ARJA 2KPNA 2QADC 4MNQE 5MERA 3QWRD 3TYFA 5FGBA 1U8KA 2Y72A 1U3YA 2VAAA 4TUJB 4YHIA 5FYLE 5INCA 5I1KL 1FLTX 1I8KA 4I3SH 4NRZA 1F4XH 2Y07L 2ADJA 3GJFA 4JVUA 1E6JL 4G42B 4ZNEE 5HYSB 1T1WA 2R9HD 4NO5B 43C9A 3N9GH 1NBQA 5D96C 5T3XH 4HIXH 5TQ0H 4FQ2L 3IB4A 1PY9A 3UMTA 3U79A 1N8ZA 4LF3B 4HHAB 2PW1B 2CIKB 4OGZA 5H8DA 4NWUH 3VRJA 5L0QC 1T89C 4HZLA 4LNRB 4C4KT 3MXVL 1E4XI 4Y1AE 2EIZA 3VXUD 4DUXA 1QSVA 2F53B 1QG3A 2WIIB 3RZWA 1PG7H 4U1LB 1YN6B 4MNGA 4AT6A 4EDXB 3NPZB 5CCKL 4XMPH 2OTUB 5HTSA 1Y6NR 1OT2A 5ERWB 3LS4L 1B3JA 3QFJB 5DMIH 3B9KD 4F8QA 4OZFA 1DQLH 1F3DJ 3SO3B 1I85A 5FUOL 2UV3A 1IGIL 2ZUVA 1RQ5A 2W9EH 4KI5F 5C0DB 4H20L 5TE6H 3RVXD 3MYJB 1GZPB 3LIZL 3HUJF 1KIPA 1FP5A 1NEZB 3G6DL 5HGHB 1HH6A 3LEVL 3NCJH 4HJ0C 4MAYA 3PHQB 4B41A 2JIXB 1MHCA 2RIKA 5KZCB 2L7JA 4PP1D 3SOBL 4G9FA 1VFBB 1AR1D 4XAKD 1PY4A 2VKWA 4FFWD 3QIWC 1UM5L 1N3NB 4GAGH 2VXSH 3R0NA 2EYSA 4G6KL 3C5ZC 5E56A 4PJBE 1IAIH 3TT3H 3GHBH 5DZLA 2I9LA 4HWUA 1KB5B 3PL6C 2CH8A 4LIQL 4Z78A 4PLOB 1J87A 2OMNA 4LVHC 2DJSA 1B2WL 5IBLC 3VW3L 1XIWA 1KJ2L 2JJSA 3DECA 1ZWIA 4DZBA 3QIBB 4JAMB 3FT2B 2GJZA 4IS6A 2E7HA 5GHWL 3SKMB 3QUYB 3TBSA 1YEHH 1RSFA 3RVTC 4Y4HC 4GQ9H 4S0SD 1VSCA 1YC7A 3CMGA 1QSEE 1B6DA 1FFQA 1F3DH 1H15B 2KL6A 4HWBH 1AO7E 4MD0A 2YD7A 1RJZA 4WUUA 3DXAE 5BS0B 2ZPKL 2BNRB 4I48A 3SDDA 3T65B 2A6DA 5F44A 3X12B 5C0GB 2QR0A 1VEMA 3K46A 5F6IB 1FL3A 5FCSH 5TE7L 4ZFOA 4S1DD 5D6CA 4K94H 3FQUA 3BXNB 3U46B 2EC9U 4ZS6D 3GKWL 4WV1B 1OAUH 4I0PD 1T4KB 1YUHA 5DVOA 1QO3B 1DQQB 1T20B 5JW4N 3QEGL 1MCOH 1JHKL 2DM2A 4NQCA 5I8KL 2ID5A 2VUOA 4KUZL 1FIGL 2X7LA 4Z8FL 2X1WL 3MCLL 5IVNA 3MCG1 1MHHB 3BO8B 1JZ7A 1C08A 2W0FA 3NFPB 1J8HE 4PYGA 3GNMH 4G5ZL 4WUKH 5DRNB 4MXQC 3SCMD 1UJ3A 4YXKH 2YOCA 1T7YA 2YKLL 3MGOB 5I15L 2NW3B 2PTTB 2AEWA 4JZJB 4BA8A 2QQQA 4QTHB 1JRHH 5E8EA 1EVUA 1NC4B 2R69H 1NFIB 3UTTD 1PLGH 4FQHA 3S37H 2LFGA 5T1KA 1R5IA 2APFA 5ACZA 3QA3A 3GEWB 5C09E 4L1HA 4Y4FD 5D7IE 5BRZD 3WXVH 4RZCB 4BUGA 5C07D 3ZE2E 4HD9A 4LHUD 3CD4A 1W0VB 3I02B 3LKPA 2AQ1A 1KLUA 1NGWA 1HQ4A 3QQ3A 1WWBX 4XXDB 5IFAL 2F54E 1RHFA 2R1XB 3T4YB 4OM1L 4UOJA 3L95A 5EBMB 3B6SA 3RWHA 5BV7H 3VXUB 3QIBC 2HWZH 3DGGA 2VERN 2FH8A 1BPVA 5FYKH 2HH0H 1HCVA 4OCXL 4Z7VF 4X6DB 5E6IA 3U6RA 3S9DB 3LN5A 3QDHA 5CP3A 3QDGA 5IGXH 4WHCA 1PKOA 3OKMB 4HIJA 3FB7B 3PP4H 1LQSR 4JY6A 4PRIB 3UCRA 1TTUA 4KRPC 4J3VA 1WT5A 4IDJL 1YEDB 2YN5A 1GH7A 4JPKL 4DZ8B 5JTWA 5EDXA 5I75B 5F6IC 5LKNA 2C3GA 1MFNA 4EXPX 5IROA 5E08L 1NMCC 3JTTB 1CQYA 3FO9A 3VXOB 2IADB 2NY0D 4WV1C 4MWFA 15C8H 3ARGC 3EJZD 4MLSA 4TVPD 5DRWA 4U6HA 3AM8C 5FV1L 3QDJE 5CZXD 1JVKA 1FG2A 4YIQB 4J3OC 1NGQL 5IW1B 3NIFE 2Z92B 4FZ8L 4FQ1L 2NZIA 1BEYL 1FLRH 1FVCB 4FQCH 3W0WB 1BD2E 4EZMA 4PUBH 1JWUB 2FO4B 4XP4H 5JLZB 1S7VA 3S4SB 1ADQH 1XGUB 3SGJA 3TPUB 3SDXA 4A6YA 4GOSA 1LILA 3U36B 2XTJD 1NCWH 3BWUC 1DDHB 4OIIH 3IAGC 5CINL 4E42A 3FO2B 3G5VA 4WHTA 4OQTL 1J5OL 5D4QA 1XF2A 1B88A 2AEIT 4DKFL 2VDNL 2XXCB 1AGEA 1W72L 2ORBH 3P73B 4KKBC 1NGYA 1IGJA 3G08B 3FQXA 1A0QH 5F7DB 1ONQB 2EDQA 2ATKA 1XR8A 4N68A 3WS3A 4M6AA 5C9JA 3Q1SH 1XAUA 5IB5B 2WP3O 3DI3B 1A02N 1KEML 2FL5A 3MOBH 2GI7A 1IM9D 1J05A 3D3VE 5EU6E 3T8XB 2CUMA 4R0LA 5MENA 3MFFB 3UTZB 2X4RA 3NABH 3MRHB 3MUGA 5KW9L 4QY8B 3T2OA 1G7IA 2JTDA 2C1OA 5GZNC 1FVEB 3G6AB 5CUSH 1FYTD 3DTXB 5JXED 4FQIH 4JN2A 1CXFA 1INDH 2NX5B 5E9DD 4ALAL 3DARA 2DQEH 1KJ3H 1NLDL 4JKMA 5CD3B 4KV5F 1RUKL 1NDMB 2DQHL 4XNMB 4F37F 4PJAF 3EZJB 4GKNB 1BOGB 4UDUB 1ZT4B 2AK4A 1EHLH 2VLRA 4LCWE 5F89A 3DYMA 3PNWB 4NRXA 4N90E 2R0KL 4JJ5A 4C57C 4HUVB 3HUJB 4MJID 2ERJB 5BRZB 1F13A 1MRFH 2WBKA 3H3PH 1IC4H 2VZ3A 5CGYD 3O41B 5IF0A 1D5XA 2ZOLA 3ARXA 4FQLH 1EERB 5EPMB 5E2WL 3UXFA 1DEEB 4MA3B 2BC4B 3MNWA 1RZ7H 2HFEB 4IHOB 4ODXB 5HJ3B 4GRLC 1JGLL 1VPOH 2RJMA 4AMKH 1ZVYA 1FGVL 2IPKA 4FN0A 4LK4A 1MLBB 1M7DA 2WWKO 4FQQA 3SDAB 1CYGA 4RMVA 4Z5RA 2YXMA 3QHTC 5E5RB 4BH7A 1K8DB 3DMMC 4KVNL 4JM2C 4TSAL 3ISWA 1AGDA 2ADFH 5ESQB 1W72B 4AIZB 3P77A 5I74B 4XC1L 1C1EL 4LIQE 1SM3H 3EGSB 4G9DA 5IMLB 4L29A 4KXZI 1J0ZA 2FNBA 2FJFA 4I0CC 5H37H 5KSAB 2NY0B 2AS5M 3QCUH 3IFPB 4D8PB 3LHPH 1YECH 1YN7B 3U0TB 2ZSVB 3UTOA 1LK2A 3EBAA 3LS5L 2FSEA 1ZLSH 4M7LH 1I8IA 1U3HA 2GT9B 4Q7DA 1WAAF 3S36L 1MCFA 1SEBB 2UZIL 2YC1A 4P49A 1L9MA 1K4DA 4M7ZB 5CIPB 2A74A 1T6WA 4G6MH 1DE4B 1XCQB 2VB5A 4Y16A 1SY6A 4OFKA 1KPUA 5I30L 1OTTD 3O2DL 1YNKL 3QQ9D 1QBLH 3MBED 3MRMA 1HI6A 4HIIA 4M6OH 1A5FL 1NGXB 1H5BA 3F58L 1WBXB 4IOSD 4P99A 3IVKB 4PRBB 1IGFH 2Q7YB 5ETUA 4C83B 4HMDA 2ESVE 2FATL 3BAEH 5DD6B 3AS0A 5DJCA 7FABL 4Y4KA 1YMHB 3WFCL 1FAIL 5JPMB 4P9HH 3UAJD 3IDUA 1KIQB 2V5YA 3QUXC 2AJ3B 3VGAC 3AGVA 2P46B 1V7NL 2X4PA 2AI0L 1E27B 4JHWH 1QFWL 3QB7C 3SKOA 4XCEB 4FP8H 3MYZA 4HEME 4GW5A 3IYLW 8FABB 4KPHH 3EO1B 3LQZB 3CCHA 4G7YL 4CU7A 1J1OL 3HAEB 5D1XD 5TF0A 3UPRA 3FN3A 3L3DA 3P0GB 4QOKE 3FN0H 2A9MH 3VFNB 3MRFB 1IM9B 4HG4J 5E4EB 4RGOL 3O3AB 2P43B 4PJCE 1KXVC 3D85A 3SDAC 3MJ8B 1JGDB 3S5LG 3KPSD 3KNBB 3T0WA 2CMRL 3SE4C 4NOFA 4JRYD 2J8UA 1RIUL 