3HE7B

Crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta7 nkt tcr
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
97
Chain Sequence
b'QKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d1
molecule tags Immune system
source organism Mus musculus
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
total genus 14
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3he7B00
1NGXA 1OB1B 4P23A 3MO1B 1KNOB 5IJVB 1U93B 4GG6E 5AWNH 1VFOA 5TE7L 5E2WH 3EDDA 3W2DL 2DL9A 3M1BB 1F11A 4Q9QH 4WCYL 1RK1B 4KHXL 5TE6H 2QQLH 2FR4B 5DRZA 3CU1A 5I18H 1JTPA 5ETUA 4U3XA 1T2XA 1E28B 3ARFB 3I9GL 1KXVC 3U0TB 5K9OB 3QQ3A 4DCQB 3JTSB 5HJ3A 3RZCB 1BVLA 1FNSH 3DVFA 5ICXB 4HPOL 2A83B 3U4EA 2BNQA 1KTDB 3KS0J 2GT9A 1G9MH 4PTTA 5KG9B 2W0FA 4JO3H 3SDXF 4MJ5A 4U1HB 3KHOA 3A6OA 3BXNB 5IW6A 3TVMC 3OBAA 3P9LB 5FEBA 3ARGA 4LASH 2IFGA 4M7LH 4LRNL 3M17A 5I8CA 3T65B 1ZT4A 1KFAL 2EYRB 3S98A 2O61A 3KPQB 2DMCA 1O7VA 2H45A 1SJHB 3V5DA 1P1ZB 1BVZA 4XNXL 3EYFA 1OF2A 5L9DL 3IVKB 4NRYA 2A6DB 4Y5VB 3SJVB 3V4VH 3CFKB 1MRDL 3OAYH 4JPKH 4C56D 1UCBL 1BPVA 4LEOA 1BZ9A 4I3RL 1E4WL 5GS2D 3TBYB 4IS6B 4IRZH 2BNRA 1LP9E 1INDH 4LSDA 3BN3B 4RGOH 3WUWG 4PJ7E 4Q9CA 4WTXA 3KXFB 2IBBA 5FYKU 1W72H 1Y6NR 3FAXA 4EQ2A 5GRZA 4KQ4L 4U6YA 5CJOH 2ZUSA 1U8PA 3UDWC 3UTTA 1SJEB 5JW3L 4E41E 1NC2D 1CICB 1WZMA 3NABH 4DVBB 2Y7QB 1KF9B 3BIAX 1U8MA 4JO2L 3L5JA 3O4OB 4QCIA 4WY7H 4FQJH 3BJLA 1HN1A 4N8VA 4ODHL 4S1QH 4F80A 4P57B 4A6YH 3KPNA 3PDOB 5D1XD 4FFWC 4FG6C 3MO1A 4IDJL 3ELAT 1MFDH 4DZBB 3REWB 3OJ2C 1G6RH 4YDLB 3FRPG 3ULVE 1EAPB 3GI8L 5DTFA 1F58H 2YPKA 3TH2T 3MLSL 5D7IA 4F7EA 3HC0B 1S9KC 2RFXA 4ACPA 2C4FU 3OX8A 4X9IA 3UTZB 1T22A 2NY3B 3JV5A 4W4NA 5IVXE 3OAZH 4K55A 2Y36L 3PGFL 1QO3A 1VGEL 1IAMA 3O45A 1G6RA 5JIKA 2HTKD 3MRDA 2P24B 1NCBL 3BP4B 4YWGL 1K4DB 1ZT7A 5DDHA 4U1JA 2G2RB 4HBCH 3Q6FA 3ECBA 1A1NA 3MCKB 1E27A 1NANH 4TULH 4X7SH 4IOFD 4NQDD 3KYNB 3IDIA 5CJ8A 3V5DB 3O2VH 5GZOC 1LK3L 1FIGH 3G6JB 4EN3B 3C09C 2ADJB 4JM2C 3ARXA 5EO1B 2ENSA 3O6KL 4LSPL 5KN5B 3OR6B 4KTYA 1TETH 3B2VH 3GMMA 4ZFOA 5EU6A 3MRIA 4HH8A 1CGTA 1TNNA 4HDIA 4F57L 5BO1H 1OTSC 1AR1D 1Z5LA 4PJ9C 5E2UL 3U6RB 3GKWH 5T1KB 4Z95L 3TBYA 4FZ8H 1K6QL 5BVPL 3GJEB 2QSQA 5FYLE 2HTKC 3NBNA 3GSRA 4PJGA 3KYKH 1MQ8A 1MHPH 2IJ0C 4NZUL 1GH7A 1ZLUK 3P4NB 1XZ0B 4QNPE 2HG5B 1NCAH 1OWRM 3AAZA 3GSUB 3SE9H 3TYFB 4BSVB 2G75A 5HHOB 5DQ9A 1HNGA 4QCIB 4UT6H 5BJTA 3O11B 4NNPH 1EEZB 2BCKB 3BWAB 1T6VN 2VISB 4XP4H 5T3XL 3PDOA 1N6UA 3LKSA 3SDXA 3IAPA 1U36A 2I26N 1HIMH 3PV6A 4L4TA 1OB1A 4P23B 5GJTL 3S3JA 3VXRD 5JDSB 1ORQA 2PO6C 1KTLB 1FL3A 2YN3A 4O02H 2PXYC 5EFIA 5FCUL 5DD0H 4NFBA 2DD8L 5C08A 4K8RH 5HPOA 1XF3B 2BHUA 4GLRH 3L7EA 4RZCB 1ZT1B 3ZDZE 2CLVA 1JK8A 3D3VE 4WO4C 