3HE6D

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta8.2 nkt tcr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
236
Chain Sequence
AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDAQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 60
structure length 236
sequence length 242
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he6D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he6D02
3ARYA 4QXUL 3A6OA 3LQAH 4DVBB 4ISVA 4XH2B 4U1GB 3V4UH 2DQGH 1UB5A 5GS2D 4JKLA 3T4YA 3U9UA 3SJVA 3BP7A 5BJTB 3BEWB 1ZHNA 5FIEA 3B5HA 1IC7H 1IEBB 1MCCA 1Z3GL 3UBXG 2NW2B 4LSRH 2W38A 3G5XB 3HNVL 2R2HA 3SE9L 3L1OH 4ODUB 3VFVA 1PKQE 4WW2C 5B21A 4XTRC 3QFDA 2VC2L 5D1ZC 2Q7YA 2APFA 5SX4H 3V0WH 1ZSDB 4WFFD 1QPXA 2ZG3A 3O2DH 1WGOA 4P0DA 5EDXA 4CU7A 1Y18B 4RFNB 4B41A 3VGGA 3QO1B 5E94A 1BAFH 2GCYA 1WC7B 5HXMA 1K4CB 1YY8B 1EO8H 4JFDE 5IV2A 4HS8L 4MJIB 3MLRL 3CPLB 1H3UA 5C6PB 4J8RB 4BQCA 3C9NB 1ZXQA 3CSPA 1A7QL 1W72B 2W0FA 3I2CL 1JPSH 3OXRA 4OFVA 3P0VL 3NCFB 4M93B 1TQBB 4PGCB 1F4HA 4ORGB 3WN5C 4Y5XC 3M1BB 2R69L 4XNUH 4ODBD 4NSKB 1RAMA 2XY1A 3QZWB 5C07D 3ZTJH 4HLJA 4P2QB 1A0QH 2XWBA 4Q6IC 5D2LB 5EC2A 5GJTH 5D7KE 4MA8L 3V5HB 3BKJH 3IT8D 2CKBH 2CUIA 3X3FH 3IAPA 3ZKXB 1QR1A 2VIRA 4FNLL 2V9TA 5DTFB 1J9CT 1H5BB 1GZPB 1QFUH 4OZIE 3K0WA 3KJ6H 2YK1H 2MHAB 3PXJA 4PJ5B 4XAKD 4XI5D 2B7DT 2HT3D 1LO2L 3RY6C 1B90A 5JHDA 5L2JB 2FATH 4DUXA 4YIQA 2JTDA 5EBLA 3G6JA 1NCAL 2VISA 1S5IL 1QSFE 3MNWA 1UEMA 4PP2A 1U41A 4HPYH 3I6GB 3RZCB 4LEOB 3ULUD 1S7RA 3ILQD 3HHRB 5BV7L 2BRQA 1TENA 3KAAA 5DI8A 1V3LA 2B1HH 3KPRB 1XCQA 3BJLA 1MCOH 4GG6F 2NXYB 5I1GH 2MMXA 3LRHA 5IESH 3TJHD 3VXMB 4LKXB 5DMYA 3SPVB 5HI5C 3RVTC 1I7ZB 5L0QB 3SDAC 2ZJSL 5IBLD 4NHCL 4P2QE 4OFYA 1J0KA 2R2CA 5D2LE 5TF1H 5IIEB 4OLEA 1YA5A 2W91A 1HHHA 2BNQA 4OCWL 4PB0H 3KHOA 2R2BB 3T65A 2Z91A 5JHDD 3PABB 2F74B 5FF6A 5CGTA 1JNNH 4XPGL 3EYQD 4JO1H 4OCNC 4KTDL 3MGOB 4TULL 1CT8A 3PNWA 1JWSA 3FB6B 4I4WA 4M7LL 1ZKAA 3VWKA 1MAKA 1V5JA 2PR4L 1I3GH 3O6MH 4X6DF 4Z7WF 3M17B 2AXJA 4F15C 3IDMB 4C58B 2NY3B 4PJBA 4U1SB 2OMBA 1MFAH 1CDYA 3KPRE 5JOFB 2HRPH 3O4LB 1FL3B 2ZUUA 2BFVL 4YR6B 1WJ3A 1ZHBB 2NNAB 5C9JA 1HNGA 2QTEA 4OFYD 2OR9L 1MNUL 3QIWD 3VJ6A 5GGTA 2FJGA 2BNQD 2NY0B 3FFCD 1WFNA 1MHEB 1AO7E 3TT1H 1UH3A 3TA3D 1Q9KB 4PGEB 4QHLA 1ITCA 1KC5L 4NRXB 5F7YC 2EIBA 5B39G 2CRIA 4PJDE 4EDXA 5EA0H 3HMXL 3C6LB 4NQXB 5BMFH 1A7NH 2CPCA 4DZ8A 3QEQA 5BV7B 4IDLA 1IT9L 2O5XH 5D7IF 1HDMB 3C5JA 3NFPB 4PJXF 4OKVB 3VGBA 1ZVHA 3O41A 1UKSA 2JK5B 2NX5D 4PRHD 4M6NH 4JZOB 4YDIL 3O4LE 5HGGS 4RMUA 4ZUSB 3S37L 1O7VA 4GKSB 4E42A 1XCTA 15C8H 4WFGE 1X5HA 1J10A 1CXHA 4PJGB 2DQIH 5M94B 25C8L 4IRJA 4NJAH 2G9HA 1K85A 3T0EA 2ZP0T 2HVJB 1A6UH 3BAEL 1BHGA 4UV7H 4KKBD 3ARBB 5IROA 1XF5A 3QEHA 5DEFA 5BVJB 3QEQD 4UQ3B 3FO1A 3VWJD 4LGSB 1R5IA 1HOCA 1QR4A 3O3EB 3CDFA 2NY1D 5DUBA 3IVKB 5I16B 1E6JL 1MLBB 1CU4H 3VFTB 5IR1B 4L9LB 3BWUC 4PLKD 1TVBA 3FN0H 4C56E 1TZGH 1FL6A 5F6HI 2DQEH 2YC1A 3MJ7B 3MUHL 1QKZL 2HG5A 4YK4B 4OLXH 4P9HC 1BVKA 4Y4HB 2VDNL 1NFDF 1FFOB 5E99H 2AJXH 3VDBA 2RR3A 3H9ZA 5D6CB 4PJGE 5C0DB 3U4BH 2J2ZA 5AG8A 1T2XA 3X3GH 2ERJC 4KJYA 4DOHB 3OGCA 6FABH 1XR8B 4KI5E 2XA8H 4LCCA 5I2IB 3FCTB 4MXVE 5DSCB 5GJSL 1ZT4A 4QYOB 1JNHB 4NQCB 5IMLB 3MRLB 2DQFB 4LF3A 4NUGL 3TBSA 4UDUA 5CGYC 1OCWH 2ITCA 1J0ZA 3NPSB 1R6VA 1Z0MA 4JCLA 4QHKJ 1T5XA 4RNRB 4DJMA 5JXAL 2DBLL 1JN6A 4LRNL 1N5AA 4GRWB 1DBKH 3MNZA 3HPJB 1BFSA 1EBPA 1HHIA 4QTHB 2HVKA 1CVSC 3T09A 4S1DC 4AEEA 4FQ1L 3OF6D 4K8RH 3DYPA 4UIMA 2A73A 5CHNA 1J1XL 2OL3A 2HJKA 4NO5A 1YEIH 3RWJA 1XIWC 5TQ2L 1CD0A 1A3QA 1NFIA 3THML 1GRWA 4HUXB 5C8JA 5HVWA 1QFWI 3PGDB 4GQ9H 5BOPA 4DOHE 4XMKL 4GW5B 2YD7A 5F7MC 1F6AA 4OF8A 5EU6B 4NQCE 4M6OL 5DHYB 4RWYL 5I19H 4WEBL 4UT9H 5JQ6L 1F4XH 3P73B 4GXVL 1K8IA 5D2LF 5C3LD 4FABL 5CZVH 4H0IA 4J2XA 4OIIL 1MCDA 1OLLA 3QIUB 5AAMA 5GRXG 4MLSA 3NABL 2OK0L 3QAZC 4YDKH 5F44A 4GRWE 2ARWA 1BFOA 2JB5H 1C7TA 1GGUA 1S7SA 2B4CH 3GSWA 5GGSY 4FXGB 4WDIB 5I1EH 4Z8FH 4OI8A 5I66A 3BZFB 3FQTB 3K74B 1YYML 3PWJA 5E8OB 1VGKB 4PS4H 5EOQH 2LU7A 1RUKL 4JFPB 3SY0A 3CDYA 5CUSH 1FNEB 4XVUD 1UA6H 1CGVA 4KY1H 4KHXH 3GMOB 5HI3C 1V3JA 2DF3A 3TNNB 8FABB 4XNYH 5EU6E 1LD9B 4LPYA 2VLLB 3VRLE 2A9MH 4P2CG 4YFLI 3OX8B 5CP3H 2Z92A 5INCB 4IHOA 5FA3A 2MCG1 3IDGB 5JXEC 5IB3B 2DBJA 1WITA 5JW3L 3WHXA 2FR4A 1KJMA 4NZTL 3A6CH 3QDMA 5MENE 4OBSA 1PDKA 3MLTB 2YMXL 4LLQA 1UENA 1BOGB 3NGBC 4EVNA 1OSZA 2WW8A 2F5AL 1CFSA 5A1AA 5L88H 2JCCB 1I4FA 4WTWA 2DD8L 3KYNA 4EUPH 5I17A 4JO3H 2R1WA 4WW1A 4Y4KC 2B39A 5CINH 3JSSA 2OMNA 3DV4B 4YAQA 43C9B 4WWKA 4ZFOA 1HKLL 2GJ6D 4XNXL 3CFKB 1DQMH 3MA7A 1JPFB 4HIEB 4NOBA 2VDPL 4K94H 5E1AB 2X1WL 3VFGL 2OTUB 1WWBX 2X5PA 3SQBA 1HXMA 3QXDB 4JZNA 2VITB 3NH7H 3Q3GB 2AEQH 3OKMA 3D2UD 3GSNA 1AD0A 1WWAX 3FB5B 5FEBA 3QDMD 1EEZB 1F6LL 3U9PL 3CMOL 3LDBC 5B3NA 3K46A 1CFQA 4NP4L 3LEYH 4FZEL 3BDYH 1CLYH 4XAWL 3EOAA 2R0LH 1FPTL 1I7RA 2P8MA 1AJ7H 3SDDA 1I1RA 3MLYL 4V1DD 1UCBL 5EFIA 4M02A 1V7NL 1RVFL 4PR5A 5DK0A 4QRUA 5IM7A 2JCCE 2ZNWA 4WWKD 1IKNA 4NZDA 2R39A 3A6BH 2HWZH 2VDLL 4N5ED 2HFGH 1TJGL 1SMAA 5GIRB 