3HE7B

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta7 nkt tcr
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
97
Chain Sequence
b'QKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7B00
4QHUA 4EJ1C 3KJ6L 5MEPB 3RDTC 1UB5B 2BC4B 4KKAD 1JYVA 2R23B 1UA6L 4DAGL 1KNOA 3BGFB 3MNWB 3V4VL 4LF3B 4PJCE 5T33H 1WAAE 3DROA 1OP3H 3GEWB 4ESKA 1WF5A 3U6RA 2WP3T 4QY8B 4M9PA 2OI9C 4CMHB 3DRTB 2D0HA 4L8SC 3WE6A 1C12A 3D85A 1J11A 1A0QH 4QLRA 2VE6A 1VFMA 3W0WA 1N0XH 1QG3A 1UADC 4R3SB 2IPTL 4R4FL 1UZ6F 2YD3A 5C07B 4U0QB 1F5WA 1F3JB 4E41D 4M8QB 4U1SA 1KACB 3B9VA 4N0CD 3PHQA 3V6OA 3LDBC 3ELAT 1J87A 1FYTA 3VFOB 4POYA 4N0YL 4M1CD 2VUOA 4DJMA 2XRAL 2D9CA 1SJVA 3BO8B 4JM2A 2DS4A 4POZC 4J4PA 2C7UB 2X9WA 5CEYA 1DUZA 1TENA 3DI3B 3PQYB 1R24A 1EEZB 3H6JA 4EVNB 1NCTA 2YEZA 4KQ3L 4PJAA 1BBJA 1DBAL 1WC7A 2AJZB 4J3WA 1CFTB 1MI5B 1FLRL 5E2TL 2APXA 3EOAB 3QQ3B 4HWNA 1FN4A 3TFKC 1DBBH 2CD0A 4NC1E 5HVWA 2BOCA 3U0TA 1A3RH 1LDSA 1TZHB 1JWUB 1QFWH 2F53B 5DMYA 4MD0A 4U7KA 4QHNB 4P99A 4F33B 3O3DB 4GRWE 1QRND 1X5HA 3JWOL 4YZFE 3U46A 4XCYA 3QEQE 4F9PA 1WIPA 3AFLA 5MERB 2FO1A 1AGEA 3U4BL 3G04B 4BYHA 1SEQH 4EN3C 3DV4A 3PWVB 3RVUC 2G75B 2EYTB 5DJ6A 4KRPC 5FB8A 2HJLB 1G6RB 4PGBA 4HZLB 4LEOA 2F54D 2EE6A 3LZFL 2AJSL 4YFLI 4M61B 3I3BA 4U6XA 2R2HB 5IM7B 1UG9A 1SYSB 1BZ9B 3C08H 4HWEH 5HHMD 2UZYB 3TM6A 1WJ3A 1QYGL 25C8H 3LVEA 1KC5H 1QRKA 3GMOB 3SGKA 3ISWA 3GIVA 3K4DA 5C0JB 1B6DA 3VA2C 1AXIB 2UZXB 4U1MB 3BHBB 5IHZB 3DLQR 5C6PB 5E2WL 1I8MA 4OZ4B 1BAFH 4KMTH 1X5YA 5IW3A 5DI8A 4YUEH 4I9WD 2AXGB 4XPAH 1PG7W 4EZMA 4DTGH 2IMNA 3SQOH 5E8DL 4AT6B 1FVCB 2YSSA 5JW4N 1B9ZA 4CN4A 3U7WL 4WI2A 2J8UB 4JKMA 1EVUA 3QUXD 3QXVA 3QR2A 2EYSA 4L4VB 1NQBA 5FUZL 4LNRB 3IDYC 5A2IH 2N4IA 3LKRB 5T3XE 5FEBA 4LHUB 3MFFA 1DLFH 2XTJE 5IFAH 4F3FB 3SJVD 2BOBB 1CXFA 2NXYB 3BQUD 3MLRH 2PR4H 5DK3A 4RGMB 1KXVC 3BDBA 4L8DB 4FZ8H 1KB5A 5CIPH 2EE3A 1NC4A 5CJBA 2EO1A 5FECB 1MHHB 5KBNC 1VFBB 5K9QG 1BIHA 5ICXA 4RGNB 4G9DB 4JO1L 1MELA 2ZSWA 1G7LB 2DQJL 5DSCB 4LPUA 5BRZD 1GGUA 3Q6GH 1RZJC 3MRKB 4HJGA 1HSAA 2A74B 3RA7L 2D4DA 4X7DC 1WK0A 4Z7VA 3QDJB 4LAQH 1PVHA 2P5WD 4IHOA 1EHLH 5CJ5A 3P0YH 3S9DB 5E08H 3NIGF 3L9RB 3QG6B 1HWHB 4FFWC 1CGYA 1I7UA 2W07A 2EC9U 4PJGB 1KJ2L 1YEJH 5F6HJ 3K74B 4BQ8A 1Q9WA 5FGSA 5F3BB 5J13C 4PJIE 5IB1A 5K59E 5IBUB 3LN5A 4OQ1A 2EXWD 1JPST 1MLCA 2CLZB 3ZTNL 2C9AA 2YA1A 2ID5A 3GJFH 3I2CH 5DHVH 5HHXL 1U6AH 3GUTB 1BFVL 2V2XB 2AW2A 1OTSD 5C0CD 5HI5C 4JAMB 3QEHB 4O58L 3QUMB 2BHZA 4FQXA 1WZKA 4QHLB 4YK4B 2DIAA 1EGJH 2QADB 3RVWC 3MV7D 2WQRA 3HPLB 5I1CL 4TOYL 4UB0L 4GH7B 2C3XA 3P77A 4OZHB 1TVHA 5C0AA 2FEEI 4NKOB 1EZVY 1JJUA 2WBJA 4RSVA 2X4PB 4M5ZH 3EDEA 1ZHKA 4JPIB 3FB7B 2V2TB 4LPTA 3K46A 5IVNA 3KPPB 5IVXB 5JA9A 1VGEL 4DGVL 1A02N 4WUKL 2OCFD 5TDPA 1MWAB 1A1OB 5TH2B 3QDGA 3SDCB 1FC1A 4HQQL 3MNZA 3AUVA 2HT4C 3QXWA 2OJEA 3IETB 4PJBB 4NGHL 1BWMA 4R97C 1K9TA 3MZTA 2Y4SA 5C0ND 1JI2A 1MEXH 3MYJA 4QF1B 1G84A 1JHLH 4YH6A 1YJDC 1HNFA 2PF6A 3X13B 3ES6B 5CBAA 3V4PL 3AVEA 3GSUB 2LV4A 5GIRB 1LNUA 2IPUK 2P43B 2WANA 3IDGB 2P7TB 1CXIA 4RZCB 2X4RB 2GTWA 4K2UH 5EUOF 4L1DA 5GGQH 4PLKC 2D03L 1ZHBB 4L9LA 2VDQH 2HTLD 4N1HB 3N9GL 4WU7B 2XWTB 3QG7L 5H94B 1FZKA 4LARH 1LEGA 5E24E 2X89D 3LS5H 5IQ9A 3WDJA 4APQD 1EAPA 1FZJB 1MQKH 4AL8H 4FTVD 5FOBB 1YY9D 2AK1H 2CGRH 4JFXA 3UTSD 2QSQA 5E6YA 2VB5A 1DQLH 1TZIA 4K94C 5AYUH 5MEOA 3PL6B 1PBYA 1ZGLB 2IPKB 3PL6D 3WUWG 1S8DA 4GBXC 2HA1A 3PWJA 5DD1L 3L3DB 3UMTA 4C83B 4ZFZA 4JQXA 2A6JB 3PJSA 4FN0A 4LNVA 4JE4B 1AJ7H 3NH7H 3SDXE 2QQLH 5C7XH 3MBEB 3D39D 4TUOB 4EUPB 3VU2A 1N59A 3MJ8A 3CLEL 3GSWA 1I7ZB 1BREA 3ALPA 3MRDA 4LLVB 3WXWL 2ESVD 4PV9B 1WTLA 5EG6C 4RA0C 2Z91B 4OBRA 3IKCA 2SEBB 3WIIH 1CTNA 5I8KL 3QPXL 4ZAKD 1G7JB 4I3RH 1QA9A 3D25A 5D1ZC 3IJSB 4LGSB 4PBXA 5DC4B 3DVGA 3QULA 2EKSB 3VD3A 3P11L 4OQTA 1BZQK 5KVDH 1U3JA 2GHWB 4DFIA 4HPYH 1MREH 3U30C 3KPMB 4Z5RB 3OR7A 1OAQL 4Q2ZB 4DK6A 3Q3GA 3LKNA 5LWYL 2X1QA 4MNGA 1AGDB 15C8L 3L5XL 5FAAA 1MLBA 3O2VL 5CUSH 3C8KA 1NCWH 2ATPA 3C87A 3DGCR 5D4QA 1V3KA 3NABL 4G6KL 2EZ0C 3MRJA 4S1SL 3OGOE 5FF6B 3OXRB 1XEDA 1QNZH 4IDJL 1Q38A 4PJFF 4PJ7B 4K23L 3O6LL 3TJEH 1R3HB 1ZWIB 5FXCH 3V6ZB 1J8HE 1HCFX 4JY5H 4X6BB 5E6IB 4I0PA 1QSEE 1T2QL 3NCYS 5CIPA 3SE9L 3DMMA 3FRPG 1K2DB 4X0KA 1U8KB 1BD2B 3MJ7A 5HGGS 3VDAA 1YQVH 3IDJB 4UBDD 1TNNA 5F1KC 4K3DL 5FUCE 1OLZA 2FYYB 4D0DA 2G5BA 2HMIC 2P8LB 4UQ2A 3O2DA 4JN1L 1MCSA 3BUYA 2R1YB 1DQTA 4PJ8A 2O5XL 1T03H 4LDLB 2OMBA 4M7LH 4HSQA 3JWDC 4C59B 4ELKA 4YXLL 2HWZL 5DUPH 2Z0BA 4JGMA 1HKFA 2VZUA 5FYJU 4GJTB 1BMGA 1M7IA 5I8OH 4P57A 4WGWB 3P4NB 4RMVA 2G60L 1KYOK 4U1KA 4U1GB 3THMH 4TTGA 3BE1L 3GGWB 2P47B 1AQKH 4MQ7A 1PG7L 5IJKA 2MCPH 2QSCL 1N7ML 3ARDC 3GDBA 3MRNA 5CP7A 2IEPA 3GJFA 2BMKA 4KV5E 5DHVA 2IAMC 3MXWL 1JGEB 1EVTC 4ODVL 4HS3B 2OP4H 3RNKB 4D9QD 1NPUA 1DBML 2AJXL 4NO3A 5T1KB 5T1KD 3EO0A 4ZXBA 5C09D 5C08A 4JQVA 4G5ZL 4KZEL 4IRZH 4LPXA 4MXWL 2HVJA 1S9VA 1Z3GL 5F1NB 3TZVC 2G2RA 3CFCH 2IH3B 2CXGA 2PYFA 4ONFL 4HBCL 1AE6H 2C3WA 3D1MC 4LCUB 3WUWA 3V5DB 5E9DB 3H9SD 1UKTA 1FFOA 2W59A 3HC0B 4KI5C 