3HE6D

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta8.2 nkt tcr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
236
Chain Sequence
b'AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDAQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 60
structure length 236
sequence length 242
ec nomenclature
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he6D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he6D02
5E8OB 5SWSE 3UTZB 1G1CA 3ZSSA 2NY1D 4PP2A 4LCWD 1FG2B 1BEYL 1UT9A 2YZ8A 4XRCA 1X6LA 5I74C 2VDQH 1G7IA 1QA9B 5J8OA 2WW8A 4U6TA 5I16A 3I6LD 2ZCKL 3C8KA 3B8YA 4PJ7E 1JI1A 3WFCH 4LVHB 3NCJL 1M7IB 2UVFA 3BZFA 4LHUD 4IRSC 4MNQA 2BDNH 3MUHL 1OWRM 3JWDH 1OAYL 1IEBA 5DD5L 5C7XL 4PJXE 3UTTA 1JGUL 1MCKA 3AS1A 1OSZA 4JO2H 1SMAA 1KIUA 5BVPH 1DEEA 1FSKC 2IAMB 4QHNB 2XWJA 4I18B 4F7CA 4QRSB 3BT2H 1SM3L 2A9MH 4V2CB 3GMMA 1TENA 3K1DA 2YSSA 2VXTH 4JHWL 2MHAA 4L4TB 5CP3H 1MRDH 4M4RA 5FKAA 3UTPE 1UJTA 2F54E 2FJHA 1MFAL 3EKCA 3RWJB 5F9WC 3F7YA 1RJCA 2F8VA 1MPAL 4DVBB 4IRJD 5D5MF 2FATL 1JIBA 1VPOH 2FGZA 2R2HB 1H0DB 4RIRB 5I17A 3IB4A 2YR3A 2ZCHL 1JZ2A 3ZKNC 2BNQB 1XF5A 3BXNA 3IXAB 3WFEH 4ZNEA 3MRJB 2EE3A 4G9FE 2NNAB 1L0YA 5FUZH 1FVCB 2KKQA 5L2KA 1J1XH 3VGFA 4Z7UB 3WIIL 3T0EE 3SE9L 3FFCB 4L9DA 1T7XA 5I74B 1RHHA 3INUL 2XA8L 3EYUH 1E6OH 2ZZUT 4V1DD 12E8L 1GGUA 4TUKL 3D2UD 1QEWA 3CFKA 2Y36H 4IRSB 1BBDL 1EO8H 2XT1B 4PRNB 1SY6L 1YJDH 1ZOXA 4U2ZA 4YDKL 3U79A 1DUYB 2OL3L 1LK3H 1AGFA 1CXFA 1JPTL 2P8MA 4FFVD 1QVOB 1XCQB 1XGYH 3MBXL 4J3TA 4Z8FL 2H41A 1T04A 2OZ4H 3HS0A 4YHKH 4KKBD 4DFHA 1XMWA 5CJXA 3TN0C 4BZ1L 1FSKB 2OTWA 1U93A 1UCTA 5ERWB 4UQ2B 3REWA 3CK0H 5GRYA 3SCMD 2AGJH 3D69B 1G7LB 1J5OH 4TVSa 1QBMH 4FQ2H 4UINH 3SKUD 5JOFB 4P4KD 4L8DA 4X98A 3C2SA 4UB0H 4QRPB 4U2YA 5JXAH 2P24A 5F9WB 1OAZH 3O2DH 4AEIL 3MJ9A 3DRTA 5GGTH 5C07D 5KVGH 1ZK9A 3CPLA 3V52H 2AABH 1LHZA 4IMKC 5IV2B 1JNHB 1RIUH 4MQTB 4M7LL 2VZOA 2NYYD 3U6RB 1T03H 4D9QE 5IROC 3SGEI 5DT1H 4L1DA 4RX4A 2BOBB 4F8TA 5FAAA 1UZ8A 4AIZA 3BDBA 2GT9A 2IPTL 5JMRA 3G08A 2A6KA 4I3SH 1SYVA 1NAKH 3Q1SH 5TQ0H 1BP3B 3MBEB 4D8PA 1A3LH 4FQIL 3P11H 4JFXB 3PHOA 5DJ2A 4DGYH 1OTSD 1U58B 4OZFA 5I1HL 2UZIH 2OR9L 4HFUL 1T1YB 4NT6B 4JN1H 3RI5F 4XWOC 1I8KB 1IGYB 5CSBA 5ABDE 2X89A 4ELMF 4U1KB 1MQKL 3ARVA 1NCNA 3L3GB 1F6FB 3MQIA 1RUMH 3UTTE 2W65B 4GRLC 2Z4QA 4RWYL 1EJOH 3TN0B 4MQXC 4Y19E 2DQIL 4UTBL 5JORA 4OKVA 4LKXA 1INDL 1YQ2A 3L5JA 2VNCA 3L9RB 5EU5B 1FRGL 3MO1A 1E27B 4OFDA 4PGBA 3MNVA 4NBZB 2CSPA 3MRDA 1U8HA 5CKGA 3WUWB 4JQVA 5D7LA 2EDHA 5FFLA 4M48H 5C0JB 1CDHA 4NQEA 3MODH 4B41A 3U0PA 3SJVB 4ODHH 2Y5EA 1CR9H 1HSBB 2FWOA 5I1LA 3QIUB 2JB6A 2QQLH 4NHUA 3PL6B 5DK0B 5IMOB 1HSAA 4OCSL 4Y16A 1HWGB 5E4IA 4TN9A 3TJHC 3TNMA 4L29B 2DF3A 5J1AA 1I7TB 3BKML 1UB5A 5F93C 1ONQB 3HG1A 3RY6C 5GJTL 3VMOA 4F2MB 6FABL 2P43B 3S7GA 3HZMA 4U1LB 5E56A 4HQQH 4Q9RH 3OXSB 1X3DA 1K2DB 4ZNEE 3MOBH 2IAMD 4G7YL 1MEXH 1WFOA 1DL7H 5I8CA 3S36H 1KNOB 4N0RA 4JGUA 3MLWL 1WBXA 2OTUB 4GW5B 4OCWL 5AAWA 3QDGA 4XAWH 4KTEL 1R5VA 3SPVB 4L4TD 3EZ8A 1YMMA 2NX5D 2FSEB 3PDDA 1Z9LA 2HFFB 4NYLB 3OSKA 1PG7W 4AG4L 2EZ0D 2GKIA 3QIWC 5D1XA 3L6FB 5FHBL 3S88H 4Q0XL 4WWID 2Z8WC 3BWAA 4XPBH 5GGSY 1X7QB 4OZHB 4GRLB 1QFWH 3MJ6A 4XHQA 1DQLL 1YPZB 4PLJD 3U0TA 4MSWA 3VFMB 2AP2A 3P0VH 5F7NC 3IJHB 1KCVL 3JTTB 2BNQD 4XBPB 3HRZB 3LN9A 1AD9A 4OFVA 1PZ5A 1FGVH 4ZUSB 1ZANH 3QT2A 35C8H 5EZIL 5IVZB 4J6RL 5IKCA 5E1HB 2X40A 1BF8A 3L5IA 4EI6A 2GTWA 2G2RA 1EHLH 1NGWA 5JLZA 3F6LA 5J57B 4QXWA 3QQ3B 1P6FA 5K9OA 1R3HA 2FLBT 3KYMA 2NPLX 5EU6E 2CDGB 1QYGL 1F42A 3CVIL 3I50L 4QTIH 4OZIF 4PRBB 2YA1A 4GG6B 1IC5L 3DX8B 4QXUL 2VN7A 1A1OA 3SDDC 1AHWC 1HILA 4ERSH 1YN7A 1IGTB 1NMBL 4LPXA 5LBSL 3PIQB 1Q9LB 3TV3H 1D5IL 3NA4A 4N8VA 1LEKB 1NC4A 3RAJH 5IW1B 3MOAH 4MCYA 3L1OL 3QIWB 5KOVC 4OF0A 5KZCD 3FQRA 2AK4A 5DK2A 4CN6A 3C5ZC 2VXQH 4NO5B 3ULVD 3DX6B 4XXCC 1QBAA 2D7TH 2RB8A 3NIDF 5I30H 3L3HB 1A6UL 5FHAL 2Y9RT 5FM5O 4ZG1A 3O9WB 1F3DH 4UIMA 3UJTH 2DM3A 1R3IL 3K7UA 2EE2A 3VXNA 5DUML 5DHVA 3V6OE 5D7LE 1VKXB 1QSVA 4HS6B 4LBEA 1MJ8L 4NQEE 3MBED 32C2A 3ZLQC 1KCUH 2C3VB 3SBWC 5HPMA 1AFVH 2EDWA 1HINL 4HDIA 2XTJC 2Q8AH 1HNGA 4U4BA 1MHPH 1UM6L 3VDAA 4C57C 5FM5M 2F8OA 5LCVH 4U05A 3WNNA 2Q76B 4RZCB 2P8PB 3B43A 5DDHB 2HT3C 3HG1E 5E2TL 3Q5YA 1N6UA 4F37F 3SDCA 3J8F7 1OAKH 5MEOA 1JWMA 1VCAA 1Y18B 3SDDB 1AHWB 5BZDB 4H88H 1B90A 3DPBA 2JELH 4O9HH 4D0DB 4EUPH 3OV6A 3DVNB 4X6BA 3N1MC 3VFUB 3LMJH 2O5XH 1JNNH 4C55A 5CINH 3GHEH 3T09A 1DBAH 1NGXB 5J1TC 2LTQB 3QDGE 3QXDA 2FX8L 1IKNA 3GJFB 1S7VB 2N56A 5EG6C 1QFWM 5L8KB 5B3JE 3F62A 4NUJA 3QIUD 3ARUA 3PGDB 4Q2ZB 1KCSH 2MTPA 3S3JA 3RNKA 3PL6D 4Z0BL 2DQTH 1SY6A 4WIQA 3CXDL 4XCCH 1Z9MA 4LSQH 4JFEE 4GAYB 1FFNA 3O6LH 3VXRD 5GZNC 4ODXA 4LNRA 4PRIB 1UM5H 3BAEL 3AU1B 1PFCA 2YPLA 3EFDH 2EC8A 3PP4H 2AQ3A 2FX9H 3DVGA 2C1PB 4UUJA 3WFDL 3H9SB 3TBWA 3VXQA 5JHDD 3JWOC 3EOTH 4XMKH 2VIRB 2YD1A 2K7PA 2XTJB 4EJ1C 1UH2A 3GSUB 3Q5TA 3MLVL 3VXSA 1P7KB 4LQFH 4GRLD 3DX9A 3VW3H 1A0QH 3GSRB 4MQXD 1VGEL 5CIPB 3QHZL 4NO2B 4LHUG 1Y6NR 1FAIH 3ZHLA 1NGQH 5F6IC 1JGLL 1E0OB 3DTXA 3IDIA 3N50A 