2A38A 4KGJA 2VLJD 2OLDA 1AGBB 3QXDB 2X1PA 3RGHA 1U8OB 4Z7VB 5TPWH 1RVFH 1L7TH 1BWWA 1ZT1B 3JV4A 3KVQA 5MP6H 2BP3A 4RMUA 5HHOA 5GJTH 1CFSB 1FSKB 4LCCA 2NZ9C 3SKJL 3TJHC 3OKYA 1EEZB 5BMFH 2BOCB 2NPLX 1KCSH 5D7SH 5I1IH 1HHKA 4LPVA 2FRGP 1MFBH 1F2QA 3G5YA 4QT5A 4OLWH 1I7TA 3CVIL 3BH8A 4KKLC 3P9MA 3STZA 1CFQA 4MJIB 5E00A 3V0VA 4L4VB 4ZTPH 5F7YC 4PGJA 4OF7A 3PQYE 3BKYL 3D0LA 4ZFGH 1I1AD 4TRPL 3C08L 1G7MB 4HIHB 1H3GA 4XT1C 5HHNB 1KULA 2FLRT 2J6EL 4JFFD 4R4FL 1N6QH 3OZ9H 2O61A 1AIFA 5F97E 1QLFB 4BQBA 4NHUA 3P4OA 3AU1A 2YPLE 1OPGH 3BESR 2V2TA 2B2XH 3W9EA 4H26A 3G9VA 2BSSA 3QZWB 6FABH 3STLB 3WLBB 1Z0MA 4XP9H 4W81A 1WBYB 3LQAH 1DVFC 1Q1JL 1RMFH 5C0JB 4N0CC 1MQKH 2CDGA 4QRUA 2HJFB 3K74B 1FNEB 1MH5A 4TVPH 3RI5F 1A7QL 4YNYA 1DL7H 1ZS8B 4ONHB 5L2KE 3QUKB 4NM8L 2MPAL 2HLAA 3CLEH 2I9TB 2ATPB 4GW4A 4JFED 1MJJB 4OFPA 4EJ1C 3QDMB 3FMGL 4KKCD 1J88A 3ARDA 5E4EC 3ZYZA 4R4ND 4L9LB 2A9NH 3DV4A 3LPWA 5CZKA 4CVXA 3U7YH 1EAPB 5E2UL 2HT2D 4TULH 1U6AH 1JPGB 1DN0A 4XPFH 3MLRH 3OR7B 3VRIA 4XPHH 3DV6B 4LGPB 5SWSA 4Q58C 2IF7A 4BK4A 3ARSA 3V4UL 4FTVD 1KXQE 2G9HA 2CLVB 1HYSD 1BBDL 2AEQH 4OJFL 4HBCL 3G04B 4G8FA 3UO1H 4FFVD 3AS3A 1NLBL 3VFTA 4ESKA 1ZGLA 1YY8B 3WHXA 1OL0A 1WEJL 4G6JL 3INUL 1JPTL 4LVEA 4N8VG 3RJDA 2UZXB 1CGVA 2PR4H 2Q86A 3RWEA 5CP7A 3T4AB 5A16B 1P4IH 3OPZH 3VMPA 4DAGH 1CFVH 3ARBA 3G6JF 4XHJD 1AXSA 5C7XL 3JTSB 5JZ7C 4GKZB 2YMXH 3ZE1E 5LJYH 3A6CL 5D1XB 4Z77A 1IC5H 1M4KA 3P11L 1QLEH 5JHDD 5CJOH 5T1MB 1OSZB 3TYGH 4U6XA 4JEGB 1I3RA 1FPTH 1EH9A 3V0WH 5IFHH 1DEDA 1Q0YL 3QUZD 1CICC 1PVHA 3TH3T 1UQSB 3BP6A 5I19H 1UZ8A 2Q6WA 3GSOA 4UTBH 1GL4B 4U1IA 2ED8A 5FUZH 4NQSB 1S8DB 4MCZA 3VFGH 2GAZA 1AQDA 4NQED 2YK1H 1G0DA 1TETL 1HN1A 1EGJH 5TH2A 1OGAB 2LVEA 3U0WH 3I50H 2NY1C 4Z7OE 1AR2A 4TUKH 3MLVL 2NXYD 5I76A 3ABZA 4ZS7L 3LMJL 1R0AH 5C6TL 4YDLB 4IOIB 5DI8A 1T22A 4EN3D 1SMAA 3OL2A 4LVOB 1R5VA 4UUJA 3TVMA 3EDEA 4FG6D 3TV3L 5BJTA 2HTKC 2X4SB 5D9SA 3IFOB 3WFEL 4F8TA 1LNUA 1NFDE 3NIGE 4NYLB 4JFPA 3FN9A 4XP6L 2ZCLL 1QUNA 2ZCHL 1OAQH 4MA8H 1A9BB 3IJSA 3ULUE 4Q6IB 4PRHE 2IALA 1R5WB 2WSKA 1WK0A 1YY9D 5CMAA 1U93A 3P4NA 5D93B 1A7RH 5FB8A 2ZNWA 4G80B 2V5MA 1U8NB 1G7HB 2CDEB 3H9HB 5H37G 5FXCH 4UDTA 1MREH 5D5ME 2E8YA 1UCTA 1XF5A 3EHBD 3TIEA 3UTSA 5SWZD 4KZDL 3I2CH 5EB9A 4ELMA 5HDQL 4ZMAT 2YWYA 5GGTL 3ZT5A 1YPZA 4MNHB 2BVYA 3ELAT 4AENB 2P47B 3M8OL 4P2CG 3DUSA 1S7XA 4S2SB 5F7LB 3L3GB 4XP5H 2Z0BA 3HI1A 5CILH 2R1YA 1KIUA 4TQEH 1OAXL 2O5YH 2BDNL 3D87B 3N9GL 1ACYH 1N6UA 5DJ8B 4HIXL 3E3QC 5BW7A 2JCCA 4OGAC 5KVFL 1NFKA 3V5HA 4MSWB 5MI0B 4OZIA 1R3IL 4PJ9A 2APXA 4EXKA 1CGXA 1Z3GH 2XT1B 3NZ8A 3F7VA 3SN6N 3SDCC 4E0RA 4F7EA 2V7NB 4JPIA 1NAMA 1KXTB 4CW1B 4OBSA 3QNYB 3HMWL 1I1FA 3HB3C 3E6HA 3A67L 3TBWA 5DMIL 3WD5H 1DQLL 2P5WA 3G5XB 1QLRA 3MXWH 3ULVF 1I4FB 3K2UH 4DGIH 5JA8B 2W9EL 4OT1L 4YDLC 1I7ZB 5TE6L 4LVOC 1SJHA 2EDKA 2VZVA 1EEYB 2DKUA 3GMLB 1PKQE 2ZUQB 4HWEH 3NCJL 3QEQB 5ALBL 4CMMB 5DQDL 3TGXA 3N1GC 5DTFB 4OZ4A 5D2NB 1MJ8L 5T33H 3O3EB 3UYRL 4UIKH 3OQ3B 2FEEL 1SYVA 1MJUH 2ZKHH 5DYOB 3ARFA 3DUHA 2VITB 4TPRL 3OKOB 2VXSL 3RL1B 3ZT7A 5IHZB 3MLYH 4YBQC 5I1GL 3TT3L 4RDQF 1UB6B 4JKPL 4LHUG 2F58H 5DEGB 5IHLB 2OTWB 3CFDB 5IB2B 4MAYD 4WEUD 4WNQB 5D93C 5DJ0B 5JW4R 2V17H 1DLFH 1F6AA 4F3FB 3H9YA 4G9FD 5FCUL 3T09A 1UH2A 4I77H 2Q3AA 1T2QH 4M5YL 1NUNB 2UYLB 4X9HA 2AJYL 2Z31A 4NQEB 4IIQB 2NY2D 2VZSA 4XCYA 1QSZA 2VXQL 4Z6AT 2EDRA 2HTLC 5ITFB 43CAA 1IAOA 3HR5B 2OP4H 1I9EA 3H9ZA 5ANMB 1UXSB 1A9EA 3QXAB 4WW1A 2NXYB 4PD4K 4ISVB 1BX2A 2XA8H 1OQXA 1P9MC 2XZAL 1XIWD 2BFVL 3IU3B 1QBBA 1E4JA 2H8PA 4LEOB 1BQHA 4XB7A 4UBDC 1J18A 1QR1A 3THMH 1TJIH 2QHRH 2LVCA 3U1SH 3E3QE 4OBRA 4HJJH 1D5ZA 1JHLH 3UBXA 2H2SC 1A64A 1RZKH 4DEPB 2NNAA 4YX2H 3FO0L 4X6CE 3FFCD 2DBLH 2PXYA 5AG8A 1F8TH 1XGTB 2W60B 4AK1A 4Z7NE 3RHWK 3HZYB 2DQFA 5DA4A 3SBWC 4JGUA 4ZYKB 4F7PB 4OCYH 5DR5L 4BKLB 4MA7L 1EZVY 2AP2A 4BQ6A 5A2JH 1S7RA 3QO1A 3EOTH 4P5KA 5CEXA 3L3KA 3VXPA 5SWQA 5I1HL 3IKCB 3VFSA 5HDOA 25C8H 3U30B 4Y19B 3B2UC 3KPPA 3EO0B 1UM4H 4PJ8B 5DLMH 2XWBA 3SJVB 3GGWB 2UWEA 1ZHBA 3W81A 2D7MA 2DTSA 3CFBB 4NQCD 3UZVB 3NTCL 3PWLA 3SDXF 1MLCB 3ULVD 2N7BA 1GIGH 4JFDB 3GSQB 1PLGL 3H7LA 1JPST 2VQ1A 5C3TA 4AEIH 3TT1L 4IRJA 1QFWI 2HT3C 4L8BA 3V6OE 1CD1B 4GXUM 5J7CC 3Q2CA 1EXUA 3Q0HA 3KGRA 3DRQB 1K4CB 4R97C 2A83A 1M7IA 3NCCB 5HDLA 3VD7A 2MQCA 4ZUVB 2B39A 4NZUL 2ZSWA 4RFOL 4OUOA 4MJ6A 3GBNL 1S7UB 3FB5B 3M45A 5MERB 5GSVB 3W11D 3L5HA 1U8KB 4ERSH 1UENA 2VAAB 5T1KD 3AUVA 4P3WA 4NRZB 1KPRA 4BQCA 3O2VH 1TJHL 2ADJB 1WZKA 1T03H 3DVFA 2HWZL 5JR1H 1TMCB 3MJ9H 4MD4A 1T1WB 43C9B 1A7PH 4NO2A 3KYKL 4ODWA 4ONOA 3J7HA 2FBJH 4KGLA 1MUJA 1LEIA 4Q9RH 4FRWA 4GRWE 5IGXL 1N8ZB 3ES6A 4S1QH 2N56A 1FO0H 2DM3A 1IVLA 3VRJB 4WFHE 1OVZA 3PP4L 4HZLB 1JBJA 3HE7C 3U9UA 4ZO9A 3WDHA 2OJZH 4PTTA 1DSFL 4AT6B 2R0ZL 1E4KC 4YFDB 3TH2T 4CVWA 1WTLA 3NA9H 3O6ML 3C6LC 3GFUA 2GK0A 4ZPTA 1IM3B 2VLKB 2G75B 5IESH 1JGVL 3JWOL 4JO1H 4BSJA 4HF5H 1BZ7B 2NY3D 3HRZA 5FIEA 1ED3A 1URLA 