4PLKC 3VXSB 1FE8H 1UVQB 4PJ5A 4R2GB 4FTVA 5AG9A 3G5VA 4KRPD 1OAYH 3QHFL 1OAKH 3CMOH 2YD1A 1YN6B 3LH2L 1L7IL 3T77B 4F15B 1T83C 2DLFL 4ALAH 4PRDA 1E6OH 2CJUL 2BVOA 3LN5B 3MPCA 2MCG1 2JIXB 3RWEB 5A2IH 2OK0H 2X41A 1CDHA 3MODL 1NGPH 3T1FB 3WE6B 1IBGH 2BNUB 4EEEA 2H6PA 2E3VA 2LE9A 5EO1A 2ATPB 4JPVH 4ZUWB 1HHJB 4BH7A 5ID1B 4I8DA 3ARTA 1VADB 2PCPB 4UMGA 1VB9A 2DQTH 4XB7A 3MNWA 5DJDA 3CFKA 2FLBT 4LFHD 3NCMA 3D87B 4CVZA 1MUJB 4N0YH 3S9DB 2DWEA 1PY9A 5D8JL 1S9WB 4JKWA 2GJ6B 5BV7B 5IVZA 5JLZB 4XI5C 4E41B 3Q5TA 3TZVB 3AB0C 1CDUA 3LPWA 5IFHL 3KPSD 2Y72A 4R90L 4NBZB 5TDPB 5F6HI 3OKYA 1QVOA 4J2XA 1YEKL 4P4RA 4G3YH 3V5KB 4NRXB 4XP9H 3E3QE 3VDBA 1N2RB 2YPLE 3QUMH 2XRAH 4Z7UA 1U8MB 4O58H 5C70A 1QSFB 3FRPA 3NPSC 1EJOL 1QFUL 5GGTA 5HHQA 2JCCE 1ES0B 3VFNB 4DN4L 1NBVL 1H0DA 4BJLA 4MWFB 1YJDH 5GGSA 4TPRH 3T0EE 2HYMA 3D85B 5SWSB 5F6HJ 2VRAA 4OZIA 4PY8J 2MSPA 3OKKA 4P4KB 5EOCH 2Q8AH 4FABL 4OZFG 2PR4L 2EE3A 4FFZH 4U6TA 3GSWA 4O2CA 1MFBL 4F7EB 4KZEH 1RIHL 4M4PA 1U3YA 4OD3H 4XMKH 1PEZA 3S36H 4LLUA 1J1PH 5FF6A 1BFSA 4OUOA 4ZXBA 1QO3B 1P84J 5L0QB 1UXWB 2B1HH 2CR6A 5CWSA 4FN0A 3FFCD 4Y1AB 1YNTB 3AS3A 4FXKA 1QLEL 4LP5A 5DEFB 1RZFH 4HJJL 4EXPX 3VRJB 4YBLB 1OGAE 4XMPL 1CFSB 1AGDB 1F02I 1I1CA 4LHJB 2DYPA 4JM4H 4UQ2A 2E27L 5B4MD 5I1LB 1QKZL 3ECBB 3TEUA 4PJ9A 3SCMC 3CXDH 4V2CB 1LO0H 2JJSC 4EBQL 4NJAH 3G9AB 4P9HH 4MNQE 1BBDH 4RQQA 5CSBA 5IESH 1OOAA 2ICES 3R4DA 3GMPA 3RWCB 3QIWD 1E4JA 4RGNB 3B3IB 5B21A 3EYQD 3SDXE 3KWWA 1ZTXL 1D7FA 3VFMA 4NC2B 4J3SA 4D0CA 1VKXA 1TIUA 1T1YB 5D1QB 1D5BB 3QAZC 5BMFH 3EAKA 1BOGB 5CBEA 3BJ91 4G5ZH 3EOAB 2FL5A 4EOWL 5E8OA 2YUZA 1IC5H 3K2MC 2AAVA 4HUNB 4HV8A 4BZYA 1E6JL 3VH8G 2IMNA 1KXQE 4M93C 2NQCA 5DQ9B 4TQEH 3BP5B 3ULUL 1IC1A 5IFAL 3RGVA 3IU3A 1ES0A 4PG2A 2AEQL 2AJXH 3VFNA 1IGCH 2XWTA 3MUGB 4L8DA 3BUYB 1KJMA 3FQUB 1EPFA 3H7BB 4YBLC 2R69L 1KTLA 1MFNA 4L8SB 3MOAL 2OTUA 1WBZA 3N50A 2HTLD 1VFUA 3UDWA 5MENB 5FO9B 3F5WB 2H2SD 1C12B 1L6ZA 1P4LA 1WICA 1PD6A 4KXZH 5CEZE 3UC0L 4OFPA 4AY0A 3VMNA 3Q1SH 1WC7B 4WEBH 4ONGL 2JB6B 4HC1L 3OAZK 3TA3C 1I9JH 2R1XA 4JJ5B 1H5BB 4Y5YB 4HMCA 5DJYA 5C0ND 1NBYB 4OZFA 2HWZL 3FQTB 5FK9B 4LVHB 1M7XA 5I73B 1DTUA 2HRPH 5FHBH 4YAQA 4JPIB 1SEBB 5D93B 1V8HA 1ED3B 5TDNB 1S9VB 4RFOL 5E9DE 1D6EB 1LD9B 2JLLA 5D1ZB 4F7TB 4F33B 1K8IA 1NBZB 2XKUA 4Q6YA 4GG8B 1T1YA 1NMCC 4ODUB 1MLBB 1BOGA 3KYMA 3LZFL 2OTPA 3DLQR 2K1MA 1SYSA 1R5IB 3HE7B 5B3NA 2YD9A 4GT7A 4NUJB 2FGZA 1JPST 4DQOL 3AUVA 2MKWA 1ZHLB 2ESVE 3DRQB 1SVZA 3OB0K 4D9QE 3U9UB 1RFDL 3DO7B 3FB7B 3MUY1 3QISA 3K4ZA 3HMWH 3HZMB 4O2EA 1HHIB 4K9EL 2Y07H 3QWOA 2Y36H 2HH0H 4ZTOH 1DLHA 4H1LA 3MA7B 1BVKB 4OF0A 3UTTE 2DM7A 4L3CA 1FFPB 1UKSA 5L8LB 3RWFA 5EZJA 4UDUA 2APFA 1CDJA 4D9RE 5IBLC 3MLZL 5L2JB 