4MHHI 1T0NA 4NN6B 4G43B 4GMTH 2BSSB 2PETA 1UWGH 2R2EA 3HLAA 3WO3B 4IRJB 1MCIA 5F96H 3M17B 1P7QB 1OARH 1ZHLB 5GGTL 3I6LE 1BHGA 1P7QD 2EDHA 3GMRB 2BDNL 5KS9A 1MCDA 1AD9B 2XV6B 3VFMA 2AV7A 5IESH 3MV8A 2IPUG 3KYKL 3V6OC 1KEGL 1DQDL 3MROB 4RQQA 1RY7B 1AO7E 2VLJD 1MRCH 3MODH 1KB9J 2VZVA 5EOQH 2ED8A 5DQ9B 1OW0A 1CBVL 5I74C 4GUPB 4NIKB 5IB2A 1ORSB 4JFPB 5FA3B 4P5MB 4V1DB 3RVVD 3CUPA 3D3VE 1S78C 3BKYL 1DEDA 2CKBL 4IJ3B 4LPVA 4JZJB 3DX8A 4HULB 1LD9B 1IGIH 4EI5C 5TDNA 4JQIH 7FABL 4TN9A 1NGYA 4PJ5E 4IRSA 1S9WB 3RJDA 4JRXE 3BVNA 2XG4A 3GSRA 2UWEE 1VFAA 2L7JA 1A7QH 5KANG 3WHXA 2JIXB 2ENYA 3HMXH 2LVCA 1RU9L 1KLUB 3LKQA 2H2SC 1KBGH 1DTUA 4LKCA 3ARBD 1XGYL 3JTTB 5IIEA 1NFDA 1JPGB 4G8GA 3B9AA 1H5BB 3MRIB 3WL9A 1B90A 4F9PC 3E6HA 3OXSB 2XN9E 3MNVB 3B83A 5D1XB 4D8PB 4PJDF 4XP6H 3X11B 3FRPA 2GITB 4GG6B 3FQTA 4NPYB 4BH8B 4YIQB 3MLYL 1QSFA 5AG8A 3RQ3A 2HFFB 1UXSA 2YD6A 1P4IH 2IG2L 4GMSH 1S7QB 3DYMA 5BV7B 4FABH 5I1LB 4HIXL 1UXWA 3PABB 4X6CF 3ULVL 4NC1C 2HJFA 2YUZA 4G6FD 4MNQE 5FCUH 2PXYA 4AY0A 2DQGH 3HFMH 1L7IH 3CMGA 2CUHA 3C6SB 4H1LH 3TA3C 3ULUH 1B4RA 1QO3B 4TQEL 1GVIA 4ZMAT 1FGVH 4BZ2L 4MQXC 1IM3A 5IW1A 3G6JE 1XIWA 1IARB 3R1GL 1HHJA 1ND0A 1YEEL 3JSSA 3GJEB 3P4OB 3BP5B 1RQ5A 4LVOC 1B0GA 3HS0B 2X4NA 3QXDA 4PRIA 3WO4B 1LK3L 4HGMA 1T1YB 4XP4H 2KZWA 4HWBL 1MJJB 1MFAL 5F7MC 4OGAC 1X4ZA 3WBDA 5DEFA 4X4YA 4DKAA 1S7TA 4XB8A 1HXYA 4QT5B 3TESA 2DKMA 4ZFFA 4PFEA 4RNRA 3IU4L 3EDJA 4K8RH 1GOFA 1CE6B 3BWAB 4E5XA 3QHTC 3A67H 4KK8C 5CJ8A 1A7BA 2JB5H 2A1WH 3HG1D 1U8IA 2YK1H 3O11A 4M8VA 3DXAE 5ILTL 3OKNB 3F7RA 4ORGA 3ZT5A 3LQAH 4MMXC 1I85A 1N5YL 2ITDA 4M4PA 3NPSB 4WV1C 2A6DA 1A6ZA 3PDDA 3CDFA 2GT9A 3UDWC 2UY6A 4W4OA 4L4TD 1WCBB 3TIEB 1RIUH 2AJYL 4R7DA 5D1QA 4DK3A 2NPLX 1SY6A 5IMMB 3CNKA 5CBEA 1OM3L 2VLKA 1KCSH 1LMKA 3IFNH 1JWMA 5JPNB 1IBGL 4P2OD 3LPWA 4LKXB 1A22B 1VCAA 3TCXA 3UTZB 5E2UL 3RZCA 1FZMB 4UI2A 3OMZA 1HSBB 4NQEA 1QPPA 3V6BR 1QZ1A 1IT9L 2A6KA 3OG6B 4ELME 4JFFD 3WXVH 4DZBB 1TDQA 3TBTB 1RZFL 3SKJH 3UJJH 4OCSL 1WEJL 3ARVA 4JFEA 5SWQA 4OLXH 3QWOA 3MCLL 1V7ML 1YNLH 3D69B 5D8JL 5EOTA 5MENE 2C4FU 2X4QA 2IANA 1F8TH 3OSKA 4ZUTA 3VRLE 3VXRB 2UY7A 2WINB 3V7AG 3TFKD 1AIFB 2FX9L 1F42A 1S7VA 5DYOB 3IU3A 1I1FA 1MRFL 4P46A 3GZKA 4JO4H 3IVKB 1T89A 4FQXC 3TO2A 1FG2B 3FMGH 4K94L 4M43H 1L6XA 4LCWB 3TNNB 5DJZA 3N85L 4XNUH 5D7LA 3MV11 3T8XA 2VDNL 3BEWA 1U41A 4Y2DB 1C16B 3GIZH 4KDWA 3G5VB 2WBJC 3KR3L 5KTEL 3LKSA 3T1FA 4EN3D 3IYLW 3UTTA 1OOAA 4UV7L 1JTTA 4POUB 3MA9L 4HJJL 4KRPD 5HHQB 1A7OH 4TPRH 3VXMD 2ZOLA 2NTSP 2W38A 3VW3L 4CDGC 1IGCL 1TMCB 4NJ9H 4OGYL 4Y7MA 3OX8A 4NT6A 4N9GB 3KPSA 3EYOA 4K7PX 3VWKB 3OKEB 5JQ6H 1TJGH 2XIDA 1EO8L 4YWGH 4ZPTB 1UFUA 1R5IB 4HIHB 4YDKH 5SWZB 2J4WL 3IDMA 3H42L 4HXBL 1CVSC 3SE8L 5BXFA 4QOKE 1BZ7B 5ANMA 2QKIA 4X6DE 1ZLSL 4ZSOA 1OAXL 1SEBB 4KDTA 4YXHL 4PG2C 2VR4A 2CKBB 4QRTB 4BQCA 2C3GA 2I60L 3OKLA 4YHMH 4ZPVB 4MD5B 3N1GC 4L9LC 3T0EB 1T1XA 1EFQA 4LLUA 3HMXA 4TTDC 4EDWL 2R0ZH 5JOEA 1PEWA 4GKZB 4M5YH 4UIKL 4GAJL 5HGBA 4NUGH 4PB0H 3DUUA 5J12C 3CC5B 3HAEH 4N8PA 5EU7E 1OAYH 4MAUH 1BECA 2A9MH 3SOBH 1C7SA 1IC5L 2VOTA 2NYYD 5CEZE 3STLB 4NNXB 4JQXC 1VADA 3CFBA 2F58L 4KI5F 4IS6B 2A83A 1C5BH 5HGDB 3QDME 3RWHB 1A7PH 35C8L 2IJ0C 4JPVL 3H7BB 5F72S 1XR9B 4L3CA 1YPZE 4BSWA 4PLOB 5LGJA 3CK0L 3LMJL 4R0LA 1DQQB 4WFED 4CADA 3NCBB 5JHLH 4PJCF 5D96C 3GMQB 4RFNC 1WAAF 3ULVD 3VFNB 2NY4B 1A6WH 4OFYD 4RAUB 1MFCH 2NY4D 3NCFB 2XFXB 4O4YL 1YEDA 3HZKB 2VKWA 2VDOH 3HI1A 4TSAH 5GHWL 4M7JL 5C0IB 4LSTL 3U36B 2CKNA 1QFWI 5L2KD 1QD0A 4FFWD 3RWFB 2JELH 1I1AA 4PJAF 4YR6B 1IGYA 3OB0K 3MLXL 4PRPB 1PSKL 1BQSA 1H3PL 1MH5A 2EDTA 2Y5EA 2KL6A 2KDGA 1XGQB 2R4SH 4XNXL 4LDOB 3HE6C 4YDJA 1I8IA 4ZUSA 1NGZA 1YN7B 1LHZA 4G8FB 4WI4A 1CGTA 4RRPA 4W68A 1YYMH 2BCKA 2VXSH 1OQXA 5L7XH 3UYRL 3LKOA 3DPBA 3RVWD 1AY1L 1OGAE 1WICA 1BFOB 2HTKD 3G6AA 1V7NL 4Q9RH 5I1HL 4Z77B 3HUJE 5K9QI 3E2HC 4ODHL 4I0PC 1LO2L 4PBVC 1YEKL 5KAQG 3LS4L 1LP9B 2HRPH 3V0VB 1RZIA 3DMMC 5JR1H 1X6LA 1DBKL 4DKEH 2NX5B 1UWEH 2BNRE 4WDIA 5EC1A 4YAQB 4H20H 4KZDL 5ITBL 3G08B 4GRWH 1A14H 3BESR 4MNHA 4WY7L 5MI0C 3NA4A 4PRHA 4O9HL 5KOMC 5GRWA 3ARGB 4GAYA 5SWSA 3SE3C 4OLYH 3GSNH 4I5BB 1Q8MA 3O4OC 5I17B 4MCYA 3GI8L 2CDFA 3CSBA 3EO9L 4NRZA 3QFJA 2Z8RA 3CZFA 1RUPL 2NY6C 5GRZA 3L3JA 4LDEB 2CUMA 5C0RH 1FRGL 4HCRH 3QJHA 1PZ5B 4LSUL 3QPQD 1PLGH 1Y6KR 4XX1E 1LEKA 2ZNWA 1XGRB 4BK5A 5JOFA 4U6YB 3LQZB 3HC4L 1MFDH 1XF2A 5FYJL 3I50L 3BP6A 3MLWH 3L7EA 4DEPB 4ZO9A 4BQ9A 4JRYB 4HK0A 6FABL 3F6IA 3AREA 2CPCA 4QRSA 2FJFB 2JTDA 4ODUB 1FIGL 3O6KH 4ZS7L 3RIAF 5DD0H 4ONOA 4XZUA 4XNZB 1MAJA 3GSQB 1MRDL 3BKJL 4OT1H 2FL5B 5DRZB 4NWTL 3CU1A 1TIUA 4OV6F 1N6QH 5I15L 3WSQL 3ZDXE 4GBXD 3JV6B 3RWJA 2XZAH 2VDRL 3D87B 5MEQB 3WFBH 5E99H 1DQJA 5F8RC 4NHUB 2V9RA 4P3DA 3FQUA 1CD8A 4QXTB 3NZHL 4W81A 4F8TA 5L88L 2VYRE 5F70A 1RIHH 4UDTA 5DJCA 2R8SL 2V2WB 3ARZA 5KSAB 2NCMA 4KAQH 4WTZG 3W9EB 3TN0A 2NLJB 3L3IA 3BDYH 2DYPD 3ILQC 4ONGH 2JJWA 4OZFA 1MFBL 5T1MB 3BT2H 2OZ4H 4MJIA 4QXUL 4XMKL 5D1ZD 1OW0C 2Z31C 3UPRB 3QUZD 2XZZA 1QFUL 2YXMA 1LK2B 2HH0H 1JZ4A 