1OWRM 1OARH 1G9EA 2V17L 2GW5A 5IVZB 1MEXL 3STLA 2FIKB 2X4QA 2F9BT 1WZKA 5IMKB 3D3VE 4P3DA 4PJGF 5EC1A 3PWPA 5GSVA 3MLPA 4MAUL 5AYQA 2EH8H 3BZDA 4DW2H 1KJ2H 3SDDD 4MXVF 5C0CB 1ZLUK 1ZGLM 4OCYL 2JIXB 5JDSA 5E7FA 3SOBL 1K5NB 1KF9B 4N0CC 1D5XB 1SJHB 2IGFH 3WSQL 2IAMB 2HA1A 3FQXA 5JZ7C 3TP4A 5CSGA 4Z77A 2H3NB 1IC5H 5DYOA 1FAKT 4YBLC 1MWAH 1UKQA 3LH2L 4RMRA 1KEML 3FB8A 3JTSB 4LMQE 1GGCH 4ODTH 5LJYH 3PWPD 4K7PH 4I3RL 2ADIA 1E4XI 5HHXL 4AIZA 4G9DA 1RUPH 1J11A 2YZ1A 3CVIH 4HJJL 1AC0A 4XNMA 5F9OH 4AY0A 4JFFA 1Z5LB 4J6RH 3U7YH 1LE5A 4ODHH 1T7WA 4HS6A 2BY1A 3MMEB 3CK0L 3NBNA 12E8L 5C0FA 4ZUTB 1WEJL 2Z4QB 5CJXA 3TH3T 3PDOA 3F5WB 3VXTA 4X80L 2PYEB 3I3EA 1HK6A 3QRFM 1D9KA 4XP9L 3SBWC 5B3JE 1CBVL 4XXCA 1JFQH 1IAII 4QHNA 1B0GB 4A6YL 4LLMA 4JPIA 4TSCH 4BELD 3P4OB 4OGAC 3MTRA 4HMCA 3RI5K 2FHFA 3PWNA 1QLEL 1T2QH 5J1AA 2XWJA 4QOKB 2BVOB 5J9PA 1C16B 1IGTB 4GQPH 5I8KL 5DD3H 4GBXC 3ZTNL 1O7SA 2C1OA 1W0VA 4KROB 4JRYB 4PJFA 3ARDC 1U91B 4HIXH 4X98A 5CBAB 5JOPE 2I07A 1P1ZB 1N64H 2ZUXA 3HR6A 1C1EH 2NY2B 1P4LB 1JI1A 3ET9F 3MRPA 3CSYB 4YPJA 2FYYB 3PL6D 1A5FH 1ERNA 4HS3B 1RHFA 3K4DA 1HYSD 1T5WA 4HCRA 4MD4B 2W92A 3UJTL 4DUWA 1D9KD 2DICA 5K9QG 3VRLF 3OR7A 3FZUC 4GG8B 1NLBL 2W65B 3BH8B 1T03L 1T7VA 4OLYL 2PNDA 5K59F 2HMIC 4X8JA 3ARRA 3GUTB 1BIHA 1I7TB 5E00B 5DQDL 2WBJA 1DJSA 3L5WA 5ADPH 1RUAL 3OV6A 5FM8A 5ERWB 4ELMA 5LKNA 4QOKE 2GT9A 4RCAA 5F8RC 1BZ7A 4ZUVB 1VACB 4BJLA 2X4UB 1PEZA 1FZJB 1EEUA 4CW1B 3P30H 3P11H 4UT7L 1QHOA 1YECH 3X14B 5DGQA 1UH4A 4JN2A 5FO9B 3AREB 1J0YA 2GK0A 4PRIB 3QULB 5EZIH 3M07A 3JV4A 1G84A 5CGMA 1BWWA 4U33A 1KLGB 1NQBA 1OM3H 3FTGB 1I9EA 4HGWA 4A6YB 5IVXB 2WBJD 4IJ3C 1A3RH 5DD6B 4WO4C 2AI0L 3IU3B 3MRQA 2AP2A 4I77H 3CZFB 5FK9B 3I6KA 1MCPL 4B5EA 5A3IC 5DFVD 5FUOL 1KACB 1NEUA 3SKMA 3MFGB 2NYYC 1Y0LA 3WFBH 3WIHA 1I75A 2JCCF 4MDIA 3EOBA 4DWHA 1KB5H 4YXKH 2CDEB 2FCBA 2RQ8A 5HYIA 2ZZUT 2MKWA 5ABDE 4EI5C 5DJ2A 1I9RL 5FM4A 5DRXA 2C1PA 1BREA 1RJYA 4JKPL 4PRIE 4UB0L 3JTTA 2BSED 4I0PC 1FZOB 3I6LE 3NIGE 1YYLH 2RHEA 5CJQH 1JK8A 3CXHK 4QRQB 3QUXC 3OAUH 3Q5OA 2F8OA 1NBYA 3VGAB 1TPXB 3WFHA 1ES0B 3DVIA 5F1IA 5IVXE 2YPLD 3U82B 4L8BA 4YXHL 4JHZA 5EZJA 4POZC 2CXGA 1FAIH 4M5YH 4XPTL 3R06B 5JUEL 5DVOA 5J6HA 2VDOL 1L0XA 3KR3L 3RDTB 3O3AB 2IQ9L 5DDHB 4OZ4A 4NM8L 3LV3B 1HCFX 3JUZA 4ODXB 2PTUA 3AU1B 5F7FA 4ELKA 4Q9RL 3TIEA 3KLHC 4DKFH 1EX0A 4MVBD 5FYJU 3QFJD 5CWSA 2Y06H 3U0TB 4ODSH 1SBSH 1M71A 3NN8A 4MD5B 5JR1H 5EWIL 5BO1L 2IG2L 1JYNA 3UYRH 3KXFB 3DO7B 3JUYA 4U2YA 1BGXH 1CL7I 4PJCB 3C08H 3SHSA 1J05A 1CDCA 1SYVA 2X4OA 5DS8B 1NDGA 1WFTA 4CU6A 3EFDH 2VDMH 4WHTB 2XNAB 5T1MB 1L4IA 2ICWJ 4L29B 4WUKL 5IK3A 3P9LB 4L5FH 4NKQB 4KPHL 3LIZL 1ZVSB 2YPVL 1RFDL 1JGEB 3CC5A 3WJJA 4YQXL 4UTAH 5ACLA 2GAZA 4JO4L 5IVOA 1QQDA 1DANU 5ITBL 3HNTH 2HTLD 1SBBA 1ZWIB 5SX4I 3ARUA 3TIDB 1CK0L 5KVEH 1IM9A 3BSZH 1N59B 5B3JF 1T66D 3TZVD 1AGBA 4XGZB 3VI3E 2QKIB 4OQTH 4OBRA 3RP1A 4Z7VB 2CIKB 3KPNB 3KVQA 4AMKL 5HJ3B 1G1CA 4ACPA 3KXFE 2WP3T 1FNLA 3NZ8B 4HC1H 4PJCE 4CKVX 2NY4B 5TE6L 4HWZA 1H9VA 4YHIB 1VSCA 3GSQB 3RAJH 1Q1JL 1ZLWK 4X9GA 3LKNB 2FEEI 3MRIB 1NFDB 1LP9A 5GRJL 3CAFA 5EO9B 4AENA 3MJGX 1G0DA 2VZUA 3ALWA 5DQ9B 5DRZA 4D8PA 2DWEB 4C55A 1F90L 4PP1C 4KXZH 2B8OT 4OGYH 1EFXD 2WP3O 4JZJA 3U7WL 2X40A 1T20B 2DQCL 4C57C 3PV6A 5DJ6A 3MOBH 1YQVH 1KCSH 4MXWL 1UM4H 4H20L 1A1OB 5D1QB 3D39A 4Z7VE 1SY6L 2XQBH 3BVNB 3MLXH 1C5DA 1CLCA 2BJML 1NUGA 3VW3L 3TBVA 2A1WH 3IDXL 1IGFH 3TPUA 2O5ZH 4PRPB 5LCVL 1QFHA 1QG3A 3MZTA 4O02L 2DQUH 2HN7B 32C2B 3HZKB 3PJSB 3RWGA 1TZIB 4F2MA 5GS0C 1H15A 5LBSH 1T4KA 3SDYH 2OSLA 5FYKH 4U2ZA 1B88A 4KUCD 1YPZE 3ZT6A 2EKSA 2UY6A 3DX9A 3D69A 1JHLH 1FBIH 3HLAB 3BIKA 4GMSL 4P4KC 3D39D 4NKDB 4JFOB 3VXOB 1MVFA 3UTSB 4PTUB 5GS1C 3NCJH 1JZ5A 3B6SA 2DKSA 4MS8D 4Y19B 4IRSD 5CSZA 4F7PA 4EI6A 2NLJA 1I1FB 2P7TB 2I24N 1UWEH 2BC4A 3JVGC 1VEPA 3MODL 4UMGA 4G80A 2YKLL 5DURD 4GAYB 3L7EB 4PRPE 4NKIL 3GMNA 2YZ8A 4EBQL 2DYPD 3V0VB 5L9DL 1FVDA 5DFWH 5F72S 4OB5H 4EQ3A 1DUZA 3MBXL 1HSBA 2Y07L 2FLBT 3GIZH 4XXDA 2NY6D 2IPTL 3NIGF 4MNQA 3D0LA 3MXVL 4I9WD 1AXSB 2FBJL 4OUOA 4TPRL 1YEDA 4HKBA 4JHAL 5FB8A 1QTYT 4UINL 3BKML 5KS9B 5CIPB 4F8QA 2XN9D 4G8GB 3UTSE 5CBEB 1I9JH 5F7DA 4LVOC 5EO1A 4GSDL 1T1XA 1RV6X 4WFEE 5JMOC 4Y19E 1HI6A 1JHTA 5F1NB 2FLRT 5I6XB 3LRSA 5IB5A 4YJZL 2GKIA 2H2SD 1AY1H 4S0TD 3B2UD 1KTDB 4IRZH 3BUYA 5SWZB 1U95A 5CLTA 2ZCKH 3CUPB 3OKDA 4XCEB 3ZKSD 5FA4B 4CVZB 3RJDA 1GCFA 4NQDB 2VRAA 1X5LA 2OJZH 4RISL 2P49B 4NO0A 3HG1A 4Q9QL 2IANB 3K4ZA 1H8SA 4L8SC 2GSIA 4FXKA 1IMHC 3RA7L 5FCUL 5L2KB 3DGGA 1CGUA 3ZE0F 5KS9E 3PDGA 5GGRB 2Y6SD 1R0AL 2IMMA 4XPHH 4P49A 4G8GE 4CDHA 1FL5A 1WCBA 3CDGA 2XRAH 1E4WH 4PJHF 2FHCA 4K2UH 4KJPD 3TEUA 2FGWH 4G7VH 2DQTH 1SJEA 5JDJA 2FJFB 4XRCB 4O2FA 5SWZE 4F58H 5JIPA 2AV7A 3W5MA 2E7CA 3DX6A 4R4ND 1LILA 3UTTB 4MWFA 2WWKT 4RA0C 1AHWA 4NWUH 4O4YH 5HY9B 2BX5A 2JF1A 4NO0D 3MGTA 2P5WB 1U8PA 3HG1D 3MX0A 3WO4C 2PO6C 4NQDE 3BD4A 2PCPB 2H2PC 3MV7A 2HKHL 2NY5C 1ZT1A 4PJCF 5IHBA 4IEFB 2X42A 2EDYA 3JWDL 3GBMH 1NCCL 4P23C 3KPLA 2P5EB 2YRZA 3NACH 3ZE1E 3ROOA 3DI2B 3B9DA 1QBLH 5L2KE 