3RU8L 1H8SA 2XWJA 5JOFA 5E5MA 1KIPB 1J7VR 3CU1A 3QP3A 4OUUB 2OL3A 12E8H 1KYOJ 1HH6B 3C60D 3GM0A 4KKAD 1YMMA 5D2LB 4MAYB 5I0ZA 1NH6A 4PGEA 3TO4A 4C55A 3F6LA 5DWUH 1JTPA 4FQCL 1QFWM 5GRVL 4PRAA 2EYSB 4PUBL 4OV6F 2BCKA 4XP4L 1CT8B 1K85A 3R0MA 3QZWG 2DWDA 2KQNA 4ZSOE 5C86A 1C7TA 2XKNA 3WNOA 3OKNA 2APTA 4RA3A 1JTOA 2DI9A 3FB6A 2NY7H 4P5TD 3HZVA 1LEKB 4D94A 32C2A 4RMWA 4DZBB 3NFSH 2IPUK 4U3CA 2BVQA 5CFHA 3JWDH 2AGJH 4BZ2H 1FJ1A 3LPGA 3HG1A 4HUNB 1OP3K 5D70H 5FM5M 4U1HA 1ZHNB 4PV8B 4PJIE 3O45A 5EBWB 5J12B 4MD0B 1GC1H 5JO5A 5HGDA 4P9MH 5IHUH 4WUUB 5DD1L 4I48B 3SDDB 1JF6A 4JGMA 2MMXA 3JV6A 4NN7B 5D1QA 4HXBH 5F8RC 5FUCC 5AWNH 4M6NH 2R1WB 2CDFA 5F7UA 4L3CA 4ZFOB 1X5FA 4WW2C 4W6WB 2ZG1A 2HG5A 2Y4SA 2EYTB 3QNZA 5TE4L 2H1PL 4LSTH 4ZO7A 5HHVH 5FM5O 4IMLB 3OJDA 3OB0K 5MEND 4PJ5A 5T3XE 4Z0XA 3MA7A 2FH6A 4PPTA 4GXVL 5GJSL 2VR4A 1C08B 2W0FB 3GSXA 1Q94A 1CL7L 1JMXA 2R0LL 3OXSA 3GJFH 3X3FL 3GK8H 3F7RA 2BRRH 2XG4A 5E8EB 2FWOA 2HKHH 2AABH 4A2LA 2AK4D 3SE8L 3LKSB 1KSRA 1BJ8A 5T1KB 3BVNB 2EKJA 4DN4L 5ACZB 3QA3B 5INDA 4I0KA 5IMOA 1J10A 3HKFA 5DO2C 4AMKL 3C87A 3MV9A 5LBSH 3ZE0E 3WFBH 5I2IA 5C0BA 4HC1L 3RWIA 3LKPB 4OZFH 5IG7A 5IMMA 1KLUB 1HQ4B 3QQ3B 1ERNA 5D7JD 1MI5D 4M48H 2EH8H 1RFDH 1N64H 1WC7A 4UQ2A 3L95B 3B6SB 1TLKA 1EX0A 3D2UA 1IMHC 2EE3A 5J06A 5E6IB 4OCLC 2NY6C 4ODVH 4OD2A 3KXFE 1TXKA 1J12A 4RBPH 3DX9A 3JV0A 3I3BA 3QDGB 4HCRA 3MLSH 4LLUA 5KVGL 3MRBA 3FTGB 3P30H 4TNWF 2NY3B 4JY6B 4JDTH 1HKLH 3LHPL 4WCYL 1YECL 5F1IA 3FZUC 1G7PA 3MOAL 2COQA 5B39G 3BJ91 4NN7C 4U05A 1T0NA 4M7LL 5T3ZD 4O9HH 2QJDA 4X5XA 4MA1C 2OX5A 1XZ0B 4JE4B 3EIFA 2ITDA 1INEH 4Y5YC 4D9QE 2VXVH 2F8XC 3OAUH 2NY5H 5GRWA 5F1NA 4FQXA 1IGTA 4XNQB 1FNGA 4M02A 3K2MC 2M1KA 5DRWB 5K9JH 2PF6A 1GOGA 5ICXA 1QBLL 3S3SA 3QCVH 1J1PH 2QL1A 1U3HD 3O6FB 1A47A 3GSVA 3V0AC 4WU5B 3D39D 1U2HA 1CGSL 5IMKA 3CH1A 4LSUL 3IDIB 1UH4A 4M00A 1IGFL 1I1YA 4RAVA 4KTEH 3JWOC 1CDYA 1RI8A 3T0EC 3CSYA 4Y16D 4X4XA 3WNLA 4MXWH 5D1ZC 3RVWC 4JRXA 1E6OH 3JVGA 4R3SA 4JPVH 1RK1B 2J88L 1SBSH 4WTZA 4L3EB 1CWVA 3SDXB 5B4MC 4JHWL 2VC2L 3ZL4L 1EFXD 5KS9A 4M03A 3BQUA 4KPHL 3CZFA 3VXMA 2VDKL 4WHTB 4WVRA 4Y4KD 3MV7D 3EYVA 1XF2B 3EKCA 3FN0L 1AGEB 2A9ML 5C08A 1NGYB 5DHVH 4DTGH 2KQMA 1IGJB 5DD0L 3FQXB 1HOCA 5E7FA 3NPSB 2ATKB 1XR8B 2CKBL 1LP9E 4PGBA 1F45A 2IMMA 3WS3B 5C9JB 3ULVH 3PP3H 1T0MB 3I6LE 4S1SL 4ONGL 1G9MH 5DQ9B 3VXRA 1AXTL 5KN5A 5GRXG 2O93L 3RWFA 1RIHL 2EE9A 5MENB 1HDMA 4K3EH 2X4RB 3D85D 5FECB 4LLDA 5F7EL 3MUGB 5MP6L 5JW5A 5F96H 5GJTL 1G7LA 1S7QA 4GO6B 2ZWLT 4OTXH 2W9DL 1RJCA 1MFBL 1X5XA 4PJ7E 4OLWL 3BZDA 3GI9H 3OAZK 5FYKE 2FEEI 4TNVK 3O3BA 5H94A 4JN1L 4MB5A 2K7QA 4E5XA 2QSCH 5C0CE 2I5YL 2ZUSA 2DMKA 5HHOD 2WW8A 3UTPD 1MFAL 2VLRB 5F89B 3FONA 4K9EL 3RIAF 4KJWD 2JELL 3S35X 5K33A 1A7BA 2J5LB 4NRXB 4JJ5B 2DM7A 2QLVB 2R23B 4F9PC 1N6QL 3C9NB 5F9WB 1LO3L 1J0IA 4OI8A 3LKNB 5DD5L 1MRCH 2R9HC 2B2XL 1FQ9C 3NH7H 4ENED 3V5KA 4Z7QE 4QRRE 1ODAA 3O6FC 6FABL 5IF0B 1D5XB 4XP9L 2C3HA 4P2QE 5C0AE 4UTAL 2XXMB 3EJJX 1CTNA 5GS0D 4KHXH 3T0EE 4RGMC 3S7GA 4ZOAA 4V1DB 1WVZA 2O5ZH 3WJLA 1BQLL 4HXAL 1J0KA 5HYEA 1WFUA 4FQQB 1DL7L 4IMKA 3LKRB 4Z5RB 4XWGL 2OR9L 4I3RL 1QRNA 3GMRA 5E8NB 3ROLA 3NMEA 3B9KC 5HY9A 2DRUA 5AYUH 5FM4A 1BGXL 5JOEA 4E41A 2VLME 3MGTA 2DD8L 1I7UA 2ZCKH 5JDSA 4OFDA 4PJGA 3WIFA 1PEZA 4LFHD 1ZA6A 3BRDA 1LWRA 3EYUH 5IEKB 3NPSC 4NUJA 4OF8A 3U7YL 3ZDXE 3JUZA 1QFUH 1A3LH 2D0HA 3LPFA 4G9DB 1TCRA 1U6AL 5EC2B 4L29B 1IEAA 3L5IA 1FNAA 2FJFB 4GJTB 1AR1C 3MLRL 1FE8L 4FFWC 1KCUL 5EUOE 4XPHL 1CXHA 1AFVL 2JE8A 3UDWA 4KK6C 3DSFL 4WGVB 2YD1A 3ARDD 1RZFH 4KRNA 1LK2B 4X7DC 3T0VA 1YEIH 4GG6B 2Y6SC 1U95B 3DURB 5T5NF 4A6YH 1I8IB 3KR3H 5KVDL 2P8LB 2CXGA 1S9WA 3EO9L 2YC1B 4P4KA 1K4DB 2A74B 5F7HA 1S5HA 4IJ3B 2P5EA 5SWSD 5SX4H 5DJXB 1OOAA 3LDBB 2PYEE 4Q9QL 1KPUB 1J9CT 3RKDD 4I18A 3K1KC 2XN9A 5A3IC 3VE0B 4KK9C 3MRMB 1HI6B 4HIIB 3ZHLA 3LZFH 1CFVL 4DWHA 3KLHC 1IGCL 4X9GA 3VI4E 4O00A 2A6JB 1NJ9A 2VLLA 3JBG7 4R2GB 4ELMF 1EO7A 5ENWA 2HT4C 3ARPA 5ETUB 1YPZF 3MC0A 1VFAA 2VDOH 4LPTA 5DJCB 1GPOH 3GSUA 5F9WC 4MNQA 3MLXH 5IW6A 1MFDL 1MCIA 3KPMA 1I8LC 2X4PB 5IFHL 3QHZL 3ARBD 1A6WH 3GB7A 4HQQH 1OGTA 4IRSC 2VXUL 1A22B 3LSOB 4ZNEA 2JCCF 4HT1H 4OFYA 5FUZL 4OZIF 3HFMH 4K8RD 1KIRB 2YK1L 4HBQA 1TVBA 4QRPB 4CN6A 3CVHA 1HIMH 2EYRA 1AC0A 1W2KT 1M71A 4CDHA 2NQCA 3U0WL 2DQJL 3I50L 2D7NA 4DK3A 4Y1AA 1A6PA 1RPQA 4NKDA 3LKOA 2X4UB 3PGFL 2BOBB 4D0DB 4NZTH 3IGAA 1KCLA 1EUUA 1CR9H 4OIBA 3NCBB 3QIUD 3A6OA 2DDQL 1JV5B 4YK4B 3WLWD 3EYSL 3AREA 2APVA 1KF9B 5HHOB 4H1LA 3TFKD 3WSQL 4LCCB 4OZFG 4XAKE 2EDTA 1IKFL 3WNKA 4NPYA 5JIKA 5B3NA 1L7IH 1HHKB 3Q3GA 3WUWA 4WENB 3G5YB 3BKJL 3DHMA 1R24A 5E00B 3PIQA 3TVMD 3BPOC 1F4HA 4EI6B 3DVIA 2R4SL 5FHAL 2MSPA 1LVEA 2YZ1A 3N1MC 2P44B 1N59B 3RJQB 4U0QB 3D0LB 1K9TA 4OLUH 4IJ3C 2V9TA 3KPQA 3MNVA 5L8KB 4GRMB 1UM6L 2Y5TA 5IUSA 3MRDA 1AGCA 2O61B 1AIFB 4NHUB 3LDBC 3P4OB 2LAAA 1L0XA 3AU1B 4JPWH 5GRVK 4FQJH 3WFDH 3WKMH 4N9GB 3W9EB 5IFJA 5GRZA 4H26B 1HK6A 