3FO2A 5EIVA 1NLBH 3ZHDA 5FGCE 4FQQA 5JLZA 3CSGA 3O4LA 4Z7UA 1YNTA 4HDIB 3KPRD 4U6VL 1MIML 2K7PA 5HHOB 1NMAL 4F37F 5HHOD 4DUXA 1I3GL 1IAIM 2FATL 1M7DB 3RTQD 4ZQKB 1ZE3C 2VMFA 1T21B 2FHFA 2MCG1 3QUYB 2UUDH 2C5DC 2EZ0D 3UYOD 1NEZG 2GQHA 3VXTA 1PX3A 3BSZL 4P5TB 3TPUB 3VGGA 5I1AA 2JJSA 4P5TD 1ZVSA 2DQHL 1T6WA 5IMLB 1KB5L 1KGCD 4NWUL 5DD5L 5JHDB 1VENA 4HFUH 1L0XA 4PJIF 4OCNC 5D9SA 2VRAA 4GRLB 1XF3A 2IH1A 1JGLL 4HC1A 4EXPX 1VSCA 2QQKH 3S34H 5JW3L 4XPGH 2XZCH 3O9WB 3B9KB 3B9KD 2ZUQC 5TQ2H 2F9BT 4K7FB 2O5YL 4UT9L 3V0WL 1WBYB 3QNXA 1N3NB 4OAWB 5F7FA 1NLDL 2X70A 2HVKB 3MR9A 2D4FA 5DRWB 1LE5A 3BDXA 3BPNC 3MRGA 3CXDL 5J9PB 4WEMB 5TGBA 1YY8B 1T1WA 1GAFH 2GK0A 3V9FA 1F4YH 5C0GA 3MQIA 4PYHA 1T0MB 4M7ZC 1FCGA 5D72H 5HYJD 4FZEL 5I71B 3I75A 3BN9C 3D9AH 2XA8L 5CGYD 1ZSDA 5DT1H 3D2UB 4ZNEA 2E5EA 3GRWH 3ARFA 2B4CC 1MCNA 2R9HC 4M7KH 1IQWH 4MAYB 4PRBA 5DJXA 3OTTA 1LO5A 3SDDC 5T33L 2AP2A 2NY3B 3PV6B 3OKKB 4PRDA 3S37H 4L8CA 2A2QT 4I18B 3DX7B 1XGPB 3T0BA 3VGBA 1N2RB 1QQDB 2RB8A 5AAWA 4HH9B 2X05A 1XF4A 4L3EB 3VXPB 4D0BB 3RGVC 2BXZA 5GGRB 3SCMA 2Z92B 4JFOB 3B2VH 1I85C 4MX7A 2LE9A 3QB7C 1TQBC 3ZHKA 4PGCA 5T5FH 3ZKSD 3D85D 3VMPA 4M3KB 4E9LA 3FQWB 2ERJB 4AENB 1ZOXA 3ZKMD 1H8NA 4ODXB 4UT6H 2DICA 3W0WD 5IKCB 3MGAA 5HJ3A 1RJZA 1I1CA 1RJYA 3S98A 2R0WH 4MXVE 1A6TA 3ALXA 5EU6B 4Y4HA 1MCPL 1WZ1H 4U1SB 1NFIA 3PWUB 5D6CB 2EDOA 3K2UL 4LMQI 4DOHB 3GKWH 2QR0B 4WTZA 1YEGH 1FYTD 4B41A 5D2LA 1CFSB 5JW5B 4WHTA 5KN5B 4S2SA 1XGTB 1MCHA 4JM2D 4XVTH 4NO0A 2ADGA 2PO6C 4J4PD 5GS0C 1EO7A 4XP1H 1N4XH 3VGEA 5IOPA 2AK4A 2F15A 3AXLB 1S7WA 1T5WB 2YWZA 2Z8SA 3SDXF 3TH4T 1DBBL 1E4WL 2I9LA 4F7TA 4MA1B 4QXGH 2CLRB 1SMOA 3FHQA 3OKDA 4KRLB 5C1MB 3CCHA 4J12A 1WC7B 3VD4A 1DEEB 2OTWA 4NQDB 5KSVB 3S35H 1JN6B 3N50A 5FYJD 4HWUA 4NJAL 3DIFB 1UM6H 1I8LC 2F5AH 4OM1H 2V17H 2ZCHH 4XPBH 2X4OA 3O3BB 1NEZA 1SEQL 1S7RB 3WFHA 1UCTA 3U46B 4BFIA 5DK0A 1JYWA 1RJLA 5KVGH 4C56E 2VXUH 3EJJX 3W11D 1EPFA 2IQAB 4HKZA 4Z7OF 2OL3B 5DJ6B 5AUMA 5BVJA 5FB8B 3C08L 4HWEL 4IMLB 3FAXA 1BVKA 5FFLA 5I73C 25C8L 3V2AR 4Y5XA 4PJXE 1P6FA 4U6XB 3F7PC 1NL0L 4OIIH 3FN3A 3EDKA 3RUGE 5L8KB 3HE7B 3STBA 3TYGH 4OQTL 3FT4B 2DAVA 1Q9LB 4PGEB 4ZTPH 1AR2A 4HT1H 1BAFL 5F7KC 4LRIA 3MV9A 4HGKC 1MY5A 3RP1A 4L29A 5CGTA 4YUEL 4OF5A 1DJSA 3U9PH 2X9XA 2DQFB 4LBEB 3K8LA 2FJHA 4KDTC 3SQOL 5DWUL 5KANI 3WCYA 1JPTH 1JF5A 4OGAD 4PJ9A 9CGTA 4LCCC 1OL0A 43CAA 4ISVB 4M93C 4G8IA 4QTHA 1JE6A 1MNUH 3P9LB 3NCMA 4FG6D 1IM9B 4TSBH 2GCYB 3C60A 4X4MA 3OJVC 2CDEB 2YSSB 1OAZH 1DLFL 4Z7WB 3EYSH 5IFAL 2GJZA 4KK8D 1ED3B 2M2DA 1FV1A 4P3CH 5DRNB 3TT1L 3ZMRA 4RDQF 4YJZL 2PR4L 4NRXB 2YD2A 3TT3H 2D7MA 2R2BB 4F57H 4X6FA 1X5FA 3GHBL 4YGVA 3HNVH 1BM3L 3I84A 1H0DA 1N0LA 5IEHB 1CYGA 1UACL 4QRPE 1REIA 4OBSA 4KV5F 1SVZA 1KCLA 3ORJA 2P5EB 5KZCD 1NUNB 4PJHA 1R3IH 1NC4D 3Q6GL 4JHBA 4BUGA 5KS9F 5LXGH 3O2DL 5ICXB 1D9KA 4HAFA 2NY7L 4KK5C 1FORH 4LAQL 1XR8B 1BJ8A 1FFNA 4R0LC 1EHLL 5F9OH 3IJHA 4N1EA 5JMRA 5LGHH 1VPOH 3P0YL 3ET9F 4NKMA 3S37X 3T0AA 4Y19B 4UOW1 4MA7H 1U3HB 4Z7VB 1YEJL 4YPGA 1U58A 4F7CB 1BEYL 5GXBB 3WDIA 2BSRA 3E6FA 3VGDA 2X4UA 5C0DB 4LLYA 1YEFH 2JCCA 4PB9L 4UTAH 3VXUA 1A6UH 4QRRA 3DVNB 1HIMH 1Q9WB 2IBZY 1KENL 4I4WB 5HDLA 5JUEL 5F7HA 1QHOA 4JFDE 1UYWH 3L3HB 4ZO6A 4XXDB 3L7FB 1F3DJ 4NKQB 4TUKH 4PD4J 1OTUD 3ZDZF 3O41B 4PV8B 3SDAB 1IGTA 2PUQT 4N0FA 4FQXD 1QLEH 1HQ4B 5DJYB 1F2XK 5ID0A 1NFDF 3RPKA 1KIQA 4NZJA 4HJ0C 3D0LB 4OUOA 3TO4C 3CVHH 5ISZB 3SKNB 5FM4A 5EZLA 3WYRA 3LRSA 2VWEE 4WU5A 1Q94B 3GFUA 5C0AB 4KJPC 5C0AD 3MA7A 4HIEA 3KWWB 5EZJA 3A6BH 5LKNA 2WBJD 3DNKA 4D0CA 2ITCB 5TF1L 1UQSB 1ONQA 4XAKE 4A6YA 5I18H 1A21A 4KGLA 3FONB 1ZHKB 2GSIB 1GGBH 3QO0A 3R8QA 2DIBA 1U8QA 1MEXL 3S35X 3ZKND 3QDGD 5IWLA 4J23A 1MQ8A 1H3XA 5C0BA 3PNWA 3DTXB 3MRLB 5FUOH 1GHFL 3NCCB 4N0UE 4XCNB 3REWA 3OJMB 1YDPB 3BP4A 1Y6NR 1DANT 4IEFB 4X7TB 4K2UL 5FYKH 2VDKH 5GGQL 4G8EA 4MSWA 1FNSH 5GISL 1DDHA 4GAGH 5EIQA 4WW1B 1E6OL 5L0QB 4U1NA 4AJ0A 2GTWB 1DE4B 2GTZB 4JR9H 1FVDA 2BNUB 4HFWA 1KPRB 4X7EC 4NQCB 3O45A 7CGTA 4OSUH 4V2BA 2IMMA 3L3OB 1DQLL 5AYUL 4NDMB 3QAZC 3SKOB 4U1HA 1Z6JT 4MJ5B 4NFDA 1EFXA 3FFCB 1SVCP 4P23B 1RAMA 2DTMH 3FCTA 4ORZC 1EH9A 1P9MA 1AJ7L 4BKLA 5I2IA 2ZUUA 2QQLL 5C7XL 1IAKB 2J6EH 5ALBH 3FOMB 2DLTA 1ZT4A 3ECBB 4ZFZB 4KJQC 3H9HA 2AJ3A 3PJSB 5EBLA 3V4UH 4E41E 4KUZL 5I6XC 1E0OB 3PP3K 1SMAA 1EZVX 3ARSA 5GGVY 1UB5A 1G9NH 3CFEB 3FN9A 3P4MB 2AGJH 5F7NC 3MNWA 3TJHC 4LF3A 4R26L 3QUMH 5GS1B 1U8OB 3BZEB 3QIUA 4QY8A 4S1DD 4LHUG 3CU7A 2N56A 3TN0C 1T04A 4YBLB 5F89B 1JNLL 4OLUH 4XNQB 5LVEA 1IZKA 1AXTH 3IDIB 3WN5C 4JGUA 4U31A 4HPYL 1MREL 4KHTH 2M26A 5DF0A 4Y4FB 3CLFH 3MLSL 4R3SA 1JGVH 2PTUA 5C07A 1F3JA 3F12B 4M8QA 4O2EB 5CUSL 4NM8H 1NCWL 2B4CL 5ACMA 3UJIL 1R3KA 1GC1C 2A77H 4XC3H 3K8MA 2OJZH 2YD1A 3H2WA 3MRMB 1MWAH 3VFOA 2HT2C 1WBZB 1QNZL 3MMEB 3BO8A 3ILPB 3TJEL 1QRNE 4WJ5B 2DM4A 4F9LA 4TVPL 4ELMF 1IE5A 5FKPB 3PQYA 3IGAB 3PGCB 4PTUA 1ITCA 1EEZA 4GXUN 4FA8A 4XBGB 3ROLB 1YQVL 4JDZB 1VKXB 2AJZA 4YHNB 1CFTA 1MI5A 4G9FA 4O2CB 4I0PD 4N9OB 5CIPB 1JHKH 5DD3L 3EOAA 3QQ3A 5F7EH 3DMMD 1SY6L 