1YMHB 2AXHA 1E4XL 2Z93B 1CI5A 1J0YA 1PEZA 4PJHE 3X14A 5A16A 4OLZH 3OB0K 4M3KB 5MERA 4KC3B 1J11A 3RGVC 5ITFB 1A2YB 3QO0A 2B2XL 3LAFA 1FNGB 3GJFH 2AK4E 3TM6A 3QNXA 2CKNA 5IW3A 3UP1A 5IW6B 1L7IL 4Y5XC 5FECA 3TJHD 1OM3H 3QUMA 1MREL 4PJFA 1P9MC 5JW5B 4P49A 1MY7A 5GGRB 1UWGH 1KTDB 4DWHA 4ZTOL 1GIGL 1GPOL 3H42H 2J8UA 3QDHA 5ADOH 4YE4H 4G3YL 4NJ9L 2G60H 1WBYA 3MRKA 1YEDA 3NCBB 4MXWL 2KZ1B 4PJCE 2R1WB 2HN7B 5FYJD 3PGFL 2XA3A 5GS0C 1V05A 3ZE2F 3N1QC 4JKKA 3C60C 3QHFL 4HIHA 3V7AE 5TGBB 5DURD 4TNWF 5E95B 1BM3L 4I4WA 1CE1L 1C12A 1UCBH 3QUYC 1A6WL 1KIQA 4PJ5A 4ZNCD 5JW4Q 1I85C 2ADGA 1HHKB 5DA4A 1H3WM 1C5BH 3OKYA 4A6YL 2B8OT 1NFDA 3O9WD 4FQCL 1HZHL 3PXHA 1P84K 3A6BH 1NCWL 3LN5A 4XP5H 4ZPTA 5CIPH 1X5LA 3V79C 2CIKB 5DTFA 2J6EH 4BKLB 3RGVB 2W9EH 4Y8AA 1HHJA 3O8XC 4JZNB 2DB8A 2IFFL 5IEKB 5ALBH 3QH3B 3SGJC 4Y5XB 3MTRA 1M6OB 4M5YH 5F3BA 1EGJH 4ORGA 5JTWA 1KEML 4OLUH 3SQBA 4ZO8A 3C09C 3MXVH 1DE4A 2FL5A 4YZFE 2F5BL 5CWSA 2IGFH 4XX1E 2NY7L 4YHIB 4OFKA 5EO9A 1CBVL 1ZWIA 5M7QA 1A14H 1XF4A 1F6AB 1TVHA 2FJGA 1O0VA 2WBJC 4OLYH 5I1GL 3HTLX 3OZ9H 2VXSH 2ZUQC 1HIMH 3MACH 3UMTA 2VDPL 1F2XK 4P2RE 1H8SA 2ZUXA 4LRNH 4AENB 1T0NB 3RP1A 4S1DC 3A67L 1XIWC 3AM8C 43C9A 1N7MH 1FQ9C 4XH2B 5GRJH 5IM7A 2R29H 2OM5A 4MJ6A 5AEAA 3C60B 3JWOH 5AZEH 3MRGA 3ETBF 4LSTL 4MJ5A 1ZHBA 1DLHA 3VXSE 3HB3D 1NDGA 1MHCB 2I07A 1LD9A 4PGDA 5JNYB 4M1CD 2QQQA 1BVKB 2R9HC 4G7VL 3KPQA 3VGBA 3H2WA 3ZE0F 1XGRA 1TJHH 1NAMB 1YNTB 1NBYA 4K9EL 2IF7A 1K8DA 1T1WB 2ADFH 2P46B 4M1GH 4WFEE 2BY0A 5D71H 1VFAB 5TH2B 1XGPB 5DZNA 3C8HA 3ARBC 4L8SA 3RWCB 4F8QA 1F97A 4JHZA 4K7PH 5EH1A 1AGBA 3QDMA 4NFBA 3RWHA 3SDAA 3O8XB 4MA3B 4GJTB 4MXVE 5FGSA 2QSVA 3U2SB 4Y5YA 2NLJB 2G75A 2XTJD 5EBMB 3QXAA 1AD0A 4NUGH 4ZYKB 1I9EA 3ROLA 1VFOA 1BFVL 1MNUH 1QRNA 4GSDH 1DFBH 3HUJF 4Q97A 4PBXA 4WO4D 4ZXBC 4GRMA 4LGSB 1P7QD 5J13C 2WBJB 4C56B 2ZUQB 4KVNH 5HHPB 4PJIF 5T1KD 4WI6A 4XNMA 2FIKA 1R3JB 5F89B 2YBRB 4HAGA 1AC6A 3RIFF 4RGNE 5CBAA 1XIWB 2P1YA 4DZ8B 4LHQB 5F7KC 1LMKA 1NUFA 4EIZC 1YA5A 2BP3A 3HMXL 3P9LA 3DO3A 3GMPA 2E7LC 4JY4B 5GS0H 1QQDB 3BE1L 1PKQB 2X1XR 3BRDA 3QUZA 3H7BA 3GM0A 1UWEH 5EU3B 3BX7C 3EYOA 4IRZH 1B3JA 4TUOA 3TBVB 4GKSB 2DBLL 2E6PA 1MIEL 4HFWA 2D7MA 2XWBA 4LLYB 4WW2A 2DOCA 4EZMA 1TMCB 3HPJA 4WEMB 1D5XB 4DAGL 1WC7B 4HK3N 1XR9A 4JM2C 4O2EB 3ARBB 1REIA 1NAMH 5TFSH 1I1YA 4XC3L 3IDNB 1A7RH 5EIQA 1YYLL 5IT2L 5BW7A 2P7TB 2BSED 1ZSDB 2FHCA 4JDTL 5F7EL 2ICEB 2G9HB 1FNLA 3D18A 4HGWB 3WS6C 5IBTH 3JTSA 4HC1H 4OLVH 3EJZC 5DRNA 3BO8A 1C16A 4KJPC 5ACZB 4JLRA 1AKJA 3IDUA 3HZYA 2GJJA 5I1IH 2ZCLL 1G7HA 5D96C 1RAMA 1AR2A 2AJVH 1LP9F 5HSFA 2JJTC 3HPLA 2ED7A 2VDQL 2HKFH 5D7IF 4OV6F 1N8ZA 4ZXBB 5L9DH 3D87B 3DO7A 4HAFA 1S7TB 5C9JB 3RZCA 1AR1C 5J13B 2ARJA 1MUJA 3X3GL 4N8CH 4M6AA 4ZOBA 5BJTA 2BDNL 3KNBA 4UV7H 1U36A 2HVJA 1S7QB 4DW2H 2X9YA 5KSBB 3FMGH 1Y6KR 4UT7H 4XNQB 4JRYA 4JO2L 5BVPL 4NKDA 3L7EB 3V0AC 3PDOB 1ZGLM 3QHTC 1NL0H 4EN3A 5LAXB 1BFOA 3BT2L 3TA3C 3G6DL 5IQ9B 2A9ML 1N0XH 3MXWH 1KG0B 2VXTL 5E7BA 1MCNA 1A7NL 1ERNA 3V6ZA 1XF1A 1F02I 2GW5A 1M7DA 4LGPB 4OM0L 2MCPH 4JFPB 1MRDL 3QRFM 2ZNWA 1Q94A 1V7NH 2MPAH 4JFDE 4LEXH 8FABB 4UT6L 4NKMA 1ODAA 4YPGA 1CXIA 4X9GA 5J7CC 3OBAA 2OSLB 4MDJA 4RAVA 4LLMB 1G84A 1W72B 1EEZA 4JFZH 3S98A 5CFHA 1IGCL 2XN9D 2Z91B 1BZ9A 5D7JD 3GMQA 3ZDZF 4P3DA 4UMGA 4YX2H 4PLKD 1JWUB 3IKCA 1G7QA 1WTLA 3O3AA 1AIFA 1CCZA 3K2UH 1ZXQA 3WFEL 2LU3A 1GHFH 4MD5A 5FUZL 1LDPH 2X1PA 3VXME 5LQBH 1U8QA 1MCOH 3QG6A 5HGGS 2XXCB 1S7RA 4U6YB 4NOFA 1UB6A 4HIEA 4XP1H 4Z7VB 3TBTB 3HNTH 4Z7OE 3QB7C 3EYUL 5BVJA 1E6OL 3AREA 1QRNE 1U8JB 3G6JE 2UY6A 4LCUB 2EIBA 2IQ9H 4Z78A 4Y4KA 2WINB 1XGYL 5F96H 1VB9A 3LS5L 4QWWD 4OGAC 1VGKA 1H3PL 1YEHL 3W2DL 3CDGB 4PYGA 1N4XH 4RFEA 1J05B 2MFNA 5JW4N 4X5XA 4JM2F 2HTKC 1EFXD 1HOCB 1IEAB 2UY7A 3PQYA 2R0KH 1XH3B 2EDTA 3WNKA 2AGJL 3KYKL 4KDTA 3VRLF 4MDIB 4EOWL 1J5OL 5IFJA 3WUWG 4UINL 1KIPB 5DMYA 1FPTL 1MVUA 4QHUA 4U1SB 5GJSL 4PJAB 2PXYB 4JFFD 4JFOB 1W8NA 4O02L 5CJQL 3C6LC 1H8NA 3SE3A 3T4YA 5JXAL 4RQQB 5CHNA 1MRFH 1OAZL 5DJXB 1Q9OB 5GGTL 5KVGL 1I1CA 1U91A 3RUGE 3QNZA 5B3NA 1IGIH 2AABL 3MV7A 5K9QG 4G8EB 2DWEA 5DD6A 4YAQA 2ADIB 1ZT1A 1T03L 5T5NF 5DSCB 1W72H 5E0QA 5J12C 3GDBA 4M5ZH 5DT1L 1RZ7H 1CFSA 4MMXC 4G6MH 4P3CH 1NUGA 4FABL 5HYJD 4IS6A 4PBVC 3GKWL 3PWUA 3BH9B 3PWJA 2R1YB 4HUNB 4I3SL 3K80A 3Q1SL 4J23A 1E4KA 1WWWX 2CGRH 5TQ0L 5ECJE 2A1WH 2B1HL 5LGJA 3FQWA 4M00A 1F3DJ 4E41E 4LLWB 3P11L 5IB3B 3AAZB 4IOIA 4YXKH 1TCRB 4XBEL 3PWNB 2UZYB 4JN1L 4HIIA 1A1NB 3UX9B 3ARQA 5E8PB 2HRLA 2V5MA 3AUVA 3P9WB 2P5EB 4NZRL 2EE6A 1RIVL 3FB8B 5DYOB 1EJOL 1PKOA 4JRYE 1K6QH 4PY8I 2H6PA 5IR1A 2R8SH 3B2UD 5CGYC 2PR4H 4KFZC 5AWNH 1X6NA 5ISZE 2JCCA 1ZKAA 1KGCE 2B7DT 4AQOA 3MLXH 3MV8E 5K9JH 3CVHB 3I75B 5EUOF 3M1BA 3C6LB 4WEBH 2COQA 3S3SA 1MAML 1MSPA 2VQTA 4ODHL 2BVTA 4D94A 1GSMA 1GYAA 3U0WL 3CFEA 3VXPB 4LCWA 2XKNA 4QYOA 5KAQF 5FYLD 5I1DA 2QQLL 1IM3B 1IGMH 4D0BA 4X80L 1RK1A 5FO9A 2QADC 3ULVL 1BAFL 1R3KB 1OQXA 5J12B 4LHUA 2ZSVB 1MCPH 5FKPA 3MX0A 2R39A 1AXIB 2VLLB 4HQQL 4Q9RL 3MOBL 1FL3B 1MF2L 3PWPE 1TETH 1MEXL 1CQYA 4MHHG 2BOCB 