2BSSB 5T3ZH 4UAOB 1K6QH 5DJ2B 2FHBA 4R2GC 5J13C 4K9EC 5E8OB 1LO0L 4JFYA 5HHMD 1RY7B 4BQ9A 4JFOA 4KHTH 4X4ZA 2JJUA 2CDGB 3FQNA 4NC0B 1QSEA 3TZVD 4F7TB 3UTSD 4YNYB 5FKAA 4YUEH 5CILL 3S96B 3P9LA 4NNPH 3KG5A 4TQEL 4XVJL 4ZUTB 1ACYL 1P6AB 3DX6B 3O4LD 2HLAB 3UYOD 5JQ6H 2B20A 4LCUA 4OD1H 5C0EA 2GJ6D 1MVUA 4QTIH 3I6GA 5EOTA 4H25A 4N0FA 1SY6H 3ARDB 5I1JH 5FYJD 2OBGA 1IC1A 3DV4B 3KPRD 4XX1G 1T89A 5CZXC 4W6YB 1MCPL 5IQ7H 5T1DH 3QXDA 3ZO0A 3WD5L 1T1XA 3NACL 3ALXA 3FFDA 3VRIB 2WV3A 4PJ9D 2AW2A 4MD5B 2X4NA 4NP4H 4JO4H 2WBJB 4QRTA 3K2UL 3U0PA 3PGCA 1A4KA 1P53A 1BLNB 2ED9A 4FXGA 4BFEA 1YYML 4G8FB 5LCVH 3HPJB 4YK4C 3A6BH 4P4RA 5ISZA 4JDVB 1J8HA 2EXWC 2V2XA 2UWEF 4GFTB 4HWEL 3UTTE 4MJ4A 3FQWA 2EE6A 4O02L 5F9AC 3JXAA 5T33L 2IFFH 2OK0L 1F58L 1UCBL 3ZKXC 1FHGA 4UIKL 3RPKA 3W5NA 1JWMB 5CBAA 4PY7A 2HKFH 3MCKB 5CP7B 3MODL 4M7KH 5C07E 1KBGH 3QIWA 1IBGH 5C6WH 4JG1L 4L1DA 1Q0XH 1Y18A 2MKWA 3C5ZA 5JORA 4MJ5A 1G6RA 2V17L 4OZHA 4UIMA 3BPCB 3TJEH 3FRUB 3KYOB 5D7IA 4Z77B 3PL6A 4OGYH 2LV4A 1MY5A 4I77L 4RDQG 2V6HA 4TOYH 1I3RB 5I1CH 1F4YL 3TIDA 4DKEL 2HFGL 2F54A 4AG4H 2UY7A 1JNNH 1HHGA 2L0DA 2OP4L 2Y7QA 3JV5A 4H5SA 3BP6B 3GSOB 4Y4HA 4TSCL 5E70A 2NXZB 4UT6H 2V5RA 3MRKA 4MCZB 4R96B 2X41A 4Q0XH 4JHAH 4N8PA 3UJIH 4LPCA 3P3YA 5E2TH 1OP5K 1INQA 1WIPA 2QHRL 4YEEA 2UUDH 3U1SL 2J12B 2Q1EA 4HJJL 5C71A 2DQDH 5HYSA 5GS0H 4YX2L 3F7YB 4ODHH 5A43C 4N5ED 1F8TL 3BGMA 5DI8B 1T22B 1FNFA 4TVPE 4AQ1B 5AZEH 3UYPA 4P48A 4UUJB 4HHAA 3T08A 2PW1A 3OKDA 3RPIA 4PLJC 5BJTB 2F5AL 2I07B 5D9SB 5CGYC 1NSNL 2UVEA 3E8UL 4JFPB 2E9IA 2EDNA 4JANB 1TZHB 2OTUA 2PXYD 5IB3A 1LK3H 4LCIH 4NWTH 4O2CB 3QDJA 2WBJC 3IJSB 5IK3A 1JPSH 4AEFA 2CKNA 3E2HC 3LN4A 5DK2A 3HNVH 5IJKC 5C0DA 3WIIL 5HDBE 3ARYA 1MJ7H 3P4NB 2XTJE 5IB4A 5I6XC 5FB8B 2RFXB 3V6ZA 1NEZA 5HGHA 2E7BA 3FOMA 1GIGL 5BZWA 3PHQA 1MEXH 2JIXA 1Q8MA 4AEIL 1BBJB 1CE6B 1QZ1A 3DPBA 1UWXH 2YR3A 3T0DA 3VXSB 2MWCA 2C4XA 4KK5C 1XF5B 3QT2A 1CFTB 2Q8BH 3BPLB 4Q97A 1T0PB 1N3NA 4H0HB 1A7OL 2GUOB 1KB5A 4MX7A 2DF3A 4GAYB 4IRJD 3QRFM 1OHQA 4FOMA 2XOTA 3DUSB 3DGCR 4YFEA 2EDOA 3TM6A 5JR1L 4YFLI 3BDXA 2BSTA 4XBPB 5IBUB 3QIBA 2JCCB 5EU6A 3SKMA 1FYTE 4KWUA 3V5HB 9CGTA 4Q9RL 4OZIB 5E9DE 2AVGA 2NXZC 4JO3L 1H0DB 1LGVA 4S1QL 3WO4B 1GAFL 3NZ8B 5HGBA 5ITBH 3F7VB 4HUXA 2DIBA 4LAQH 4E0RB 3D9AL 4F7EB 3QQ9C 1UACH 1NAMB 4FS0A 1KCVH 5CEZL 1CLZH 1OP9A 5D7KD 4IDLA 3S34L 1IQWL 1DBAL 1I1FB 1S9YA 4QKXB 2BNRA 3TBWB 3T65A 3LY6A 2IBZY 3MTRA 4UB0H 3ZTNH 2P5WB 5IESL 1EJOH 4K8RH 1N26A 5DUPH 3WUZA 3BXNA 3LEXA 1SJHB 4LCWA 2FJGB 4OF6A 1R3HA 3U46A 4OAWB 2AJSL 4NDMB 2ZZUT 3ARGA 1HWHB 1T4KA 2B7DT 3IJYB 1YJDL 4OZ4B 3VMOA 1T20A 4M5ZL 3AM8A 5F7KC 3C09B 1SYVB 4LNVA 2A1WH 3ARFB 4F7CB 1X6LA 3FHQA 4AJ0A 3KAAA 5IVXE 1BM3L 1S5IH 1N5YH 3BGAA 5MEOA 4YDJB 5DJAA 3WBDA 3OHXB 4G8GD 4LLQA 4HG4K 1YMMD 5F3HB 1CGTA 4JFZL 5DRNA 3TO4D 2NW3A 2PTTA 1F6AB 4YQXL 5T5FH 1KELH 1QA9B 4M1CD 5KANG 1ND0A 1WWCA 3TH4T 3U7AA 4QTHA 5TDOA 4RSVA 2IANB 1NFIA 4MHHI 4GSDH 3BDYH 2Z31B 5J56B 4JQIH 4XCYB 3VGHA 3BPLC 1C5BH 4RCAA 43CAB 2AGJL 1IAOB 4BZ2L 4UV7H 1A9EB 4U1KA 1KCKA 3C5JB 4BYHA 5JUEL 1BOYA 4EOWH 5TJWK 4KQ4H 2RCSL 4O58H 5J8OA 4YWGH 4XCNA 4DVBA 2VDRH 2DI8A 2H8PB 3QCTH 4XWOD 1K5NA 1SJEA 1KJ2A 3T4YA 4PJFE 1NC2A 5E4IA 3M1BB 3HG1D 1I1AC 3RVVC 3UBXB 5AWNL 1RJLA 2NNAB 2GY7B 1ZANL 4M6NL 2FR4A 5IVZB 5FEBA 2PXYB 2EO9A 1CXLA 3WO4C 4I2XB 3KJ6H 5JA9A 1YZZA 4NC2B 1S7RB 3QO1B 1I3UA 5D1QD 4LDEB 5SX5H 4P5KB 5CEXB 2LQRA 1MAML 5SWQB 3CDFA 4YHPA 2D7TH 4WRLA 4DZ8A 1ZVHA 4XPGL 5E5UB 3RQ3A 4U6YA 4PJAE 5EZJB 3KPPB 3JTTA 5FYJH 4W6XB 4D9LH 1I1RA 3SPVB 4HLJA 2UWEB 4Q2ZA 4PJHE 1Q38A 4J6RH 4PRDA 1D5BA 1I3GH 1NKRA 3PWLB 2HKHL 2APWA 5J3HC 3T3PE 3H8NA 2VQ1B 3VDCA 4IRJB 4L8BB 5KS9F 2JJTA 2W0LA 1Z5LB 1MFCH 2VWEC 3UJJL 2VN7A 1TVHA 4R4NC 3HNSH 4M6MH 4YHZH 2A83B 1NAMH 3KPSE 1M7IB 3TN0A 3W0WA 4I5BA 4RFNB 4QOKA 2HT2C 4GRLA 4XPAL 3CDCA 3P2TA 2WWKT 4JRYE 4LQFL 5LBSL 4BQ8A 2FO4A 4CJ0A 2OM5A 3S4SA 1I9IH 2VLJE 3TPUA 4PJCA 4YC2C 3HC0B 3GMOA 3RDTD 3U36A 2DQCH 4PGCA 3DMMA 1DDHA 2NLJA 4XTRD 4DFHA 4RX4A 4JM2A 4MD4B 4ZAKC 5I8CB 3FO2A 3NBNA 4ZUWA 4NO2B 4NQDD 4ODWB 5DJZA 4LU5L 5CHNB 4DQOL 1EEQA 3P73A 5I18H 5FGRA 3G08A 5F70A 3BRFA 3N1PC 3PDGA 1ONQA 2F5BH 2FGWL 3MLSL 1KJVA 2J2ZA 5GRYA 1CK0L 1S78D 1P5VA 1WZ1L 3P30L 4Z7UA 2CLRB 3OGOE 5D71L 4KJQD 4WO4B 1HKLL 4X7SL 3U9UB 4ACPA 4J4PC 1IQDB 1XF4A 4GH7B 1A7NH 4NFBA 2LAGB 5AG9A 5CJQH 3T8XA 4DVRL 1J86A 4A2MA 4LPXA 3MFFA 5DS8B 2GK0B 4ZPTB 2AV1A 4JFFE 4APQB 2QSVA 3HHRB 5I66A 3PABA 1QHOA 1INEL 1U58A 4XAWL 1FVEA 1V3LA 2X1XR 1WAAE 1YEFL 3DTXA 4HSQA 5E5MB 1MRDL 2NX5A 5K9JL 2OL3B 3D1MC 3QUZC 1FCCA 1RULH 1YMMB 3ZDYF 4PGEB 1ZE3C 3TO4B 4XNMA 2YPLA 3IFNH 1DR9A 4UINL 3WN5B 4GKNA 2H2PD 4UDUA 1ZT4A 3DVGA 5E99H 3PNWA 4FQXD 5D72L 3GM8A 1E6OL 4JPVL 1U8PB 5CAYB 3CMOL 3IFLH 3V5DB 4DN3H 4M9PA 2XKNB 4JFEE 1YJDC 1BVKA 3QUXA 1YDPA 3CU7A 3B5TA 4KZEL 3O41A 2VWEE 2B0SH 3HZVB 3VG9B 5K59F 4LEXH 5EPMA 3S97C 4LFHG 3RVUD 2PETA 4DTGL 1DEEA 2BC4A 