2F54E 1D5BA 5FHBH 3BPLC 3VRLF 1JWUA 2F53A 2Q3AA 1A3LH 2D9QB 4MVBC 3TVMC 4WUUB 8FABB 4QHNA 5HYEA 3FB5B 4F33A 3WLBB 3O3DA 2UZIL 3HC3H 1FIEA 5HHME 4G6JH 4WFHD 3CDGB 4M6AA 3THML 1SYVB 5K9KB 4PJ8D 5MERA 4ELKB 1AQKL 5GS0L 3QI9A 1RMFL 4MS8D 3G04A 2MOVA 4LLQA 1M7IB 3PWVA 3KG5A 2NY6D 2G75A 3P40A 4QWWC 1NSNH 1J5OL 2H6PB 3O2WH 5BS0B 3OZ9H 3NIDE 5D7IE 1IZJA 1G6RA 2OP4L 3RWIB 2HFTA 4HZLA 4I9WE 2XY2A 3GBMH 5TF0A 5CD5C 3VRIB 3TC9A 4Y16B 4W6XB 3GJFB 1FO0H 5DHVB 1HYSC 5F9AC 4YX2H 2R2HA 4P59H 5IM7A 1XH3B 1SYSA 1BZ9A 2FX8L 3SN6N 3CFCL 1G7QB 2ZJSH 4UV4H 5GGUB 2MNUA 5E4EB 5HVGB 1RULH 4WTXA 4ZXBD 5C08D 3GMOA 1RD6A 3WKNA 3SJVE 3DRQA 5C0JA 3CXHJ 3CVHA 4PJEE 4CBPA 5J56B 1U92B 1CR9H 3BHBA 5IHZA 1FBIH 1BOYA 2IFGA 3ARPA 2FCBA 4GMTL 1B0WA 4QHMB 4RBPH 1UWGL 4OZ4A 1D6VH 2PW1B 3SEPA 3MOBH 1OARL 1JPSH 2VZ3A 4U33A 3QRGH 1ODAA 2AXGA 5DVLA 4LP4A 5KJRH 3HLAB 4AT6A 5BRZE 4FQHB 3RY6A 1FVCA 4Z7NE 1ZLVH 3L6FA 4YDVB 1N5AB 1AGCB 2J8UA 4Y4HC 4QYOB 4OGXH 4U1IB 1M6OA 3ABZA 1A47A 1YEIH 4L4VA 5CEZH 3MV8D 3LKRA 2P5WE 1T7VA 4LHUA 3RU8H 3HZYB 2DB8A 2WIIB 4F3FA 1WGOA 2BOBA 2EC8A 5EU4B 3TF7C 4OIAA 1X7QA 3ZKXB 4L8DA 2DI7A 1IGIL 4H0HB 5EPMB 4JQIL 4PJGE 5F7WC 3QDHA 4EUPG 2ADIB 5FECA 1MHHA 3C2AH 5T3ZL 1BP3B 2BNQB 3H9YA 3RDTB 5EU5B 1ZVHA 4G9DA 2B0SH 5DSCA 2FRGP 5C0CE 1NGYB 1A7QL 3HMXL 4IRSB 4EOWL 4MQSB 4IRSD 2LTQC 5DURB 1P5UA 1FNHA 3GNML 3MV7E 3QDJA 3MRFB 4NZTH 2OK0H 5DJ0B 3SE4C 4HWZB 2PTVA 2FD6L 3UP1A 3L9RA 1X6NA 2FLBT 4Y89A 2NNAB 4XP6L 2J6EA 4XPTH 2VLRB 1CN4A 1DBJH 1MCBA 4G8GB 4G8GD 2CLZA 1V5JA 3U7YH 3G9AB 2V5MA 3T08A 1QACA 4GMSL 3WFDL 2WM0A 4FABL 3B4NA 1UM5H 2JK5B 5KG9B 2J3SA 3GUTA 2V2XA 4HX1B 5GS2D 5FCUL 3FQRB 3RNQA 2VSDA 3TBWB 4PJ5D 1QSFB 4JAMA 1JNJA 2DQGL 1QSFD 3HFML 3QUMA 3IFPB 2AVGA 4UIMB 4QHLA 1CVRA 2X7LB 1K3ZA 2PXYD 3QCTH 1ZMYA 5C2BL 4Y5XC 3RVTC 1YYLH 4OF3A 4OZHA 4YNYB 4DGIH 1V8HA 4PG9B 3B8SA 4NKOA 4JG0L 4KROC 4HUVA 1FG9C 2EDNA 3FO1A 3SGJC 2X4PA 1CF8H 5IW1B 4EIGB 4NQTA 1JNHA 1XIWD 1ND0B 3RL2B 3DUSB 3FB7A 3WIFB 2V2TA 2O93L 3KPPA 5IVXA 2XTLA 1C8PA 1ZLWK 5IB3B 3J7HA 4PRID 4GW5B 3O3UN 3I3EA 1MWAA 1V3LA 3QIBC 5AWNL 3FO0H 5TH2A 4ENED 4K8RL 4MXQC 3SDCA 1E4XH 3C09C 1MJ8H 1CE1H 4PJBA 2JB6B 5DEFB 2R9HD 3A67L 4F15C 3UROR 1DVFC 2D7TH 2A1WL 4FTVE 2O5ZL 4U2YA 4AZ8A 3DURB 1HOCB 4QF1A 3UTSE 3QT2A 1FFRA 2K9UA 2CMRL 3ZTJG 1GCFA 3VA6A 4Y5YB 5I9QB 3LQAL 3X13A 3ES6A 4OM0L 3FRUB 3GSUA 1FL6B 4E5XB 3BH9B 4LPCA 4QCIB 5ALCL 1NANH 1YC7A 5CZXD 1EBPA 4GQPH 3IDGA 1TVBB 1NCAH 4TVPD 2P7TA 2YHGA 32C2B 3MJGX 4RZCA 3D39E 3AS2A 1BPVA 1ZHBA 2XNAB 1KCSL 1UZ6E 1A5FH 3L3KB 2ESVE 2XWTA 5H94A 2R4RH 3GI9H 5D1QD 2ZKHL 3MZGB 1CLZH 1FAIL 1FZJA 3KXFB 1D9KC 3V95A 2VLKD 4P2RB 4UILH 4YLQT 1JWMB 4UNVA 5DQDL 3WXVL 4U1LA 1ZGLA 3GMMB 2IPKA 2C1OB 1QR1B 3HRPA 5CSGA 3RZCB 3QH3B 4C83A 4R2GB 5DDHB 3RZCD 3QSKB 3SKJL 3UJJL 4G7YH 4NQED 3BN3B 1RI8A 1UWXK 3ZDXF 1JTOA 3ZT6A 3MBEA 5GS0D 1CFQB 2VDLH 1HXMB 4EUPA 4AH2B 4XWOD 4HPOH 1PKQB 5BMFH 4JREC 1RZKC 1I7ZA 1W8OA 1CDHA 4LLVA 4RMTA 1FO0A 4JFEB 5SWQB 1TJIH 5BV7H 4JFED 4PLNC 2Q20A 4N68A 1F4AA 3UCRA 1TQCC 1KCVH 1CDIA 2IANB 1GIGL 4JO4L 2IAND 3RX7A 2EC9T 3S3PA 1G7JA 5IGXH 4N5EC 4XMLL 5C9JB 4XNUL 4YC2B 5CHNB 5LCVL 1S7VB 2CSPA 3EZJB 1KCKA 2EKSA 4P46D 3T2OA 1XF1A 3T04D 3U48A 3GIZL 1AKJB 1JZ7A 5DJZB 1QSVA 4Y4KC 4Z5RA 3KPMA 4H8WC 2GSGB 2W60B 4Q2ZA 3NFNA 5D7LD 1E4JA 3VXSB 3PP4H 1AGDA 5CJQH 3BEWB 1ZT1B 5KAQF 1YN6B 3PDOB 5F93C 4NN5B 4MMZC 4XWGL 3GB7B 3PDGA 3IDXL 3UTTD 3EYQD 3DJ9A 4IOFD 1TJGL 4WWKC 4D9RD 5FF6A 3OXRA 3S36H 5HGHB 1N6UA 4PY7B 2B5IC 2EH8H 2HFGH 4PJ7A 1P1ZA 4YWGL 3X3FH 4JVWA 1J12A 3OX8B 1ZWIA 4R8WH 1KTLB 3KPSB 3V6ZA 4YXKL 4YDKL 3KPSD 4X6BA 4NBZB 5F7YC 5IWLC 5E6IA 3KS0H 2NY5C 4ACPA 1T0PB 1K2DA 3VFGH 1U8KA 1BD2A 2EIZA 3AB0B 5GRVK 3WUZA 3IDJA 1IJ9A 4I3GA 2XA3A 4NOFA 1JF1B 1GC1L 5FV1L 3SY0B 2FYYA 1Z9LA 4D9QE 5JMOC 3AROA 1A1NB 2P8LA 4J7RA 5T3ZD 2R0ZL 1HHIA 3K0WA 1CT8B 2R1YA 4R90L 4I2XB 5C09E 1S7SB 4XVJH 1E6JH 1NBYB 4NUGL 1KIUA 4PB0L 2LABA 2X4TB 1OAYL 3CMOL 4MAUL 1U8JB 2A9ML 5KSBB 3SOBL 3QXAA 2H1PH 5F3HB 3P4NA 3DECA 4HHAB 4O5LL 3MFGB 4P2QB 3GGWA 3C6LC 4UTBH 3H9SE 2NXZC 4ZO8A 1B6UA 1E27B 3MLVH 3O8XC 1H9VA 5LBSL 1BQUA 4WENB 2Y06L 2XXMB 3WFCL 4X6CB 5D7JB 5DVNA 4HS3A 2RHEA 3RNKA 2DQIH 4HC1L 4IOIB 1QFWM 5FCSH 2A83B 5HD8D 3OGCB 1K6QH 3SKMB 2DQCH 2ARJQ 4LQFH 2VISB 4KKAC 4RX4A 5JHLL 2DLHA 2VLJE 2YPLB 3TYFB 5I8CB 1TPXB 4BSWB 3BGFC 5F1NA 3BRDA 1A6WL 4P4KB 1MFCL 1P6AB 3KYNB 4KK5D 4H1LB 4RMQA 3RWGB 2IH3A 3F5WB 4KXZH 1T2JA 3AU1B 4OJFL 1A6PA 2XWBA 4MYWB 3B3IB 1ROWA 5GGSY 4HKJA 4TSAL 5IFHH 5E9DA 3OAYK 1FYHB 2WQ8A 4RMSA 1KUMA 4G42B 3TLRA 4I3SH 5GZND 1F90H 3HC0A 5DR5H 4G43A 1KXQE 1YMHB 2BSSA 2DQDH 3MBXL 4IRJA 4NO2B 5I1GH 3FTGB 1MFEH 3M17A 1ZHLA 3B6SB 3GMRA 1IKFL 1AD9A 3QZWG 1UJ3C 2VXTH 3NPZB 4N0CC 1I1AB 4MJ2A 2BVQB 3MCG1 1I1AD 3MROA 4JFQB 4MXVF 3B5HA 1YYML 1U95B 1G9MC 2R56H 4KTYA 4K8RD 2VXVH 4ZUSB 1CFVH 3BMVA 5DQ9A 1RZ7H 4GUPA 1MJ7L 1LILA 1BLNB 1ORSA 2RAMA 3MXVH 4JFPA 4MB5A 1T1ZB 2DQUL 4P5MA 4Q9RL 4V1DA 3RZWA 4F9LC 2VN7A 2HRPL 4JZJA 2Q6WA 1J10A 1EJ6A 3F58H 1LD9A 2CRYA 