1I3RB 4XPBL 3GHEL 3QO1A 1WF5A 2JCCB 4H20L 1K8DB 4F2MA 3U82B 3PWPB 1F5WA 1K3IA 3WNMA 4ZYKB 4W68A 4GXUM 1G7PB 5I1JH 2IEPA 4P2CG 1XGYH 5LAXA 2QSVA 5ENWA 4QYOA 5FGBC 1JVKA 3PGCA 1FYTB 4WFFE 4DW2H 3FHAA 5MEQB 4PRPB 3VRLF 2PNDA 4PJXF 1FAIH 1AO7A 4HWBH 4UI2A 1W72A 4X6DB 2DIJA 1G9ML 5D96B 1SEBA 1CU4L 2CO7B 5EO9B 3QUYB 4ONHB 4LBEA 4G7YH 1XGRB 5B8CC 2OP4L 2VDQL 2HJKA 1G9NH 1WT5A 3BN9D 4UAOC 1MREH 2KZ1B 2YWZA 3SDCA 2J4WL 2IG2H 3JWOL 4JANB 3BZFA 1ZOXA 5E4EC 3GIVA 1CT8A 3G6DH 5IV2A 5DFVD 5I2IA 1OAXL 4OI7A 1U8IB 4TTDC 3IFOA 5LGKA 5FCUH 3WJJA 1B2WL 4PJAE 5KS9A 4LSRH 1W0WA 2FZ3B 4I0PD 4PGDA 1A02N 3SE3A 3FOLB 1FNHA 1JF5A 3QEQD 1FVEA 2BSRA 3KLAB 5IKCB 1W0VA 4W4OC 3PWLB 1T4KA 5J1SC 4OQTH 4LCWE 5BRZE 4D2NA 2ZUTA 3PIQB 1KGCE 1BVKA 1RZ8B 2ZOLA 1MF2L 1DQML 1NC4D 1MWAL 4I13B 1I8KB 1A22B 3P0YL 5ISZA 4X4XB 2LU4A 3C60B 3PNWB 3DMMA 4WTZA 2X4QB 5EN2A 1W0YT 4LLVA 2AXGB 3U1SL 2JJTC 4U1SA 2AEIT 8FABB 1A47A 1BBJB 3PQYB 4JFDD 4F2MB 4IRJD 1I1FB 5JXAL 4Z7WA 4Z8FH 3RUGA 1IM9B 5E70A 5DD5L 5FYJD 5I1DB 4E5XB 2UYLB 2CUHA 1OTTC 1JRHL 2VO5A 3CFBB 4NQCD 1QLRB 1D9KD 3PABB 1LEKA 4X6EB 1YYLL 3QDME 4XNQA 3K1KC 4TNVF 4LARH 4Z7OF 2EYTB 2NPLX 4FRWA 4NGHH 5C9KA 5HYIA 4POYA 4JG0H 4BSJA 4M6NL 3O4OC 1Q1JL 1I8IB 3KPOA 1WJ3A 4FZEL 2Z31D 2Q7YA 2HT3C 4EUPG 1KG0A 1J1OL 3SOBL 4QRPE 4HAGA 2FX8L 3P3YA 3FB6B 2ESVB 2KPNA 3U7WL 1F90L 1GPOL 2CGRL 15C8H 4NQXB 1IQWL 1JPTL 4J3OC 1YNLL 3G6JE 1HOCA 3K3QA 3CUPB 3HE7D 5E6ID 1FH5L 1DQJA 4UIKH 4CVUA 4W70A 5CEYA 1A14L 4OGYL 4HH9B 3TNNA 2NY2D 1CF8H 2FHFA 2NW3B 1FIGL 1YUHB 2P5ED 3GSVA 1NAMH 1HHGB 4U1GC 3NA4A 4OGAC 5FYKE 5I19H 1S7SA 1I1RA 5DMGC 3CSGA 3UBXA 3VFGL 1JL8A 1GGIH 5DO2D 1FRGH 5BO1L 5L6YH 4QHKJ 4CAGA 4R4FL 5FYJU 3ZTJG 4KUZL 4P59H 2EDBA 4OGZA 5C09A 2P8LA 5IG7A 3Q5YA 4IS6A 4Y19D 5DJCA 3SDYL 2IALA 3KYKL 2GCYB 4QHMA 1XF4A 2P4AB 2J6EA 1ZLWK 2I9TB 1OQXA 1KN2L 5DFTA 3DMMB 2C1PB 3D0LA 3QHTC 4AL8L 2IQ9L 3JZ7A 3UTTB 3VXTB 4I5BA 3B9EA 3HPJA 1BQHB 5FOJA 2GK2A 4AENA 3HAEG 5INCA 2ICWJ 1U58B 1MCJA 2NLJA 4OBRA 3Q2CA 5ECJE 2X1OA 1CD9B 3RUGF 1FL6A 2FDBP 4X6DE 2AJVL 4JREB 1VESA 5E9DA 4HWUA 4KH2A 1FQ9C 5EC1B 3UJTL 1JFQH 4YJZL 5D7LA 3U30B 2WQ8A 5A2JH 3IXAB 3IDJB 1R3KA 2Q20A 5EBMA 5GZNC 2A9ML 4Z0XA 1KELL 1H3WM 1IILE 1AQDB 5BW7C 5DRWA 4QXUH 4IRZL 3SBWC 4P46C 1AQKH 1O0VA 2XXMB 1B90A 1QPXA 2BK8A 3NFPB 4NHUB 1LO2H 2BVTA 4KI5E 1KJ2B 4XCYB 5DD3L 2ITCB 4PB0H 2NXYD 3GSNL 1MHCA 1HWGB 3QUYA 1TFHA 2N7AA 2AK1L 4JRXE 2VLJE 1AR2A 3B6SB 4LSTH 5D7KD 5DRXB 4MAYA 4N90D 3RFZC 2NXYC 2R1WA 3ETBF 1L9NA 4GAYA 2HA1A 4XBEH 3SKOA 3KPLB 3MOBH 5KVDH 43CAA 1I8MB 5I2IB 3VI3E 2P1YA 2F5AH 1U8JA 4OZGA 3LS4H 2E5EA 1BQLL 4TUKL 4ZFOB 4OLVL 3G5YA 2IADA 4KPHH 1EX0A 2DQJH 2EDHA 4U7MA 2CDEB 4H5SA 2Z9TA 3SCMB 1REIA 3S35L 