3B5GA 4HS3A 2BVQB 5HJ3A 3U2SB 2A6KB 1DFBH 1FJ1B 2FB4H 2W1NA 4J3WA 3HG1B 3BP7B 3VCLA 2OZ4L 4U1HB 4OCWL 3QXTA 1G9ML 4WU7A 3VXMD 2ICWB 4QXWA 2YD3A 3SE4A 2Q76B 3O45B 4FTVE 2XG5A 5JO5B 1S7SA 3RWJB 1K8DA 4AIOA 1HZHH 4LGRB 5C08D 1MCKA 1YY9C 2DLTA 1BVZA 3JV6B 4OQTA 1OARH 3HI6L 3U4AA 3VJ6B 4PJXF 3EFDH 2HFFB 1W72A 3BMVA 3GMPA 5LXGL 4C56E 1XF3A 5KSBB 2CDFB 4UILL 4L3CB 5EWIH 3QO0A 2HG5B 3EGSA 4NKIL 3VXRD 2PYFB 4Q6YA 2E27H 3GI9L 4WO4C 2FIKB 4L9DA 4UT9L 4PJ5B 2Y25A 1P6FA 4D8PA 4Z0XB 4P2RB 3U0TA 3CXDH 5E8DL 5K93A 4LSPH 1P4BL 4MAUH 1TFHA 3GSXB 5JHDE 2C3VA 3MUHL 4APQC 3CXHK 2QQNH 5GGVH 1MWAL 2GYSA 3BE1L 1OAKH 4FMKA 5CIPA 1TQCB 3OTTA 1DE4A 4ZDHA 3NAAH 4K2UH 1EHNA 1PX4A 3BHBA 3NH7L 5HI5D 3WEXA 1D7FA 4LASL 1MIEL 1YNLH 1NAKL 2FD6L 5A1AA 1NGXA 3WN5C 1NMBH 4OF5A 3RWGA 4NQEE 3IVKA 5GS1C 5INDB 1DVFA 1WFOA 3SDYH 5H2BA 5IMOB 4M7JH 3CFCL 3QPQD 4PRBA 1KN2H 1PG7X 2XQBH 3R06A 5DD6A 3MV9B 2WUBL 1PYWB 5DJDB 2NR6C 2XRAH 5I2IB 2RAMA 5HVWA 1KIQA 5C0BB 1CXKA 2AJ3A 5IG7B 2CIIB 4GBXC 3QWOB 5AYUL 1JHTA 1E27A 3VDBA 4XCEA 3SGKC 4QLRA 2ZCKL 8FABA 2XQYK 5F3BA 1FDLL 3D2UB 3HAEA 1EO8L 3QPXH 3VG0H 2X40A 5EOQH 4XNXH 3QHFL 3VFNA 5J57B 4K23H 4OD2B 4ZOBA 1QRND 2A0LC 2NYYD 2UZYB 5EIVA 2BVEA 4XGZA 4LLUB 4RGNB 1HXYB 4E41D 2J4WL 1NCDL 1GSMA 4X6EA 1JN6A 1EHAA 3MNZB 5F1IB 4HS6A 1BIIA 3OB8A 3T2QA 4L8DA 5IP4A 1RUPH 4R7NA 1U8OA 4PRHA 1ZV5A 4X5XB 4F58H 1T80A 2ADIB 5IV2B 3RBSA 4BZ1H 2WLZA 3PWPD 2VH5H 3QISA 1EEZA 1A2YA 2BOCA 4IOFC 1XGRB 5SWZE 5ICXB 2VDPH 2FDBP 3MRGA 3ZLQC 4MZ3A 2HRPL 3GSVB 4KQ3L 3KPLB 3OBAA 4P4KD 4WTWA 4YJZL 4JY4A 2ZOKB 2P5ED 4RAVB 5DT1H 1REIA 4PV9A 1MSPA 3DVNA 1MWAB 2C7UA 5BO1L 4X4XB 1XGQB 1G7MA 3G6JE 4JRXB 3P0VH 2KZ1B 4ZPVA 4R3SB 5EBLA 4HIHA 1P4LA 5HHNA 1FORL 2XN9D 1YEGL 1QLFA 3SE9L 1KTKE 3E0GA 3DO7A 1YQ2A 1JGUH 1QBML 1N2RA 2X9WA 4XPBH 1A21A 3DETD 1JWSB 3B2VH 5KS9B 3H9SB 4HJGB 3BQUB 1CICA 3CZFB 3VXMB 4HT1L 5HI4D 3WS6C 4ZG1A 2XZQH 2AK1L 4PJEB 1GHFH 2RB8A 4G43A 1SYSB 5C0JA 1HOCB 1KENH 3O9WB 2OTPA 3O6LL 1RZJL 3AY4C 4K7PH 4N0RA 4FFZH 4OLVH 2UVFA 4S0TD 5DEFA 1K3IA 5TDPB 4P3CL 1VGKB 1RK0B 4NCC1 4M8VA 4YPJA 4OFYD 2LE9A 5EZIL 3VXRB 4CU6A 5KN5B 1MQ8A 1CR9L 4LPWA 4MNGE 1FZMB 1HDMB 1M6OB 3QDMA 4NJAL 4TSBH 5FO7B 4N0UE 2FX9L 2ZUWA 5JW5B 2FIRT 3EOBB 3S37X 1G7LB 1S7QB 3T3ME 4RGNC 1CLYH 1G9MC 5D7LB 1L7IL 2K3TA 1JPGA 4OLEA 2YXFA 3CX5J 1UH3A 3GMMB 4N0YH 3KYNB 5IJVA 5H94B 1P7KB 4E5XB 3ARED 5BVPL 2G60H 4G9FE 5GGQH 5DRXB 3KPNA 4OZHF 4OLUL 4I9WD 5D7IF 1YY8A 2YA1A 4QWWD 4JFHD 1DCLA 2QSQA 2YD8A 2YN3A 3WFDL 4FQJL 3LKQA 5FYLL 2PCPB 3PWUB 2E6PA 3WCYA 1ZLWH 2NY4D 3JUYA 4GLRH 3TWCH 4HCRH 5DGRA 1AQKH 1BF2A 1EV2E 1X5AA 4P5MA 1Z9MA 2XV6B 2WAHA 3JVGC 1YYLH 4WY7L 2J6EA 1UKTA 3I6KA 4X80L 2XY2A 4NNPL 5FOJA 3GMRB 3ROLB 3FFCE 4WDIA 3QJHB 5JQ6L 3BQUC 3LH2L 3UJTH 1C5DB 1FGNL 2QADD 1AD0B 4R7DA 1A14H 5E03A 1I7UB 5AAWA 5JDSB 1II4E 1BQHG 4AEHL 5CKGA 5BOPA 4QNPE 3CH8A 5I1JL 3WIFB 4XX1E 4X6CA 3H3KA 4NQSA 1JIBA 4FFYH 3C60C 3OR6A 3O9WC 3SQOL 3GKZA 3SDCA 3UBXG 1TCRB 4YDIL 1IEAB 1VGEH 5F9DC 1KYOK 4LARH 2IAMC 3MRPB 2A73A 1G9NL 1DBKL 3LN9A 3U9PL 1EEUA 4NN6C 3PWNA 1KN4L 3IJHA 4X7TA 4XVUC 3V4PL 4JCMA 5GISH 4NQCE 4PJXB 5DK3A 3KJ4C 4IOIA 1U8IB 3ULVE 1IE5A 1S9WB 2X4SA 3IFOA 2IFFL 2DL9A 2GW5A 1CQKA 4RISH 4P5TC 5EOCH 2I25N 3ZDZF 4M7KL 4I18B 1KBGL 3MRIA 5ISZD 4ZO8A 3HE6A 4MMZC 2H3NA 2IG2L 3TJEL 1IARB 5ENWB 3GO1H 5I73B 4Z76B 4HJ0D 1VFAB 4OGYL 3PWVB 4K3JL 1I9RL 1QYGH 1U8NA 3GSUB 4Y89A 3RL2B 4KC3B 4U1GB 5I1LA 4PB0L 4MNQB 3H9HA 1VKXA 4TOYL 5CSBA 3KPMB 4QHUA 5I1CL 3QIWD 4PTUA 3FKUS 4J3UA 4EIZC 1IZJA 3BZEA 2KH2B 3GB7B 3GBMH 1OGTB 4AG4L 3C5ZD 1JNNL 3FB8A 1KT2B 2X05A 3PL6D 3NN8A 1T6VN 5AEAA 4YHKL 4YHNA 5L9DH 4MNHA 4Q0XL 3ZSTA 5IBLD 4JHAL 4KJPD 3UJIL 5B8CC 1P9MA 4RAHA 1M71B 2GSIA 5CZVH 4CL7A 4OB5H 4O2FA 3RIFK 1NDGB 1KLFA 1QSFD 4S2SA 5LGJA 5LVEA 4FABH 2D4FA 4Y1AB 1X6NA 2E9JA 3NGBB 1V05A 3MLWL 3RVTD 4Y4HD 3ZKNC 4NBYB 3T2PA 3K4DA 5BQ7B 2DICA 3TF7C 3IGAB 4CMHB 1MAJA 4PP2A 5AZEL 4UV4H 1TPXC 3D18B 3SBWA 5MEPA 2ICCA 3AREB 1RIVH 1RZJC 4OCRH 4PYHA 3PHOB 4WEBL 2V7NA 3RFZC 1OTSC 5DZNA 4PB9L 5ILTL 4BZYA 3QNYA 3Q3GB 3WUWB 5ADOH 1LK3L 4LCIL 1T2XA 1JFQL 5J11B 1F02I 3CLFH 1R24B 5E2VL 3PIQB 3HNVL 5EZOL 4WI7A 4R90L 2F53D 2EDDA 1BQUA 2BSED 4PJBB 3GMLA 1MPAL 3CFKA 1XFPA 3KPQB 3MNVB 3GIVA 1HHIA 4GMSH 5D7JC 4B0MM 5LGHL 2P4AB 2Y5TB 3QFJD 4LSQH 3GSNL 3VH8A 4MQSB 1AJ7H 1GVIA 3D69A 1J11A 5IFJB 1L4IA 1MF2H 1AKJA 2VITA 3MACH 1B6UA 4G6FB 5EA0L 1EMTL 4OM0H 2QADB 4GAFB 5DJ0A 2Q8AH 4AL8H 2JIXD 4JFOB 5I8OL 1IT9L 3GSRB 3FQNB 3RBGA 5D6DC 4GXUN 3MBXL 1QSEB 2CXKA 4Z95H 4CU8A 2O5XH 2UYLA 3P9LB 4UI2A 3FQTB 1KEGH 1CBVH 1J0YA 1V7ML 2PO6B 5EORH 4QRQA 2BVUA 4LCUB 5JIHA 2V2WA 1KACB 1QBAA 5D96B 5F93C 5E24E 3PP3K 5EOTB 3AXLA 5SV3A 1UB5A 5GGTA 3QXAA 4NZDA 4OGXL 1T83C 2CQVA 3MMEA 4M3JA 5ITBL 5MENE 5CLTA 4ISVA 4YZFF 3VGEA 1D5IH 5GIRB 3RUGE 1CDJA 4M61B 1B4JL 3MX0A 5L0QB 4JCLA 3HE7A 3QIBD 4JG0L 4RQQB 2BY3A 2EXYD 1E4KA 1T1XB 1OY3B 1FRGH 3FFDB 3ZTNL 1A3QA 2X4NB 