1Q72H 1XGTA 3KPLA 4G8FB 4JFQA 4EDXB 1XCTA 1VACA 5FDWB 3BEWA 3QO1A 1F90H 2HMIC 3JV6A 3WIFB 5DFTA 4FNLL 5KW9H 1I1AC 2BVPB 2CK2A 3B9KC 3GMOA 3IT8D 4OM1H 2XOTA 3SHSA 1KB5B 4K7FB 2PYFB 1EJ6A 4ZOAA 3S88L 5EU4A 1WAAF 4XPBL 1QSEB 2ILLA 1J0ZA 1QFWL 2ICWJ 1U95A 3JWNC 1C7TA 3ZDYE 5J06A 3V6BR 1JPST 1P1ZB 4IRJA 4G8IB 3O3DA 2GQHA 4PJEB 4XP9H 3P0VL 2XACC 1RULL 1A6TA 3C5JB 3VRIA 3PQYE 2NY6B 3EJZD 1FGVL 3VDCA 4RDQG 1ZANL 5DRZB 3HMXA 3C08L 4PFEA 3KPSE 4P57A 3DSFL 5F1IA 2DQDH 3DV4B 1EHLL 4NM8H 3KLSA 1WIPA 3G04A 3CVHH 1ZLUK 3VFVA 4P2OC 4MNHB 1AR1D 1A3QA 2OK0H 1QR1A 4X4YB 4V1DA 3DWTA 3D2UA 3MV7E 2BNUA 4J1UB 5CZVL 4YXLL 5I75C 2EO9A 2HRPH 1UJ3C 1LEIA 2Q7YA 2EDJA 1AQDA 5DVNA 4GFTB 1N5YH 1JHLL 1B4JL 2E6QA 3VD3A 4CW1A 4U1MA 4JRXD 3X12A 4JZJA 3TV3L 3GIZL 5FGBA 5K59E 1KIRB 1FFOA 1DN2A 4JR9H 4KKCC 1Q0YL 3SCMA 2PXYD 2BK8A 1L9MA 5GRWA 5J89A 4P4KA 1GGCL 2F53B 3I6GB 5D9SA 2VXQL 4W81A 3DHMA 5GIRB 5DJ8B 5FB8A 4MAYA 1JV5B 3MLYL 3EOYG 3BP5A 5I30L 4NRYA 1XZ0B 1RUQH 2I26N 5C07A 4KI5D 2D9CA 3IDXH 5AUMB 4BSJA 4F33B 1CFNA 3KDMA 4XCNB 3GSQA 1B0GA 3MLTA 3O6FC 3NGBC 1MJJA 1JZ4A 1CT8B 1FYTB 3ARZA 2ATKB 4LOUC 5EB9A 2JCCE 5DVOA 3MRLA 1T7WA 4LK4A 1QUNA 4FFWD 4WU7B 1WQVT 2I60H 3TIEA 1KCUL 4P2OB 2C26A 1MI5B 1P7HL 3LV3A 5E2UH 4HPYH 2Q8AL 5DFWH 1BD2B 2AQ1A 5C08D 4F7EA 2YWZA 4JPWH 3TZVC 4NCDA 5LCVL 4O2FB 2P5ED 3BWUC 4YHPB 1ED3B 3E3QE 4QXTB 5I75B 3WV0A 1UJ3B 1OAKL 4H88L 1NMAH 2JELL 2HTKD 3EIFA 5EBLB 2N4IA 4OCYL 3TIDB 3VI3F 1PGRB 1T1XA 4P46C 4BELD 1ETZA 1TVBA 1JNNL 2UWEB 4Z7NE 3VRJB 1U0QA 3GHEL 4KK8C 1DBAL 1A7QH 3QISA 1FFPB 3PDGA 4I3GA 5E8OA 1RZJH 3VFSB 3QPXH 4U1HB 5J1SC 1INQB 4OZGF 5FYJL 3T1FB 1UEMA 1FGNL 1FG2A 1MWAB 4G5ZL 2HKHL 2XQYK 2OMBA 2J8OA 5D1ZC 3WLWC 3ZHDA 4D3CL 4FXGB 3WL9A 5JDSA 1QA9A 2DQTL 2Z35A 1PQZB 4LSQL 2EYTA 4HXBH 4M4PA 4LARH 1X5AA 3LH2L 4OGZA 1UM5L 3LQMA 1CDYA 5F7YC 2V7HA 1I9IL 4GAJL 5EA0L 1SEBA 3ZL4H 4NP4L 3O6FB 1A7OH 3NGBB 3C2AL 4MX7B 1QHPA 1VHPA 3QDJD 4PB0L 4WHTB 1HNFA 2VOTA 4BUGA 3MLRL 3X11B 4QXGL 1ZA3A 1D5ZA 2AW2A 2IAMA 4O58L 4LPCA 4QHNA 4PJGF 4I18A 3C6SB 4QRSA 4NQDB 5IB4A 1KJ3L 1P4IH 3LSOA 3FN0L 2BVOA 4HLZG 1BX2B 3Q3GA 2CIIB 2B5IC 1G0YR 4L4TA 2BCKA 5GGTA 3O4OC 3BZDA 5IBLC 4F9LC 4V1DE 3NMEA 5DJZB 5IEHB 3ULUC 4YIQB 3OJMB 4M61B 1QSED 4LQFL 3RWJA 1T5XB 2J2ZA 5D6CB 1T5WA 3O4LB 1OW0C 3QFJE 3UTSE 5JUEL 1PDKA 1FAIL 1NGQL 2QR0B 1H0DA 1EUTA 3W0WB 5B8CC 3X3FL 2W1NA 1JZ6A 4UNUA 4P46B 1P2CA 2BHUA 2W9LA 3T4AA 2NY6D 4AT6B 5L88L 3PJSB 2BNQA 3IXAA 1DSFH 1L0QA 2NNAA 3UYRH 1FVCA 4JY5H 5T5FL 5DQDL 4Z7UA 1IKFH 1J1PL 4TQEH 1R5IB 1DQDH 1U8OB 1CFVH 5D1ZB 4EBQL 5GS1C 4R3SA 2PCPA 3FCTB 1FDLH 4Z0XB 4I2XE 1YYMH 3VGDA 2V2XB 2VWEC 5C07E 2J4WH 1A1MB 4IEFB 4PRNA 5HI5C 1TPXC 5L6YL 2I5YH 4F57L 3GBML 3NFNB 3NACH 4GW1A 5EZLB 5B38B 1QVOA 4JM4L 3H42L 4UV4H 4F80A 4YE4L 2HJLB 3I84A 5F7DB 1IC7H 4FP8H 4H0GA 4NNXB 4ZFGH 1WUNT 1T4KA 5ERWA 4KXZH 4U6XA 2EIEA 2FJFB 1Z5LA 3DVIA 4V2BA 2MWCA 4AIOA 4P23D 3D69A 1DDHA 1G7LA 4AYFA 4LIQH 3TT3H 3O4OB 4KGLA 1D5MB 5JOFA 4LDLB 2YS4A 1MCFA 4RBPH 1HI6A 5J3HC 4C4KO 3MUGB 3BZ4B 4EI5C 1UCBL 3GMLA 2C3HA 4RAUB 4YUEL 3F7VA 1C5BL 4KRLB 3H6JA 5IV2A 3S6CA 5HI4C 1OLLA 5B8CB 4CJ1A 3A6BL 4XP5L 4E9LA 2VE6A 4D0CA 3U6RA 3QIBC 2AK1L 3OAZK 5FGRA 2DDQH 4JDVB 5MEQB 2J6EL 5E99H 1IVLA 1QSFB 4HWBH 2AKRB 4ZD3H 1WFUA 3VXTB 5DC0A 3NVQA 4LSRH 3RJDA 3IDMA 2VZVA 4P2OD 5EUKB 3T2PA 5GS1B 4PD4J 1CICC 3MBEA 4AH2A 1GGIH 2DL9A 4RMRA 1RUAH 5F1OB 1BPVA 2FGWH 4JFXA 1BD2D 1FE8H 1U58A 3LKPB 4NT6A 1IT9L 4NQXB 3FQUB 2YXFA 1I8KA 4JJ5B 5HPOA 3MXVL 2ZUYA 3ILPA 1TPXB 4ODVL 1I1FB 2QTEA 2QHLA 4M9PA 3WFHB 4U1KA 1BFTA 3DI3B 4WEUD 3L3GA 1UFUA 4OLYL 2W65A 2VXSL 3OZ9L 4KDWA 1F4WH 1DQJA 1HIML 2HYMA 2Y1VA 3MACL 4S11A 1A9EB 3S34H 3L9RA 4DKEL 5EU5A 2H32B 3QXVA 1E27A 5HDBF 5C6TL 1F11A 2NY4D 1N7ML 4GT7A 3SKNA 2YD6A 3NZHH 5EOQH 4Z76B 3PV6B 2R29L 3WUWA 3FB6A 3BPNC 3JWOL 5AZEL 2EDQA 4LASH 3TBSB 5C0JA 1FG9C 4L4TE 4HJGB 7CGTA 1HQRA 5A2IH 4EI5B 5ADPH 1C08A 3QIUA 4WFGD 4BQBA 3LKOB 4OZ4A 3ULUH 3PL6A 4IMKA 5DK0A 1RUPH 3BMVA 5HJ3A 4L29A 1EZVY 1GZPB 4Z9KB 3QIBB 3VXRA 5IB2B 4LOUD 3QEQB 5DF0A 4F2MA 2GYSA 2BNQE 3MNWB 1MHHA 4U1LA 3KPMB 4K7PL 1K2DA 3RHWF 4HWEH 3A6OA 4UI2A 4NQDD 3OJ2C 2GSGB 3MRNB 4RRPG 4Z7UE 2OTUA 1YEIL 4GW5A 2YA0A 5GRVL 3WD5H 3FFCE 4IHOB 5JHDA 4LLAA 3EO1A 3BZEB 3TGXA 3HZKB 4GXUN 1ZGLP 4FQHB 2FSEA 3V5DB 1QFUL 2HFFA 2NXZC 4NYLA 1QFHA 5HXMA 4HKXB 2PYED 3WFBL 1XFPA 3L6FA 1DFBL 3TCXA 3CX2A 2P8LB 1X7QA 5HHMB 4HG4J 4GRLA 3O4LD 3HI5L 1K85A 4M93C 4KVNL 3V5KB 1S3KL 1DBMH 2GHWB 3W0WD 4PJ7F 4NNYA 3VJ6A 4WENB 4YXHH 2Z31B 5DWUH 3JTTA 1MCJA 4KK8D 4XBPA 3HRZA 3LEVH 3DYPA 3VMNA 2Z92B 3BKYH 4PJXF 2FLRT 3BPNB 1CDCA 1DLFH 2GCYB 5IVZA 2R0WH 4LMQI 1U42A 4QRPE 1MJUH 2X70B 2VAAB 2VZ1A 4IRZL 1II4E 1AE6L 5E9DB 3ULVE 5INCB 3OKNA 1AGEA 4H26A 3ZKXC 4K07A 2CDGA 5F44A 2VUOA 3DV6B 4R0LA 5C0ND 4OI8A 2FBJH 1KJ2B 1MCQA 2DWDB 3P4OB 4PRBA 5D6DA 1J0HA 4LSPH 1YEGH 5D8JH 4GG6A 3MFGB 3DX8A 1OHQA 4XTRD 1KTKE 4ZODA 2XI9A 4XPTH 1OCWL 1WT5A 1Q9LA 3R1GH 4R2GC 1LEKA 3SGDH 5I1IL 4UDUA 2HJKB 5IW1A 3LB6D 3NFSH 2A0LC 5IBLD 1DCLA 2W0FB 2NXZB 1TVDA 5E5MA 1KTLA 