3BD3A 4YGVB 1FP5A 1S9XB 3DROA 3MNZA 3CVIL 4XNYH 3PWLA 3U2SB 3F6LA 4YFEA 4LPYA 1NMBH 3UCRA 2NY4B 1BD2B 3HG1E 2NNAA 4MD4A 5A16B 3UC0H 2ZCKH 3GUTB 5F7FA 4JDZB 4NM8H 3KPPB 4E9LA 3D18B 3LD8C 2WUBL 1MFCH 1JTTA 1OTSD 1L4IA 5JUEH 2BMKB 1A6AB 3HPJB 1TVHB 4KROD 2KL6A 5JA8B 4LVOC 3RRQA 3GIZH 3OKEA 3BEVA 4EVNA 3H2WA 5BJTB 3PP3K 1FO0L 5DZOA 3K7UA 3RVVC 4OD1H 3LS5H 1BBJA 3PQYA 4KGLA 4N8CH 3H3PL 3MLXH 5FKAB 1ZA6B 2D2OA 3VWKB 3ZSSA 5CMAB 4PRAB 2BY0A 3TPUB 4RCAA 4Q2ZB 5JW5A 4PB9H 3UTPE 4LKXA 2KZWA 3ZKXB 1I9RL 1TZHA 3ARZA 5D2NC 1UCBH 3UPCA 3QH3A 3A6BL 3TBTB 3HE6C 5EU4A 1HINH 5CFHA 3TN0C 4YIQA 2VDOH 1QZ1A 1Q9KB 1MAJA 5KG9A 1KJ2A 4BZ2H 3RVTC 1NC2A 5K9QG 3EYUH 4ZAKD 5ICZB 1C5DA 5C9JA 1BF2A 3QCUH 1X4YA 2W9EH 1C5BL 1L6XA 4UT9H 5FGCB 5A2LH 3D3VB 1CGUA 3DGGB 2P5EB 4FQJL 2Z31A 3BZ4B 3VXUB 3O0RL 2MQ0A 1WLHA 1YPZE 3MRGB 5CJXC 4ORGA 1WFUA 4X83A 3C5ZD 3QDJB 3BRFA 5KTEL 2LTQB 4NQTA 1IGFL 2EXWC 4KY1H 4X99A 3NAAH 3C2AL 3TBVB 2XTLA 4Y2DA 1D6VL 3OKNA 3QCVH 2E9JA 2OX5A 3PGFH 1I1YB 5BMFL 3FTGA 1HHKA 3S37H 4HZAA 1JGUL 5E8DH 1RJYA 4JFOA 1IC5L 2VLJD 1DUYA 1QSEB 5GGRA 4M48H 4ODSL 4HF5L 1F6AB 1WZLA 4LLWB 4PJIB 1KPUB 5C6TL 1EERB 1CBVH 3O4LB 1EO5A 1TVHA 1M7DA 1ZE3C 3MRQB 1GL4B 1KB9K 3NCYP 4YX2H 2NY4C 5IFAH 2R23A 5LXGL 4ZS7H 3VXMB 5GRWA 4UBDC 4P5KA 5E03A 5D2NB 2GSGA 5CEXB 4G8EB 4YDJB 1FORH 4LU5H 2CDGA 5E56A 4QLRA 3REWA 5IJVA 5EBWB 4QHNA 4Y8AA 1BGXH 3VFWB 2VR9A 3MLRH 1QFPA 1IAOA 1F58L 2ZUUA 4LL9A 4FQIL 3WFDL 2WINA 4I1NB 1KJVB 1I9EA 4AIXA 4JY5H 4G6JL 3JWOH 3V8CA 4LVOB 3BPNB 2A6IA 3K8KA 3WS3A 5C2BH 4XWOC 2NY4D 1KENL 2ICWA 4KXZI 4TSCL 3MLPA 4NKIH 4WJ5B 3KPTA 4PV8A 1EGJA 5I1KL 1IARB 5JPNB 3T3PE 4L4VB 4MNHA 3GI9H 1NFIB 4G3YL 4ODVH 4X7CC 5GS1B 4K94L 1B4JL 1J0YA 2A9NH 3V5HA 2L0DA 1HI6B 4HIXL 4L8CA 2PW1A 3WFZA 1ZKAA 5FB8A 3CLFL 1IGTB 4Y16A 1AKJA 3VXOB 3EFDH 4GAYB 3DUUB 4D94A 1GOFA 1TVBB 5IMLB 5C8JA 2R56L 1CR9L 3DX6B 5DC4B 1RV6X 5FHBL 3IFPA 1P1ZA 4JJHA 5KN5A 1YYMH 3DSFH 4X7FC 3ZLQC 4NQEB 4NO2B 4R7NB 2L7UA 3CDGA 3BDYL 3HI6H 4NQDE 1MFEL 2VLME 4WHYG 2AJSH 3VFMB 1G7MB 3GDBA 3HPLB 4HUXA 3MREA 1U8QB 1XIWD 4HQQL 4U31A 1WT5C 1I1YA 4B41A 3QZWG 4TSAL 3U2SA 4ZNCD 4MNQB 4C59B 4G9FB 1NUFA 3PGDB 5F70A 4OF5A 1FFNA 3FT3A 3KXFA 3U4BL 1T1WB 3GMOA 5EIIB 1FLRH 3EYQC 4AIZA 2BNRE 2VSCA 4HJJH 4WHCA 1ADQA 1UA6L 4JB9H 4HJGA 4LLWA 2ZZUT 2CJUH 5I1AA 3T0VA 3HE6A 2CDFB 3WKML 3EUUA 4YUEL 1FSKB 2E8ZA 3QQNA 4NCDA 5DVMA 3LEXB 4LSUH 1F4YH 2BNQE 3U36B 1Q94A 3NMEA 5FXCH 4NUGL 4ZUVB 4JPVL 1URLA 3H7LA 3BRGC 3D39B 4OLXL 2BOCB 4N0CC 2BVEA 4TOYH 4K7PL 3TPKA 1ZTXH 1DBBH 4M7ZB 4HGMA 4WIQA 3HC0A 5DUBA 3L7FA 1ZMYA 3TWCH 1OGTA 3QIBA 3S96A 4PG9B 3I02B 2ICWB 4JRXB 5KVFL 1GIGH 3MRDB 1TCMA 3EOBB 3K4DA 2VQ1A 1KT2B 3PV7A 3OR7A 4MCZA 2X4OA 3ARFD 