2HN7B 3DYOA 1EJOL 4PLKC 4MS8D 4QRTB 4CMHC 3C6LA 3U0PB 3HR6A 4K8RL 3V52L 5DUPL 4JJHA 1U42A 1N0XL 3HZYA 1X7QB 3NCFB 4F7PA 4BKLA 3KWWA 1MIMH 1J8HB 1TTFA 2AK4E 2DWEA 2V2XB 2BNRD 3FQWB 5E8PB 4BUHA 1YC8A 2YPKB 1DP0A 2DIJA 1G9NC 3L7EA 1Y0LB 1D6VH 4X9IA 4PY7B 2A1WL 5DD3L 1MCJA 3E1F1 2BNUB 3CVHH 1DBJL 5CJ8A 4RWYH 4M1DL 1Y18B 4Y19A 2ICES 4N90D 3AS1A 1RUAH 5C09B 4DOHE 4NKMA 3C5ZB 5JORB 4MJ5B 1G6RB 4OZHB 4UIMB 1P84K 1OLLA 5D7IB 1MI5E 3PL6B 5DSCB 1WBZA 1ZA3A 2RHEA 4LVHB 4PJCF 4BFBD 4QXGL 3F62A 4JREB 3X3GH 4GSDL 4JFDA 1PQZB 1T66C 4XCCH 5DVKA 3W2DL 6CGTA 4LMQE 2BY1A 4JM2F 4HKXB 3R1GL 1X3DA 2F54B 4H0IA 1O0VA 1HNGA 4H1LH 1HHGB 2Y7QB 1FZJB 4UV7L 4H5SB 5IW3A 3OKEA 4NO0B 2HJKB 5EU3A 4Y4HB 4ZUVA 4GKSB 2ADGB 4LRNL 4KQ4L 3VWKC 4NJ9H 2Z91B 3MRKB 3P9WB 1S7UA 3IF1A 1NC4D 1WCBA 4YWGL 1QQDA 3FB5A 3RWDA 1ZEAL 2VDRL 3KXFA 5GSVA 2Z8VC 4Z7UF 3QCTL 2WINB 4MMXC 3S35L 5T3ZE 1LD9A 1INQB 1OAYH 5CKAA 4NZRH 3IXTA 3ESUF 4IRZL 4GUPB 4Y5VC 1XGYH 2PO6C 4XNUH 3R8QA 1T21A 4KJWC 3VXTA 5I1DA 1W0WA 1NCUA 3BGMB 3MJGX 2VIRA 3RNQB 1WFNA 3KJ6L 3MA9H 4WW2A 4LRIC 2XYCA 3OKDB 3RPIB 3UPCA 4Q9CA 4PBWD 1PW3A 3D39E 1JK8B 4HFWB 1F90H 1U41A 4TUOA 4H0GA 4R4BA 4HLZH 4DGVH 3QFDB 2W65B 2XPGA 5IB3B 3QDJB 5TFSH 5JNYA 5HI3C 5GZND 5IK3B 1IM3A 3L3IA 2G75A 2VLKA 3LN4B 5DK2B 3IDMA 1BZ7A 4OLXH 3TP4A 1LMKA 3FOLA 4PRID 1BD2B 5IB4B 1I3GL 1CTOA 4OUUA 1IEBB 2F8VA 3V6ZB 4OV5A 2FO1A 3FOMB 1NL0H 5D2LA 4XH2A 5BZWB 4OCSH 3MV7E 2XWTA 3BIKB 1D6EB 4UZGA 4GMTH 4YHOL 3AFLA 1DQML 4OI9A 3S88L 1O5DT 4NO3A 2YUVA 3GIZH 3GI8L 1M1SA 4XVSL 1MCCA 2R56H 5DHYB 1UA6H 5E1AA 4YHLH 4J2XA 1CT8A 2B1AL 2C3XA 4MX7B 1EK3A 3S5LA 2EH7H 2R2CA 2I27N 3RP1A 3QUMH 1LP9A 5LWYH 2NW2A 4JREC 1FG9C 2DQCL 5DURB 2DKSA 4Y5XA 4DJMA 3ULSB 2BSTB 4O51B 3W0WD 1LEKA 4JZOA 4HH9B 2J8UE 5A2FA 3D3VB 5EU6B 4YE4H 3HS0A 2R29H 2VAJA 3WL9B 2G2RA 2X4TA 1EPFA 5HGBB 4HUXB 1ZHNA 4PV8A 4RX4D 5KANI 5EBWA 4AEEA 5FYKU 3X14A 4G7VL 4OLZL 1A7NL 3UTPE 2DMBA 1S9YB 1X9QA 1A1NA 5CJQL 1BFVL 4KRPB 5IKCB 3GMNA 4LMQI 2ZG2A 5C0CA 4XC3H 4RWHA 3L5WA 2R1WA 3BSZH 1NMCB 3DX7B 3LEXB 4LCWB 1YEJH 1R3HB 2EYTA 4Y5YA 3ZE1F 5I1EH 1RULL 3ARGB 4IMLA 5HPOA 5LQBL 5HGAB 1A8JH 4XI5D 4OI7A 2MQ3A 1WIUA 1MY7A 4K8RC 4U49A 1QEWB 4I13B 4P2QA 4L8SB 4NCDA 4PS4H 5C0AA 5C2BH 1SEQH 1FZOA 3T0EA 1KCRL 2VYRE 5MEOB 2NX5D 2WZPD 5DJAB 3VMNA 4LLQB 2VOTA 5D1ZA 3IFLL 3BWAB 2A6IB 5ESAB 3ZMRA 2DQGL 1MCQA 1CLOL 1ND0B 2XZCL 5TDOB 4N9OB 3PUCA 3LKSA 4KMQA 3QIUC 4LEXL 4DW2L 4KI5D 2ZUUA 3BVNA 4YXLH 1W0YT 1WGOA 1DFBL 3TFKC 2FB4L 4UNTA 4U1KB 3QUXD 1ACZA 5DC0A 4OD3H 5HHXH 1A3RH 1VA9A 2AJXL 4RMSA 4LSVH 4XCNB 2CR6A 1LO2H 4DVBB 4B7IA 5KG9A 1NFDF 3NIGF 2VSCA 1K5NB 1HZHL 2NMSA 4FZEL 1SJEB 2R2EA 5ALCH 1KJ2B 5EUOA 4OKDA 1C16A 1OARL 1NC2B 3FJTA 3EFDL 2VXTL 1BAFH 1S7WB 1JYXA 1GGCL 2EZ0D 5FGCE 1RJLB 5SWSE 2FR4B 3SDAD 1ZTXH 2C4FT 4LAJH 4NBXB 5EBGA 2IPTL 4PRPE 1HINH 2YPVH 5I71B 3FTGA 1LO5B 3RHWF 4N8VA 4OQ1A 1MOEA 4Z7WE 1MHPH 3CXDL 1V8HA 4LSPL 4MAUL 4KU1A 2D9QB 4YHPB 4M9OA 1KB5H 1UC6A 1Z6JT 1BVLB 4LLWB 3IXAB 2NZ9D 1XZ0A 1OAKL 4U6YB 5C0FA 3FT4A 1DQTA 3BUTA 3TZVC 3TBTA 1N4XH 1UKQA 1T04B 4URTB 5KSAD 4JO2L 3WDJA 4Q2ZB 1KC5H 4QXUL 4XMLL 4F9PA 4KKLD 4PRDB 1D5BB 4Y88A 2XI9A 4F7MA 4YDVA 4XNQA 1G1CA 2ITCA 2EDLA 4PBXA 1HQRA 1OSPH 3S6CA 3DWTA 4MZ2A 3O6FA 4WU5A 3L1OL 3IDIA 4K07A 4L8SC 1TVHB 4JQXC 5I1KH 2DYPA 3TN0B 2NTFA 2Y07H 5GRJL 4C58B 4I5BB 1CGWA 4QOKB 3MRLA 4GRLB 1E6JH 3NFNA 4NC1C 2XRAL 1RK1A 5ICYA 4MVBD 4L3EA 5CJBA 3BT2L 3QQ4A 4PJCB 5KVEL 5BCAA 3B9KA 1DVFD 2XFXB 3GMOB 5GGRY 1UZ6E 4PGCB 2W0PA 3DMMB 2NLJB 1EDQA 4GW1A 1FBIL 1RUQH 2N1KA 3IAPA 2R2HA 4JM2B 4ZUWB 1A6VL 4N0CD 3MXVH 1BJMA 5DJZB 4XNXL 1U8QA 1VESA 4K23L 5M7QA 5CCKH 2YRZA 3T1WA 2ZG3A 1V3MA 1KJVB 1FVDA 2FCBA 4Z7UB 4HC1A 1CDUA 1T0MA 3B8SA 5FUOH 2OXHA 1IGIH 5DQ9A 3VD3A 1XF4B 4H20H 1QKZL 4ORGA 4H1LG 3L5JA 4KRLB 1H3TA 3LIZH 3WV0A 2BNQA 3I85A 1RUPL 1OCWH 3F7QA 3LEVH 3RAJH 5FECA 2AV1B 3IT8D 1PX3A 3PQYB 4PREB 3ZKSD 5I66B 1R3LB 3PABB 3SOBH 1D9KC 1RURH 2VH5L 1U58B 5I71C 1JL8A 4RIRA 4D3CL 1UM5H 4X7CC 3BD5A 4G6KH 1NBVH 5HHME 1VDGA 5SV4A 2YPLB 4YXHL 4LIQH 2YUZA 4K7FA 2B4CL 4KMLB 5FA3B 1L0QA 3DVGB 3UTSE 3AMKA 3MRNA 3VW3H 2MJWA 3OJMB 3K81A 4ELME 2R23A 4S11A 3C9NA 2RBLA 4NT6B 3O4LE 5DXWA 3LKNA 1YPZE 5GHWH 1BVKB 4HLZG 3ALPA 3QUXB 4L4VD 2GJ6E 1I8LA 3QG6A 3VGAB 1YDPB 3QDAA 5EO0A 2VISA 2JJTC 4IRSA 5L2KB 5JZ7D 3AROA 2XZQL 5FYJE 5JMRA 3KPRE 1K2DB 5HD8C 4G6AD 4YGVA 4V1DA 3TN0C 4HS3B 5CWSA 1MNUL 5E95B 3HLAB 4NC1E 1CE1L 4X6CF 4NSKB 3ZSSA 5KVMC 3WHE0 1HILA 5DJ6A 3CDGB 4EVNA 4HK3J 3VCLB 1MCHA 1HHHA 3LKRA 4WU7B 3OV6A 2P7TA 5E8NA 5FAAA 3DRTA 1S7SB 2BJMH 4J3TA 4JGJA 3ALWA 4KY1L 4U2ZA 1X5YA 4ZUUA 3MJ7B 3VWJB 3GMPB 3ULUL 4HV8A 2X6MA 1XF3B 1JHKH 5IEKA 1AXIB 2CKBA 4KUZH 3QO0B 1CLYL 1FIGH 1Q72L 4Z8FH 1DUYA 1PSKL 2P49B 3CC5A 5EC2A 5F6HJ 1NQBA 3UTTA 1P7QB 2VZUA 3U7WL 3QG7H 4HKJA 4ODSL 1I8MB 4LSRL 3QDMD 1EAJA 2G60L 2YKLH 3TCLB 5I15H 1OD9A 4GG6A 1U95A 1TZGH 3DURA 2HTKD 3IDXL 1MCNA 2C3VB 4H8WL 1F2XK 