1AGCB 4F7TA 5L9DL 4XB8A 4NO5A 5KVFH 2AEPH 3TEUA 4FFZH 3DX6A 2C1OB 5EIIA 1S8DA 2EIZB 3CJJA 4CVZB 4HSQA 4TSCL 3L3HA 1R6VA 1XF3A 2CPCA 1X4ZA 3SDXB 3O9WA 3FMGL 1T66C 3Q6FB 4UT7L 4NCC1 5IMMA 2HFEA 1YEFL 1QSFD 3C5SB 1GZQB 3NABH 3S9DB 2A83B 1NL0L 2EIDA 3VG9C 3U4AA 1VKXA 4ZOCA 4PP2B 4HCRA 4X9HA 1OARH 4R90H 3QRGL 5GHWL 4XRCB 1T2JA 3GHBH 3IF1B 1V7NL 3REVA 5CCKH 1B0WA 5I16B 2Y23A 5MI0C 5C9KA 4R4FH 4KRPD 1PG7H 5IVNA 4HKZA 3BFOA 3BZFB 3ZYZA 3AXLA 4MNQB 3O3BB 3U1SH 3MOQA 4JFZL 4RZCA 2P8PA 3WNMA 5DDHA 5FA3B 4MS8C 4H0HB 1UG9A 4BSVA 1Y18A 5BZDA 4JO1H 1YQVL 1OSZB 3I3BA 1YUHA 4KMQA 1KJ2H 4YGVA 5CJXC 4D0DA 5F9JB 3HNSL 3WFZA 1GHFL 3DVNA 3MLSH 4F7CB 4R2GB 3VFUA 1LDPL 2Y5TB 2YSSB 5LQBL 1E28B 2FR4A 1MCOL 1Y6MR 1KYOK 5JHDE 1FL6B 3GJFA 1N6QH 4XP1L 5L8JB 4NC2B 5DVLA 5TPWL 5JDJA 5FKAB 2EDKA 2FJHB 4UIKH 1I8IB 5AZ2H 2R4RH 2JJWA 3ZT5A 4Z77B 5HI4D 5FYLL 4OZHE 2IQ9L 3WN5C 4HMEA 1YPZE 2B39A 5F96L 5F7LB 5I17B 3KJ4C 4ACPA 3QEQD 3AU1A 5H37H 3LKRA 3L3DB 4WHYH 4K23H 2C1PA 3BXNB 1XF5B 1QLEH 1OGAB 3CX5J 5E70A 5L2KB 2VZ3A 3ARSA 2UZXB 2X4NB 1EEQA 2R15A 1MRCL 2OX5A 5MI0B 1OWWA 2VIRA 4DVRH 3RIAK 4U1NB 2IADA 5ICYB 2FO1A 5I0ZA 2AJYH 4HK0B 3GSUA 3HKFA 3PWVB 5IFHH 2VR5A 2P8MB 5ITBH 1UYWL 4WO4A 1FJ1A 2HT2C 4F15B 1P7QA 2YC1B 1IQWH 1JGEB 1T04B 4GG6E 1W72L 4JO4H 1RZ7L 4MXQC 4G6ML 2Z31D 4P3CL 4WUUB 5T1KA 2VDRH 2VDLH 4FG6C 5CILH 4C54A 1MLBA 5KVMC 4WUKH 4QT5B 2Z93A 1QACA 2CGRL 1JRHH 4XVJH 4JQVC 5FYJE 3LS4H 3U30C 1TNMA 3MROB 5HHOD 5CZXC 4L8DB 4X98B 1WWAX 1YEEH 4YXKL 4I1NB 4YQXL 3MRRB 2EYRB 4NZTL 1OAXH 1FNGA 2YMXH 4MNGA 1OTTD 5E9DD 5F1NA 5FYKD 3H7LA 1TJIH 3CPLB 4X9BA 3WN5B 5DMJB 1EBAA 4DGVH 1NC2D 3L5HA 4XXDB 5IHBA 5JW5A 3ALPA 4KUZH 4Z7WA 5GGRA 2FECL 4W70A 1K6QL 3V4PH 1KOAA 3U46A 4Y8DC 2R8SL 1NGYB 2PR4L 4ZO9A 5AWNL 4PJ8B 2WWMC 3B4NA 3G08B 2IQAA 1SYVB 2R1WA 3NA9H 3O45A 4ONHB 1M71A 5K9JL 3RX8A 4EXKA 3D48R 3B5TA 1Q0XH 3TCLB 3PHOB 3HCVB 2NXZD 3F7QA 1GC1L 3EW3B 5TGBA 5I1CH 2A77H 3DNKA 5FM4A 3VFRA 1HHKA 3MRCA 3RVTD 4UTAH 1D5BA 1MCPL 3VXOB 5MENB 5JORB 4OKVB 1CXHA 4U6VH 5EOCH 4Y0GA 1TETL 4PGBB 1FNSL 1Q72L 1MCSA 1U8HB 3EUUA 3MRDB 5D7LB 4BKLA 3FJTA 4J12A 3CH1B 3U30B 3CC5B 1ZLVH 4MLSA 3U0PB 5HVFB 5I15L 1K4CB 4U7MA 1MY5A 5DVKA 2WBWB 3QH3A 1SYSA 4Y5XA 4OM1L 1HSAB 1P9MA 3TNMB 3MJ9H 1UB5B 3HG1B 4PRIE 1FLRL 4RNRB 5D7KD 5F7WC 4QO1A 4NWTH 3ARPA 1IAIH 4EQ3A 4XP9L 2XN9A 3HZMB 5JXEC 4A2MA 5EO0A 4A2LA 2FO4B 3H9SE 2DQUH 1N5AB 4G9DA 3STLA 1WBXB 3MJ8B 1CU4H 3WEXA 5FK9B 1KXTB 4K55A 3BDXA 3CU1A 3DUSA 2L7UA 1YMMB 4N0YH 4FZEH 4NM8L 2XTJE 3CVHL 1ZV5A 4MD0B 4OV5B 2M26A 5DC4B 2DQFB 1S5IL 3BWAB 3OXRA 3RRQA 4TSAH 1G0XA 1R24B 1MHCA 5JNYA 4LHJB 1I4FB 3D9AL 3N9GL 1BVKA 3U0TB 1T66D 1YNTA 5K93A 2OP4H 2HRPL 1KJMA 5GRUH 1AD9B 3JZ7A 1VFAA 1PZ5B 5TH2A 1JYXA 3P4LA 3TFKC 1JTOA 1OGAD 3FN3A 3RWCA 2CD0A 1CG9B 1KELH 1EFXA 2APTA 3RVUC 1GOHA 2QL1A 1OSPH 1JGDA 3BN9C 2GTWB 3SGJA 2G2RB 1Z6JT 4MNGE 3GSVA 3KWWB 4H20H 1R3HB 4KTDL 1NPUA 4POZD 4JFFA 3HAEB 2AS5M 2NY0D 1U8MA 5B3JF 4MS8D 1KB5L 4X7TB 3NPSB 4P5TB 4Z7WE 4NZJA 3B3IB 4UNVA 4ELKB 1IAOB 3K0WA 4GMSH 2GJ6B 3ZTJG 3SDCC 2XZZA 4TRPL 2DLFL 4NKIL 4RGOH 5HHPA 1HILB 1YN7B 4WUUD 1R3JA 5F89A 3OAYK 1G6RL 4G80B 2VR4A 1PYWB 3IDYC 4LSUH 4N8VB 5HYJA 1NC4B 2C4XA 3ZHKA 1KC5H 4OF5A 2I60L 3CXHJ 4M3JA 4ODSH 5I19L 4MCYB 5LWYH 2WUCH 1PKQA 4HPYL 2EH7L 1I9JH 2DQJH 2OMNA 1N6VA 3HC4L 5JZ7D 5E94B 1CTNA 2X9WA 3IETA 3ET9F 4LLYA 3C8DA 4D9RD 1NMAL 1D5XA 1WC7A 3LIZH 5EBWA 5DJYB 3LEXB 4PJ8D 3IDNA 4APQC 4KPHH 4LBEB 1A7QL 3IXTA 4MB5A 2G9HA 1MCCA 3CIQA 4HGWA 4RRPA 3S36X 2XQBL 3QPXL 3GSXB 1G0DA 5E24E 4YWGH 5HPMB 1OY3B 3K8LA 4PJHF 1IAIM 2CXKA 3VFGH 3C87A 4MQ7A 3RX5A 4HXBL 1S7TA 5E4EC 1LK2B 5IGXH 4LARL 3SDCB 4GKNB 3HAEH 5ILTH 5MEOB 1JWMB 1RZGA 1CDGA 1JI2A 5MEND 5C0BD 3ZL4L 2XN9E 4PPTA 5CLTA 3HN3A 5B38G 4FG6D 4J3XA 2ENSA 1YY8A 2AJZB 4XWGH 4XNQA 3IDYB 5FO7A 4DN4H 5JPNB 1RUKH 3PDOA 3ZKMD 5HYIA 3K8KA 5LAXA 1HYRC 5IQ9A 1RURL 5KS9A 2E7LA 1KG0A 1P4IL 3NAAH 4PJCF 2BXZA 4U1JA 3T3ME 3CDYA 5HHNA 3S5LG 3RNKB 5IP4A 1I3UA 3AMKA 2MKLC 4JZOA 3LKSA 1J8HB 4X7DC 1ZE3C 2OSLA 4WTWA 4MJID 3GMRA 2XRAL 4K3JH 4GRWB 1W72A 3ECBB 2YPLB 2IPUK 3BQUC 1R5WA 4XBGA 1KFAL 2Z91A 4OFIA 4YEEA 4UUJB 4APQB 1NUDA 1X5JA 1G7PA 3GSNB 4GH7B 1JWUA 4AEEA 3SKJL 3TBWB 5EIVA 2W91A 3RWEA 3WNPA 1DSFL 1U3HD 1IKFL 4TQEL 2JJTA 1CFVL 3P0YL 4GLRH 3IFOA 4Z7VA 4JFFE 5EPMB 4PRPD 1FDLL 1Q38A 4X4ME 3QJFB 1YYML 5E4EB 1MFAH 3VXSB 1MWAL 1JF5A 4HV8B 3S37H 2J4WL 3DX9B 1GGTA 1KB9J 1CS6A 4LCUA 4F7MA 3EYQD 4YHNA 2PTTB 2I5YL 4C56E 3NACL 3OB8A 2FATH 2WINA 3U36B 4JRWA 1NLDL 4MMZC 4PGCA 5F72S 1HE7A 4YZFF 3CDGA 1IC7L 5IK3B 1J0KA 1J05A 2EICA 4S0SD 5HYJE 1LE5B 1J8KA 3X14B 1HOCA 1IEAA 2OI9C 3D39D 3UPCA 1XH3A 1FC1A 2NY2B 4LSDA 1A7PH 3QO0B 4MDIA 2Y7QA 4OGYL 4XP4L 3SE9H 1KIPA 1PKQE 4U1SA 5EORH 3U4EB 4PJAA 2E27L 4NBYB 3T8XB 2PXYA 3INUH 2XA8H 5FECB 4YHYC 4GAGL 4RQQA 4TUKH 5DJXA 2HFGH 3QUMB 4PJFB 5C1MB 1EO7A 4IOFC 3T3PE 4P5TD 3RDTB 3BQUB 1SY6H 4YDKH 1TQCC 4HZLA 1AC0A 1JPTH 5JXED 4G8EA 4NKOA 4Z8FH 2J8UB 2ADIA 3IJYA 4GRWH 5DZLA 1WBYB 2OQJA 1MCIA 2DDQL 1YEDB 4BZ1H 4HJ0D 1Q9WA 5E99L 2MOVA 1OVZA 