5ALBH 5JPMA 1NPUA 1QD0A 3MRBB 3TJEH 1IKFH 2H8PA 1MH5B 1MNUH 1EJOH 1QFUH 2AXJA 2A6KB 3HMXA 3VXOA 4G9FD 4XBPA 1AH1A 1SJVA 1E0OB 3T0WA 1OAUL 2A73A 2R69H 5DJXA 5EUOF 1EVUA 3PP4L 5E6IC 1LE5B 2GW5A 1Q9WA 3QDJA 3WNOA 3AM8C 3VG0H 1E4KA 4PJ9D 3BQUC 5MEOA 4XPAL 3ILPB 2DB8A 5E2UH 3ZYIA 5CCKH 2YS4A 5MP6L 3QO0B 5F21B 1AI1L 4ISVB 3DJ9A 2VQUA 3GJFK 5DJ8A 3N1QC 1R24A 2WWKO 2J6EL 4JR9H 2X42A 4HG4K 2VXTH 4WU5A 5HHMB 5TDPA 4ONGH 2DBLH 3TYFA 2J8UF 2UY7A 2FATH 4XP9L 4G6FD 4JFXB 3RZCC 1S7QA 5DSCA 3RVXD 5FDYA 2Q6WB 4CUCA 1H3VA 3O2DL 2P46B 4PRBB 3RX5A 4QRSA 4PV9A 4NT6A 4MA8L 4LSSH 3LKSB 1NBVH 5IWLA 4PRIB 1K5NA 1YJDL 4XPGH 4I0PC 3D9AH 1WWAX 1X7QB 2EH8H 4J3UA 5EBWA 3ZHKA 2HKFL 2NZ9C 5L2KD 1A2YA 2X4TB 3PWPD 5C08B 4N1HB 4N0FB 3O41A 1JNLL 5HI4D 3N1GC 2OMNA 1LDSA 4HHAA 1EO7A 2A74A 1AGBB 3MV8B 3CX5K 1EDQA 3FO1A 3ILQC 4M6OH 4NP4H 5EUOE 1NSNH 1S7WB 2FCBA 5I6XC 3HI5L 3VFPA 3EOBA 5TQ0L 5HYQB 4GSDL 3HCVA 3LS4L 1DCLA 5J1AA 5JHLL 1ZHBA 5JIHA 2BHZA 1YYLH 3PGCB 2BSED 5GS0D 1JZ3A 3M17B 5I8CB 3ULVD 2WLYA 4PJFE 3GGWB 5FB8B 1D9KB 4EUPB 2XKNA 1KB5B 3O9WA 1NGPL 5ALCH 3MNVB 1MAMH 5I1IL 3EBAA 2VLJA 3BKML 1PLGL 1TCRA 4NWTH 2K7QA 1BM3L 3W9EA 3EHBC 2FWOB 4IIQC 4OFIA 3R0NA 3GSQA 2AJZA 2BFVH 4Y4FD 4QOKD 1EFXB 1LO3L 5FAAA 5DJ2A 2GJ6A 5DMKB 3BDXA 2YEZA 5JHDB 1H3GA 1S7TA 3HB3C 1S5IH 5FDWB 1T1WA 4KVCL 5CD3A 2MKLC 1SJEA 4OF7A 4HCRL 5DGRA 3ZSTA 1BFVH 1I9RH 5I1AB 1A1MB 1FVEB 1MPAL 4ENED 4PLNC 2XV6B 5HHQB 3DX8B 3LQAC 4PRIA 1FZOA 2N7BA 2VAAB 2IWGA 3IDXL 3HMXH 1RZ8A 2ED9A 3EHBD 4ZNEE 3O6MH 4OLWL 2VABB 5FYLD 1UM4H 3ZDXE 1U3HC 5FYJL 3C5SB 3VFRB 2OP4H 4KRLB 4N0UE 1BEYH 2R1YB 1DBAH 3VXQA 5IP4A 2DTSA 2C4FT 2VDKL 3QPQD 4S1RH 1Z9OA 4L8BA 3NA9H 1R3IL 1JWUB 1K4DA 2GY5A 3MV8E 4UUJA 2BY3A 5FFLA 4OAWB 2UYLA 3B2UD 5TFSL 4XMPH 2NY1C 1H5BA 2V2XA 1XAUA 3GJFA 2P47B 4HFUH 3TN0B 4UT6L 5JMOC 5CEZD 1AJ7H 2FD6L 1A7QH 5DMGD 3W9DA 2VN7A 3QIUA 3KR3H 3NIGE 4UV4H 3QZWA 3WS6C 1GRWA 4O02L 2DMKA 5EBLA 3OR6A 4DN3H 5EG6C 4E0RA 4Y4HA 4CVWA 3BH8A 3L3HA 4XZUB 2QKIA 2YSSB 4ODSH 5A2FA 4LMQI 1S9VA 2NY5C 3QNYB 5C92A 1EV2E 2H2SC 4K7PY 3RTQA 3QSKB 4F33A 4L3AA 3K8MA 4LAQH 2FHCA 2R2BA 4XCEB 1XGQA 2MQCA 5DJ2B 2HFFB 1KIPA 3GSRB 4PJGB 2E9BA 2ZUWA 4Z76B 1IM3A 2I60H 1SYVA 1G9NC 2HG5A 4S2SA 1EZVY 2IQAA 3FB8A 4XCCH 2HLAA 3RWJA 3DNKA 2P49B 3VD7A 1AXSA 2HT4D 1Z3GH 4Y5XA 4WWKA 1NC4A 2VWEC 1F42A 4G8FB 1WISA 2D0HA 3AGVA 3D6GA 5DVKA 4C56A 2BRRH 4JG0L 4OUUB 4LIQH 4M8QA 5DRNA 5KANG 2ADIB 1G7QB 3LIZH 2UWEF 3WSQL 4WU7B 1OW0A 5FO8A 4JFFA 3WXVH 1J0IA 1OCWL 3G6JF 4P2QD 5EU5B 2OXHA 1FNFA 1IQWH 4QT5A 1EEYA 5IM7A 1BQHA 4CN6A 3L3JA 4WGWB 3UTTD 4PJ5B 2QQNL 5KOMC 2ARWA 2Z91B 3RNKA 2JELL 3PWPA 4OGYH 4JZNB 3VFTB 4D0BA 4L3ED 1KN4L 4Y1AE 1GZQB 5GGUB 5IFHH 1VEMA 5I19L 4LK4A 