2P8LA 2CD0A 4HGMA 2HJLA 2VL5A 2AEPL 1PD6A 1FNHA 1PZ5B 4ZDHB 1DBBL 3IU4L 5DUBB 3B9EA 5DJXA 3BHBB 5AZ2H 3WEXB 1JZ5A 2LTQB 1XT5A 2VKXA 1NGPH 4YBLC 3BH9A 4XXCC 3VE0A 1MCRA 3OWEA 3RWGB 4CN1A 1DVFB 2A6JA 2XY1A 4QHLA 5H2BB 2BHZA 4F9LC 4NRYA 3L5XL 5IFAH 1YYLL 3R06B 5F9JB 1ZSDA 3OAYH 1NCCL 4GRWF 1MCDA 3NCEB 5I1AA 4EI5B 1IJ9A 3KYMB 2GQHA 4OCXH 3MUJA 4HKBA 3RKPA 4G3YL 1JHTB 3UJTL 1FL6B 1GOFA 2I60H 4WIQA 1A14L 2HYMA 2MOVA 3LSOA 4CAGA 5F3BB 1E0OB 1RU9L 2P8MA 2E8ZA 1AY1L 5TQ2L 4FFYL 4LPYA 1KIRA 5M95B 4CDGC 5L8LB 1JNHA 3IETA 5HYSG 4O5LL 1UWEL 1VB9A 4QRPA 4XGZB 3BKML 1L6XA 1VGEL 4JPKH 5ESVA 1CVRA 4DGYL 5FK9B 1RAMA 5I16A 4P46B 3GRWH 1NFDB 3H0TB 4X6EB 3NZHL 4XPTL 4YO0A 5E08H 1JN6B 5TGBB 4OGAD 3X11A 2X4UA 2BOBA 4HS6B 4D0DA 4KROB 5JMOC 1CZ8L 1BIIB 1BP3B 2D31A 1GRWA 3VWJC 4YHML 2IFGA 4JR9H 4EUPB 4L8DB 4GAJH 4R7NB 2E6JA 2YD4A 4MB3A 3L3HA 3BKCL 4PRHB 2YSSB 3UPAA 1JV5A 4NNYA 2VDLL 1KNOA 4HX1A 5SX5K 5LAXA 1OGAD 1CU4H 3LD8C 1NGQH 5ICZA 2EDXA 3HB3D 3L7FA 5ACMA 4FQ1H 5AYQA 1FH5H 4WFGD 1A2YB 2PW2A 4ZTOL 2FX8L 1AD9A 1OB1A 3MRGB 5D5MB 3NVQA 4D9RE 2CJUL 1NEZG 5CEYB 3C5SB 4P0DA 4EI6A 4OF0A 3GO1L 4JY4B 2P8PA 2W59A 2ED7A 1N59A 4PV9B 3DVNB 2C7UB 4JZNB 2BMKB 4LOUD 5CINH 4ZPVB 5EBLB 4GRMA 1P4LB 2E3VA 1J5OH 4Y2DB 1ZK9A 1NMAH 4DKFH 2VDNH 1I9JL 5I0DA 1W72H 4XNZB 2QBWA 2LTQC 3DO7B 3GBML 1N2RB 4N9GA 2OJEB 1FNLA 1CICB 5DVLA 5DJ2A 4BFGA 1ORSA 2B4CC 2WLYA 3V79C 2EECA 1IAKB 5E8OA 3SQBA 4OZGE 4G43B 5JXEA 1KEMH 5D7KE 5E9DA 4RMQA 4EI5C 3N06B 4F7TA 4FABL 5DEFB 2HTLD 4O2EB 3VFWA 1A6ZA 5KW9H 3S96A 3K7UA 5MEQA 4PD4J 1WF5A 4I4WA 4MQXC 4ZUTA 2NY1B 3HC4H 4V2CB 5EIIA 3DX6A 4AQOA 1R6VA 2JKXA 5CIPH 2J3SA 3TCXA 3IS1X 4NNXB 3QAZB 1T3FA 3EOAA 1CI5A 4ALAH 5JIIA 1NLDH 1RIVL 4XNYH 3U4BL 2LU3A 1RUKH 4UBDD 4G8IA 1ZT7A 4D0BB 3CSPA 4QHMB 3SEPA 4P46C 4Q74A 1PKQB 4P2OC 1AE6L 2H2SD 2EIEA 5EZLB 1KTDB 1U8MA 4KROC 3O6KL 4HW6A 4MD5A 5IJVB 4G8GE 2R0KH 1YMME 2WBJA 3W11C 3T1FB 3UROR 3ULUC 3V7MA 1NCBL 1BLNA 2R15A 4TNVF 5IJKA 3HPJA 2IWGA 3KPNB 4PIRF 4NHCH 3TBYA 4JDVA 4N1EA 1MELA 5K9QG 1OWRM 1E4WL 1JNJA 3ZE0F 3HAEH 4XTRC 5E2WH 4P23B 3CFEB 1JWMA 3LKQB 4M62L 1IEHA 1JGLH 3OMZA 1FGVH 3MCKA 3B2UD 1UFUA 1DLHA 4RFEA 3GJEB 4P5MB 2DTML 4H8WC 2K9UA 2YBRA 3IDYB 3QEQD 1Y6MR 2EKSA 3K8LA 2QSTA 2MCPL 4AL8L 1CDGA 3BPCA 3FRUA 3KYOA 3CK0L 5DK0B 2HT3D 4Z95L 4Y2DC 3SKUD 3MV8A 3I6KB 4XNZC 1CD0A 1KEGL 5TF1L 4N8CL 4WDIB 1Q9KA 1I1CA 4KVCL 4R7DB 4PJFA 5HVFB 1F4WL 1JUFB 1FNSL 4EEEA 4X6CB 2C1PB 3EUUA 1JPFA 2VABA 4WW2F 4ZFFB 4R96A 1A6TA 3OR6B 1HSBA 3SDCB 3LS5H 2A73B 5JW3H 1FRGL 4LKXB 3QH3B 4PBVC 3PWNB 1TDQA 4MDJB 3IJHB 3HPLB 4X7TB 4JDZA 2MTPA 3QAZC 3F7YA 4NQUA 1NBYB 1DN2A 4F15B 1JI1A 1C12B 2HVKA 3P0YL 3ETBF 1MIML 3HE7D 5I30H 3O2DH 1ZLVH 1A6UL 1CXEA 1IGML 2I07A 3IAQA 4W68A 2H32B 1A5FH 3R8BB 3F58H 4PJHA 3C8HA 3NCMA 5D2LF 2CPCA 2OR8A 1TZHA 4JANA 3T0AA 1JNLL 2FATH 2WWMC 4L4TA 4O2CA 1QFPA 3MRIB 4RWYL 3WE6A 3HE6B 4MDIB 1CFBA 2H3NB 3MLZL 3WIHL 2AI0H 1IKNC 4EDWL 1SJVA 5JOPD 4JRYA 2RFXA 1G9EA 4G7YH 4C59B 5I1LB 1LP9F 1VKXB 4XCCL 4NQDE 2VLJA 4P23C 1A6AA 4QHUB 2HRLA 1BBJA 5DUML 1CE6A 1WUNT 4PTUB 2GKIA 4Y19D 5JXAH 3VXSA 4DUWA 3BZEB 4PJ8D 3S4SG 1CFTA 3FB8B 3SJVD 3CSGA 1ZHLA 1UYWL 4KJYA 4YEFA 1JZ4A 2N7AA 3IDYC 5FA4A 3NN8B 1XR9A 3TO2B 4YHNB 2DBJA 4JFDD 2GUOA 4PJDE 3QEUA 1Z2KA 4X0KA 4GRWB 4GAYA 1O7VA 3LAFA 4I3SL 1MCBA 1F4XL 2GSIB 1K8IA 3TA3C 5DMGD 4O2FB 5CD5C 1G7JB 1OAYL 5EC1B 5LGJB 5GGSY 4XNUL 4XBPA 3D6GA 5T3XL 3QI9C 5TQ0L 3SKJH 1I1AA 2E5EA 4KKNA 4H88H 4FQPA 4PP2B 5DDHA 1H0DA 4JFFA 5AD0A 5MEPB 4NWUL 1T2JA 3RTQB 2ICEA 1KTRL 1F90L 1PG7L 5I9QB 4DGVL 1N7MH 4XMPL 3DOSA 4TRPH 5TFSL 3C08H 5J1SC 4Z7QF 5HYJE 3NCYP 4F15C 5KJRH 5FO9B 2J6EH 4R4FH 2V7HB 4MJ2A 4OLXL 3BEWA 4D9QD 1T7XA 2FJGA 4HDIA 4OAWA 1TTGA 3CFKB 4NDMA 1NL0L 1HHIB 3GIVB 5GGVY 5CJ5A 3IJYA 4ZSOB 3SGDH 1Q1JH 3VH8B 4JFEA 4JRWA 3ZYJA 3D69B 2VLKD 2FHCA 2NCMA 1AKJB 3GIZL 3V6OC 4F7CA 2A77H 2E9WA 4GAGL 3HE6C 4R97B 1T5XB 4X99A 1A7QH 1IAIL 1UA6L 3VXME 3ECBB 4YDJA 4WI5A 3GHBL 3OHXA 5F3HA 2AKRA 2MPAH 3RY5A 3QUML 4RAUA 1JGEA 5C08E 4UU9A 5GSRB 1QA9A 2IEPA 3FMGH 2IANA 1IL1A 2H41A 2P48B 1J1XH 4PJIB 5EUOF 5DO2D 1WCQA 3ZYIA 3BFOA 4HUMB 4ZAKA 4QRQB 1I3VA 3FRPA 5E2UH 4YE4L 2GFBA 1YEHL 2V2WB 2ZNXA 1DUZA 4GQ9L 1F5WA 1MAKA 1CD9B 1UB5B 3AXLB 4WHYH 4C56A 3C5JA 3MMEB 2VDQH 4HGKC 3OXRA 4X83A 1OTUD 3SE3C 3BRGC 3OB0H 4ZUSB 3O8XC 4HWBL 1ORQB 4J8RB 3HE7B 4OJFH 4HBCH 2C26A 3MJ9A 4J4PA 3RZCB 1NLBH 4XRCB 1NGZA 4J23A 3J8F7 1WEJH 3M1BA 4G6JH 3TPKA 3C6LB 4XC3L 3INUH 3BSZL 5IVZA 4K94L 1YEJL 3VI4F 4I2XA 4LDOB 3KWWB 2DWEB 3RTQC 1OAUL 1TIUA 4WUUD 3FZUD 3SDDD 5I9QC 1VADB 3QUZA 3QULB 3L7EB 1MCOL 5C7XH 3NA4A 4ZXBB 4LSSH 3QXUA 5HI4C 1IILE 4GLRI 4YGAB 3A6CH 1TZIA 4G8EA 4GRWH 3ZDYE 4NN5B 3IDGB 5C2BL 4RMTA 4O4YH 3N0PB 1NANH 1FV1A 3GNML 5CJXC 5EZJA 2CRMA 4NKMB 4PG2C 4WUKL 2WUCH 4YXKL 2IQ9H 3SPVA 1CGUA 5HYQA 1Q0YH 1ZLWK 3KDMB 2JB6A 5GZOC 1JRHL 2X44D 1WBZB 3EOYG 4LVNC 1ZA3B 2QQKH 3VFVA 2EIDA 2R69L 1RZ8A 4UMGA 3FT3A 3S37L 