5JR1L 2I25N 2Q7NA 2CLVB 1ZV5A 4KVNL 4NM4H 4GG6E 4DKEL 2KPNA 4JHAL 3W82A 1GZPB 3G6AB 4HJ0D 4I8DA 5JQHC 1S9WA 1D5MB 5E2VH 3RWCB 1ULVA 4KJPD 1RZIB 1RIVH 5FYKU 3JVGA 2JIXA 5EZOH 2Y7QB 2IQ9H 4JCLA 4H88L 1HDMB 2CJUL 5J6GB 1YMMB 3MRBB 3JTTA 2CUIA 4PRHD 5SWSB 1H5BA 3PWPB 5SWSD 3OXSA 3K80A 3MNVA 4ZTOH 1PLGL 2DM7A 5D1XA 4MCYB 4D8PA 5H35A 2VSCA 5I1EH 3X11A 2GITA 3QFJD 3SHSA 4BH8A 4YIQA 3L3JB 4PD4K 5H37G 2HFFA 5L6YH 4JB9L 3WJJA 4S1QL 3QJHB 4Z0BH 1S7QA 4ALAH 5I1LA 1JRHH 1LEKB 3MLWL 1U3YA 1FNEB 3PABA 4NNYB 1DZBA 1FPTH 5EUOE 1MHPH 1AP2B 1T22B 1NGPL 4RA3A 4UUJB 1B3JA 1PY4A 4EBQL 4PYGA 3C6SA 4GO6B 3O6KL 1QO3A 3BP6B 1BQLL 4HK0B 5LJYH 3HG1E 3ARED 4OF7A 4PJXF 3GSOB 4JY4B 3C5SB 5IG7B 1N6QL 2YD5A 3GJEA 1N64H 4M1GH 3P4OA 5E4IA 3BP5A 2XZAL 3HS0A 4KFZC 3WFBL 2EDFA 4L4TE 4XPFL 1EUTA 1T1YA 3DO7A 4NRYB 5TQ0H 5AZEH 1A2YB 3RL1B 4QT5A 5KVEL 1CDBA 1RIHL 2H8PB 5FGRA 4JFYB 4P3DB 4X9FA 1WWWX 1GGCL 2FHBA 3OF6A 5DQJB 3PV7A 4PJHF 1JIBA 1CE6A 2B8OT 4OLEA 3BWAA 3BZFB 3KDMB 2CRZA 5I1KH 3RWEB 3TJHD 4FXGB 2QLVB 3BIKB 2RFXB 3BT2L 1NGWA 5C0FB 3OKNA 5DJCB 4JFFE 4HH8A 2AJVL 5DFVD 4ETQB 1ITBB 2HH0L 3TN0D 5ENWB 5SX5K 4X5WA 3AMKA 1NLBL 2NXYC 3BQUC 3AS1A 2IAMB 4JFZL 5HDQL 2MSPA 3U0WL 2OTPA 4MJID 1WCBA 3TIEA 4S1RH 1PD6A 2FB4H 1ACYL 5DZNA 4I77H 3HI5L 5TJWK 5GS3A 4BFBD 2MPAH 3QZWA 2EIDA 5JPNA 3AS0A 3O3AB 4Z7UB 3O4LD 5I66B 4LKXA 2GJJA 3KPQA 3P9MB 4G6AC 3H3PH 1R0AH 1EK3A 1TZGL 1FZMA 1EJOL 2K7QA 3OKMA 1HE7A 1A9EB 1J0JA 3T2PA 4DZBA 1WWBX 3T65B 4PJFE 2EECA 3TBTA 3HAEB 4NHCH 4S10A 3QXTA 4P9MH 4HFUL 3OAZH 5E03A 5HI3D 2Y72A 3G5ZB 2DWEB 2EXWC 2XQYK 2QQKL 3S34L 2Z4QA 3VXRA 1F11B 4HS8H 4XPGL 2XZCL 2WINA 2BHYA 5EU3B 4YHPB 3QP3A 4P4RB 3VXME 1U8NB 1AIFA 4HUXA 1OTSC 3CDYA 5D6DA 3GBNH 2A9NL 3ROOB 1M71B 3IVKA 1QLFA 3RHWK 4MVBD 1MF2H 1KTKE 2QADC 1CIUA 4LCWA 2DLIA 12E8H 3TNNA 1EEQA 3QWQB 1MCQA 1ZA6B 4EI5B 4KKBD 2BVYA 4FFZL 2NY1B 4RGOL 4RCAA 4HMEA 4Y2DA 3KJ4B 5D72L 1C16A 3G5VA 2BFVL 5TGBB 2R1WB 2GK0B 4KVCH 2ATKB 2H9GA 2B7DT 1FHGA 5DT1L 5HHQA 4IDLA 4M7KL 4QGTA 3W5MA 1IQWL 3VCLB 4JPKH 3IT8D 3W2DH 5IB5A 1SJEB 4FQPA 3VI3F 2ZUSA 5CD5D 1C5CH 4N9GA 1QFHA 3SDCC 3VWKA 3OKEA 4P48A 3ARFD 4K55A 1L9MA 4IOSD 4LGRB 2DI9A 1CICA 2NQCA 4ZPTA 1P69B 4AIZB 4PRDB 4DCQA 1HILA 1R5IA 4HIHA 4HK3J 5SWZA 3VWJB 3NAAL 3B2VL 4H8WL 4R4ND 5T5FL 1CLOH 1G7MB 2ZWLT 1XF4B 1RHFA 3V52H 1SEBA 2DKUA 3KPNB 4UT6L 3NBNA 3D0VB 4QRTA 3SCMD 3VXNA 1U91B 4YDIH 3RJQB 5DVMA 3MGTA 1A3QA 4KY1H 4MX7B 3S7GA 4A6YL 3JV4B 4ZPVA 4MD5A 2R0WL 2OSLB 3TA3B 3T0EA 1WZ1L 5DHYB 1UCBL 4GRWB 4WFEE 1ZK9A 3T4AA 3PGDB 4APQC 3N1MC 4GKZA 5ADOH 4NP4H 3QEQB 3ULVE 1NAKH 1BF2A 3CC5A 3JBG7 4Y4HD 1GL4B 3GSNB 2NY5L 3QDAA 1CQYA 4LVOB 4X5LA 3OAUH 5JOPD 3S88H 3PL6C 4X80H 2X1OA 3WS3B 1CD1A 1N4XL 5D2LB 4NNXA 4X8JB 4U6HB 2M1KA 4IS6A 5L2KE 3SGDH 5HGDA 4BSJA 1UKSA 3KAAA 4QXGL 3RWHA 4NO0D 3MBEC 1XR9A 1BVLB 4CU7A 3WNMA 5DFTA 4BH7B 3B2UD 3CXHK 4NZUL 2AK4D 3M8OH 3MC0A 4F7TB 1DQQA 1CDYA 3PGFH 1ZEAH 2C3HA 3HB3D 5D2NE 3BKML 3MCKB 1J1OH 3I9GH 4XPHH 5I1DB 1A7RH 3GMQA 2F5AL 4ZAKC 3VFNA 2V17L 5DS8B 2YRPA 3BZ4B 4OD1H 4RAUA 4XRCA 1I1YB 4WV1B 2C4FT 2XFXA 2IBBA 2JJTA 4LASL 5GRJH 3T4YB 3HZKA 1I9JL 5C0IA 2Q7YA 2LU3A 1PZUB 3U36A 3E8UH 1DSFH 4YHKH 3RWFA 2KKQA 1KTRL 2VXUL 1XCTA 1V3JA 3MTRA 1PGRB 4YR6A 2NW2A 4PRPA 2IWGA 3BXNB 2LQRA 4YHIB 1JFQH 1CLYL 1XGQA 3E0GA 3LKPB 1RJLB 1YN7A 3KYMB 4G8FA 4HKZB 4CVWA 3QCVH 1HKLH 3ZYJA 2XTJB 5FK9B 1Q9OA 5FO7B 4TUJB 2E7LA 3SBWC 3KGRA 1BFOA 5D5ME 4YPJA 3RVTD 5BOZG 4HT1L 5E6IC 5JXAH 1T80A 1JGDB 1LP9A 4JDVA 3U9PL 4KROD 1KF9B 4WW2B 2VABA 2NX5A 2BERA 2W9DH 3AM8A 4UBDC 4XGZA 4YAQA 1BGXH 1JPTL 3T2NH 5A2FA 3MV9D 4L29B 4WHCA 5IMOB 4UAOC 3L5JA 5L8JB 1MNUL 4LRNH 3ARGA 4TSBL 5IEKB 4UOJA 1WT5C 4I5BA 1NKOA 1IILE 4PJ9B 3EYSL 5I17A 2XQYG 4PJ9D 4P3CL 3AY4A 4HKBB 2OX5A 2E3VA 4F57L 4P3WA 5IT2H 3C60D 4U1GC 2RIKA 4PJIB 1PZ5A 3FZUC 4WO4B 2BRRL 1XGRA 1FV1B 4U6YA 2EDXA 3LQZA 3BP7A 5JIKA 5TE6H 4BQBA 3NIDF 1R3IL 1LO4H 4YFDB 4KKLD 1J0HA 4UOW0 5ICYB 4JRYA 4NOBA 1KJVB 1I3RA 3IDUA 1FORL 1IFHH 2FJFA 3BI9X 3BRFA 4ODUA 3MLTB 3V6FB 5F9OL 4LSVH 4Q6IB 3ZO0A 4JPWL 1RURH 3GSQA 2J8UF 1LEIA 1D9KD 2ADJB 2FL5A 3MUZ1 5DRZA 5I1IH 4MB4A 3BD5A 2F74B 4K3JH 4K9EH 4IM8A 4YDLB 3JV6A 1QFOA 4J3UA 5E1HB 5MEQA 4NHUA 1YEFL 2NY0B 5F7DB 1OP3K 1C1EL 4QXTA 1A6UL 4NN6C 4MD4B 1G6RL 1HIML 4YPGB 3KPRE 2NY2D 4IRJC 1VEMA 3IB4A 5HHOE 5ETUA 2ORBH 1FL5A 5JPMA 1BJ1H 2Y07L 3DV6B 5BVPH 2JCCB 4J3OC 3VXUD 2QHRH 5KSAA 2DJ4A 4QRRD 3W9EA 2VN4A 2NLJA 3CFKA 4OZIE 5MHSD 1QLEL 1FC2D 4KKCC 5DJAA 5T1MA 3ETBF 1IKNA 3I6KA 4OZGE 2WBKA 4YE4H 3I02A 1J18A 3K4AA 3CVHL 2VQ1B 3NCYP 1WVZA 3RVVC 1PYWB 1GGYA 1KGCE 1NC2B 5GRUH 3NFSH 4HK3N 4IJ3C 4PJGF 2E8YA 3EYVB 4HDIA 1OAKL 4XVUD 1GGBL 4WU5B 3MA7B 1M7DA 4DAGH 4RFNB 3WHE1 2QJDA 1SQ2N 3V4VH 4L3AA 1ONQB 4DN4L 1NBVL 5DUMH 2CR3A 4IMKC 4EEEA 4GG8B 5INDB 5EB9A 3QUYA 3Q48A 4OD3L 1F4WH 3QO0B 2CO7B 2ZCLH 3LHPH 1U8QB 4WI6A 2XYCA 3TPUA 5FUOL 2FJGB 4KPHL 4OZHF 4F7EB 1MCOH 4XMPL 2ADFH 4OLVH 1OHQA 2Z8WC 4LHQB 4MZ3A 5FYKL 5HYJE 5A3IC 5JHDA 1E4XI 3PHOA 5C0BD 4OFKA 3JUYA 1FNSL 5KW9H 3HE6B 4GRLA 