4I3SL 4K8RD 3LHPH 3HI5L 3E6HB 1JJUA 1LNUB 4P9HH 3DURB 3TVMA 1YQ2A 1S7VA 3GSOB 1U36A 4KDWA 4U1NA 4CVXB 4DUVA 4MA1B 5EN2B 4CNIB 1P4IH 1MCIA 3L7FA 4BK4A 1U3HA 1ONQA 3QNZA 2G5BA 5T1LB 4RDQG 1EEQA 2WNGA 2E6PA 1RSFA 1WBZA 4Z7VF 1TQCB 4AIXA 4P4RB 4C4KO 1F4YH 2YA0A 3C5ZC 4XMPL 4JFQA 4HBCL 2P5WE 1BX2A 1M6OA 3P77B 3S35H 3WEXB 3IXAB 4GMTH 1Z9SA 1KG0A 4KQ4H 4S10A 5HHOD 2VZ1A 5T3ZH 1MFNA 2NY7H 5DHXB 3GRWL 4FN0A 4WY7L 1U8HB 2YSSA 1G7QA 2V2TA 4XCFL 4HWBL 1LHZA 4QT5B 3S88H 3AM8A 5IMOA 2P42B 4K23L 3LPFA 1U3HD 3LAFA 5LGJA 4N68A 4U05A 3RGVC 1ZGLA 1XGYL 3FOLA 4ZNEA 2D7NA 4BFIA 2EE6A 3RVVD 1MSPA 3VMPA 3VXSA 4PG2C 2MQ3A 4Y2DC 1MIEH 4XP4L 5CEXA 1EH9A 5L8LB 5TDNA 2WWMC 4KK9D 2X1PA 1CICA 3B9AA 2BRRL 2J8UA 3UX9B 2RJMA 5IJVA 3AAZA 2CR3A 5AWNH 1OW0C 4NNYA 2F58H 1DFBL 5E6IA 1FZMA 2R1XA 3B9KB 4JN1H 2NZ9D 2IH1A 1HH9A 5C0GA 2IF7A 1QSED 3IDIB 4YXLL 2UWEF 3QJHB 4QRTB 3WUZA 5GGSA 5IW1B 2HT2C 3TC9A 1SVCP 3IFLL 4U1HB 4JM2C 4LEXH 1MRCH 4KRMB 4R2GB 1B0RA 5DJ0A 2AXGA 3UZEA 1IQDA 4TTDD 4RQQB 1P84J 4WU5B 1KB9K 1MI5E 5H2BB 5HGHA 1CICD 1QD0A 1QA9B 2VLRD 4F57L 2CGRH 5EPMB 5MHSE 3GBNL 2B20A 1G9NC 5BXFB 5D7JA 1ODAA 1V05A 4DAGH 2XZZA 4NQTA 1FV1B 3BRFA 1QLRA 5F9JB 5J3HD 1FRGL 3QR2A 5I74C 2XZAH 5C0AA 5KW9H 2ZUQB 1P2CA 5E2UH 2VH5L 4KKLC 4GRLB 4E5XA 3WLWC 3ARGC 2SEBB 3QUKA 2HH0H 1R3JB 3DX7B 4AEFA 1KJ2A 3NIDE 1OGAB 2M8XA 5ESQA 4YHNB 1MF2L 5HHNA 2FSEA 4PTTB 2KH2B 3E6FA 3QQ4B 2D31A 1RK1A 2J4WH 3O45A 3HS0B 2LAGB 4JPWH 2W0KA 2BOCB 2AK1H 1X3DA 3KJ4B 3KPSA 5HHPA 1MWAA 4IMKC 5KS9F 1BQUA 3JXAA 3W0WB 5EUKA 4JG0L 2ESVE 4NKMA 1S9YB 5H37H 1CXIA 1U3YA 5EU5B 1JV5A 5C0AD 4NYLB 1DBJL 4X4MA 4CADA 2EYSB 3LS4L 4APQD 3VD5A 3HZYA 2HKFL 1OAQH 2VZVA 4L8CA 2DQDL 2N4IA 4OGZA 4CMHB 2CRZA 4I48B 1HHJA 4X7SL 3EYFA 4PFEA 5DUPL 1OGAE 2GTZB 5D71L 2XFXB 2ZKHH 3NVQA 1FYHB 1AE6L 3Q1SH 3QI9A 4NRZB 4DQOH 1PKQA 3MUGA 1BVLA 5I1KL 2MOVA 1FYTB 1KN4L 1LO0H 4G5ZL 4OF6A 5GSRA 1CXKA 1WZLA 2ZOKB 2YBRB 2E6QA 3FFDB 3KPSD 4HF5L 3I02B 5KVDL 3Q6GH 3O8XD 4ZAKA 4LSTL 3ZHKA 3ZE1F 5I1JH 5L7XH 2BHYA 2G2RB 5KVFL 3H7BA 5EIIB 5AG9A 3W0WE 5HVHB 5D1XA 5TE7H 1I85C 1RUML 4OD3L 1ZE3C 4EQ2A 2YUZA 3BIAX 1JMZA 3QQ3A 5ISZA 3W2DH 1NC4B 3MCG1 3GI9H 4FHBD 4AH2A 1G7MB 2BVPB 2FRGP 5ESVB 3AUVA 4R97B 1FCGA 3OSKA 3MRHA 3QI9D 1K3ZA 3CFCL 4QHMA 1X44A 4LCIH 2OXHA 3LEVH 4FFVD 3PGFL 4F37F 1TNMA 1EHNA 2O61A 2NQCA 3FB7B 4OD2B 3TWCL 3GB7A 2YRPA 3AB0B 4FQXB 1F00I 1FYTE 2ZCHL 3SO5A 1UZ8A 4K9EL 1YJDC 3ARFD 2ZOLB 5T1DH 4KK5C 4Y89A 2X4TB 4U3CA 5C0ND 4HUWB 4FQCL 4M6MH 1U8QA 3CVHH 5BS0B 4W4OA 2GI7A 3QUYC 3OKKB 1N3NA 1S9VB 4EN3D 4M1GH 5T3XL 2F54E 2BSSB 3IU4L 3G5VA 4BFEA 5FDWA 1XF4B 5JORA 3TNMB 4Y5VB 1BIIA 1FNSL 3GBLA 4H26B 3EYVB 3FT4A 1Q94A 1LO5A 1D6EB 4QHUB 1DDHB 4PGDB 3QNXB 3RI5F 3VXNB 2FO4B 2R15A 2MNUA 4MLIA 4PRBA 1JWUA 4R90L 4Q2ZB 4NQUA 3TYFA 1JTTA 1E4KA 3RZWA 1T89A 2D7TL 3L3KB 4UUJB 5I18L 2A83A 3D87B 5DMIH 4MD0B 3FHAA 3U4EA 1BFVL 1NDMA 4DN4L 3ULUC 2BOBB 1HCVA 3ILQC 4RFEA 4MNHB 3T1WA 1HXYA 4X8XA 5IB4B 5BS0E 1RZIA 1UQSB 2UZYB 2D7QA 2VLJA 3O6FB 4L4VA 1I9IH 1KCVL 2ATPB 2PTTA 1UGNA 1WBYA 4L4TA 4PJ8D 4NO3B 2I60L 4OV5A 5DJDA 5IBLC 1NSNH 3RVXC 1JHKH 4XVTH 3O4OB 5JW5B 2FL5A 4OM1H 5E9DB 1DVFA 3EDFA 1LVEA 5I1IL 1RZGB 2DOCA 3BN9D 4QY8B 3DIFA 3EYQC 1EMTH 3O6LH 4PV8A 5JHLH 5L6YL 2X1OA 2Y5EA 3FRPA 5DT1L 1MHCB 3OG6B 1KIPA 4O58H 4PGBA 1CE1L 4J3TA 3L5JA 4S11A 1M7DA 4JY6B 5E8PA 1MFBL 2VLJD 1YUHA 4S2SB 2Q8AH 1JZ3A 1HHKB 1RJLA 4C83A 1V3KA 4IOSD 1HH6B 1KT2B 1VFBA 2AJ3B 2CLZA 3BQUB 5DK2B 3QIWC 3U1SH 3DSNA 3QDJA 3VGFA 4D9RE 3ULVF 5D7LD 2OI9C 1VESA 3T2NL 1JF1A 1KIUA 5JIKA 4Z0BH 4TSBH 3FO0L 3WIFB 5IB2B 4XC3H 2VXTL 2AK4D 2X4RA 2AEPL 4ZOCA 4R7DA 1QVOB 4XZUB 3K7UA 5E9DE 1FORL 4GS7C 4BZ2L 3TA3C 4KKAC 3ZMRA 1J8HD 1NMBH 4YDLB 3BGMB 1UB6B 4G8EA 4LPUA 4KK8D 4PREA 1OP9A 1ZLVH 2ZNXA 4JFZL 1WFOA 3BP6B 5SWSB 3G6AB 3GIVB 1MHPH 5F97E 4F9PA 4FRWA 1A9EB 2QQLL 4O5LH 1AXTH 2IPUK 3GM8A 5B8CB 4AEIL 1W0WA 4NNPH 3QXTA 5T3XE 4N90E 2BY3A 3QDGB 2F19H 4K7FB 2X44D 3NFNA 4KRPB 3VFRA 3KPPA 4UTBH 4KZDH 1IQWL 3DUUA 1OAUL 4FG6D 5IUSA 3D48R 1UWXH 2CK0H 2YPKA 2CUMA 1EHAA 3FONB 3UPRB 1EAPA 3MNVB 4C56A 4N0UB 1T1WA 4TUKL 2NY2C 4OQTA 4YHYC 4JFHE 4JAMA 4KJWD 4HIHB 4LPVA 3VWJC 4YO0B 5GXBB 2ICWA 4JJ5B 1P7KB 1U8MA 2W07A 2ORBH 2WINA 4Z95H 4ISVB 4HC1A 5SWSE 1T0MA 4WW2A 1J1OL 2H32H 2NY1C 5D1ZA 1UB5B 5J89A 1EV2E 3U46A 3T4YB 3U9UB 3OPZL 2X2YA 3SJVB 3BP7B 1ZHNB 3OKEA 5SX5H 1KN2H 1FO0B 4O2EA 5HHQB 4MQSB 1KSRA 1DBBH 1MQKL 2OS7A 2R2HB 4WI2A 1RI8A 5DHVA 4WNQA 3VFVB 4OD1H 2XTLA 2UZIL 3QFDB 4UU9A 2Q7YB 1LDPH 3CH1A 2DTML 4YHKL 1BPVA 2APVA 2EXWC 3DHMA 5E94B 4N0UE 4WFFE 2GCYB 5AAWA 2HFTA 3WN5A 1FC2D 1KV3A 1U8LA 1QPPA 4E41A 5IV2B 4XTRD 5D1ZD 4ZSOB 1LQSR 4LARL 4TRPH 3SEPA 4Q6IA 5HHVL 4Y7MA 5JLZA 2W0FB 4MA7H 2O26U 1RZJL 3EW3B 2ZUYA 3OXRB 3QUMB 1HWGB 3SJVE 2AGJH 2ICWI 2Y4SA 3BMVA 3U2SA 1ZANL 2C5DC 5DLMH 4PJEA 1CDJA 5D72H 3RY6A 1J5OH 1TITA 5DQJA 2XWBB 1NFKA 2L7UA 3REVA 5EC2B 4LSQL 3C2SA 4PBWD 3OR6A 5GGTL 4KHTH 1EJ6A 4G6MH 4IDJH 2L0DA 4TOYL 2VIRB 1QR1B 4KVCH 4E41D 4AT6A 4P46C 4LSPH 3P0YH 4RFOH 1INEL 1RULH 4KXZI 3PQYD 5JHDB 4U1LA 