5JQHC 5L7XH 2XICA 2BVPA 1Z5LA 1QRNE 3AVEA 4KTDH 1TETH 3WXVL 5F21B 4E41E 3OKEB 5EU3B 4S10A 4OD3L 1A3RL 4TYUA 5B4MD 5C8JB 3P4MB 3IF1B 4PJGE 1WCBB 1LO2L 1QQDB 3MLVH 5C0ND 3RWDB 3KXFB 3HAEG 4U33A 4W4NA 2Y5EA 5IQ9A 4ZS7H 1OF2A 4ELKB 3HC0A 4HUWA 1LD9B 5ALCL 1F11B 3CX5K 1IZKA 3ILQD 3IXTB 5BV7L 1BAFL 3TV3H 5I8CA 1T21B 5FYKL 3WFEH 4QHNA 4WWKC 2HH0L 3PWPE 1ZMYA 5CHNA 3VXTB 1ZTXL 5I1DB 1BECA 1W0WB 2YWZA 1MCLA 3FO1B 4XP6H 2VIRB 2ZCLH 5DZOA 2ZCHH 4EQ3A 4WW2B 2IGFH 4MQ7B 2GITA 2VMFA 1F3JA 2CLRA 3GUTB 2NY4C 4WO4A 4TUOB 1MHPL 4R4BB 1V3JA 1IQDA 2P5EE 3RZCC 5SWZA 5E6ID 2XPGB 4M8QA 4GKOA 2C3WA 1BFOB 5JNYB 3HMXH 1VFOA 5DS8A 1RJYB 3QDGD 3L3IB 4APQA 2XN9E 3MRJB 3VI3F 5EU7C 1N4XL 3IDMB 2Y23A 3PHSA 3FOLB 2W92A 15C8L 3NIDF 1S3KH 4POZC 3MZTA 2MFNA 1GGBH 4OV5B 2FEDC 4XH2B 5HDQH 3Q6GH 5GGTH 2XWTB 4ZXBC 5JHLH 3GSWA 1X5IA 3ARVA 5KBNC 5C0RH 3BZ4A 3R4DA 4NN5C 4NO3B 3WN5A 1FLRL 4JHZA 3M8OH 4JB9H 5GS1A 4LBEA 3V7AG 1UVQA 3RWCA 1FFRA 3IRPX 1S9VA 5E1AB 1U8PA 4EQ2A 1OAXH 2X1OA 2BDNH 1ADQL 3V5DA 3O6FD 3S5LB 1LP9B 4IM8A 2VN4A 5KVFH 2NW2B 5HSFA 1NCWL 1R3IH 4GBXA 4J3SA 3MO1A 4Y5XB 1G1YA 4OIIL 1RUQL 2DYPD 2SEBB 5DC4B 5KOMC 3SGKA 5KSUA 3QNXB 3BIBX 3EFFA 4JZOB 2ORBL 1YEEH 2DQUH 3QEHB 1A0QL 1OAZH 3U2SA 3HS0B 5EUKA 2NY6B 3HMWH 1JCKA 2A6KA 2G2RB 2X4TB 4L3ED 1X4YA 3A67H 4N0UA 4UT7H 3BP7A 5BXFB 2N4IA 1LE9B 3Q1SL 1TJGH 2ICWA 4U1JB 2Q76A 3OAZH 4OT1H 3X14B 3MOBL 3RWJA 4YFLF 4PJ7B 2LU4A 1M05B 3ARTA 3C2AH 4KDWA 5BV7B 1A1NB 4LCYA 3UTQA 4I9WE 3ZKMC 4LPUA 1OCWL 1LDSA 5ALBH 3RAJL 3VJ6A 3NABL 4JFHE 2HFFA 3GMNB 5DQDH 4GG6F 1SVZA 5C0CB 4MA1B 1MJ8H 3L5WB 5KSBA 3UYRH 1RURL 3RGVC 5J89A 3FQRB 5CUSL 1CVSC 5D8JH 5E7BA 4Y5YB 4FQIL 3IDJA 1INDL 4KK6D 2PYFA 5H35A 4TPRH 3A0OA 2BXZA 2DQEL 1KJ3L 1NBVL 2FIKA 3I3EA 5I1GH 2BNQD 1NBZA 2JK5B 4JKPH 2Y6SD 5EO1B 2APBA 4P2RA 3OX8A 3PDDA 1OD7A 3S3PA 2JF1A 4QRRB 1EHLL 4P2QB 5DEZA 5FCUH 2H9GA 5EU7E 5C0AB 3MROB 4K94C 2I26N 4KJPC 1FZOB 3T0EB 3Q48A 2QKIB 4M5YH 4MXVE 2AJYH 3BEVA 5D1ZB 1MCWM 2VXQH 4WI3A 1N0LA 3VFOA 2CK0H 4LL9A 1MRFL 3H3PL 5A3ID 4KK9D 1IC4L 1P69B 3ORJA 4CNIA 3KLHD 1CS6A 3EJYC 2VLRD 4RNRB 4CVZB 4FQLL 3ZHDA 3FFCA 2YD9A 2HT4D 3KPOA 1U91A 2XZAH 2DQIH 2BFVH 4X9BA 3WS6A 2G5RA 1R3JB 1RZ7L 2PNDA 2BERA 1VPOL 1VEPA 2YUWA 3MLPA 1LHZA 1PYWA 5DJDA 5FFLA 3AY4A 5ECJE 4IRSD 4X4YA 3FO0H 2CIIA 5KG9B 3QWOA 1NEUA 2BJML 1CIUA 4Y5XC 2WIMA 3BOVA 3REVA 2R2EB 4V1DD 5EUOB 5DR5H 5JIPA 1C16B 1U8HB 3V8CA 2IPUG 2GTWA 1P2CB 2ADFL 4MA7H 2X9XA 5DHVA 1AHWB 4C54A 5CSZB 4HK0A 5JDJA 2P24A 3I3DA 1SM3L 5HDBF 5I1HH 4LHQB 1RZGB 2OZ4A 3SO3C 5FKPA 1HXYA 3C6SA 5ISZE 3QG7L 4N8VB 3QCUL 3M17A 3MNZA 1DTUA 5BV7C 2PYEB 1ZLSL 1ETZB 2OYPA 1TZGL 3NTCH 4V2BA 1Z9SA 2FHFA 4WHYG 2ADIA 5C0FB 5IV2A 3FT4B 4NIKB 4CN4A 2CGRH 3TT1H 3VFRB 4G6ML 3TBTB 3TNMB 4X4MA 4OZHE 5AZ2L 1HXMB 3T04D 4F7MB 4YDVB 1XGRA 1KGCD 1NGPL 2ITCB 1HQRB 4JLRA 4NZUH 4U7KA 4RFOH 4UQ3A 1LE5B 1EBAA 4M6OL 1U92A 3GBNH 3KPLA 2FZ3B 4XBGA 3WHE1 4RGMB 1UXWB 3LCYA 2W0KA 2ZOKA 2DYPB 3QXWA 1MWAA 1TJHH 3BAEL 2NTFB 4PG9A 1QSFE 1X5JA 3MRLB 1XGQA 1DQDH 3NFNB 4P9HL 4P59H 1MHEA 3GHEH 4WI8A 2EXYC 3QUYC 3KYKH 5ICYB 3QQ4B 3S8WA 2WANA 1KUMA 4MS8C 4FP8L 3B9KB 5J6HA 4R2GD 2I60L 4CKVX 1JWSA 3H9SA 4HJGA 1HE7A 4GW1B 1WWWX 4KK8C 2R2HB 5L88H 2Y1VA 4OKVA 2F19H 4GG8A 5L2JA 4PJEA 1U8QB 3WYRA 1SYSA 2EDHA 3CFJB 5DC9B 1DSFH 2R0ZH 4LSDA 3C60A 3MSPA 3O9WA 3O6MH 1FVDB 2G5BB 3GRWL 5TDPA 1R3KB 2IAMA 2OR7A 1VGKA 3ZT6A 1RK0A 1JGVH 3JWOH 3VXQB 3RNKB 2F53E 1FAKT 4ORGB 3RU8H 3L3OB 4JR9L 1HSAA 4GAJL 1FZMA 2BNQB 1AHWC 2DB8A 4QRPD 1M6OA 3X13A 5TPWL 1RVFL 1L7TL 2J1KA 4NUGH 5FO7A 3IRZA 2CRZA 3QFJE 2C9AA 5IVXF 1CU4L 4JY5H 3D25A 3EOBA 4U1NA 1O7SA 3WXWH 1FH5L 5D7LA 5BMFL 4RIRB 1KCSL 5D7SL 5I1IL 4P5TA 3BDBA 3GMMA 3KYNA 4P3DB 4ZTPL 4JZJC 1P7KA 2EXWD 2VQTA 4K7FB 3ZDZE 4FNLH 3VH8G 4ZFGL 1FZKB 1IAII 5DRXA 3OJVC 3MRNB 1FFPA 1YQVH 4JM4H 3OZ9L 1NMAL 1CGYA 4WJ5A 1OPGL 2YA2A 5B3JE 3QG6B 2PCPA 3PWUA 5EO0B 2VISB 4HPYH 3CAFA 3PGDA 4IRSB 1A1OB 5CP3H 3LQAL 5LGKA 4PJFF 2EDWA 4YGVB 5HGGS 1RMFL 5CWSB 1MQKL 4WTXA 4I0PB 1HILB 5DD1H 5DJ6B 3T0XA 4EVNB 1ZXQA 5B8CA 4TVPL 2GIYA 1I7RA 1AH1A 5DJYB 3RUGA 1HHHB 3ARQA 2BHYA 3HN3A 2P7TB 3HC4L 3DRTB 3QJHA 1RHHB 3CLEL 3VGBA 3WFHA 1GGYA 3H42H 1C5DA 3VD4A 1AD0A 5TE4H 2H1PH 5GQBA 4ZUUB 5BS0E 4YAQA 3I75A 3VRLE 2BNRE 1BZ9A 3RVXC 3SCMB 4XNYL 3BN9D 4HV8B 3D5OF 3MRCA 1KJMA 5EH1A 4CVUA 2A9NL 1KPVA 2CKBB 5I75C 4GXVH 4HWZA 1DUYB 2X4OB 4TULL 5GJSH 3CC5B 4PP1C 3UTTB 4PJHF 4HS8H 3BD4A 5DF0A 3QXVA 3MRPA 4XPFL 4NFDA 1CL7H 5IEHA 4HKJB 1U3JA 3WDIA 3T2NH 2R0LH 1B9ZA 5CBEA 3T3PF 4HIEA 3MR9B 1N5AA 4ORZC 4R26H 3B9VA 4Y4FB 3L9RA 3X3FH 2AEQL 1T7WA 3BPOB 4PJXA 7CGTA 3DHJA 2CRIA 4PLJD 5C07B 2VQUA 3UO1L 3DROA 4LHUB 1U8IA 4JFXA 4NHCL 1SHMA 1S9KC 3SE8H 1XF1A 2HJLB 2VL5B 3VA6A 3WJJC 1IAIM 2CR3A 4BFIA 4DN4H 3GMQA 5D7JA 1MI5A 4Y7MA 1JRHI 2PR4L 4DKAA 2WBJD 3W39A 4BSVA 2B5IB 4PR5A 1UJTA 5IIEA 2DJ4A 3BH9B 1QHPA 3PWJB 4CUCA 1P4IL 3OPZL 4DAGL 3BZFA 4HC1H 3KLDA 2VSDA 4QHLB 3EYQD<