1UVQB 3OJDA 4ZD3L 4RFNB 1KPUB 1OAQL 3GSNH 4YC2B 5DO2D 3HR6A 3VD5A 4ONFL 1NFKA 3BH9A 2R1YA 1EAJA 4NNPH 3RL1A 4UDTA 3UTOA 3UJIH 5IESL 1GGIL 2FGWL 5IB3A 1WFTA 3AAZA 2X9XA 4W4OC 3SEPA 4MXVF 4I4WB 5FYLE 5B39B 3PWNA 1C12B 3BGMB 4PJ5B 4AEIH 2ADGB 5C08A 1WWBX 1A1NA 2GSIA 1X5GA 5JMOC 2ORBH 3D6GA 1U8KA 4U0RC 1NFDB 5E8PA 1RJZA 4KJWC 3FZUC 4M7LH 2P5EA 4ONOA 4XP6L 1VFBA 1T7YA 3LN5B 4ZPTB 5KSBE 3V95A 5A2KH 1F4WL 3PNWB 3TFKD 5DTFB 4QRRB 3GEWB 3RIAF 2WWKT 1SEQH 4L8SC 3QWRD 5FGCB 5GGRY 1S7XB 3SDAC 3NZHL 4FHBD 1XGUB 1BGXL 2CDEB 4Y5YC 3T65A 4LASL 3CVHA 3I75A 5C3LD 4FQIH 3U82B 4JKPL 4YHYB 4ZFFA 5BMFL 5ADPL 5I1HH 4HFUH 3VGGA 3WHE1 5FIEA 4R8WL 3MA7A 3ULUL 1DE4B 1IM3A 5JW4M 1TQCB 1EHAA 4LSVH 4IDLA 1MQKH 5EO9B 3QUMH 1FV1A 1R3KA 1TVHB 2FJGB 2PW1B 4KKAC 1U92B 2ZSVA 2FEDD 5AD0A 2DQIH 1CGWA 1INDH 2AJUL 2UV3A 2VLLA 3QDJA 3NTCH 1FRGH 1FL3A 1CXKA 2HTLD 2H1PH 43C9B 1H3UA 5DJAA 3RBGA 4HKBB 5HHVL 4G8FA 4MJ6B 4X6DB 1F00I 4WCYL 3WD5L 5FDWA 4K7PY 4Z7VE 4MJ5B 5DMGD 3WIFA 3W5MA 1A9BA 2BVPA 3QUZC 3QYCA 3WMSA 4B53A 1T6WA 3EDKA 3ZT7A 2I07B 1LD9B 4U0RB 1KB5A 4K7FA 1J8HD 5BXFA 2XG4A 5D2LB 4LPUA 4OCSH 1QSEA 1CL7H 3RU8L 1K8DB 2JJUA 4WW2C 1DBML 3ZKSD 4X5WA 3QQ4A 4WHYG 4APQD 4YXHL 4G8IA 1CLOL 1RQ5A 2AVGA 5E8DL 6FABH 4L8SB 4PJEA 3EDDA 1JJUA 1G6RA 4W6XB 1AGBB 3DXAB 1L7TL 3C5JA 3QDMB 5ICXA 3RWHB 4G7YH 3BKYL 4EXPX 4H25B 4U6HA 5C6PB 3N1GC 3KHOA 3QAZC 1MQ8A 1DLFL 2VDOH 3MRIB 4KTEH 1AD0B 4PJAE 3SY0A 5J11B 4KMTL 1NUNB 4I0KA 3ALXA 3ROLB 4OJFL 2B4CL 4MNHA 3HE7D 4MD4A 3ARDC 3QCVH 4PRDA 5FHBH 4X4YA 4Q0XH 5C09D 3QXWA 4KI5E 3U7WL 4XHJC 1CLYL 4GBXD 2FBJL 2VQUA 2EO1A 1T0MB 2F58L 4XNMB 5HI3D 4MVBC 1UGNA 4FTVB 1KCVH 3SKOB 4CN4A 3MV9D 4K8RD 4XPTL 3EOAA 5D5MA 3R1GL 4NRZB 2NY2D 4EN3C 3P9LB 1KIRA 5EZIH 1FH5L 4HD9A 1MCEA 4HUVB 2C5DC 4J6RH 1QSZA 4P23A 1RMFH 3ULSB 3NZ8B 3P40A 4TUOB 1KV3A 3I6GA 2SEBB 1YY9C 2AEPL 5GIRA 3RDTD 4HFWB 4Z7OF 1BHGA 5TE7L 2VQ1B 2P5EE 2QSTA 4O51B 1QYGH 2V6HA 1XZ0A 3CZFB 3HPJB 3I50H 1W0YT 4XAKD 2AJXL 3FT2A 5AUMA 1RZKC 4FOMA 1I1YB 1TZHB 3G6JF 4QXUH 5TDNA 1BREA 4DEPB 4QNPE 1CT8A 2ATKA 2AAVA 3QAZB 1KN2H 3JTSB 4M43H 1MAJA 3MA9L 1D5IH 4JLRB 1AKJB 1DQTA 3HZYB 4WU7A 5JHLH 2PW2B 3OKKA 1G7HB 4R90L 4KK5D 3HPLB 1AO7B 1IGJB 2A6IB 4P2OA 5ANMA 1CD1A 5CCKL 5EOCJ 1I7ZA 3ARDB 3R06A 4JGMA 1ZVSB 1N8ZB 4R4FL 1PG7L 3DO7B 3AREC 1BD2A 2X44D 4Y1AD 2GTZB 4O2FA 2HVJB 2IBZX 5FYKL 1ED3A 1H8OA 4QXTA 4Y4KC 5FHAH 3RVWD 2CRIA 3SE4C 1S78D 3EDEA 3AS3A 3RUGF 4QRRD 1R3IH 2BNRB 4NKDB 5FCSH 1KJ2L 1IAMA 4WW2F 5EBLA 3FAWA 2DI8A 3MLSL 3TIDA 4EN3B 4HXAL 2ZUUA 2UWEA 4RMWA 4OF3A 3PF2A 4BH7B 1M7DB 1FFPA 2EDFA 3GFUA 5ELIA 1N6QL 3ZSTA 3VFSA 4U1HA 4KRMB 2E3VA 1WISA 3ARRA 3T1FA 5AZ2L 5EULV 1MWAA 3SE3C 4ENED 1BLNB 4FXGA 1WEJL 1IC4L 4M1DH 4RAVB 1UM6H 1QSEE 2ZSWA 1PQZA 1FNEB 4FZ8L 5E2TH 1BZ9B 4Y2DD 4PJEE 4PJBB 3O3AB 4K23L 4MX7A 3GB7A 1KUMA 4WHTA 4BZ2L 2DMKA 3KYAA 5AAMA 4QRUB 2D0FA 4ODUA 2X42A 5GGVH 3QG6B 3NN8A 3VD9A 2FX8H 3C6SA 4L3EB 2VKXA 1S7RB 1E4KC 1VA9A 4NQDA 5T1LD 4WI3A 3VGAC 5BVJB 4L4VB 3AREB 2CIIA 4NGHL 1DTUA 4Z0BH 2MQ0A 5DJZA 4YIQA 4KJWD 1CD8A 1S9XA 3WE6B 1BJ1H 3H3KA 4XGZA 4M61A 3DUUA 5GPRA 4YK4C 3BAEH 4KDVA 1VGKB 3O4LA 4KK9C 4CJ0A 4IIQC 2QR0A 1MFCL 2HVKA 3K1KC 3W0WA 2J3SA 1HYSD 3DXAD 2VDLL 5CILL 1LO4H 1PX4A 4FXKB 1T20A 3NCMA 4WUKL 3PJSA 3V7MA 5IFJB 3DARA 3LS4L 4HK3J 5CEXA 3DETD 3T4YB 4K71C 4JCLA 3FT4A 1R5IA 5GGUA 1U8OA 1OAXL 2YMXL 2W07A 3K4ZA 2NY1C 4LGRB 2F53E 4PRAA 4KI1A 2VN4A 3FCTA 4Z0XA 1TJIL 3BPLC 5HY9A 3RTQD 3MLVH 3FQNB 4AL8H 2V2XA 1R3LA 4PJDB 4JB9H 2VYRE 4KKAD 4IM8A 4KUZL 5ACMA 4QRQB 1ZT1B 3KS0H 4M8VA 1JNLL 5A43C 3E3QC 5B38A 5EZLA 3V4PL 5JPMA 4BM7A 1RZKH 4FTVD 3WXVH 2HJLA 4XZUB 5F7DA 3ZDYF 1QLFB 3OTTA 3QI9D 2HG5A 4NNXA 2DM7A 3PWUB 3PWJB 3P73B 4I0PC 1OTUD 2K7QA 1CFBA 2LAAA 4LLVB 3MCG1 3FQWB 4KQ4L 1Q0XL 1ZS8A 4N0FA 1EAPB 2DS4A 5ANME 1EHXA 4IOIB 1MI5E 3WYRA 5C2BL 3S5LA 8CGTA 5A3ID 1D5MA 9CGTA 1BD2E 4I13B 1OT1A 3MUGA 4P59H 1K5NA 1AXTH 2A77L 1SQ2N 5SWQA 4YK4B 3FO0H 1MREH 4RAUA 2OJEB 1LO2L 4OLWL 3BP4B 4IIQB 3FONB 4ZTOH 5KSUB 1GIGH 2H6PB 5KTEH 1GPOH 3GBLA 2LABA 4U6VL 5EOCL 2MCG1 3U9PL 1IAKA 5B4MC 1S7WA 4YR6B 2JCCB 1B2WH 4NN7C 2UWEE 5F7HA 2CKBB 2KQNA 1FO0B 1K4DB 1QSFA 2RQ8A 3SE8H 4OZIA 4R7DA 4OD1H 4MQSB 3PGFH 5HYEA 4K71B 1H9VA 1AO7D 2O5YL 2NY1B 3CFEB 5EUKA 4LCWB 1NKRA 1JHTB 3ARDD 1MH5B 2ERJB 3BPLB 3QHFH 5I1DB 5K59F 3L3KA 4X8JB 4D0BB 1KLGA 3LKPA 1BM3H 1CE1H 5L7XH 4NQXA 1A6WH 3FQUA 2XZAL 4JJ5A 5FO9B 3TP4A 3HAEG 4CDHA 1I1FA 1JZ5A 3WFHA 4LHUB 1OPGL 4HF5H 5FKPB 4FQCH 4OSUL 4NWTL 1XAUA 1IAIL 1NCWH 2BNRD 1ZEAH 3OKLB 1KJVA 3ELAT 1W0WB 4I0PB 1A9EA 2DQUL 4J8RB 1XGTB 2YD9A 4JFQB 2R0ZL 2H32A 1XCTB 1I8MA 1VACB 5FGBC 3BEWB 4CVWA 4NQDE 2IALB 3PV6A 2IFFH 3FHQA 1TTUA 2P5WB 3LRGA 1L4IA 4FZEL 2A38A 2JCCF 3SCMC 1LE9B 4CMHB 3GMOB 4HJGA 3NIFE 3CMOL 2DIJA 4R4ND 4P4KC 4Y88A 3KLAB 4TSAL 3LKOA 3D85D 1CFTB 4K3HA 4CN1A 2R1XB 2IH3A 2R56H 2NY7H 1I7RB 3O4LE 3O3DB 2QSQA 5DMKA 3W0WE 1UH3A 5GRUL 3O11A 3QEQA 1O7SA 3VRIB 2VDPH 4NN7B 4XVSL 4I48B 3MNWA 5BS0B 2VO5A 1KELL 1BOGB 1C8PA 4P57B 3A67H 3GI8L 5F1IB 5T5NG 4HUXB 1FO0H 3FT3A 3MREA 