4GAGL 1QR4A 4X9IA 3WJJC 5IVXF 3O9WA 4YO0B 4N0YH 5IK3B 1P4LA 4K7FA 2OMNA 2XRAH 1NANI 1WBYA 5CINL 1OGTB 1N3NA 4JY6B 3PF2A 4PJBF 1QPXA 5DRWA 2ZP0T 5EIIB 5F7UA 1H15B 4GLRH 5CCKL 5J9PA 1WTGT 4B50A 1FVDB 3WNKA 3E2HB 3U79A 1A7NH 3NZ8A 1T0MA 3PWNB 5FV2A 2J6EL 5ALBL 4KQ3H 3HPJB 4KHXL 1EFXD 2NXZD 3V4UL 4CVXB 3VJ6B 3O6FA 1TCRB 3W0WE 5MI0B 4ZDHB 3D2UA 1JNNL 1G9NL 2R2CA 4ZUVA 1CG9A 1Q0YL 4FQIH 5CKAA 4LSRH 5HYSB 2A6IB 3JUZA 5C3TA 4MAYA 3QUML 1AFVH 3PV6A 3IXAB 4UZGA 3OKKA 1AQDB 4I18A 4XVSH 3DX7A 1XGPA 3V6OE 3T09A 4O02H 5CSZB 4LLWA 1N2RA 1QQDA 3JWOH 5EC2B 1FYTE 1J8HB 4MCZB 4HH9A 2X2YA 4OLUL 4CNIA 3VXPA 4L3EA 4D0BA 1NBZB 3H0TB 4JZOB 3QIUB 5GGRA 4KHTL 3QIUD 3NTCL 2Z92A 4JFOA 3CLFL 4JVUA 3VFPB 1T04B 4GQ9L 3UBXI 3K1KC 3EFDH 1X3DA 3WIHH 3FQWA 3ZSTA 4AENA 4NM8L 1ZS8A 4ODXA 5IKCA 2A77L 4XC3L 3ZDYE 1VEPA 4PJAE 1MWAL 1MY7A 2AJSH 5C07D 5EU6A 3T3MF 4FXLA 1Z9SA 3PWUA 5D6CA 4Z95L 1R3KB 2ZPKH 2HLFC 4P2OC 3LN9A 3D18B 1QBLH 4LLMA 5FYJE 3BJLA 3Q0HA 2QR0A 5L9DL 1CFSA 5JW5A 4XCEB 5KN5A 3MUGB 3C8HA 1XGTA 5C3LD 1XZ0B 5IROC 3EDDA 2WZPD 1QBML 3LEYL 4GSDL 3UYPA 3AXLA 1JHKL 5HY9B 1T5WA 3C8DA 5F8QC 1IGFH 2AEQL 3PQYD 4PTUB 2CLRA 5ACZB 5FHBL 3BFOA 4ZOCA 1A3LL 4HMCA 4ZUUB 5CS7A 2ZCKL 4G9FB 1DEEA 1MI5D 4G9FD 5KSVA 4NQDA 1S5IH 1JN6A 2EDYA 1E4KC 4G6JL 3U7WH 1D5BB 4Y5VB 3DIFA 4CAGA 3HA0A 2Z31B 2F53D 2AQ2A 3ALWA 4DN3H 1KJ3H 1Q72L 3O3BA 3GJFK 2KZ1B 4EKXA 1S7RA 3BGMB 2R69H 3HI6L 1NSNL 1HH6A 1J1XL 4WFFD 5E5UB 4LSQL 3OZ9L 1FNAA 1PW3A 3TBSB 1RFDH 3QI9B 3LV3B 3I85A 3QI9D 4HF5H 2XQBL 1X5AA 4LLQB 2IQAA 2DDQL 2QSTA 2DQJH 2OL3A 1FO0L 1O0VA 1HZHH 4YX2L 4P59L 1AO7B 1I9EA 3DI2B 1TETH 3FN0H 4IMLA 2BSED 2ZJSL 2FIKB 3CVIL 1B4JH 5J1AB 3VWKC 4BFGA 4ZFGL 3BGAA 1FL3B 4BZ1H 3HE7A 4L5FL 1CR9L 3FT4A 1Q9LA 4PGEA 5FHAL 2RCSL 5AD0A 1KJ2H 2M8XA 1KPVB 3MOBL 3DRQB 4QHKI 3CVHB 2DQFA 4JRXB 5C71A 3HCVB 2AV1B 4LBEA 2UWEB 5HHXH 5B8CC 5KJRL 3IXTB 2Z8VC 4KXZI 4XCCL 3A6CH 2CR6A 5ESAB 4GFTB 4O58H 3QNZA 3SDYH 2XZQH 1P7KB 4ISVA 5DTFB 3T0EC 5ESQB 3BPNB 1IC7L 3F62A 1EEYB 3LPFA 3P9LA 1MCJA 4OGXL 1IM9A 1YEIL 2GCYA 5HHPB 4LSDA 2PCPA 4ODWA 2CDEA 3RU8L 5I1CH 3FT2B 3L6FB 4UB0H 4Z7WA 4M7ZB 1ED3A 2EEDA 5DRNA 3VXOA 2XN9B 1OQOA 4NRXA 4N5UA 5J7CC 1MSPA 2R2BA 3EZ8A 1M6OB 1UEMA 4HEPG 4Z7VE 3P0GB 4L4VD 4TNWK 2NYYC 4LHUD 4JGJA 5IEHA 2NXYD 1QLRB 1X7QB 1RUKL 1CWVA 4NYLB 2R1XB 2APVA 3B5GA 1VGEH 4GOSA 5BOPA 3MRPB 2P5EA 4MNQB 5FYKD 1I7TB 1MUJB 1D5XA 4RGND 1I4FB 4NGHH 1BBDH 2E6PA 3CH1B 2UYLA 5FM5O 3X3GL 3VRJB 4ZOAA 1XR8A 2V5RA 4NZTL 3G6JB 2O26U 1C08B 4XNMB 3RGVB 3ULVC 4G6AD 4OTXL 4Y19A 2NY4C 3V4PH 1U3HA 3AAZB 3QDJD 1DBJL 4GW4B 4F7CA 1EHXA 3TP4A 5DFWH 2EDWA 3U7YL 3L1OH 1KN2L 1GZQB 2BVTA 1KTDB 1Z9OA 2NTFB 5C0DA 1UM5L 5C0AE 2D03H 3DVNA 1TTFA 3MPCA 4B0MM 2ZOKB 4I4WA 4Z9KB 3LN4B 2I07B 1HHKB 3L3HA 5JORB 4AEIH 4XXDA 2D7OA 3L7FA 2V6HA 2XICA 5D2NC 1TITA 3RNQB 4O2FB 3S5LB 1CCZA 4MLIA 3O41A 4PV8A 3SDAA 3QDGE 4DGIL 3T3PE 1HQ4A 5DJYA 1CFNB 4F8QA 2ICEB 5DD1H 4HD9A 2QADD 1MVFA 4Q0XH 1JRHI 4NN7C 2OTUB 2HTKC 3D0LA 3L5IA 3OQ3B 5ISZA 5TE4L 3SKNA 1KCUH 1T5XB 1KIRA 1Q94A 1KT2B 5CD3B 2H26B 3LSOB 3KWWA 4CU8A 3MYZA 4GKNB 3VG9C 4GG6F 4HUVB 4CVUA 2ZUXA 3FO1B 2ITCA 3CLEH 1UQSA 2Q86B 1S9KC 3GO1H 3MACL 1AGFB 1J1PL 1JNHB 4S11A 2XXCB 3FONA 3V0AC 1S3KL 1MJ8L 4OLWH 2GSIA 2V5YA 2ILLA 1GGIL 5DVKA 4K3EL 5I8KH 2I5YH 3TIDB 1YECH 1EMTH 1EV2E 2VR5A 3LEVL 1IAIL 4NFCA 3CX2A 5I8EB 3SDCD 4XC1L 3RKDD 4LVEA 3O3EB 3FFCE 1XCQB 3DTXA 3MRLA 1I9IL 1FNLA 3RVXD 3QYCA 4XCNA 1QFPA 1YDPA 1NCAL 3RWDB 1Q1JH 4DW2L 1P2CB 5DMIH 1DLHB 3WJLA 3QPQC 4GS7B 5MENB 4X7TA 2FR4A 1KLGB 2OR8A 4DQOL 5LWYH 5DJDB 1A5FL 4HIIB 5CFHA 4AIOA 4L8BB 4WW1A 3GI9L 2HN7A 1DE4A 1CLZL 2GTZA 2BNUA 1KPRA 4NQCA 3NABH 4JANB 2EDKA 4CU6A 4UILL 4S1SH 4G7VH 3OJDA 3L3OA 5JIPA 4NDMA 4FFYL 3SKOA 4K23H 3O6LH 4MJ5A 4R4BB 5DLMH 5JO5B 1WFUA 4XNZC 3WNPA 5J3HD 3FFCA 4P23A 2PYEA 4G7YL 4P9HC 3SE9H 1EIBA 3IAGC 2J88H 5B39B 4U1LB 1IAKA 2VDLL 3FOMA 1T83C 3ECBA 1R5WB 3UPAA 4K3DH 3QO1B 4LCCB 1MHEB 1TJIL 5F9DC 5BV7L 2YKLH 3MBED 1FZOA 3CFEA 3P4MA 4JN1H 4K3HA 4MNGE 1VGKA 2MJWA 5GS1A 1U8OA 3QNYB 2CH8A 3BZEA 1FO0B 4YXLH 2B39A 2CDGB 4QRQB 1T3FB 1NCNA 3CSPA 3BPOB 1EEUA 1WQVT 2G60H 3O6ML 5F89A 1P84J 4R96A 4XNQA 3IDIA 3WNNA 2C3VB 4QOKB 1MCRA 2WUBL 3QUZC 5JDSB 4Y4FA 4X6DB 4YFLF 2QSCH 3PP4L 1N7MH 1D5ZB 3ZHLA 5C8JB 3CSYB 5CJQL 3F12A 4O2EA 4ODVH 1U2CA 3ARTA 3U0PB 4HLJA 3NFNB 3MRMA 2K3TA 5ID1B 1D5IH 5DC9B 4Z7OE 2EIEA 1WBZA 4KRNA 3RTQC 3MMEA 3S36L 5J57B 3ILPA 2W0LA 2HFGL 5K9JH 1Z3GH 2XKUA 4WFHE 4R8WL 4WJ5A 3GM8A 3MOAH 4XXCA 4X5XB 3ME0A 4RFOH 5DMKB 3IFLH 5FKPA 3IGAA 3PGCA 3NA9L 1P1ZB 4P5TC 4U0RC 3OR6B 4PRNA 4XBGA 3O0RL 3ROLA 4NO5B 4JDZA 5MP6L 4BFEA 1VKXA 3SPVB 4YHNA 1DQML 5E6ID 4O2CA 1YPZB 1V05A 5GGTH 2BDNH 3MLZL 1BD2D 1S9XB 2EIZB 1OP9A 5LQBL 2Z93B 1JL8A 1SHMA 1H3UA 3GMNB 2OBGA 2P8MB 4WUUA 4XVJL 8FABA 3O9WC 2DMCA 3B9KC 5CJXA 3FB5A 1CXLA 3WLBA 4UT7H 5F44A 2RR3A 3CDGA 1HHIB 4YEFA 3Q5TA 5GJSH 1SYVA 5K9KA 4F58L 2VC2H 5C08E 1D6EB 3TO4B 3V7MA 4UTBL 1O7SA 3MLVL 2EDDA 3BKYH 3QXAB 2PW2B 5TE7L 4JFHD 4GKOA 2H6PA 3QFDB 2BY0A 5BS0A 