4J4PD 4H8WL 1FVEB 4YIQB 5EBLB 3E0GA 3SDAA 3G6JB 2Q86A 2VISB 3GHEH 3MNWB 1EVUA 3EJZC 4PP2B 3DBXA 5TPWH 1TDQA 1S7RB 4Q74A 1INDL 2BSRA 5ILTH 5DI8B 1TTGA 3TYGL 1N26A 1XCQB 2NTFA 5KSBF 3RVWD 3INUH 3SKNA 3H3BC 3ZKND 3BE1H 2VL4A 4TQEL 4WHCA 5FYKD 4U6VH 1LO4L 4YNYA 4PUBH 4LSVH 2B2XH 1U58A 2GTWA 4K3DL 3VE0A 1IVLA 2QADB 1IAMA 1A14L 3MRMA 1OAXH 2DKUA 1DLFH 1R5VA 2BNQB 1NCUA 3RBGA 3T65B 2KKQA 2Z91B 5FF6B 4XVUC 5MENA 3SDAD 4NZRH 1CT8B 1BQHG 1N4XL 1YN6A 1WLHA 5JHDE 3ELAT 3PNWB 4I4WB 1MJ7L 3D25A 3FT2A 4KRNA 3VWKB 1CIUA 4ZTPH 1I1AD 2HJLA 3G6JE 2DQHL 1I8LA 2A6JA 4M8VA 3QPQD 4I18C 4PJBB 5F93C 5K9KA 3OAYK 1MCKA 2EEBA 4DVRH 1HINL 4ZO7A 5DJCA 2E9JA 3GSXA 2Y5TA 1GGBH 5DGRA 4NZJA 2VZOA 4WJ5A 1BEYL 1KPVA 2FJGB 4L8DA 1F42A 2BHZA 4P9ML 5DK3A 4OLUL 3W9DA 1MREL 1JIBA 1XH3A 35C8L 2R0KL 4YPGA 2BNQE 3O2WH 1U8KA 4QHLB 3WXVH 1Q72H 5EBWA 3FFCE 1DR9A 4EDXB 1WK0A 3DLQR 1KPRA 3E3QE 4UT6L 2VQTA 3C5JB 3L3DA 3VFPA 5CJBA 1RIUL 2DLHA 4OIBA 2D2OA 4PJBE 4P5MA 2RBLA 3O41B 4DGYH 2HAZA 1PBYA 2EC9T 1YNKH 3QO0A 1BFTA 1NCBH 1XCTB 4HKZA 2MSPA 1WSST 3VD3A 1KELH 3UTZA 1JPGA 2WUBH 4IRJB 3WNOA 5FOBA 4LGRB 4HXAL 2G9HB 1T1YA 3T0EB 2OL3L 3BI9X 1A3LH 4EOWH 1W72H 1XF5B 5LGHL 3E2HC 3FO1B 4LVNC 3C60D 1R5IB 1TLKA 1GIGH 3LVEA 1HOCB 3L3IA 3MJ9H 3HRZA 3QEQE 1G7PA 5DUBB 4YHOH 2XG5A 4WTZG 2BDNL 4LCUA 3FJTA 2XZCL 5AZ2L 5C9KA 2P45B 4LPXA 2FGZA 4WVRA 3GDBA 2X70B 1TVBB 5CEYA 3MLSH 4URTB 2A6DB 1FL6B 5KZCB 5BRZA 1QEWB 3BPOB 2YC1B 4JANA 3GNML 2HG5B 1P69B 1BVKB 1JZ8A 4BZ1L 2HTKC 2H1PH 1CDGA 1YY9D 2FX7L 2HP4A 4M43H 1FJ1A 4XHQA 3T0AA 4YZFE 4X6CA 4KJYB 3OGCB 3T0EE 1GL4B 3WFDL 3B9EA 4QNPE 4LCCB 3SDCD 5J11C 1LGVA 1NGXA 1Z3GH 1AGDB 3V52L 4K7PX 3SKJL 4EIGB 1N0XL 4LF3B 3PHQA 4UDUB 3SE9H 4Y16D 2ITCB 3V4VH 2VC2H 1XIWA 4FS0A 1T5XB 2V2XA 4P2OC 4G43B 2Z35B 4YX2L 3ARQA 1JN6B 1N5AB 3MNZB 1HHIB 3TV3L 2HVKB 1KBGL 3O81A 2X4NA 4HS8H 4UIMB 2A73B 5ETUA 2DLFL 2OL3B 5AEAA 4NO5B 5T3ZD 3RWJB 3I2CH 1NFIB 2IBBA 4LDLB 5C8JB 4RMSA 4N8VG 2APXA 3IDUA 4J3OC 1AP2A 3V2AR 3P0VH 2IPKA 3W82A 3ZLQC 1FN4B 5F71A 5KSAD 4S1DD 5I1DB 1NUDA 3IDJA 3NTCH 3LS5L 2R69H 4M03A 4ZODA 1F6AB 1PKOA 3V5KA 3WNLA 1ZA6B 4D0DB 4NRYA 4ZFOL 5C09D 5LXGH 3HCVA 4OJFL 4MA8H 1K8IB 4PRNA 5ICYA 1PGRB 3K2UL 2VKWA 2GFBA 4FNLH 1TVHA 4HLZG 2Z31C 3GJFA 3GHBL 3PL6C 1T2JA 3GSNL 1LO2H 2APBA 3PWVA 3VFSA 1BFOB 1N5YL 1S7SB 3GSWB 1H8OA 4ETQA 3BGFC 1NCAH 1XGUA 1S5IH 2QSCL 3G6JF 3Q0HA 3PWJB 5IF0A 4GW1B 4G3YL 3SY0B 2EO9A 1IRAY 4LCWA 4MX7A 5JXEA 5FV1L 1VEOA 2BSTA 1VHPA 3QCTH 1IGCL 1E4XL 4AIOA 5FKPA 5E5UB 1BJ8A 2A6KA 4RZCA 5F7EL 2ZJSH 5T1KA 1UKTA 4M1DL 4IHOB 5FA3B 3T04D 2HLAA 3L3OB 5K33A 4OCWH 2G75A 5E08L 5GRUL 3WHXB 5HI3D 2OBGA 5C6TL 1KJMB 4Y4KA 5IHLB 3GGWA 3QT2A 4XPGH 3V6OC 4KTDH 3QDMB 4L3ED 5F3BA 1Q9OA 3BW9A 4M7LH 4BK5A 4LLQB 4EVNB 4NT6A 4MA3A 4JPVH 1IAIL 1OSZB 1UM5L 4MQTB 1FLRL 3RWIA 1CFSB 4UDTA 2WM0A 1I4FB 4ZUWA 4G9FD 1NC2D 4OZHA 3KYNB 5I17B 1FHGA 2WBJC 4XNQA 2R1WB 4WW1B 5IEHB 3B8SA 1S9KC 2EECA 4YAQB 2QSQA 4ZFOB 2BFVH 3MA7B 4P5TD 4XVSL 3I3BA 5T1KD 1J1PL 2OR9H 5DFVC 1KENL 3OBAA 1A64A 5FHBL 1HXMB 4JZNB 3W11D 2F53D 3OKMB 3GSNB 1AD0B 2KPNA 3T0WA 1KC5H 2GSGA 1CFQB 3HMXH 5T5NF 1VFAA 1XGTA 4S1RH 3EOAB 1ZAGA 3MRRA 1I7RB 2P8MB 3QDME 3SKUD 3F7PC 5EFIB 1N6UA 1IT9H 4LHUG 3GMMA 3EYUL 4PR5B 5DK0B 1TQCC 3IDYC 3OAZH 4RGMC 4Y1AD 5IM7B 1I3VA 4AZ8A 1HSAA 1HQRA 4JR9H 3LN4B 4AEHL 2K7PA 1IGJA 3MRBA 4HZAA 1AI1L 5CSBA 4RBPH 5JA8B 1X5GA 4YDIH 1P53A 2DKMA 1BM3L 3U0WL 3STLB 3LQAC 5I8CA 2X4QB 3C09C 2NMSA 4PG9A 2EE2A 5J6GA 2EH7L 2Q8BL 4P3DB 5EC1B 3PWPB 5GSVB 2CIIB 3VA2C 3WD5L 4YZFF 3P9MA 3BAEH 4MVBC 2NTSP 3CFDA 4QNPF 8CGTA 1I3UA 2R23A 1MLCB 1YEJL 4F7CA 3VCLB 4IS6A 5JDSB 2QHRH 1JZ7A 4HCRL 2A38A 5DEGA 4WUUD 3OL2A 2UV3A 3FQXB 1E6JH 1S9XB 4LK4A 4LLAA 3PP3K 4Z77B 5DYOB 5A2JH 3B8YA 1B9ZA 2AXFA 3LKQA 4JM4L 3FB8B 1AQKL 1IAOA 3N06B 3FO9A 5EOCJ 1QKZH 4I13B 3IJHA 2FH8A 4X5WA 1LO3H 2VDNH 2ADIB 3MYJA 3H42L 1YEGL 4G9DB 1ZT7A 2MCPL 2HTLC 4XNMB 4D9QD 4X6EA 4R2GC 3PWPE 4S1SL 4JFFB 1LE5B 3SBWA 1OAYL 4HS6B 1S78D 5M95B 3TZVC 4G6JL 5F6IB 5GJSH 3GO1L 4NPYA 5C0FB 3CLEL 3R0NA 1OF2A 5T5FL 4GBXA 1BBJA 4NUGH 3PDOB 3VXTB 3HC0A 4M6AA 3T3ME 3ARDA 1D9KB 3OKOA 4GAGL 3SCMC 5LVEA 4QHNB 5JXAH 2DBLH 4LLMB 5A2KH 3DSFL 4JPIB 2J8OA 4LRNH 2AJVH 3PWNB 5DC0A 5J1AB 2XWJB 5J9PB 4IMLB 4FQ1H 1IE5A 4XCCL 2C1OB 3U83A 3TO4D 3SDXA 1J1XH 1W0VB 3JWNC 2ITDA 4PJFB 5FHAH 4RSVA 3IFOA 5TQ2H 4X98B 1CYGA 2I07B 3ARTA 3THMH 5D93B 3ZO0A 3MFFA 5E2WH 3BT2L 4FQJL 3MRPB 5J1TC 4YFLF 3WIHL 3DVNA 5E4EB 3H3PH 2ADGA 1CL7L 1T5WB 1A6ZA 5DA4A 4XX1E 3EJJX 4ODWA 5HHMD 4M6OH 1VA9A 4RWYH 1YPZA 4NC1E 4Z7OE 5ITFA 5EO0A 3OR7B 3VD7A 5JQ6H 4NC2B 4GXVH 4JRXA 1SHMA 5MEQA 1CD8A 2EC9U 1TCRA 1AC6A 4X8JB 3NABH 2OK0H 3L5WB 4XMLH 3TN0D 3D18A 5I1LA 4M5ZH 3S98A 1W8NA 1ORQB 4ELMB 1NL0L 2GT9B 5CD3A 1CGSL 4HUKB 3S96A 1YYMH 1B2WH 3ULSA 4PJFE 4BSWA 4CAGA 4JB9L 4CMMA 1A1MA 1RUKH 2HMID 4HG4J 5C0BA 3RIFK 3D0VA 2CJUL 5K9OA 4WO4A 4JN2B 4YHPA 2BMKA 4P2YA 1JPSL 3JV4B 1T3FA 3C8DA 2WBWB 4IRSC 3T8XA 2FEEL 4HGWB 4OIAA 4CJ0A 3EZ8A 5IFHL 2KZ1B 4OGXL 5BVPL 5JW3H 1VCAA 3MRQB 1HE7A 4XVJL 5GJTL 3I6KB 4Z76B 