5D70L 3KHQA 5EZJA 4JFYB 4IHOA 4L4VD 1U8LA 4KUCF 5SX4I 4Z7NF 4H20L 3BZEA 2DTSA 4Q6IC 4WNQA 4FQHA 3V5DA 1OTSC 4HIJB 2W9DL 3NCFB 4KJQD 4HKXA 2BNUB 4WI7A 2Q20A 4R26L 4S1RH 2P8LA 3OJVC 4GMSL 1PBYA 1LEIB 2Q7YB 4RGOL 3RVXC 4K3DH 2A2QT 5F9AC 1FLTX 4QHLA 4ZFZB 3Q2CA 4P5KB 2UUDK 2Z31A 4U1MB 5IVOA 3KPTA 2YD5A 4G6AC 2YHGA 1FFOB 4LSUL 4F37K 2Z92A 2CDFA 1KC5L 3TO4D 3LVEA 1CXLA 1W2KT 3SCMB 4ODSL 3TPUB 5EN2B 1VFUA 2P4AB 2VDKL 4NRXB 3MFFA 3ULUE 5HHOA 1RY7B 2WUCL 4LAQH 5E6ZA 3HA0A 4NOBA 5FB8B 3FRPG 2X70A 1M7XA 4JREC 5E9DA 5HHQA 3BP5B 4NRYB 5INCA 3PWLB 4C4KT 1CFNB 5SWSD 1NC2A 1JCKA 1YEJH 1WZKA 3DV6A 1B0GB 3MLTB 3P4OA 2DWDA 4N0UB 2NY5C 1NCBL 3UDWC 1M1SA 2ZPKH 3RPKA 1QSFE 1XGQA 1V3MA 3MGOA 3TIEB 2PNDA 3QFDA 2ITDA 2LFGA 5F71A 4H0IA 3LV3B 2HJKA 4Q6IB 3BE1H 5CUSH 3RKDC 2W0FA 4F7EB 2VWEE 3EO9L 1AGCA 1Z9OA 3EGSB 2IC2A 3VFGL 3I02B 2AERT 2DBLH 1JF1A 4CVXB 3OGCA 2EZ0C 4BFGA 1MIEH 5TE6L 2EIZA 4CVZA 4QHKJ 4LCYA 1XR8A 3KVQA 4DAGH 3OL2A 2EDOA 3SDXA 4PLJC 1JP5A 5CKAA 3Q6FA 1G6VK 3R8BB 3KYOA 1T1XB 2ZKHH 3RQ3A 1YYLH 3UTPD 1TVBB 3UZQA 4DN4L 5IT2H 2NQCA 3C5SA 5F7EH 1GZQA 3HE6D 4GKZA 2A83A 3R0NA 1B4RA 4CADB 1A7BA 2D7OA 4ZFOB 4U1IB 1CD0A 4KKNA 3B6SA 3DOSA 2ZCLH 3NAAL 2ZP0T 3WL9B 3IF1A 5JDSB 4JREB 1IC1A 2Z35B 4F58H 5KSAC 3PHQB 1EV2E 2EYTB 1T0PB 2VJXA 3X3GH 2XTLA 3O3BA 4K3JL 2C3WA 2V7HB 1SEBB 1NANH 5FA3A 4XI5D 4QF1B 3QEQE 5GRZA 1UZ6E 5JW4R 1ZA3B 2EXYC 2ICCA 4I0PD 1D5ZB 5JR1H 3NOIA 2LVEA 4JPKH 5F9JA 2CRYA 3GK8H 1PVHA 2Y5TA 3G6DH 3F65A 3P30L 5IB4B 2YUXA 4LCCA 3LSOB 1E28A 3CU7A 2P5WD 1A7NH 2BVOB 4YDIL 3Q3GB 1FL6A 4DFIA 4OM0H 4DUVA 2F8XC 2BCKB 1Y0LA 3QEHB 2EDEA 2NX5B 1DBKL 2Q7NA 4UT6H 1I8IA 2I24N 3TYFA 3S37L 1P4LB 1KN4H 5B39G 2H2SD 4Z77A 4MJ2A 4OTXL 3ULVC 1T5WB 5E08L 5HHME 4I5BB 4N0CD 1IGCH 3S96B 5B4MD 1P2CB 4TNWK 4HHAB 3T4AB 4KQ3H 1FIEA 3L3DA 5BS0D 3OHXA 2DQHL 3IDGB 1OGAA 4KV5E 5TDPB 2K1MA 1PSKH 4UAOC 1A7PL 1U2CA 1J12A 3ARGD 1MAKA 2X4NA 3ZE1E 5EORL 4R3SB 3V9FA 3IRPX 3B2VL 3MBEC 3RWGA 5KSAB 1EA9C 2PCPB 4D9QD 1BJMA 3SKMA 4U1NA 3LPWA 3KYNA 5E9DE 5ICYA 2HFGL 4NN5B 5I8KL 1CTOA 1OQOA 4HK0A 3LHPL 3EHBC 4KTYA 4ESKA 3EZJB 3MRHB 3PWVA 3QCTL 3EFFB 4GW1B 5EC2A 1D9KD 3VFWB 3LS5H 2V2TA 3QUKB 2YC1A 1JGEA 1YEHH 1H3PH 3ALWA 5JIIA 3W2DH 5E1AA 2NY5H 1NCDL 5TDOB 1C1EL 2ZJSL 1T4KB 3LPGA 4WUUA 5IB5A 2DD8L 2H8PA 4U6XB 3GSNL 1OL0A 4Z95L 4QT5A 1Z5LB 3ORJA 5KN5A 3RWIB 3KYKH 1DDHB 2QSCL 4EOWH 5ID1B 1C5DB 4NNPL 1A4JB 3UJIL 4G6KL 1FPTH 3MROA 3B9AA 4X6EB 1BJ8A 5GJSH 3W39B 1HI6B 4YNYB 4O02H 4BUHA 5CJQH 3HR5B 4Y19D 5KZCB 3MRRA 2EYRA 4PGJA 3VFOB 3GMLB 3DROA 4S2SA 4Z7UF 4RA3A 3QIUC 3WJLA 4OD2A 3F7VB 3WN5A 2ORBL 3PL6C 4MA8H 4XXDA 4OAWA 2BMKA 1NDMA 2VE6B 4D0CB 3SDXE 3V4UL 5CEYB 2FEEL 4XPAH 4ZTPL 1N64L 1BMGA 5I18L 1SEQL 1NGYA 1SJEA 4FABH 2JF1A 4WI4A 5GSRB 4PJ8A 4UAOB 3GKWH 3F7PC 3IDMB 4ONHA 2B1HH 1M4KA 2W0LA 4AH2B 3TCLA 3FFDA 3HCVA 4N8PA 2GAZB 3IS0X 4XBEH 4FQXB 3QWOA 1VEMA 5IVXB 3ILPB 4NO0D 5LGHH 2GJZB 1G7JB 3N06B 4MNQE 4OIBA 4LSVL 1UACL 3QUML 3ARWA 4NZRH 3RVXD 5D7KE 1RIVH 1SBBA 3VMPA 3ULVF 1DQJB 2OR7A 3VXOA 5MENA 2VB5A 1IFHL 4G6AD 1YDPA 3BW9A 5BOPA 2BXYA 3NTCL 4XNZB 2YD4A 1F11B 3TNNB 3SGKC 2H1PL 3SKNB 4DQOH 3ZTNH 3FB6B 3CH1A 3CC5A 2FNBA 2E8YA 1T80A 4N90D 4I77H 4I0CC 2A6DB 4BJLA 1MAMH 3AMLA 4KU1A 1HQRB 25C8L 1K4CA 4LDOB 3U0WH 1I7UA 3RIFK 2AXFA 1C08B 2DBJA 2JE8A 5F7FA 2V7NA 4OZ4B 4WW1B 2BSRB 3LQAC 4X80H 1PAMA 5E6ID 3CSGA 5HJ3B 5M94B 2ZUSA 1CL7L 3VXRB 1BAFH 1X4YA 4PB9L 3ULVH 4MJIA 2XKUA 5MEPA 4RNRA 4R0LC 2XWTA 1AY1H 5D7IA 5D6DC 5ID0A 1S9WA 2QV2A 2P48B 5F9OH 1MHHB 4WDIA 3GJEA 5EU7E 3LDBB 4MA7L 1MF2H 1OGAE 3O2WH 1TDQA 2FO4A 3SDYL 3O6MH 1BJ1J 1CE6A 4J4PD 5L2KE 15C8H 1N5AA 5EU6D 5DUPL 1WT5C 3QDAA 3MJ8A 1WSST 2VDOL 5JHDB 3RKDD 3EO1B 5IB1A 1U3HA 5FK9A 4PD4K 5MHSE 4FNLH 3BSZH 2DLEA 4HBCL 4P5MB 4MD0A 4OV5A 3FB5A 3WJJA 1QO3A 3QCVL 4PRPA 1WTGT 2B20A 2XZQL 4WI5A 3W81A 3NCCB 2DQFA 1FAKT 5DI8A 5F88A 1R24A 3RJQB 2VC2H 5ESAB 1I4FA 2MQCA 1ND0A 3U9UA 5DGRA 2YOCA 4NNYB 3VJ6B 2WANA 3DUHA 2DQGH 3O9WC 5HVGB 4Z7QE 1RULH 4WUUE 2OTPA 1S9YB 5BQ7B 2CXGA 4PGEA 3PHSA 3C08H 1CGTA 1CG9A 1ZVYA 2HA1A 2DM2A 2VUYA 3D39A 3KS0J 2ZG2A 3R8QA 3DSFH 5IHUH 4G8GB 5KSAD 1RMFL 4L4JA 5DEFA 3KWWA 3OKNB 1AGEB 1GGYA 4H26B 2APXA 4JVWA 2JTDA 3HAEA 1A3RL 3QZWB 4R0LB 4X7TA 1INEH 4P5TA 1FZOB 3B3IA 5CZVH 4YXLH 4ELKA 1IAOA 2EXYD 2GJ6A 5JXEA 3BOVA 4D9RE 4JPIB 1ZTXL 4YBLC 4OZHF 1JHLH 2GK0B 1N3NB 1YPZF 1B4JH 4PRHB 1KN2L 4M43L 4X9FA 3F12A 3GIZH 4G80A 1Z3GH 1CGSH 1PYWA 1KCRL 5JHLL 4UDUB 1Q0YH 2LTQC 4LVEA 4OQ1A 2J8HA 5E5MB 1KTLB 2G5RA 5F3HA 4Z6AT 3GIVA 4HGMA 4F7TB 5I0DA 1GGCH 3KXFB 1FFQA 1G9NC 3WIHL 2H3NB 1U3ZA 2PKDA 5DURB 4CMMB 3MLYH 5LJYH 1FNHA 5EIIB 3W11D 1S8DB 1KEGL 5DK3A 1CDIA 3HB3C 1XF3B 2PF6A 5GZOD 5HYQB 5DJ0B 2QQNH 4M1CC 5E94A 5MENE 4E5XB 5IMMB 2EYSB 3PGCA 4BSWB 2HFEB 1HN1A 5DJYA 4OFYD 3LEXA 2ZWLT 3BKCL 3BJ91 1KCLA 2EDLA 3TO2B 4TYUA 4GG6F 2FX7L 1E4XI 3QWRA 4JFED 1N26A 2E7HA 5EBGA 2N1KA 3GSXA 1D6VL 4FQLH 5IUSA 1P5VA 4HUMB 5AG8A 3REVB 3WHXA 4ODBD 4JE4B 4FQXD 3TYGH 4HKZB 3EHBD 1KULA 4M1DL 1V3LA 3AXLB 3LQAH 1LK2A 1RVFH 1ZT7A 1S7SA 4UILL 4GKNA 4WO4C 