1R6VA 3WS6A 3FZUD 4PPTA 3RWIA 3HNSL 2DQIL 3OHXB 5DEGB 1JV5A 3VRIA 5CGYC 4Y16A 4LQFL 1CGVA 3BYTA 3FAWA 5CZVH 1XH3A 1RU9H 5KS9E 3RI5K 1G7QA 5GGUA 1WFOA 1LDPH 1JPFB 2FGZA 3MV8E 4I18C 3SGDI 1EGJA 1OGAB 3TWCL 4XCFH 4RX4D 3EOBA 2EE2A 5IFHL 3HUJB 4XHJD 3EKCA 1ZTXH 1U92A 4I3SL 2AEPL 5JW4Q 1WZLA 1JYXA 4QHMA 3BKCL 2XWBB 3Q1SL 2PW1A 2EXYC 5I1GL 4HKJB 2BNRB 1MFEL 3MLYH 3MRCB 5E9DD 4WTWA 1AXSB 2ERJC 4OCWH 3ZKMC 1EO5A 5J1SC 2DM3A 2FX7H 1TFHA 1RZJH 3EAKA 4FQHA 4IRJD 4YDVA 5SV4A 1N5AA 1T66D 1JHTB 3KYOA 3QAZB 3MGOB 1AGCA 4JG1H 4NSKA 4QYOA 2VXVL 1CFVL 4U1IA 4XT1C 4CDHA 4MA8H 5K9OB 3MXVL 3ULVF 2FZ3B 2E9WA 3HZYA 3EDFA 4LIQL 2WIIA 4EI6A 5E1AB 3ZDZE 3R1GH 4GAFB 1YEEH 5EU4A 1IC4H 4KKCD 4L9DA 3F58L 2IF7A 5EPMA 4JM2C 4J4PC 1ES0B 1NFDE 4X7FC 2ADIA 3K4ZA 1LK3H 4G8GE 1MJUH 4HWBH 3STZB 2BNQA 4V1DD 1MFAH 3RDTA 5EU5A 1K8DA 4FNLH 2Q6WB 1HN1A 1RIVL 5TFSL 1RUQH 4J3SA 5ITFB 1R3LA 1W2KT 3QWRA 5EZOL 1QSFE 2IQ9L 5CLTA 3IU4H 4KDVA 1F4HA 4ZFOB 3X12B 1OY3B 3RX5A 4K7PH 2FLRT 3DVFA 3CGTA 3MRFA 3A6OA 5GRVL 5DJ0A 2JIXD 4HWZA 3D48R 3FFDB 1IL1B 4OUUA 2NNAA 1JK8A 3IDNB 5I1EL 2VLRA 4C57C 1I9RL 1PG7X 4LMQE 4LVHB 2AJYH 4Z0BL 3NVQA 3INUL 4ALAL 5H35B 2JK5A 5D1XD 5A3ID 5KG9A 1MCWW 1CXKA 1FPTL 4PRIE 3W11C 1LE9B 4HX1A 3FQRA 3TBWA 1X44A 2FEEL 4PRAA 4U1JB 3IFPA 4UIMA 1IBGH 5FDWB 4YHOL 3UBXB 5E2UH 2X7LA 4BA8A 1YJDH 3KLSA 2NMSA 3WFZA 4J6RL 4OCMC 1K8IA 4YNYA 4M6NL 4M1GL 1F58H 4PG9A 5FYLH 5F88B 3Q5YA 2W9LA 1U8PB 5D5MF 2FGWH 3VFVB 4KK9D 1KFAH 2NW3B 1XGUB 3V5HB 1WEJH 4YBQD 3DUSA 3RL2A 4TVPE 2GW5A 5TQ0L 3WIFA 3EGSB 5AZEL 5D8JH 3BPLB 4NZRH 3SGKC 4JVPA 1A4KB 5IB3A 3H9ZA 3TVMB 4GW5A 4D2NA 2JKXA 3RX8A 5D70L 2W9EH 3LY6A 3DO7B 4V2CB 2FX9H 5E56A 5LG1A 2JB6A 4OCYH 4EDXA 5I1KL 3DYOA 4LFHG 2EDQA 3DURA 2VLKE 1HOCA 4K94H 2JF1A 4FG6C 3OF6D 1T20B 4Y5YA 1MCFA 2FO4B 5IHUL 3BD4A 3FRUA 4PP2B 1HINH 1FL6A 4ZD3L 3BH9A 4QCIA 5EDXA 3SO3C 4X8XA 5IJVB 4Q7DA 1JP5A 1TVBA 4NQEE 1NGWB 1TJHL 4K07A 3UTQA 3CFDB 32C2A 2F8XC 1OSPH 4QRUB 4YHZH 4X5WB 4XB7A 4I77L 3UC0L 2XNAA 3MA9H 3L3KA 1KJMB 3M07A 4HJJH 4F7MB 2MPAL 2KQMA 2FBJH 4JFEE 5HVHB 5F1IB 2FSEA 2DQTH 1IGCH 1QSZA 2LFGA 4OGYH 5BJTB 4JM4L 2IANE 4OF6A 1RUML 3KXFA 5D71H 3VH8B 2YC1A 1RK1B 4H1LG 3S3SA 1QEWA 4P2RA 3TV3L 1NMCC 3QZWB 4I48B 2IFFH 3QHZH 3CZJA 4NNPL 2HLFD 3GMMA 2B2XL 4JHWL 4N8VB 3KPQB 2C1OA 1QR1A 1DL7L 3QH3A 5DDHA 2HLAB 3VXQB 3OKMB 4P9ML 4X9GA 3CAFA 1DUYB 1X4XA 3BMWA 4HXBH 4WWID 3VGAB 1U3HC 5CP3H 4TULL 4OB5L 1CFQA 5D7LE 1HXMA 1OPGH 1ZLSH 4AH2A 4WEBH 1OAXH 2O61B 4M6OL 3L3GB 1FQ9C 1PKQA 1FNGB 2I60H 2VH5H 2A0LD 3D6GA 4M00A 2I27N 3UTTE 2Z4QB 3WKMH 1FCCA 3VXRD 1RZGB 1HI6B 4D9RE 12E8L 5C9JA 4J3XA 4HUXB 1OTUC 4P5KB 4OZIF 1CQKA 2QV2A 5CHNA 1F6FB 4U4BA 3KPSE 4P9HL 1QLFB 2E27H 4BUHA 1Z5LB 1AKJA 3GK8H 4OZGF 5LAXB 2HG5B 1UB6B 1XF5B 4LCWD 2F58H 2GSGA 2W60A 1ZKAA 3OKOB 3ARXA 3VXSA 1INDL 5HHNB 2VITA 5J06A 1ZT1A 35C8H 3WEXB 4Y2DD 4NZDA 1YN6A 3PDOA 4GLRI 2APTA 3W2DL 5ANME 3NCJL 3GB7A 5T3ZE 1C5CL 4ZS6D 2H9GB 1CDGA 2NR6C 4KMQA 4ZSOE 3U4EB 3MJ6A 3JWDH 3MRQB 1KULA 1Z9MA 3IAQA 5FIEA 5HGHA 4KQ4H 4PY7A 5IB5B 3TNMA 3VD7A 1KTLA 3UJTH 5DVOA 3ZKNC 4GKSB 4KTDL 3VWKD 5I75B 1CICB 1CICD 4DCQB 1HILB 5SWZD 2AKRB 4KTEL 1RHHB 4KY1L 3WJLC 1JF1A 2ZSVB 2EICA 3MLXH 3SY0A 1H3PH 4TRPH 3RHWF 3MLPA 3ZE1E 4C58B 2R29H 1A1NA 2W0FB 4MGXA 4Y88A 1ORQB 1CT8A 3VXNB 4I2XA 1S7SA 2Y1VA 3MGTB 5ADOL 4NP4L 1NBYA 3NACL 2ZUWA 1NAKL 2X4TA 3GSXB 4Z0XB 4RAHA 1U8JA 3P2TA 5KSBA 3T0ED 1SJXA 3UTPD 5F3HA 3UYRH 4Y8AA 3T77B 3OAUL 5IHLB 4HHAA 1PQZB 3T4AB 4PJDA 1NGQH 4P2QA 1CU4L 3RIAK 4Y1AA 1FSKC 1V7NH 4P23C 1QOKA 1E27A 1UM4L 4C56B 4X6CA 1CD1B 3QIBB 5D7JA 1J7VR 3C09B 4GRMB 4IOIA 2P8PB 3PUCA 5ITBH 1YA5A 1V3MA 3OGCA 1KPUB 1DVFB 1DP0A 3SKMA 4WY7H 2VISA 3I9GL 2QTEA 4XPHL 2YPLA 3TYFA 4PIRF 5I8CA 1IAMA 2AI0H 3QXUA 4PJXB 4OD1L 4P4KA 2EKJA 3BEVA 3KYNA 3RWGA 4H1LA 3RUGB 1MCKA 3GI8H 3F5WA 4S1DC 3EO9H 3P73A 3BAEL 3AU1A 5GRJL 2VL5B 3V7AE 1FH5L 3B3IA 4YBLC 2H3NB 1FRGH 3GMPA 3E8UL 4G42A 4UU9B 4CVZB 4JM2F 4XRCB 1ZANL 4JZNB 2YUVA 1YMHA 1VEOA 4Y4FC 4NO2A 3FTGA 1JFQL 3B6SA 5AAMA 2E8ZA 4KUCD 2Q7YB 1RVFH 4NQXB 2L0DA 3CIQA 5HPMB 2ENSA 3ZDYF 3S8WA 1XCTB 6FABH 2BVQA 2NW2B 3GKZA 4LQ1A 3LD8B 4HUWA 2DL2A 4JFQA 4PRPD 3QCVL 3PHSA 5I19H 4Z8FH 2HP4A 1U95A 1FIGH 5IQ7L 1RZ8B 1O5DT 3PWLB 4ZS7H 5IF0B 4U6TA 1TTUA 3LB6C 4XP5L 2WWKO 2HYMA 4PRHE 3BKJH 3HAEG 4ZOEA 1BLNA 5SX4H 2QEJA 3UO1L 4CL7A 4NWTH 1T1ZA 5SWSE 2A73B 3KPTA 5JXAL 2CIIB 2E7HA 5I15H 1L9NA 1I8KA 1Q9OB 1VFUA 3DX9B 1Z2KA 3QFJE 4MDJB 4QRPB 2CLVA 1NDMB 2W9DL 1GZPA 4NUJB 2XWJB 1D5MA 3RWCA 3T2NL 5L88H 2UUDK 4NC2B 2B1HL 4JDVB 2Q8AH 4I1NB 1JVKA 5C70A 2VABB 3OG4B 2NX5D 2Y7QA 3QA3B 5DD6B 4XGZB 1M4KA 2VUYA 1HDMA 5M95B 5J6GA 1YMMA 4RISH 3MRBA 1I3UA 2KBGA 2GI7A 3EJZC 4B5EA 3G5XB 4WNQB 4DGYH 3ARGD 1G7IB 3PWPA 5D7SH 4Y4KB 1N6VA 4PJ8C 5GQBA 4NCDA 5CP3A 1NMBH 4MS8C 5F6IC 2MFNA 4QEGA 5INCB 5TE6L 1K5NA 1UKQA 3L5WB 3HZMA 1FNEA 4NNYA 4JFDB 4CN1A 5IJKC 1AP2A 1T22A 4WWKB 3BP7B 4UUJA 3RFZC 3AMLA 5CGMA 4Y16C 2MQ0A 4LSVL 2X9YA 5CLWA 5A16B 4WGVB 4A2MA 1I3RB 4JRYD 2RQ8A 1IGJB 3TGXA 3IFOA 3GSOA 