3TIDA 4IIQA 4WEBL 1DFBL 2H32H 3DTXA 3M1BA 4GMSL 5F9WB 3IKKA 2IH1A 5C0EB 2D7NA 3LKRB 3EJYD 4KUZH 1OM3H 4P46B 3G5XB 4RRPA 4XMLH 1ZLWH 4C55A 4ELMB 5GRJH 3KLHD 4TSAH 5C0RH 1U2CA 2IPTL 5FIEA 1R0AL 2FJFB 2H6PB 5F1OB 5C0AB 2W0FB 4K7FA 2ITCA 4R8WL 1FZJA 3UTSE 4U7KA 1UQSA 2VLRE 1C5BH 5E7FA 5IIEA 1BQUA 4FZ8L 1R3JB 1FHGA 5L0QC 4APQD 2IG2L 1GOGA 2OJEA 4Z78B 5JQ6L 1AO7E 4HKZA 5F96L 4NFDA 1B88A 2JB5H 3WHE1 3C6LA 4OCYH 3ARED 4K8RD 4NC1C 4WFEE 3RVWC 4Y4FA 1BWMA 2NTFB 3EO1B 1W0WB 5ILTL 5T3ZH 3DRQA 3F7PC 5SX5H 1LK2B 3SJVD 5F7UA 3NCJH 3JV4B 3JV6A 5ERWB 5B3JF 4ZTOL 3DX8A 4HIJA 1HHHB 4HFWB 1OAZL 1CD1B 3HNVL 1LDPH 3BWUC 5D7IE 1BD2A 3VXRA 3DXAD 4HKXB 5K9JL 3EKCA 4HIEB 4UDUB 3WIHL 1BP3B 4YHIB 3O6FA 5F6IC 1MCIA 2WSKA 4O5LL 2CK2A 2GJ6D 3VXQB 1PZ5B 4MYWB 3UAJC 5JIPA 3RZCD 3BDBA 3HZVB 2CQVA 5GGUA 5J6GA 4Z8FL 5TE4L 3N0PB 3UO1H 3VRJA 2UWEA 3HZKB 4PD4J 4NC0B 4JFDE 4DW2L 4FQIH 4Z7VB 5CP3A 3OG4B 3WHXA 4PG2C 4X98A 2VQTA 1IC7L 4H88L 1UH4A 4XNYL 4HK0B 2QQKH 2Z92B 1BIIB 4L5FH 1MJ7H 3GO1H 5D9SB 3OPZH 1XF5B 4OBSA 4E0RB 2R4RH 3U7WH 4WENB 4XXDB 4DUXA 2DQTL 4EI6A 1KYOK 4PY8I 4P0DA 4F15C 1C08B 2IH3A 2ICEA 3QJHB 3VXPA 3KPRE 2HJKB 3HS0A 5EOTA 1A1NB 1KIRA 3VD9A 1N5YL 3O4LD 3IDYB 5CBEB 3VFOA 1JPGA 1QFWL 5B22A 3FT2A 2AABH 1YYML 5ESQB 3SKMA 2IQAB 4DUWA 1S7SB 4HD9A 5ABDE 3UXFA 1LO4L 5GSRB 2R0ZL 5DZLA 2ED8A 3V79C 4QHLA 2OQJA 5C09B 4LKCA 1T21A 3PWNB 3GJEA 2XWTB 1Z2KA 3FFDA 4P2QB 1DUZB 4PYGA 4ODTH 1A6UH 2ZCLL 4LRIA 3ET9F 4WWKD 4L8SA 3V52H 2IQ9H 4JDTH 4WUKL 2OR9H 4S1DD 1ZANH 1F4WL 1EZVX 3BKYL 4M7ZC 2XN9A 1A6ZB 4CU8A 2X70A 4DUVA 1GAFL 3MUHL 3RUGB 2XZQL 3AU1B 3QR2A 2W0LA 5KTEH 4ELME 3QNXB 2H3NB 1BQLH 4TUKH 5F7DA 1T03H 3DETD 3L7EB 3R1GL 5C07B 3CZFB 4M43H 1FSKC 5C0EA 4RMUA 4NYLA 5HJ3B 1UWEL 4M62H 1BLNB 1MRCH 2IPKB 3ZT7A 1CXHA 3D0VB 3WFBH 2CLRB 1QNZL 5DUPH 1GIGL 4FFVC 5E99L 2V7HB 4U1HA 3SOBH 5KSBF 1LO5B 4O9HH 1C7SA 2GJ6E 4JQXC 2AV7A 3EYOA 1IKFL 1OHQA 1K8IB 1ZS8B 5IIEB 1ZT4B 3MJ9A 4Y2DC 1OPGL 4YFDB 3IFNL 1JE6A 4YXHL 1SY6H 3VFOB 1YQ2A 4N8CL 5EO0B 2NY3C 3HR5A 3TYGH 4PJEF 5JOFB 2C3VA 2XPGA 4OZIE 1CLZL 3ARBC 2OTWB 3H9SA 4JM2B 5GGRY 5C0NC 1U6AL 1EHLL 2A77L 4WI7A 1RJLB 2YOCA 4JRWA 3I6GB 4P59L 1S7RB 3PE9A 5MP6H 1ZGLB 1YEIL 3WJLC 1YEGH 1S9WA 2GIYA 2Q8BH 5DK2A 1U92B 3T2NH 2D0FA 2KBGA 4N1EA 4Z18A 1VPOH 4APQA 4JFYA 4N8VG 5IK3A 3ZYJA 4M1CD 3E2HB 1CICA 2X10A 5M7QA 4I5BB 1HCVA 1ND0A 3PWVB 2EXYD 5B39A 3JVGC 5DHXB 1YEHH 3VD5A 5I1GH 4YR6A 2DOCA 3FMGL 5INDB 1PZ5A 4LSSL 4UNTA 1FL6B 3KR3L 1UXSA 2RJMA 5EPMA 1OAXH 3P40A 1A6VL 3FN0H 1U93A 4YO0A 1BJMA 3VFSA 1IC4H 1TZGL 4M02A 1JF6A 2UWEB 4LVEA 4G6KL 4RIRB 1KELH 4HS6A 1TVDA 5EU4B 5T3XD 3RZCA 4X8JA 2IPKA 4HIIB 3V0AC 1CDCA 2DJ4A 3HI5H 5GRVL 5HI4C 4HJ0C 1KPVB 4DZ8A 2J8UE 1BECA 