4BSVB 4YBLB 1GVIA 1FCCA 1YUHB 3I3DA 4YGVB 5ICZA 4TVPH 2AJZA 4Y7MA 3DSNA 4OCYH 3V0VA 2YUZA 4QRTA 5GGVL 4N9OB 5JPNA 2FR4B 1OAUL 2EEBA 5F97E 2GUOA 1F8TL 1CXEA 1YMME 4ZS6C 5T3ZH 5FYJH 1CLZL 1FGNH 3M45A 1RI8A 3FRPA 2HKHH 4G5ZH 4PRPE 4R97C 3OKOB 4D3CH 5IF0A 1PX3A 1UQSB 1O7VA 5EUOA 2X7LA 4WFHE 1J8HA 2DLHA 3AB0C 3CSYB 3LH2H 3ECBA 2HH0L 3DX7B 2MMXA 1I9IH 2P42B 3LKRB 4GAJH 5EA0H 5EFIA 2XZCL 4NP4H 1HK6A 3C2AH 2NY3B 5F7UA 5F21B 3MLUH 4PB0H 4APQA 4ZUVA 1LO4L 3MLRH 5IIEB 4QXGH 4DCQA 3GSNA 5CP7B 4M8QB 4AMKH 4Y5VB 1JPGA 1BVZA 2E9BA 3L7FA 2E5EA 4O58H 5HGDB 3BUYB 1QFPA 2VLJB 4NQSA 4WGWB 5CJOL 1KJ3H 3FN0H 1RSFA 2IADB 4HCRH 2VISB 2CR6A 2C7UB 4KWUA 1U2HA 3FO2A 5EPMA 1IQDA 1QG3A 4C83A 4LEOB 1BWMA 3QJFA 5C0RH 4IMLB 3HE7A 4NKQB 3CFBB 4AL8L 4HV8A 4JB9L 2A6JA 4PYHA 4WO4B 1FJ1B 4AQ1B 5HD8D 1P7QB 3QA3B 2PTTA 2AEQH 2GJ6E 1HXYA 5JUEH 4GBXA 3T2OA 3U36A 1RZKL 2BVUA 3QBTB 3WXVL 5GS2D 3X3FH 4YHOL 2Q1EA 5T1KB 2X4TB 1MLBB 3QULB 5I1AA 4YHZH 5IK3A 5L88H 3MV9A 1LE5A 1N2RA 3UPRB 5IFAH 4G6JL 4M6MH 2CLZA 5T5FH 5DQDH 4G8GD 1PLGL 1J1PH 5DJ6A 4R97B 3Q5OA 4EBQH 4MNGB 3WSQL 1EX0A 2QBWA 4OBSA 5F1NB 3U4EA 3T8XA 2MKWA 4P59L 2ZUTA 1AXTL 1HKLL 4GO6B 1G9NH 2XFXB 3AB0B 4NDMA 1GH7A 3FO0L 4Q6YA 4Z7WB 3JV4B 4PTTA 3RDTA 4TVPD 3BQUA 2XPGA 4CBPA 5L6YH 4F57H 1KSRA 3GBMH 3EOBB 2YEZA 5KTEL 4JM4H 4XCYA 3T0AA 3U46B 2X4RA 4OB5L 5D7JC 1H3GA 1MFEL 4LCIL 4PRHD 1B2WL 4PLKC 3SE8L 3CX5K 2IQAB 1UVQA 3O45B 3QQNA 4OD1L 1M71B 5T3ZD 1PEWA 1KPUA 1OP3H 1YEKL 3O3EA 4HKJB 4ZUWA 1KACB 4O00A 5D72L 2Q6WB 2CMRL 4NQTA 4U3HA 3KXFD 1HCFX 3T2NL 5B39A 5L7XL 3BGMA 4P2RD 3VFRB 4YUEH 1C5CH 4PP1D 5E8NB 1EERB 3MRCB 4HF5L 1D5BB 4Y1AA 2EEDA 3K81A 3DBXB 2HLAB 5D1QD 1ZEAL 3PNWA 3UJJL 4QWWC 2AK1H 2VL5B 3QQ9D 2RR3A 4Z7WF 4QRRA 2Q8BH 4TOYL 5DD0L 3S35X 3TC9A 4DKAA 2W60B 2V9QA 4JKWA 1MIML 1S7XA 1QPXA 2DMCA 1B88A 1XGUA 2CDEA 1SYSB 5GSVB 5IMKA 4LRIA 3SGEH 3VFNA 2WIMA 4Y4HC 3G6AA 1JUFB 1IT9H 1BQHG 3IGAB 3DMMD 1J8HE 4ODVH 5GS3A 3DYMA 1NCAL 2R56L 4GRWE 2CRMA 2YPLE 3OKMA 3VG0H 4FQJL 2XN9B 1RZFL 2PW1A 5D7JB 2CLVB 1U92A 4Y2DA 2I25N 3MNZA 4WRLA 5EO0B 3UTQB 4ZAKD 3LKQB 2VLMD 4G9DB 4DKEH 3STLB 2VXVH 5C6TH 3E1F1 2EDYA 4L5FH 1A6VH 3WEXB 4HKBA 2CKBL 3DUSB 1FO0L 2Y72A 4LFHD 4X6DA 3O81A 1MHEB 4DJMA 4W4OA 5T1LA 4HLZH 3RNQA 2XQYG 4XVUD 4NZUH 3OXRB 4M7ZC 3BEVA 5DQJB 1ZVHA 3MYJB 2P47B 4HULB 1NMCB 5J0BA 3RBSA 5D2LA 4S1RL 5FUOL 4YHML 4OZGA 5E7FA 2FH8A 1KJMB 2NY3D 4K3DL 4JPVL 5F7MC 3VWJC 1ZLSH 1HH9A 3GO1H 3T0XA 3OG4B 2WLYA 4M7KH 4XPFL 2R23B 3DXAA 3RVVD 1HXMA 1EFXB 3B2UC 1JYNA 4H25A 2VLJD 1JGDB 5ENWA 4JG0H 3THMH 1YEIH 4MZ2A 3MRIA 2NW3A 1A4KA 3GSVB 4Y4HB 3QG7H 3MRFA 4LAQL 4Y4FC 3I6KB 4JFFB 2GK2A 3WIHA 4NC1C 1QFUH 4PJGA 1MLCB 4PJFE 5CSGA 1U8MB 1TXKA 3WFBH 1T83A 4EDWL 1G9ML 2ZUWA 2ED8A 2VH5H 1P4BL 3T3MF 5I73C 3RTQA 1OT2A 1YEJL 2QHRL 3VGHA 3HI5H 2PETA 2J8UE 5DQ9A 4XAKE 2XIDA 4QCIB 1S3KH 1T0MA 1T22A 1T7ZA 3TF7C 2ZPKL 4FTVA 1AXSA 3SKOA 4PLNC 1MCDA 2X05A 1CFQB 5HYJB 4HUKB 2X41A 3QI9A 1H3XA 3CZJA 5HDQH 4NRZA 4ZS6D 2LAGB 1ADQL 3F5WB 4HUVA 4KMLB 4S1QL 5CUSL 3FOMB 2C4FT 3BUTA 3W9DB 2VTFA 1F4XH 4M7ZB 3NZ8A 3ULSA 3DYOA 4OF8A 3BD3A 1AE6H 4PJ5E 2SEBA 3VI4E 3MCKB 1NFDE 1V3JA 3S35L 2VQ1A 3IETB 3VFTA 4O51A 1CZ8L 3CZFA 3VWJB 5C0EA 3RA7L 4ISVA 5EBWB 4QRRE 1TZHA 4YDJB 2ZKHL 3OF6D 1CGYA 3QUXD 4JFDD 5INDA 1FBIL 4O5LH 3G5XA 4LU5L 3IXTB 5FGCE 3ME0A 1OCWH 2WNGA 3TBYA 1A5FH 1TITA 4Y4FB 2PW2A 2AXJA 5CMAB 2A9NH 1AO7A 1IGJA 4FFYH 2A6IA 3B9VA 3MZTA 4RISH 1QFOA 4F58L 3ARDA 3MCLL 1ZVSA 3L95A 2QJDA 4MQ7B 3VWKD 1SVZA 1X5FA 5I73B 2R2EB 5T1DL 2JIXD 1RZGB 4HPOH 4TSCH 3ZKQD 1S9VA 4KK6D 2GTZA 3VXMD 3MRBB 1BQUA 2RCSH 2WWKO 1YY8B 1NFIB 5FA4B 3T3PF 2C4FU 4RBPK 5FO7B 2BNRA 5CJBA 5JR1L 1YEFH 1H3TA 4JPKL 2IH1A 1UXWB 4I9WD 3IDJB 3RWFA 3GK8L 2BERA 2P45B 4OD3L 2DJSA 1T21A 5KS9B 4X6DE 4ZMAT 3CXHK 1MJ7L 4BH7A 2YPVL 4U1JB 3QRGH 4ZDHA 5GHWH 5HHNB 3BYTA 4R96A 1GC1C 1LEGB 5KSVB 1K3IA 5HBBA 2PXYC 5C8JA 4JZOB 3CCHB 1MCWW 3I9GL 1L0XA 1W0VB 3L3IB 3LKSB 1KN4L 5I2IB 1BLNA 1LGVA 5D2LE 2EDNA 3D5OF 4Q9QL 1NCCL 3GMRB 3D85A 1R5WB 4XBGB 1FNEA 4KI5C 3STZA 4XCFL 1GJIA 4GQ9H 4HX1B 3WLBB 1YQVH 1G7PB 4KQ3L 2Z8SA 4PJBA 4KZEL 3BIBX 3DXAE 3QDME 3HNSH 2ZG3A 3RWEB 5KSBF 4QRUA 5HDOA 3N1PC 1PSKL 3LD8C 1AH1A 4FFWC 4L3EA 3IFOB 3K74B 5TPWH 1WZMA 4ZFOL 2X10A 4L4VA 4FMKA 3M8OL 4OBRA 5TJWK 4F7MB 2VABB 4YHNB 5FYLH 3WE6A 1EBPA 3PXJA 4M7LT 2E8ZA 1NGPH 3HC3H 1BQLL 4DUXA 4PGCB 4XVTL 3SE4A 4CU6A 1URLA 4UZGA 4E41D 4X99B 2NY5L 3CNKA 4FTVE 4KRNA 5L0QB 2CQVA 3CSPA 1JF6A 4XNXH 3FO9B 5I8OH 1S5HB 3EYVB 4FXKA 1WF5A 1QKZH 4JRXB 3GRWL 3S97C 1H15A 1FYHB 2Y7QB 3TO4A 4Y4HD 4ZUUA 1MRCH 2VDML 3E6HA 4UOW0 1JGVL 3U4BL 4NQCB 2LQRA 4MJ4A 4OIIL 1T1ZA 3WKNA 4Q74A 2HFTA 4MA8L 4Z7VF 5ISZD 3FQNA 4LLUB 4HZLB 2QQKL 4PJDA 1KGCD 4NKOB 1UYWH 4QRQA 1MVFA 3MV8D 1K8IA 1QFWI 4OCRL 5SWSA 1QPPA 3IJYB 5HYSG 4M6OL 4B50A 4XPAL 2OQJB 2XKSA 2VRAA 2GIYA 1Q9WB 3OJDB 4BFIA 4XZUA 4PR5A 5D7SL 2RIKA 1QLFA 1OP5K 1VSCA 2QLVB 3LD8B 4X6CB 3P73A 1OP9A 1UC6A 5DRWB 5FCUL 3RL1B 4UDTB 2JK5B 4LLVA 3MYZA 2WM0A 3BP6B 1AO7E 1EAPA 4L8CA 3CAFA 4YQXH 4NZTH 3RHWK 3UZVB 4PJXA 4C59B 