4EI5A 4KUZH 4M61A 4NN7B 1A02N 3DROA 3R4DA 3X3FL 2DMKA 4ELME 5LGKA 3QWOA 2YMXH 1F02I 2EDHA 3SKMB 1QFUL 3CFEA 3FT3A 4I0PA 3MSPA 2F5AH 3K81A 2YK1L 3MCKA 4G6FD 2NY6C 3AS3A 4WO4D 4N1EA 3QUXA 3EOBB 1A7PL 2FX8L 3BGAA 1U6AL 5DJ2B 5HYJA 2C1PB 1RJYB 2J5LC 1T21A 2VDPH 3JTTB 4XP1L 4GG6A 2AJYL 1K4DA 2NW3A 1FE8H 1K6QH 3WIIH 5I1GL 1JK8B 4UZGA 5J56B 1DBAL 4X5LA 3WFHB 2H2SC 4EI5D 3B2UC 3KLAA 4L8BB 3U9PH 5EZJB 5TF1L 5KSUB 1QACA 2PXYB 3GMLA 4NP4H 4XAWH 4HUVA 4I0PD 2D4DA 5J6HB 3MREA 2NXZD 4R7NA 1F4AA 1RVFH 4TVSa 3VXPA 3BPLB 4JO1L 4MXQD 1QFOA 1QBML 4ELKB 1JTOA 3TIEB 4POZD 3WNMA 5IHUL 4X6DA 5F88A 5F6HJ 5CWSB 2VDLH 5HYJD 1M71B 1F2XK 3B5GA 3NIFE 3NN8B 5IVNA 4P2RA 2LABA 3QXAA 3VFWA 2JJTC 2Y6SC 2V17H 3UTPE 3OB0H 3ILPA 3KPOA 1J05B 3LKSA 1SYVB 2X4OB 5F9WB 3OWEA 5EU7C 4KJPC 3HC4L 2GHWB 2J8HA 1E6OL 5E5MA 3QEUA 4HV8A 5IK3B 1JE6A 4FA8A 3VFNB 4R4NC 4OF5A 1GOHA 3CC5B 4OCYH 2GAZB 3J8F7 3QG6A 5TFSH 3SOBH 1QZ1A 4OLWL 1QQDB 5HTSA 4R4BB 4P48A 1OTTD 1DLHA 5FV2A 1IM9B 1M7IA 4P2RD 4LP5A 3NFSL 1QHPA 1AGBB 3ZYOA 3LH2H 1NMCB 2BHUA 1KEMH 4CUCA 3VDCA 1ZHLA 5F1SA 3Q48A 4WCYL 4LKCA 4HZLB 4TYUA 2MFNA 1Q0XL 5FDYA 3SE8H 2B5IB 4HJJH 3QXVA 1DQQB 4HWZB 5GGUB 2PF6A 4GO6B 3CK0H 12E8H 1LP9B 2DQIL 4JPKL 1OVZA 4AENB 4X4YA 2W9LA 4NJAL 4XB7A 1A4JB 1KPUA 3MACL 1WEJH 1NJ9A 4GT7A 4QLRA 5DRZB 4D8PB 1MVUA 5CJOH 1A6UL 1FFQA 4X80H 4XP9H 4JZJB 2EDEA 1CBVH 1G6RA 5DFTA 3PV6B 5DJ6B 4G42A 4A6YH 5ALCL 1INQA 1ND0A 1C8PA 1QFPA 1QLEH 5EOTA 3H9SA 2PW2A 2IH3B 4OLVH 3BPNB 3D39B 4PP1D 5DF0A 5I8KH 3LKRA 1C5DB 3FN0L 1F97A 4KRPC 2DQEL 4YHLL 4M48L 3TBVB 1B0WA 1MCLA 1NFDA 3ES6B 3KYKL 3TPUB 4OLXL 3C6SA 1FGNH 1IARB 3TBYA 5LQBL 5D2NB 1UADC 1OWWA 4P4KA 1QYGL 3UROR 1F3DJ 4XH2A 3RWGB 3HI6L 1BQHA 1LP9E 2VUYA 3U4BL 3QHFH 5AUMA 4F2MB 1H15B 1KCRL 3UJTH 5GS1A 3S36H 1S7TB 1T4KB 4HHAB 2NCMA 2OSLB 2XA8L 3RL2A 1XMWA 4TNWF 4PYGA 1TIUA 4UIKL 5TE4L 3JVGA 3BFOA 4OLYH 3DX9B 2RGSA 5J06A 3HE6C 3BIKB 3M45A 3H9SD 2VOTA 5DQDH 2NZ9C 1DE4A 4HKJA 2R2EA 1RUAH 4QXTA 4D0BA 5C92A 2A6IA 4H0HB 4RAHA 3B6SB 3D39E 2D0HA 3N1QC 4JFDD 5CSZB 4F7PB 4EI6B 3KPMA 1F3DH 2BC4B 4OI7A 3FHQA 2QR0A 2AEWA 4G80B 4KV5E 3RHWF 5EZLA 2EKJA 4K8RL 1OAZH 1EUTA 4XC1L 1JTPA 1W72A 1FVDB 4K94C 4MMZC 1DUZB 3MXWL 2VNCA 1HSBB 4LLVB 4N0RA 2LAAA 4F8TA 2ARJQ 3U48A 1CIDA 4MNQB 3ZT5A 3D0LB 5J3HC 5D7KD 1YEDB 4N0FA 1NKRA 2MPAL 1GC1L 1UYWH 4U49A 3QG7H 4QTIL 5ESAA 3IB4A 1EJOL 1F3JA 1JPTH 1MCPH 5I73B 3QHTC 5F7DB 3U30C 2MTPA 4PRAA 1HI6B 5AZEL 4PJ5A 3LRSB 1A47A 4JY4A 4MJID 4OT1L 5IB5B 1OP5H 5GRVK 2JB5L 2B4CL 3FAWA 3BUYB 1U95B 4Z8FL 1WT5C 5FGCE 4L8SA 1MRFH 3LN5A 3NIFF 3OKDB 1I9RH 1G7JA 1F4WL 3QB7C 4X7FC 4JKPH 4UB0H 3MV8B 2YOCA 5ANMA 1UA6L 1J87A 4PJ7A 4WTZA 3LD8C 4KY1L 5F89A 4HX1A 4NO0B 2IPUG 2N1KA 2WUCL 3HG1B 4APQC 3TCXA 4WTXA 1AKJA 3RWDA 2GSIB 3QUZC 4X9HA 2EDXA 4CL7A 3QJFA 3DGGB 4XPTH 5JUEH 1VADA 5D7SL 2OXGA 1JRHH 4PJ5D 2VDOH 1FL5B 4U0RB 2IQ9H 3CDGB 1Q38A 4NM8H 2N7AA 2PO6A 3A6CL 3KDMA 3TBWA 1SJEB 4P23A 1Z0NA 4OQ1A 4O2FB 2AV7B 3PGCA 1A21A 3O8XC 3ZYIA 3DX6B 3KPQA 2IEPA 4L1HA 4MWFB 5BO1H 2IG2H 1AHWB 2AEIT 4JO3L 4U7KA 3VXMD 5JNYA 1U8PB 5C6WH 4YGVA 3MV7B 1AKJD 1QFWM 1V8HA 1ZT1B 3OB8A 4YWGL 3HC3L 1T7YA 2Q6WA 3HG1E 3ECBA 3KPLB 3BKYL 4WUKH 2IWGA 4CBPA 5B4MD 3C8KA 4KPHH 3ROOB 3LIZH 1MHEA 2YPVH 1RFDH 4JO4H 3MLZL 3RNQA 5C08B 1J18A 5ITBH 3HNSH 3WHE0 5GZOC 1A6PA 3C5ZA 3TVMB 1S7VB 4HEPG 3MLVL 4N8VA 4U1NB 1BECA 2VR4A 1CLYL 3BKCL 1MCWM 2R0LL 3L7FB 2WZPD 3RJQB 1U3HB 2G60H 4PJAF 2NY3D 1HDMA 1ONQB 3ARFC 5TDPA 1FP5A 3QNZB 2G5BB 5C0NC 1Z9OA 2W9EL 3O4LD 2M26A 2DIBA 5IFJA 1WBZB 5DXWA 2A0LD 4OFDA 3NAAL 4AMKH 2XKSA 1B6DA 1A2YA 4EN3C 3GMQA 2CRYA 4JFQB 1M6OB 4M62L 4PYHA 4PBXA 3BUTA 5TE6H 3MV7E 3PWLA 5HDLA 1OQOA 2E5EA 2O5YL 4ZUSA 1SJXA 3RGVA 1D5IH 7CGTA 1P7HL 1KULA 1P7QA 4PG2A 5MI0C 2CRMA 4HWUA 4Y2DA 5GRJH 5E8NA 2YSSB 1G7QB 2V2TB 3C5ZD 3QHZL 5ID0A 2VWEE 1BLNA 5IMOB 2EH8L 1RPQA 4LFHD 1F90H 4XX1G 1KJ2L 5I8OL 1RHHA 5LGJB 1OW0A 3FOLB 4LGPB 4BFIB 2DQCH 3NA9L 3VXSB 3VG9B 3O3EA 2IGFL 3F62A 3DVFA 4AYFA 4FTVA 4M7ZB 4H20H 1CICB 2J8UB 4ZOBA 4DEPB 3VFTA 1SY6H 1CZ8L 5IJVB 1J12A 1MWAL 2MWCA 3AAZB 4HK3N 5CIPH 4YHZH 5DJXA 2BJMH 4JM2A 3RGVD 2EC8A 3HZVA 3UZVB 4PJ8C 3DI3B 2C7UA 4NNYB 1GGCL 4FQQA 4RGNB 4ODTL 3IDXH 5E6IB 4KV5F 1FZMB 1R3HA 5LCVH 4O02H 2R1XB 2WWMD 1I7UA 2IADA 2IH1B 1HH9B 1BBDL 5C0GB 5C0DA 2VB5A 3CVIL 5F9OL 3D5OF 3ARBD 4W4NA 4Z7NE 5GGSB 3OJ2C 3WUWA 3OKYA 4X6BA 3LMJL 4Y8DC 4DZBA 2GJZA 5KVGH 1B0RB 5DJ0B 5DJZB 2AXGB 3JV5A 4XHJD 3DUHA 5F7NC 3GFUA 5INDB 4C54A 3O9WC 5HGHB 3IKKA 3ESUF 4ZNEE 4GMSH 2YWYA 3ARGA 2HT2D 1XGQB 3ZDYE 1FGVH 5D7JB 1JFQL 2J8UE 3H9HA 3W39A 1FSKC 2VABA 3MODH 5C0AB 5DD3L 1P2CB 4RGNE 3UJJH 2YKLH 4LSDA 5I75B 4E5XB 3L9RA 3QUKB 5HYSG 4HIXL 1KJ2B 1N64L 4IMKA 3S97C 5L9DH 1C1EL 5ESQB 3SGEH 4X9IA 2X09A 2AJUL 3MBXH 2Y07H 5HHNB 2FSEB 4KK8C 3Q5YA 3E6FB 2IPTH 3MXVH 3O45B 1WIOA 2FBJH 3AS1A 4LL9A 4KKLD 4S1QH 5HI4C 3WLWD 3ARGD 5BZWA 2YXMA 4UINH 3BKMH 3GKWH 3H3KA 4GUPA 3KPSB 1MWAB 3P73A 2R0WL 2OJEA 3WNNA 5EUKB 4NKMB 3AMLA 5LG1A 4GSDH 1JV5B 3VXRA 4BUHA 4CADB 1N6QL 3FN9A 4X6FB 3HZYB 1ADQH 1OQXA 4FG6C 3WNPA 