4JY4A 1MIEL 3C5SA 1JGUH 5FKAB 5IG7A 5DJ2B 1DFBH 4MQTB 4ZXBC 3MLUH 4UDUB 4Z7WF 2DTSA 3J8F7 4JQVC 4K9EL 4ODSH 4FXKB 6CGTA 1WWAX 5AZ2H 3C5ZB 2YBRB 1LEIB 5D7KD 3UTOA 2R0LH 5DD5H 3QIWB 4MJIE 4BM7A 3DETD 4NRYA 4Z18A 4QTIL 1A2YA 5IP4A 3RL1A 2ORBL 2H8PA 4JFYA 2OL3L 1OAUH 5DQJA 3P9WB 1H8SA 2HJKB 3VDCA 43C9B 3O4LE 1AGBB 4OKDA 4Z7UE 2YMXL 2PTTB 3BZFA 2O5YH 4UT9H 4W70A 3V0WH 1Y0LB 3KDMA 4LPWA 5ETUB 3RWEA 4FXGA 1FL5B 5JPMB 5AG9A 3BIKA 5E7BA 2RFXA 2W65B 5K33A 5T3XH 5C0FA 3T0DA 5ERWB 3BJ91 1CDJA 4YE4L 5KSAD 3EOTH 1CXHA 3ARDA 4N0UB 4ETQA 2MMXA 5ENWA 3CFKB 1BJMA 5GRUL 5DJAB 2IAMA 5J89A 4Z7VF 3WHE0 3ZKXC 3V5KB 3ARWA 4AMKH 3I6KB 4FS0A 3I02B 2UVEA 1LO3H 5JXEA 2XA8H 2FH6A 5HHVL 3CH8A 3N0PB 5EBMB 3LRHA 2E6QA 4LCYA 3O3AA 1OB1B 3TZVA 3LIZH 1G7PB 5I66A 5DUML 3P9MA 5GJTL 4IRSC 2VDMH 4B53A 1F4WL 3MUJA 3BUTA 4LP5A 4R6UA 2ZCLL 3LHPL 1A9EA 4I0KA 3T65A 2LVEA 3FQNB 1JZ8A 3HAEA 1MCOL 5E8NB 1J86A 2ADFL 4OLVL 4H5SB 1HHGB 1OTTD 1UC6A 3QUYD 3KS0J 5JW4M 4QO1A 5BO1L 2GJ6A 2A38A 1FVEB 4E41B 2OQJB 5KW9L 3G5ZA 5EZIL 2HKFH 2DWEA 3DSNA 1UJ3B 4JJ5B 1CK0H 3Q6FB 1F11A 5IUSA 4CMMB 1P84K 5EU3A 4YHPA 2Z35B 3PHOB 4P4RA 5JHDD 4OFPA 1SM3L 1U8NA 2YZ8A 1IAOB 4PJCA 1WAAA 1MCPH 5IV2B 3ROOA 1YNKH 1M71A 4GRLD 5DRXB 5HYQB 3K2UH 2P24B 5E8EB 1F2QA 5KSUA 4ZNEE 3O9WD 1P4LB 3FOLB 1A7NL 2PXYC 1ZA6A 3KHOA 3T3PF 4EI5A 1WZMA 2ICWI 3I6GB 3QQ4B 2R1WA 2ATKA 3NZ8B 1XIWC 4XBEH 5EWIL 1E4WH 5CWSB 3IKKA 4FQIL 4LSRL 3VCLA 4J2XA 3S96A 1WLHA 1AFVL 1SJEA 4ENEC 3O6FB 4XVSL 3O6FD 4TVSa 4H26B 3WNLA 3VD9A 1QRNB 4O02L 2EYRB 4F2MB 1W0VB 3D2UD 1C5DB 1CG9B 4MDIA 4QHKJ 4ZUVB 5DEZA 4NJAH 1NGXB 3WLWD 4MAYD 4Z7QF 4AIZA 1NCUA 2NY3D 1OP5H 4LLDB 5JOPE 3VWJA 2Q1EA 3UPCA 4Y5YC 5I9QC 4LLWB 3VG0H 1ZT7B 1KV3A 5D2LE 1UEYA 4G6MH 3EFDL 5CZXC 3WIHL 1G7MA 4CNIB 1A0QL 4L3ED 4AEEA 3KPNA 4OGZA 1N0XL 3D0VA 2F54B 1CDUA 1U91A 5ACLA 2EXYD 1NUDA 1NH6A 3JV4A 5C2UB 3NIFE 2OSLA 3TA3A 1AD0B 2AK4E 2YOCA 4W4OC 3NMEA 3V8OA 5DHYA 2JE8A 1ZS8B 3FT3B 2ZPKL 2DWDB 1FGNH 4HS6B 1QBLL 5D1QC 5HHMB 1B0RB 2GFBB 3PGDA 4LLAA 2WUCH 2GAZA 1Y6MR 2Y9RT 3QEQA 4HKXB 5ECJE 1NL0H 5EU6D 4Q9BA 3GSNA 3AS3A 1OD7A 4LLMB 3VGHA 4FMKA 3WS3A 5JDJA 4OQTH 3B8YA 3RZCC 4R2GC 4X8JA 4U6HA 4X6EB 1OSZB 1FLTX 3TH2T 5D7IB 2X4SA 1D3CA 4HCRA 1IGFL 4C4KO 2XI9A 4IIQB 2D7PA 1BVLA 4XWOC 3P3YA 5DWUH 5HTSA 5EA0H 2FEDC 4BH7A 2ZUTA 1S5IL 3DVIA 3ULSB 3QUXB 3MCKA 4RIRB 3C5JA 1A3RL 2YD7A 3B9DA 5I1DA 1QFWL 2BSTB 5DS8A 1QP1A 3BZ4A 4DN3L 1KJ3L 3SJVB 1I1YA 2VZOA 4NQDD 1J0YA 4MB3A 4ODTH 4WV1A 4HUUB 3BQUB 3OB8A 3GHEH 2G9HB 4PJEB 3JTSB 5F9WB 3TT1H 4YC2C 2FECI 2R69L 3T4YA 3UDWA 5I16B 2C1PA 4P46C 3GHBH 4S0SD 1T89C 2DM2A 5DO2C 5DUBB 1BM3H 1RFDL 4RWHA 3IF1B 4HF5L 1JMXA 1UACH 3DO3A 3KPOB 1ZGLP 5EFIB 2ARWA 5GSRB 3BXNA 1B2WH 5CMAA 1HH6B 4YHIA 3LH2H 1CTOA 5BRZB 3LKPA 1HZHL 4GXVH 4J1UB 4CW1B 3W39B 3MV9E 1ZHNB 1TETL 3KYMA 3FN0L 3O2DH 4Q74A 4NN5C 4UQ3B 4D9LH 3OPZH 3W81A 1WFTA 3MO1B 2NY7H 5FA4B 1B4JL 2QSVA 3EYQC 2P5WB 4IOFC 5TPWH 1A1MB 1RUAH 5FK9A 5FO7A 4TUJA 3TBVB 4E0RB 4BZ1L 1KC5L 4X4ME 2OZ4A 1BEYH 3ZZ1A 1JGDA 3NGBB 1BVZA 5A43C 3HE7D 4WW2A 3K1DA 3AB0C 2GY5A 4PB9H 5AD0B 5C0CB 4KMTL 1KENH 3A6CL 1F02I 1QBBA 2JJVA 3SDYL 5JUEH 5IMOA 2XZQL 4XPAL 1VFOA 5B4MC 4U7SA 4DTGL 5IEKA 3MV7B 4DVRH 4Q9QH 4PJHE 4R7NB 1X9QA 3QNZB 2IADB 4HKBA 5HXMA 2YA0A 1IM9D 2Y5TB 5F9JB 4ODWB 2PCPB 4PJIA 4QGYA 4WO4A 4J3TA 4FQJH 2FHCA 4ZOBA 3VXOB 3MLRL 2CK2A 5F71A 4X83A 4FZ8L 3G6DH 5DK2B 5HYSG 5TF1H 5D7JC 4KJWC 5ICYA 3U7AA 1KJVA 5HD8C 1CGSH 1BBDL 3NFPB 5C6TH 2JCCE 2I24N 3VXUE 4M9OA 3MLTA 4QRRE 4YEEA 3V6FA 2P5ED 4XBPA 4Q6IA 4ZYKB 1AHWB 1TPXC 5MHSE 1D5XB 5BCAA 2J5LC 4L4JA 2ADJA 4PR5B 4P4KC 3P30H 1URLA 2UYLB 5H8DA 3ULUC 1ZA3B 2F74A 5IHBA 1GHFH 3L1OL 3C9NA 4PG2A 1G0XA 4XH2B 4FRWA 5E08L 1OCWH 5GZNC 4Y19D 5F7DA 1M05B 4E42B 1U3HD 4MD4A 4NQSB 4ZUWB 5EO9B 2EIBA 5GISH 1E6OH 1W72H 5B21A 4APQB 3DV6A 3I2CL 4AEIL 1HEZB 1U6AL 3GRWA 4FTVB 2YRLA 3I3DA 3VFRA 1I1AC 4RDQG 4CJ1A 4J8RB 3UTSB 3LEXB 5T1DH 1B88A 4TNWF 4K8RC 2WNGA 1EGJL 4Q0XL 2VQ1A 2GEEA 1KCUL 1T4KB 1PYWA 3SDAD 2GUOA 3D39B 1NC2A 5GS2H 1IEBB 2WBWB 3LQAC 5C0BE 3EYVA 1II4E 4M5ZL 4RWYH 3GO1L 4KUZH 2ESVB 5HDBF 3U9UB 5ISZD 4OLWL 1KIRB 4Q97A 2P48B 2XG5A 4ZAKB 3V79C 2CRMA 2I5YL 4R26H 5CJOH 1YECL 1EMTL 4XNYH 3VI3E 2NR6D 4GG8A 5INDA 3ZLQC 4MLSA 1W0YT 2X10A 5C86A 1T6VN 1EAJA 1JNLH 4WHDA 2FJGA 4RMUA 1JCKA 1JHLL 4F7EA 3VFTB 3WD5H 1Q1JL 3SDXA 5DMIL 3CPLB 3MLSH 4NCC2 1X5IA 3HE6A 2B4CH 3UJIH 1O7VA 2DIJA 1AR1C 2FR4B 4YO0A 4OIBA 2VDQL 5IK3A 4K71B 5JZ7C 2BVPB 1OGTA 4G7VL 4JY6A 2HN7B 4LARL 5ELIA 3LS5L 5EIIA 1H15A 1WSST 5DLML 1MQKL 4AL8L 5IW6B 1PX4A 2AK1L 2CGRL 5EN2A 3MUHL 3AREC 4NQCD 4TVPH 3OJDB 4WHYH 4NFBA 2HT3D 2J88L 3PWNA 3VE0B 1N8ZB 3FJTA 3HPJA 4YBHA 4BELD 2PYEB 3FFCD 4P23D 4XAWH 1KG0A 2PYED 4CVXA 3VJ6A 4OCXH 4EXKA 3NH7L 5DD3H 1PAMA 1TCRA 5J11B 4UAOB 2X40A 2YKLL 4ZDHA 4LCIH 1SY6H 5DC0A 3BZDA 5HYSA 1OF2B 3SE3A 2J1KA 2A6IA 3BPCB 2YRZA 5C07E 3W9DB 1IMHC 1GOGA 3KLHD 3IXAA 1AQDA 2UZIH 4N90D 1DN0A 4RBPK 5CSZA 1RK0B 1FZOB 5EC2A 3WIIL 1J8HA 2XPGB 2HKHH 3R4DA 1VGKB 4MCZA 4OLZH 1QSEA 4B7LA 4I3RL