1MWAH 4OF6A 2VQ1B 4MDIB 3V6FB 2AV7B 1JTOA 3F58L 4ZOAA 3HA0A 2YKLH 3BESR 4U6XB 3T65A 2DM2A 4F37K 5AZ2H 2YR3A 4D8PA 4LLMA 2EDWA 4LCWA 2IBZY 5IW1B 5BRZA 4YHML 1CT8B 2LTQC 5TPWH 1EBPA 1G1CA 5CIPH 4QF1A 3KPRB 4DK6A 3MA9L 2IFFL 4Y5VC 1NCCL 3BAEL 2F5AL 5DJXB 3ARFC 3U9PL 3WXVL 5KS9B 4JM2A 2VIRA 1FNEA 1V7ML 3AS0A 4FOMA 3I3EA 1ZGLA 4R0LB 1MQKL 1A3RL 5DVLA 4J8RA 2X4UA 2DS4A 1KENH 3MFFB 2C3XA 5JQHC 1CK0L 5CAYB 3T2PA 1J1OH 1XIWC 3X3GL 1DUYB 5I66A 4IMKC 2WNGA 3D69A 4BSVA 3ORJA 3H8NA 5IHLB 4WO4D 2O5ZL 2VN4A 4GRWB 5FYKD 3TGXA 4P3WA 4OFYD 3V6OC 2AW2A 1IEHA 1U91A 4XPBH 5GRJL 3RGVB 4FS0A 5GSVB 3ZKXC 1JYXA 4L9LB 4Z77B 5L7XH 5I75B 2E7LC 3X12B 3MXWH 2XQYK 4DZBA 2DTML 1FC2D 1A9BB 4PJCA 4YXKH 1IAOB 3T4AB 1RZGB 2HT2D 3LSOB 3FN9A 3PABA 2OTUB 2MJWA 3T0ED 3JVGA 4I3GA 3LAFA 4XP1L 4BK4A 2WWMD 3BYTA 5HDLA 3BPLC 1MCRA 4LQFH 4LOUD 1UZ8A 4ZD3L 3FO1B 2DN7A 3J8F7 2R39A 2H1PL 3QJFB 3L3OA 1N8ZA 2N1KA 5JPNA 4ZFFB 1JZ5A 3EYUL 2RB8A 5E6ZA 1HH9B 4LCCA 1FGVH 4LSVH 4ODVL 2WIIB 4XXCA 2A9NL 3QDJD 3QI9C 4FMKA 4IRJC 2XZZA 1IGTA 4FXGA 5IVXA 3MMEA 4BK5A 4C57C 5ISZE 4U0RB 3NTCL 1TVBA 5IMLA 5EZLA 4QF1B 4GRWF 4YAQB 5FUZH 2HT2C 4NO2A 4R7NA 4YHKL 3VFVB 4XP5H 2D03L 2Q76B 5K9KB 3HPLA 4HUXB 1DBKH 3MREB 4Z7OE 3TWCL 4PJAA 5KS9E 4ODUA 2E6JA 3PWJB 5HHPA 5HPMB 2EE6A 2VDRL 3OKMA 1X5FA 4R3SA 4U6VH 1JUFB 2CK0L 4ZOBA 3THMH 1DANT 1QVOB 4P9MH 5E2TH 2C1PA 1D5ZB 3CC5B 3O2WH 4WVRA 3AFLA 3D25A 4TVPD 7CGTA 4JM2F 5MERA 4LMQE 3IJHB 4WI9A 3A67L 5T3ZD 4NHCL 3O11A 2ID5A 2XYCA 4JHAL 3HRZB 5C7XL 3SDXB 1FZOB 3U36A 2VAAA 4R2GD 3ARBD 3KNBB 2B4CH 1BGXL 4QHNB 1V5JA 2X40A 2YRZA 2V2TB 4XP6H 4M7KL 5JXEC 5EU3B 4NBYB 3NH7H 5J3HD 3AMKA 3MACL 4AEHL 3QQ9D 3WFDH 1KTKE 4U49A 2VNCA 1BFOA 4IEFB 4G6JH 5KSBB 4NN5B 4R7DA 1M1SA 5ICXA 1FYTD 2EIEA 1VSCA 5LVEA 3MGTB 4OFDA 2LU7A 5FA3B 3T2OA 1MCPL 4I0CC 4NKIL 1I1AA 5IQ9B 2YPLA 4MX7A 2D3VA 1QA9B 3O9WD 1JWUA 2WUBH 4YHPA 5BZDA 1F90H 1GPOH 2CGRH 3UTOA 1QEWB 5JOEA 1CGXA 2OLDA 2WIIA 5GRYA 1H3PH 5EZIH 5EOQH 2C3HA 2JIXA 3KPQA 3LEYH 5C0RL 4GRMA 5EZLB 2AK4B 3T0DA 4NZRL 3ULVC 3DUUA 4Y19A 2L7JA 5ITBH 3V0WL 1TJHL 2HKFH 5BXFA 4U1IB 4XZUA 3MRFB 2XZCL 4JPWH 3MBXH 4W6WB 1YEFH 4XPFL 3K46A 5ANMB 2G9HA 4KK6C 4JRYE 1IAKB 1D5BA 4Y2OA 2BNRB 1U3ZA 3PWJA 4QWWD 5HHPB 4M6OL 2F9BT 4HWZA 4LLQB 2HVJA 5C6WH 1UZ6F 4JANA 3CZJA 2JJTA 1LHZA 2F19L 2UY6A 5D5MA 2VERN 3DV4A 3HC3L 1JGEB 5E94B 3IDGB 3TZVA 3KPPA 1R3IH 3GMOB 5EIIA 3TV3L 5HD8C 1X5IA 5DR5L 3V0VB 3NCYS 3W0WB 4M43L 1J7VR 3Q3GB 5DYOB 4UT9L 1H15A 4G8FA 3OGCA 5HY9B 3WKMH 4N8VB 5AUMB 3TBSB 2HKHH 2CRIA 2AJVH 3X12A 4QRTB 1PW3A 1VFAB 3FO2A 2YA0A 1AR1C 3QDMB 4DKEH 5BS0B 2ZOLB 5DUPL 3MZGB 4CJ1A 4JVUA 4XVUD 4OZIF 2IMMA 4JN2A 4K3DH 3SE3C 1U8KB 4MDJA 2AEPL 3O41B 1QR1A 2X6MA 4BFEA 4Y8DC 