2BVQA 5C0AE 1VDGA 5L8JB 4L8CB 5I30H 5DD1H 5D9SA 5E8OA 1VGKA 1HHJB 3EYFB 3P30L 5KJRL 4WV1C 3S4SG 5IJKC 4V2BA 3QI9B 5EU6D 1V7ML 2I26N 1PKQB 1I85A 3GMOA 3MUGB 4RISH 1BVLB 4EDWH 4Q9QH 2XIDA 5AYUL 4YC2B 2FJHA 3Q5TA 3TH4T 1OM3L 4OZFA 4ZAKB 5FCUH 5HPMA 4XPAH 3QIUD 3KPSE 1R0AH 2VZTA 1A3RL 2W60A 2APTA 3BP4B 3H7BB 4U1IA 2AJSL 5D1XB 3MRJA 2YR3A 3LQZA 3UTQA 2COQA 4X4ME 4ZTOL 1IAIM 1CLZL 3QQ3B 4Q0XL 3G6DH 5ISZB 3QP3A 3TPKA 5EBGA 4TUJA 5DUML 4AH2B 2EIZA 2E27L 4ZS7L 4GAJL 2OQJA 1VGEL 3MRHB 1KJ3L 3QUYA 2LVCA 4QHMB 4Y0GA 3IJYB 4YXKL 1DQDL 1J7VR 2OTPA 1LE9A 4JO2L 3T3PE 3GB7B 5C07A 1IBGL 4E9LA 4HIEA 2YA2A 4RRPA 3ZTJG 1NCCH 1I1CA 1UZ8B 4OZIB 1U8QB 2CDFB 3G5ZA 3OAUL 1N3NB 1NANI 4Z7QE 3FB5A 2YA1A 3HI5H 1BWMA 1PFCA 3G5VB 5FDWB 4NHUA 5JORB 1QSFB 1BIIB 1FAIL 4M5YL 5GPRA 2P1YA 3FT4B 1Q94B 1LO5B 4KK5D 5D6DC 2DM3A 3ULVH 4UILL 5ISZE 1IGIL 1LEGA 1BJ1H 4YHMH 3QUYD 2EDQA 1F6FB 1UJ3C 4TN9A 2KQNA 4PRBB 1JWUB 2CLRA 5KAQG 1MIML 3TYFB 1VFMA 2Y06L 2RFXA 1SBSL 3HAEA 4HBCH 1DEEA 4J4PC 4ZFGL 4NBXB 1YZZA 2A83B 3ROLA 5GIRA 4PIRF 2Q1EA 3U4EB 1X4ZA 4L4JA 3N50A 1NDMB 5LWYH 1MCJA 3GRWH 1NGWA 3C08L 4WY7H 4RFEB 1HXYB 3RVWC 1CXFA 4HWBH 1RZIB 4Z7NF 2G5RA 3EFDL 4L4VB 3ZKNC 4FXLA 2VDML 5I9QB 1MCEA 3HUJA 3MRNA 2VYRE 3OG4B 3BESR 4JDZA 4LP4A 2PUQT 2PTTB 1WBYB 4K23H 4L4TB 1CE6A 5KN5A 3GJFK 1B3JA 3GI8L 5DJDB 4OV5B 3G08A 3S8WA 1JL8A 1XGYH 4MAYC 3BISA 1OD9A 5IB1A 2AVGA 2W0LA 2FL5B 1C12A 1FG2A 4XP4H 4QF1A 2P48B 1DVFB 3MV11 1CR9L 2BRRH 3DYOA 2R0ZL 3I75A 2J8UF 3DIFB 1SEBA 4PV8B 1A7OL 4OQTL 3RVXD 4PGBB 1KIPB 1W8OA 3QIWA 1AO7B 1YMHA 1I1AC 1DFBH 4LNRA 4J3XA 1M7DB 1P84K 3L3GA 4WEUD 3VD9A 5E8PB 1DUYA 3RWFA 3BEVA 3QPQC 4U6TA 1CXLA 3FFCA 5E2VL 1YUHB 4HC1L 4PJDB 3V5DA 3TA3A 4GRMA 1RJLB 4C83B 5C0CD 3RAJL 2CLZB 4L4VE 2VLJE 2JIXD 1RU9H 4BUGA 3QDJB 2IJ0C 3QH3A 4L4TE 4PLNC 5E95B 5CEZH 2IAMD 1RZFL 4R7DB 2VN4A 3F5WA 1YNTA 2PYEA 5D7LE 4K71C 3ZYZA 2E7BA 4OM0H 3VGHA 1CFVL 4G8EB 2ENYA 2NX5A 4PREB 4PRHA 2R4RL 1I8LC 1J8HE 2FDBP 3E8UH 1KCSL 1UM4L 1FRGH 4G6KL 1C16A 5CJ8A 2VH5H 4KKAD 4JRYA 5SV3A 2HYMA 1U93A 5CBAA 1MQ8A 4EZMA 1A4KA 1W0WB 5JMRA 4ZO9A 4CJ1A 1RZKC 1IGFL 1P4LA 5F9AC 2O5ZL 1MF2H 3NFNB 5K93A 3VFRB 1Q9WA 3KPPB 2L7JA 4H88L 3VWJA 3FOMA 3DUUB 3VRJA 3QDJE 4JQVC 2PYED 5J1SC 4U31A 3LKPB 2YPKB 1ZLWH 5DC4B 3UC0H 1RURL 4C56B 5D93C 1EGJA 1T1WB 4GG8A 2Z93A 4KMQA 4LSUH 1OHQA 3EJYC 1FBIL 4HJ0D 4I5BA 1I8KB 4JG0H 2E7HA 4JAMB 3WXWH 3ETBF 1JPST 1CWVA 4QOKD 4KC3B 4HT1L 3C60C 2ICWB 4JQIL 1U8MB 2WINB 1X5JA 4D0CA 4KROD 4JRYD 1KXQE 3IF1A 1BJMA 2HKFH 1T0MB 2I9LA 4WW2B 3V79C 4NKOA 5D1ZB 2I9TB 1YNLL 1VENA 4ZUVA 3O3UN 2NY2D 4MHHI 5E8DL 3U46B 3UYOD 4F7EA 1I8IA 4L3CA 5CILL 3OKEB 3IXTB 2WBKA 2VMFA 4O2EB 5I1KH 4RMWA 1KN4H 3C87A 2AV1A 5DHVB 4WNQB 4N0YH 1NLDL 3U6RA 4UU9B 4BH7A 5KVDH 2DN7A 3CH1B 4ZS6C 1YY9C 5A16A 1MY5A 4PJ9C 4LSTH 5ACMA 1URLA 3S3SA 2K3TA 4CVWA 4CVUA 4FZ8L 3SDCC 5KVFH 5DD6A 3WN5B 2KDGA 4Z7QF 4Y5XB 5E4IA 1VERA 5I1HL 3CZFA 1U8LB 4E41B 1D6VH 4BSVA 3OF6A 4Q6IB 4Y16C 1I9JL 5HDBE 5JLZB 4NDMB 2EEDA 2EXWD 3QIBC 1NAMA 2DDQL 3PDDA 3ARED 3CFBA 4ETYA 1AY1L 3U2SB 1NBVL 2WIMA 2BY2A 5GQBA 4P46A 3PGFH 1ZA3B 1FZKA 1KTLA 3ARXA 4PJEB 3TWCH 4YFEA 4NN7C 4JGUA 1X4XA 5DQJB 3FQNA 3LB6C 3REVB 3RKPA 2V6HA 1UJTA 1UWGL 1RZ8A 2ICEA 4K9EH 4I3GA 3L3JA 3OR6B 3DRTB 2VQ1A 5FFLA 4GKOA 2V5RA 4OZIF 2IQAA 4AT6B 4HIJA 5KSAC 4HFUH 5IBUB 4Z7UE 3TFKD 3IU4H 2C3VA 4U1LB 4KI1A 4FFZL 1FNSH 5DZNA 3SDAB 2Q86B 4E41E 5HGAB 1NGPL 1K2DB 5JO5A 4NN6C 3DBXB 4PJHA 2BSRB 5DDHA 2UY7A 2XRAL 1E4WL 3LV3A 2XTJC 2NTFB 4P46D 4K2UL 3SKNB 4R90H 3EYOB 2EO1A 4HGKC 1C5CH 3U0TA 1H3TA 4YNYB 4PJEE 2D7TH 1N7ML 5I18H 2DM2A 2PXYC 3EJZD 1PY4A 1U58B 2GTWB 5FYKE 3VE0B 4M1CD 4O4YL 4I2XA 4F15B 3MRMB 3WS6C 4DN4H 4JREC 1R5VB 1XF1A 4O9HL 4I18A 1AGEB 4MDJA 3S3PA 5IFAH 5MENB 1A6AA 1Q9LA 4JVWA 4L29A 3VG0L 1U8NA 3GSUA 3NACL 3L95A 3RDTD 2I60H 1QRKA 3D25B 3QA3A 3FT2B 1YDPA 1QBLL 2A9NL 4A2LA 2HJLB 4LASH 2A6JB 3LHPL 2BNRA 1HEZB 4P9HL 4GXUM 2YD8A 2J6EA 2WMPA 4XWGL 2VDQH 1XF2A 4EUPG 1JYVA 2EDOA 5I1IH 2FX9H 1N59A 3GSXB 2Y5TB 4NFBA 2GJ6A 3GEWB 5L6YH 4XBEH 3HA0A 4WJ5B 3HZMA 4ZMAT 1KPVB 5FUZH 4L8DB 1JGUL 2UUDK 5EZOL 3ZHLA 1F4YL 3LKOA 3W9DB 5EIVA 3S35L 4F3FA 1XH3B 3D2UA 3OKNA 4YPGB 1MOEA 1U8KB 2RCSL 3F7RA 5FM5M 4PJDF 4KQ4L 5EBWB 2PETA 4IIQC 1CGXA 5FM5O 2AERT 3GKZA 4P5TC 3REWA 2BNRD 1KPRB 1WFUA 3F7VA 4R8WH 3T2NH 4V1DA 3FO0H 1FO0H 3W11C 3S88L 1FDLH 3L3DB 2VXTH 3VFPB 2AEPH 4LSSL 2VL5B 4XNZC 1FORH 5CLWA 2OP4L 4BZ2H 2VDRL 4P5MB 3AS0A 4X99A 2V9QA 1KIQA 3V8CA 3EHBD 1GJIA 4NO2B 4UAOC 1UM6H 1FNGA 2EE9A 3MA9H 1EZVX 1CLOL 1IGMH 3QO0B 2QQNL 3D3VB 2IFGA 4JFZH 2XT1B 4HKZB 5CKAA 4AM0A 4MZ2A 1Z9LA 3UTZB 3I50H 1CN4A 4HQQH 4K7PY 4C59B 1JPGB 1PEWA 1PG7L 2NY4D 3B5TA 5FOBB 2OR8A 4YEEA 1T1YB 2RAMA 5AWNL 4AEIH 4RMTA 2CDGA 3DX8A 3S37X 3QUMH 1BF8A 4GH7B 2X41A 2UWEA 3L3IB 2VLKA 1OAUH 4D3CH 1G7PB 1EXUA 2ZSVA 1MRDL 2YD4A 1MAJA 2ERJB 4TUKH 1JRHI 1EAJA 3SO3C 1MCNA 1PQZB 4Q7DA 1J86A 5CEYB 4P5KA 2K7QA 5D2NC 5BRZB 4JANB 5D1QD 1A7RL 2CGRL 4R4FL 3V7MA 5F7HA 2IMNA 2QSTA 5A2IH 4PTUA 3RGHA 4ONGL 3JWOC 4WGVB 1KFAL 1J1OH 3G9AB 5KANI 