3V2AR 5C08B 5LGHL 2IMNA 2GSIB 3PWPD 1U8KB 4PJAF 1RJZB 3VDBA 1KB9K 1G7MB 1HCVA 3VWJD 1UXSA 2I9LA 1VFBB 2OJEA 4OQTL 3GBNH 4YDLC 5ACLA 3BP4A 4IIQA 3FONA 1P53A 4X7CC 3ES6A 2YK1H 5KSUA 4PY7B 3S8WA 2RAMA 3CUPB 2BNRE 3BGAA 5SV3A 1MCBA 4KI5F 2DLIA 1O5DT 1D6EA 2A74A 4YR6A 2NY6C 3V7AG 4DQOL 4U0QB 2CKBA 1FO0A 1K4DA 1PW3A 3ZTNL 4PLOB 3A6CL 3T65B 1TJGH 4Y4FD 5JIHA 4I77L 3IRZA 3DIFB 5C92A 4ZFFB 2YRLA 1ITBB 1T3FB 1VEPA 3MMEA 1JHTA 1GC1H 3CFJB 1MH5A 2E9IA 5CSZB 3MA7B 5F9DC 4X8JA 1FORH 1DP0A 5CLWA 1HKFA 1RZ8B 1FV1B 1I8LC 3T08A 3QZWG 3KPSD 2VL4A 5AD0B 1AY1L 3QNYB 1IJ9A 4PJBE 3K3QA 2MQ3A 5F9OL 3GUTB 3CGTA 3QDJB 1JMZA 1YZZA 4ZPVB 2PN5A 3OKLA 3O2WL 5TQ2L 4WJ5B 1FNSH 1W0WA 3O6ML 4I0PA 5DJAB 15C8L 4J8RA 3NBNA 4ODTL 2VZSA 3UCRA 4L3EE 4FQQB 4RMTA 2F5AL 4Q58C 2IALA 3BH8B 4QNPF 4TNVF 5I15H 3BSZL 2P5WA 4OUUA 4AK1A 4L4VE 1A9BB 1LE9A 4P23C 4XX1G 2LV4A 3VFPB 2FZ3A 5E8EA 2E9JA 5BXFB 2X09A 5EDXA 1RPQA 3KLAA 2V2WA 4YDLB 4LNVA 1CFTA 2VC2L 4M02A 3FAXA 1FLRH 3VU2A 2R1XA 4X5WB 3QQ4B 1KYOJ 1I7RA 1F3JA 2DQGL 5E5RB 5FF6A 43CAA 4ZUTB 1G6RB 3VD7A 4HIXL 5ICXB 1KTRL 2WLZA 2BJML 1KPRB 4U6HB 3IFLL 1WV7T 4I48A 3CFCL 5BS0A 1WIOA 1ADQA 4JANB 1WFNA 5EO1B 1BOGA 1ULVA 4JFHD 3HI1A 3SY0B 5IHUL 4HUXA 3DGGB 3ARGA 2Z8VC 4RAHA 5CD5C 4JFYA 4MD4B 1NEZB 4PRDB 5DXWA 1SHMA 5DJCB 7FABH 1S5IH 5DRXB 4HIJA 5HHXL 4AIXA 4PJDE 3ESVF 1INEL 3D9AH 3RY5A 3N9GH 4O2CA 1UM4H 3MUY1 2AXGA 5DEGB 1LVEA 1I75A 2YRZA 3BHBB 1D9KA 3UC0L 4POUB 4DN3L 3O3UN 4ZFZA 3EOAB 2VSDA 2QKIA 4P5KA 5IMLA 3OX8B 5D5MB 4NQVB 3ZDXE 1Z3GL 5CD3B 1CGSL 1T89C 5DEZA 4PJEF 3RZWA 4LPTA 2V5RA 2CUHA 2NY4C 4P23B 2ICWI 3TPUA 1EMTH 4LFHG 5EN2A 3BYYA 4NRXA 4NQCD 4NZDA 1DN0A 4HJJL 4KTDH 1C7SA 1V7MH 1BQHA 1FP5A 4K94C 4Y19A 2NW2A 1J87A 1AP2B 1SJVA 1UKTA 4D2NA 4WI2A 4KUCD 5KVDL 1WK0A 1KB5H 4YH6A 2QQNL 1OOAA 2JB5L 3PWLA 3FT2B 3FQXB 5I76B 3QR2A 4NFCA 4LLDB 4TRPH 4CRPA 2DLFH 4NKIH 4N0UA 5FDYA 1EXUA 5TDNB 3L5WB 2WQ8A 3K2MC 1JWSB 2G5BB 2ZNXA 4QOKB 2WZPD 1G6RH 4K3EL 3OKKB 2B1AH 5A1AA 4FQLL 5I19H 5ANMB 4LCWE 1CD1B 4B0MM 1A47A 4TPRL 1I7ZB 3R06B 5K9KB 1GRWA 1IGFH 4Q6IA 3TYGL 2ATPA 1DVFD 2EH7H 3EGSA 4GQPH 3V0WL 3I6LE 3I02A 4P9HL 3LQAL 1U8IA 1N59A 4NO0A 4CVXA 1RVFL 3HC4H 2PO6D 4YBQC 2L4OA 1QNZH 3AY4A 2KBGA 1LO5A 3DRQA 4TVPL 2Y06H 2CK0L 4JN2B 1LQSR 2DLTA 1GOFA 3BN3B 5IOPA 3RWDA 5EZOL 1JFQL 2NY4B 1I3RB 2XQBH 2N7AA 4CADA 2P5WE 4HUWB 4ZFOA 4U1IA 4KH2A 1QBLH 4JG1H 5T3ZL 1MFDL 4UT9H 3QFJD 3UTSD 3D25A 1KXVC 4ZSOB 3JV5A 3TESA 2FHBA 5GGVY 3ZYOA 4GUPB 3PHQA 1EK3A 2ZSWB 3CH8A 5HYFA 3IU4L 4NPYB 1OD9A 5E6IA 2GFBA 1I3VA 4TTGA 3MPCA 5I1EH 2V17H 3MJ7A 5C0NC 4QF1A 3GB7B 3MLUL 3UDWA 4ELMB 4IDJH 5E5UB 5BS0E 5JA9A 3GRWA 4MAYD 4ODUB 4AMKL 4LAJH 4XTRC 2PUQT 3NN8B 4MB4A 5DD3H 1UA6L 4J4PA 2DRUA 5EU6A 1RURH 5DS8B 4YFLF 5I71C 2CLRB 3UZEA 3G5YA 4HCRL 2UWEF 2NR6D 3BDYL 3LB6C 3QEHA 2NX5A 1KF9B 2AJSH 2YUWA 5C0RL 1S9XB 4XGZB 3C9NB 3DUUB 4TTDD 1CDBA 1P4LA 2PYEB 3G5VA 1K9TA 3EDFA 4TULH 2VMFA 4OGXL 1ZLVK 2XRAH 2AEQL 5D2NC 2J88H 1UWXH 4I5BA 5DHYB 1KFAH 3S96A 2HVKB 4UOW1 3AFLA 4HHAA 4NM4L 1J1OL 4YHZL 1T20B 4RA0C 3SKJH 3PE9A 4WWKD 2Q86A 5IFAL 1X5YA 3IDGA 3GSOB 4M6ML 5CEXB 2V9RA 5TDPA 4HH8A 3OWEA 2EH8H 3FT4B 5GGUB 3P0YH 4PRAB 2BFVL 3T0BA 5KSAA 3D3VB 2H9GA 3TVMD 5HY9B 5IJVB 1G9NL 1MWAH 1R3LB 4K94H 4M7JH 4KRPC 2L0DA 4N9GB 4OQTA 5IJKA 3NIFF 3MRHA 3EFFA 3V6OA 3FTGA 1BBJB 5L2JB 1RJLB 4N0UE 5JPMB 1NLDH 3ZTJH 3VFWA 4HT1L 3IU3A 2V5SA 3QUKA 4M6NL 3KJ6L 1U9KA 3DURA 2HG5B 5TDOA 3HLAA 5IQ7L 1T2XA 5I71B 2A73A 4JQIL 1ZS8B 4N0FB 1XT5A 4C58B 3RWIA 4B5EA 3LCYA 5ID1A 1C5DA 4OGYH 4XP4H 3S5LB 1A4JA 1HH6A 3OMZA 4X6EA 3W39A 2E27H 2B4CC 4YNYA 3BKJL 3HR5A 1K5NB 4N5ED 4GAGH 5ESQA 1BZ7B 3CFIC 3VFOA 5SWQB 2D4FA 2O5ZL 2WIIA 5GGQL 1C5CL 5C70A 5D2NB 2WP3T 5C0GB 4HEPG 5CEYA 3JUZA 1IAKB 1HHGB 1X44A 4KGJA 5C0CB 1DZBA 3HC0B 1S7WB 4QOKD 2Q8BL 4OZIB 3LQZA 3RFZC 4OFYA 4R7DB 4MAUH 2L7JA 5GSRA 1OAQH 3W9EB 3QEGH 4ONFH 2NZ9D 5CD5D 1J0IA 1V3KA 3BPOC 5IG7A 4N90E 3U7YL 4JFEA 1FN4B 3TH3T 5IESH 1S7UB 4PREB 4NQUA 1ZHNA 3L3KB 1KLGB 2GAZA 1LO0H 4FQXA 4KRPB 5IVXA 4ETQB 5IWLA 2GJZA 1M05B 3FO1B 1G7JA 3FOLB 4UQ3A 3ULUF 3VG0L 4XP6H 1LILA 2FD6L 2HT4C 5J6HA 3FFCD 1BIIB 2UVEA 4YO0B 1KJVB 5K33A 2Z31C 1MFNA 1I8MB 2WUBH 2VXVL 3TNNA 4IRSD 4L5FL 1A6VL 2DI9A 2MSPA 2BVQB 4P0DA 1BGXH 2OLDA 1JPSL 3WS3B 2A6DA 4JKPH 1T2QL 1HDMB 3LRHA 2NX5E 4EUPB 2VR9A 5BMFH 4NJAL 3PP3H 4NZUL 1U8PB 4HWZB 4R8WH 4W68A 4WW1A 4DGIL 1OTTC 2BSRA 3UBXI 4KVCL 2IH3B 4BH8A 2K9UA 1WZ1H 3VA2C 5DMKB 5HYSA 3OR7A 4H8WL 4PJHA 1ZLSL 3O11B 3GO1L 1ZAGA 3M17B 1HQ4B 4QRPD 4PS4L 2AJUH 4M7KL 1V5JA 3BP7B 4U7SA 1NBVH 3BPOB 4IJ3C 5HHVH 1GAFL 4JG0L 3THML 3FT3B 3MREB 3CLEH 5EZJB 4WCYH 1QD0A 1U8LB 1YC8A 3QG7L 4WNQB 3ZKND 1MFBL 4P5MA 1J18A 4WY7L 4YBQD 5CJ5A 2ICWB 2VH5L 1SJHA 4DZBB 4PJCA 3RU8H 2X4PB 2IPUG 5ESAA 4Q9CA 1U8NA 2F74A 4QHLB 3RVTC 1CLOH 1RV6X 1XEDA 5E8DH 4OCMC 5DMIL 1L7TH 3SGKA 1S9YA 5FM8A 4QHMA 5BQ7A 2RFXA 2CDFB 5HDQL 1UZ6F 2H32H 5SX5K 3P9MB 3T04D 5T3XH 3MFFB 5HHOB 4KMTH 4O4YL 4OFPA 4G8GA 2XY2A 3D3VD 3TN0D 1F4XL 3X17A 2IFGA 4AM0A 2DJUA 4OJFH 4WGVB 1EVTC 2B4CH 5HHQB 4X9IA 2D0GA 4LVNC