5BOZG 5HDBF 4NN5C 1KNOA 1FJ1B 3K4AA 4WW2F 4ZQKA 4ONFL 1G7LA 1P5UA 4KI5F 3OPZH 4P2OA 5F3HA 2GUOA 4UV4L 4TTGA 2XZAL 2P43B 2E8ZA 1NGXB 2VLKD 1TVDA 1FNAA 5JPMA 2JLLA 5DJYA 4LPTA 5DD0L 3R1GL 5FECA 3JBG7 4JG1L 2EE3A 1R24A 2HTKD 4R0LC 2YWZA 3PHQB 1OAKL 2VXSL 1XIWB 5DVMA 1QSVA 4F7MA 4XP6L 5GRYA 5AD0A 3M8OH 2J4WL 4YHKH 1KCLA 3JV6A 3C2AL 4W81A 1S78C 3TM6A 4YE4L 5JIHA 1G0YR 4N5UA 3UTSD 3EOTL 3QXUA 1ZLSL 5JIIA 5BRZE 4U6HA 2X4NB 4WFED 5ETUB 4Y19D 4LARH 3RKDD 5CBEA 5CZKA 4P2OD 5HYQA 4H1LH 4TSAL 1RZJH 1AP2B 5DMJB 5EU3A 4X6CE 5T3ZE 4ERSL 1KTDA 2Z31A 3PL6A 3QAZB 1LMKA 3KYMA 1ZANH 1TNNA 2HFFA 1ZHKA 4YDJA 3UTOA 3V5KB 4BYHA 2YEZA 1KJVA 5J13C 3KHQA 4PJEF 4NRYB 1JCKA 2P4AB 3TO4C 2R8SH 2C3WA 4AQ1B 4LSQH 3HCVB 1U42A 4PRNB 2OLDA 4RAUA 2ZKHL 5GGTH 1NGYB 5ICYB 3VMOA 4QEGA 5C0RL 4TOYH 2GFBB 1A7BA 1LO0L 2IANA 3GJFB 4DGIL 2Y7QB 4GRWF 2XV6B 4DTGL 4JDTH 1INEH 3Q6GL 3PWVB 3VFSB 1MCBA 1DQLL 4KMLB 4MCYA 1CGYA 4J3SA 4ETQB 4XPFH 1XGUB 2Y23A 5IF0B 5DRWA 3R0MA 2X9XA 1INDH 4LCWB 1DBML 4MX7B 2Z31D 5SWZD 5D96C 2BSTB 3IGAA 1MCSA 4UQ2A 4WIQA 5BZDA 3W2DL 4TQEH 4RAVA 5IQ9A 2FJFA 4MSWA 5FXCH 3TN0C 3V6OA 2A6KB 1LO4H 4RZCB 5I15H 3MUJA 4NQDD 1EFQA 5T1KB 3NGBB 1A22B 2D3VA 4U0RC 3LEVL 5CD5C 4KVNH 1A14H 2IAND 1H8NA 2PCPA 2G75B 4PY7A 4ZOEA 3O0RH 4AQOA 4KZEL 4ONHA 2YD2A 4Y4KB 1P4BL 4KFZC 2ZUVA 5L2KD 5BW7C 2F5BH 2D03L 5F3BB 5T1DL 1Q9OB 1N4XH 4X83A 3BW9B 4M6ML 1MJ7H 3VI4E 4NT6B 4MA3B 4QRSA 3RWIB 2DQHH 2UYLA 1OT1A 1BQLH 4MB4A 4UDTB 5LAXA 4LBEA 2ATKB 5HYSA 4ZUWB 1ADQA 4OZHB 3F65A 2Z8VC 4KQ3L 4Q6YA 4LCWE 4XNQB 2K9UA 4CVXA 3S34H 1S7WA 3LDBB 4HH9A 4WI3A 2WAHA 3MROA 3UTTD 3O2VH 3EIFA 1BOYA 4HDIA 5ICZA 3QCVL 1BEYH 2P5WD 4GW4A 2C3XA 1KYOJ 4CDGC 3FRPG 1G7HA 4P9MH 4JGMA 4OLUH 4QWWC 2W9DH 35C8H 2R0KH 4PLJC 3S7GA 2P5ED 1YEHH 3SGEI 1CFTA 2YPLA 3FQUA 2GSGB 1HQ4A 1T1ZA 3DARA 1VFAB 1XGTB 1OSPL 3MRRB 3SQOL 1JGVH 4UT6H 3GMMB 3HE7C 1LK2A 4LRIC 1P6FA 2XG4A 3MR9B 1A9BA 1I9IL 4Z18A 5E6ZA 3RIAF 2BK8A 1HSAB 1HQRB 4NWTH 3UAJD 4OZHE 3OJDA 3S4SA 1IGJB 3MRBB 4ZD3H 2P24A 2WANA 1QP1A 1NSNL 3QFJA 3TESA 4XVTL 1Y6MR 1CCZA 1AXIB 4OTXL 5I8CB 3O3DA 2XACC 4V2CB 1JGDA 2NXZC 4PG9B 5J6GB 5DMGD 4HXAH 1EMTL 4MXQC 2OL3H 3P4MB 4MQ7A 3O2DA 4QRPA 3DETD 3P9MB 4YBLB 2LU3A 1IEHA 2FECI 3CFDB 3MV01 5LGHH 5HD8D 4DCQA 4F7CB 1IKFH 4CN6A 2NZIA 4IS6B 4M4RA 1H3GA 3L5HA 5DEGB 1F13A 4FFYH 2OYPA 4OZGE 2E8YA 5IGXL 2XZCH 5AZ2H 3TCLA 2VDKH 3U1SL 1C5BL 1U8OA 5H94A 4F7TA 2AXFB 3LKQB 4TSBL 3OXSA 3TZVA 4XC3L 2J88L 5H2BA 1F58L 3DUSA 5C0IA 4EXPX 1QA9A 2W1NA 3GNMH 3IJHB 3BX7C 4JFXA 4LQFL 4HUUA 2DLIA 3BDXA 5EB9A 1NMBL 1PD6A 2V7NA 3MYJB 4IOIA 4BZ1H 5KTEH 1G9MC 1ZT7B 4QRPD 5E0QA 1YEEL 5DMKA 2YUXA 2EXYC 1BD2A 3SCMA 5HDQL 1W2KT 4X6EB 1CTOA 1OTTC 2CKBA 5FCSH 4W6XB 4NPYB 4D9QE 4M7KL 1MHPL 1OF2B 3V52H 4Y4FC 4O5LL 3SKJH 3MRKA 4GBXB 1R3JA 1N0XH 1BBJB 2CD0A 2R56L 2LQRA 4P57A 3HC0B 3MRCB 3IRZA 4R2GD 2Y36L 3ULVD 3ARDB 3OKOB 3EGSA 4JEGB 1MFDH 1EFXA 3H2WA 4YX2H 4RDQF 3X11A 3AROA 5DEZA 2Z8WC 3TV3H 1YEKH 2BXZA 3QSKB 5TQ0L 1U8JA 1KBGH 1JVKA 5E24E 2XPGB 1BD2D 1MJJA 3SCMD 5HGBA 2DLFH 3SDXB 2ITDB 2Q76B 3WE6B 5FKAA 3IFOB 4HKXA 1KEGL 2I27N 4Y5YB 4NYLA 3MFFB 4JLRA 2EYSA 4GRLD 3OKLA 3DVNB 3S3JA 1NGZA 2DI7A 4WFHE 2ADGB 3VFMB 2NR6D 1OGAD 1U0QA 3A67H 4TVPH 3RWEA 4LAQL 4ODWB 1EUUA 4LCYA 1OY3B 1YPZB 4JY5L 5ITFB 5EO0B 4OJFH 3BYTA 5IHZB 2XFXA 4JRXB 4ZXBC 4XP5L 1WCQA 5MEQB 3WS3A 3LPGA 3K2UH 1TCRB 3D1MC 3RBSA 3GHBH 4LLWB 2YBRA 3DOSA 3D18B 1U3ZA 1AGFA 3S36X 1AQDA 5I1LB 3MBEC 5J12C 2FB4H 1WZMA 5F7UA 3D6GA 3LZFH 3CCHA 4MYWB 3DMMB 5CD3B 5IBUG 2DLGA 3SDXE 3S96B 3WJLC 4IRSA 3AY4C 5CKGA 3MRFB 4G3YH 3ULSB 1X4YA 1HIML 3CD4A 4BSWB 1A1MB 4CMMB 1ETZA 2R4SH 1OPGH 5C0BB 3D0VB 1QOKA 1PX3A 3MO1A 4G6FB 5K9OB 3O11A 1T0PB 4DGVL 5EU4B 1IGCH 1E4XH 4YHPB 1J0JA 2BMKB 3S5LA 4MA7L 1XAUA 5F7EH 2DYPA 2OTWA 1T3FB 5CEZD 1SM3L 4M1DH 3T8XB 3DECA 4ENED 1FYTD 5DLML 2W0PA 3LY6A 4FP8H 4JRXE 1J5OL 5E08H 2IALA 2YS4A 2X4PA 5GRUH 5C6TH 5J0BA 4U1GC 1A6WH 7FABL 4NUJA 4M61B 5I0DA 4NGHH 3TJEH 1D5ZA 2B0SL 3DROB 1CS6A 2XN9A 1GH7A 1IAIH 4WENB 3OKKA 3CFEB 3FT3B 4I0PB 4N1CA 3MCKB 4LSPL 3P0YL 1TTUA 4KTEL 1RULL 1JYWA 3QUXB 1I8MA 3IAGC 5C0BE 1NC4D 4OZHF 3RTQB 3DJ9A 4QHUA 3ZL4L 1XGRA 4XVSH 2EDBA 1GAFL 4K3GA 5TH2B 4RFNC 1PZUB 5HYJB 2FD6L 5ILTL 3VXNA 3U79A 5KSBA 5IOPA 1T21B 1KENH 4HIIA 5FHBH 4HW6A 4GG6B 2V7HA 1K4DB 3INUL 3LSOA 4F33A 4MQXC 4Q2ZA 3QRGH 5I8EB 4U6VL 5B38A 1S9WA 5IVXF 1SQ2N 2X89A 5C2BH 5F1OB 4ZPVA 3KLAB 2GITA 2OZ4H 3WFEH 1QO3B 4F9LC 4TUOA 1XFPA 4MD0A 3WLBA 2DQJH 3GMLB 3K1KC 1X5KA 3FMGL 4HUVB 2H26A 4M93C 2JJTA 3MREB 1TQBC 4NZUL 1RMFL 4R7NB 5IWLC 4WI8A 3EYUH 3VXPB 5GISH 3BWAB 4LLUA 2GY7B 3NPZB 1DSFL 1CI5A 4AEHH 3QWQB 2X9WA 4X6DB 5F88B 3BHBA 4ZTPL 4NQSA 1YC7A 1YEFH 2VSCA 4LIQH 4P2RB 3GJEA 3QXAB 1G6RL 3ZKXC 1RZKH 3VFWB 1H5BC 5CCKL 5H8DA 1UXSA 5HYJE 3U0WH 4FQIL 4GG6E 3KPOB 2X89D 5GS0L 5TDOA 3LKSB 2EH7H 1L7TH 1LK3L 1N2RB 5GHWH 3KPTA 3WD5H 3RZCC 5E5MB 3QEUB 4HV8B 1N6VA 3NCBB 4MJ2A 2ZUTA 1BZ9A 2NXYC 3QG6B 4HCRH 3WXVL 1Q72L 5L0QC 2XZQL 2BVEA 1DLHB 2E7MA 3BDBA 1GGTA 1N8ZB 1M7IB 4NQEA 3VI3F 5ENWA 1IFHL 2UVFA 4X6DE 2YHGA 1EPFA 3SKOA 4JM4H 1ZHLB 5B4MC 1AQKH 4PY8J 4P2RE 4JHWL 1MH5A 4PJIA 4DGYL 3H42H 5EBMA 1YEGH 1RUQL 4KMTH 1YNKL 4Q9BA 1C7SA 4S1SH 4NQVA 2A77H 3OAYH 1PW3A 1KELL 5IP4A 5HHOA 3N1GC 4G6JH 2NY3C 3GO1H 4G7YL 4X4YB 1S7QA 1KPUB 4N90D 3KYOA 4HPOL 5T5FH 2WWKO 4U3HA 3H8NA 1A3LL 2A0LC 3BQUD 4OCLC 3RPIA 1W72L 3BRGC 2CR6A 1JF5A 4NQED 3BO8A 3X17A 3NCMA 3CFJA 3PP4L 1G6RB 2B1AH 2NY0C 4I0CC 3H6JA 4G42B 2ZUWA 3IDNA 3DSFH 1INQB 4R6UA 3BOVA 1ND0B 5ECJE 4RWHA 4M3KB 5EOTB 3H9SB 2PW2B 1UG9A 3UPRA 4XCCH 3LKRB 4AG4L 3VRIA 2Q3AA 3C6LC 2VXVL 3SDXF 5CP3A 3N0PB 5SWSD 3WV0A 4WRLA 5BV7C 1PSKH 4YDVA 5F70A 5EUOA 4ZO8A 3G04A 1ED3A 4FQJH 4JJ5A 3HE6A 1P7KA 3C6SB 4R26L 1S5HA 3TBYB 3WIHH 4P4KB 1CL7H 1BQHB 2H1PL 2VERN 4XB8A 2YD6A 5AUMB 3MGAA 1QSEA 4M43L 3QDGD 5GS1B 4YUEH 5F96L 4HWNA 4KRPD 3RL2B 1WBXB 4XPBL 2LE9A 1MI5B 1YPZF 5C7XH 3BP5A 4EKXA 1FO0A 3QPXH 3UO1H 2C4FT 4HG4K 4EUPA 2FH6A 5HHQA 5FGSA 3WDJA 1DE4B 4Z78A 3V4VL 1GOFA 4HKJB 2R2EB 2VLRA 4KI5C 2PYFA 4QXTB 4D0BB 3AXLA 3ARBC 2A6IB 1NL0H 3H9SE 1DL7L 2QLVB 1A6VH 2AAVA 1CGSH 3KPMB 3MOAL 3HE6D 2QR0B 1OB1A 3I9GL 1RZ7H 4JB9H 4XHJC 3T1FA 5EZLB 2CJUH 1NFDE 1WTGT 4ZSOA 3EO1A 3JV0A 5C0EA 2NY5L 3LEXA 3K1DA 4QCIA 3SJVD 4L9LC 2ZPKH 3QUMA 2XQYK 1H0DA 2FEDC 4LVOB 5ACZB 5D70L 2CXKA 2VR5A 3NTCL 5I1CL 4YK4C 3V9FA 4Y4HC 4N0FB 5IFHH 1TJHL 4BQBA 1S3KL 5F7KC 4OGXH 5BVPH 5ESAB 3OMZA 2QV2A 5DC9B 5LXGL 1WT5A 4XVJH 1RQ5A 5FOJA 2ESVB 1X5YA 1F3JB 3HRPA 2D7PA 4HFWA 5JW4M 1L0QA 2DJSA 5EORL 4PRAB 2V5TA 5H37G 5HYEA 3RY4A 4ODVH 3P4NA 4JY4B 1FVEA 4APQA 1A7PH 3NPSC 3UP1A 4L8SB 2FX8H 2X4SA 3QUZA 3OB0K 4MJIE 1B4JL 1U6AH 4U1JA 3LN5B 4ZUUB 2VAAA 4UI2A 1G7JB 4JFYA 4ZOAA 1WICA 4XP1H 3IETA 3AS2A 2AJYH 5ANMB 2WQRA 1MFCL 4PJ7B 3QCTL 5CP7A 1LEIA 1TTFA 5CZXC 5F89B 4HX1B 5FYLL 2BVTA 4Z0XA 2VXQH 1DBAH 1JZ2A 1T83C 2JELH 1F11A 3H0TA 3FQRA 3MLWH 1X6NA 1AKJB 4DFIA 3RWDB 1FFRA 2DJUA 4K3HA 3QJFB 3O8XA 4O2CA 3SN6N 1VADB 1MHHA 2J7LA 2OX5A 3BIBX 2M2DA 5DD5L 3BJ91 4X5XA 2IBZX 3L5XL 1JGLH 1MCRA 2IFFH 3WO4B 3Q2CA 2PO6B 1XZ0A 4PJ5E 3QUZD 1QBMH 3KDMB 3TBWB 4MB5A 2WK2A 5IHUH 4P23B 4U4BA 3BPCA 4GAFB 4H1LA 3T08A 4JPVL 1L7IL 3PGCB 1NCWL 2XWTA 3RX5A 4YGAB 3KPQB 5FUCC 3QIUC 4NCC1 2H6PA 3HR5A 5JNYB 2CLVA 2AABL 5ANME 3RWCA 3RU8H 4YGVB 4PJ7E 4KDVA 1CD1A 3QEGH 3WKMH 4U6XA 3VXME 2Q6WB 3ECBB 3HC4H 3OHXA 2QADD 1VFOA 4NFCA 3L3HB 1AFVH 1E6OH 2QBWA 4LDEB 4Y88A 3C8KB 4GOSA 3ARFA 5FYJH 1FIGL 3FN3A 2F54B 3WL9A 4DN3H 4Z5RB 3RNQB 4OLWH 3FKUS 3CX2A 3C5ZB 3RVUD 4EN3A 2Y1VA 1G9NL 4N8VB 3VWKD 4FQ2L 4S1RL 3JWOH 5F21B 2JJUA 3NFSH 2E9IA 1SEQH 5TDPB 2P8LA 1FH5L 1Y6NR 5MP6H 2ZSWA 4JR9L 1CD9B 4WCYH 5GZOD 5IFJB 1U3JA 1X9QA 1Q0XH 1A2YB 3GMQB 3ZSSA 3P9WB 3R8BB 3PWLB 3IAQA 3RGVB 1NEZA 3PXHA 1P7QB 4RGOH 4JPKH 4Y2DB 2BERA 5E8NB 3MACH 1I3RA 5E5RB 5ID0B 3RUGA 2CH8A 1BLNB 2DM4A 3MUZ1 5J4MA 1PJ9A 3X12A 1RHHB 4GFTB 3EKCA 4PJ8A 1KXTB 3N85L 4UNVA 1IM3A 2QHRL 3F58L 1O0VA 4HK0A 5ALCH 1PG7W 1DN0A 2CMRL 4GKZA 4HXBL 4FTVB 1A1NA 4OSUL 2FZ3A 2JJSC 1X7QA 1S7XA 3BZEA 2VO5A 1OP3K 5FYLE 5DJXB 4JM2B 2X70A 4YBQD 3HZVB 1OTUD 1ZTXL 3UDWC 2A6DA 4LHJB 2C7UB 1QEWA 4YHLH 4M48H 4FQQB 4FFWC 2VAJA 3C5SA 3KYKH 4IRJD 1R3HB 3O9WA 1I7UB 1LO3L 1RY7B 2IADB 5LQBH 4M00A 3T0ED 1QYGH 1IL1A 1WZ1L 3HI6H 2EDDA 1HHGA 1KCRH 3T0DA 4G8FA 2BXYA 3WUWB 4X6BB 2ED7A 2FO1A 2I25N 2GJZB 4DZBB 2R29L 1OGTA 4LPWA 4UIKH 5TE4H 4Z6AT 2Z9TA 1AGDA 3UJIL 4D9LL 5IKCA 5I74B 5D7LA 2I5YH 1KB5A 4JVUA 2AK4A 3ARGB 1L9MA 5EOCL 4BFGA 4HWEH 4FTVE 1OP5K 3RL1A 3OZ9L 1J8HA 5KZCD 3GK8L 4G43A 3D9AH 2Z35A 2IC2A 4E0RA 4LOUD 1MAML 3H9HB 2XXCB 2CO6B 3W39B 4M9PA 1FFPA 2AJVL 3SGDH 2VABB 3O9WD 2YUWA 1CG9A 1SMOA 1RIHL 3PP3H 3HFML 1T0NA 1R3LA 1ACZA 2PTVA 2IAMC 1FVCA 4R96A 3L9RB 1PYWA 5FHAL 3VXUA 3NIDF 4XC1H 3CNKA 3CXDL 2HLFC 3GSVB 4ZO6A 3B83A 4LHUB 1YJDL 5E2WL 4CGTA 3FRUB 4WI9A 5TJWK 3MXWH 5L8KB 4EEEA 1FN4A 3H3PL 3TH2T 5I1DA 1MJ8L 5CMAA 4J12A 5GGQL 3UPAA 5BZWB 1KLUA 2MPAH 3AFLA 1GC1H 2X9YA 1ZA6A 4D0DA 4QTIH 4K3JH 4KGJA 3PIQA 4GUPB 1QLFA 1BZQK 3WBDA 1EJOH 4BQ9A 1DN2A 2V2WB 2OJEB 4ZNCD 4WV1A 2VN7A 5IJKA 3VXRB 5HI4D 5K9JL 4XMLL 1J8KA 5FYKU 5AZEH 4OT1H 3CSBA 4M5ZL 4AL8H 3AVEA 2J3SA 3VXUD 2BVQB 3EDKA 1XR9A 4JFEA 5HGDB 2DIAA 1ZK9A 5D9SB 4GW1A 1B2WL 3EO9H 1DANT 3STBA 1F4WH 3GZKA 2H9GA 5FGBC 4CU8A 3IFNL 4HJ0C 2DM7A 3ULUL 4XCNA 4NBYB 1LDSA 2HT4C 4PJ7F 2WUCH 4KROC 1H3XA 2FJHB 2Z0BA 4OAWA 1CQYA 1UXWA 1BVZA 4OZFB 5HPMB 4PB9L 4YBHA 2AW2A 1TXKA 3L3OA 2R1YA 5D7SH 5K59E 2W60B 4U1IB 3DRQA 1AIFA 5D8JH 2ADJA 3G5YB 3MRJB 2PW1A 4HMEA 5FUCE 1WVZA 1T6WA 3LQZB 3UTQB 2WIIA 4JFED 3VXRE 5BQ7A 4KUZL 4NJ9L 2GYSA 2DJ4A 1NPUA 4TUJB 2EIZB 2VXUL 2OQJB 2XOTA 2J1KA 3QUYB 5SWQA 2DWDA 5DWUL 5IEHA 4UNTA 4X9FA 1L6ZA 2C4FU 4BFBD 5GS3A 4EXKA 1LE9B 5B22A 4YWGH 5C07B 3WHE1 3HC3H 3BZ4A 4UBDD 3BKYH 5D6DA 1FE8L 4JKWA 1K6QL 3WIIL 3HB3D 3G5ZB 1UJ3A 3HMWL 1S8DA 4Z7UA 3AREC 3MLUL 3MLZH 1DP0A 2H8PA 1D3CA 4NHUB 3EYSH 3PQYA 3MLVH 4J4PA 1BF2A 1G9MH 3BKCH 1NCDH 2VKXA 4O51A 2DMBA 5ALBL 4NNXA 5GRZA 1LEGB 4FQLH 4TVPD 2W9EH 4NM4L 2CLRB 3LN4A 1IILE 3NAAH 3U36A 5E70A 4BH8A 2RFXB 3HAEB 3MYZA 4M62H 3EO0A 3TFKC 1KIRA 1DEEB 3R8QA 3ROLB 2O5Y<