2GSIB 1OT1A 4OFYA 5HI3C 2YBRB 1BFOB 4ZOCA 4D0DB 5KSBA 5FO9A 5IB3B 4QO1A 3VGFA 3D2UD 1LNUB 3O8XC 5L2KE 1NL0H 4LLYA 4IMKA 2FB4L 4RISL 4MX7B 1U3HB 1NC2B 1XH3A 3BUTA 5FECA 4KVCH 3B8SA 5DDHB 5CEZH 4BZ1H 3PWUB 2J5LC 4Y5YA 3X14B 1EH9A 1GCFA 2DYPB 1RUKH 2X1PA 4CBPA 4OD2B 3L5WA 1YEIH 2B7DT 2EYTA 3MMEB 1YEGL 4OKDA 1PSKL 4HK3J 1FZMA 1I8IA 2D7MA 2YK1H 3KYOB 5J4MA 3ARBB 4UT7L 4PJDA 2VAJA 4B7LA 3H9HB 1KG0B 1LP9F 2EDRA 2B2XH 1L0YA 1UCTA 1LMKA 3QG6B 5FGBA 2R0LH 1F97A 3MRFA 4JG1L 5E00B 2EYSB 4EKXA 4M3JA 3RWGB 1LE9A 3VXMD 1T0NA 1G9EA 2F54B 1IT9H 1XGTA 4ODXB 2D7QA 5GXBB 1HZHH 3FFCA 4LRNH 5ESVB 2VL5B 5EZOH 1AI1H 4PY7B 1HHKB 3ZKMC 1T04A 5DWUH 1CZ8H 3RNQA 1W8NA 5C0GB 1HYSD 3BKJH 5B38G 2GJZA 5J13C 1WAAE 2DQHH 2VXTL 5C0IB 4Z9KB 4WU5B 4H25B 3L3DA 4GKSB 3UBXB 1UYWL 4RAVB 1KPUA 1BAFL 1YNKH 2R2HB 5AZEH 3RIAK 1LEGB 5IUSA 3I85A 5I76B 5F9OL 1GYAA 2VXUH 3OGCB 3BVNA 2DQEH 5MERB 4P2OA 4FQQA 1CL7H 3BPCB 5C0JB 5CJ5A 4Y4HD 5CEXA 4OIIL 3PQYD 4JFDB 3GRWA 2IANE 1KJMB 1FL3B 3QQ9C 2VXQH 1Q0XH 4HUUB 1NJ9B 4OM1H 5EZJB 4U1LB 2DRUA 3GMQB 5JNYB 1WIOA 1ZT1A 4N0FA 2BVPA 4KRNA 4D0DA 4LCUA 1RULL 5INCB 4K3HA 4HQQH 1BWWA 3ARSA 5DA0B 3MLYL 4NN7C 4F7MA 4MMXC 43C9B 1V05A 4WI5A 3RIFK 3CGTA 2VDKH 4UBDD 5T1MB 3INUH 2Y5TB 2EDKA 5LCVH 32C2A 4CGTA 2EEDA 4JFFE 3BZDA 1F11B 1UA6H 2VE6B 4JB9L 5LGHH 3QULA 3WIHA 3V5HB 2F74B 3TCLA 3RBGA 4Z7VA 5DZNA 3MJ6A 4ZSOA 5FM8A 1WWBX 3HC4H 1KB5A 5C8JB 3ARBA 3EW3B 2VLKA 3MFGB 2FEEI 5EBLB 1PX3A 4DN3L 1YECL 3W9EB 1LE9B 4WHTB 4LBEB 4LFHG 1YMHA 1MRFH 2IAMD 1CD8A 1NMCB 1MUJA 5MEPB 2WAHA 4LAQL 2I07B 5ESVA 1XR9A 3QPXL 2DBJA 4NO3B 1ACYH 1UH2A 3PHQA 3L1OH 5FOBB 3RNQB 2R2EB 2EIZA 3ALWA 2QV2A 4OLUL 1I8LA 3QI9D 3HR6A 2Z8RA 4PJ8D 4X4ZA 2ZUVA 4H1LG 4NUJA 4XCCL 2I9LA 5CD3B 1OF2B 3QIUC 5JW4N 2DJSA 1N0LA 2OM5A 4KDTA 4HIHB 3C6LD 3MUJA 1MCFA 4I9WE 1QRND 3VW3L 2AEWA 3B4NA 3S35X 1H5BC 2X89A 4IHOA 4ZFZB 5B38A 5H37H 1R0AH 3IJYB 1UG9A 3V6ZA 1RIVL 1I8KA 4TTGA 4KQ3L 4K2UL 5TGBB 4G6FB 1S7XA 3DUSA 2NY7L 4HLZH 2OYPA 4JY6B 5FA4A 2JCCF 4GXVL 2JF1A 3UEZA 4DVBA 5JO5B 1HQRA 4S1DC 4TVSa 3ISWA 1OP9A 4BA8A 1GJIA 5IMOB 1A6TA 1DEDA 5I1DA 1KT2A 4G8IA 3VGHA 4MNGB 3Q6GH 4Y0GA 3OGOE 4ENEC 3RKDC 3TFKD 3CFEB 5LG1A 1B4JH 2V2XB 4BSWA 3BGMB 4U1KB 4DFIA 5J0BA 1NEZA 1P6FA 2C3WA 3QUZB 4WHYH 2P7TA 4Q74A 3MV01 4XBPB 3T0BA 2O5YL 4M93B 5A3IC 1X6NA 3D9AL 1A6UL 1WGOA 1G6RB 1Q9KA 3G08A 3WJJC 1RHHB 5F3HB 5IT2H 2H26B 3M8OL 4MSWB 4RA0C 1BX2A 2W92A 2CIKB 5FKPA 1NANI 3H3KA 1OD9A 3PHQB 3BKYH 1RY7B 4PJCF 3BZ4A 4KKAD 4PR5B 4KUCF 3KLDA 4YHNA 4N90E 1MEXH 1KBGL 1HNFA 3FB8B 2XPGB 4PGEA 3SPVA 1ZSDA 3P4OA 4F37F 1UJTA 3B9AA 3WV0A 3MLSH 1ADQH 5H8DA 4ZUSA 2P8PA 2NY2B 4KK5C 5DGQA 4M62L 1MFAL 4PRBA 4MQ7A 3CSYB 5GISH 3WDJA 4C83A 2FJGB 1E4XL 2IALB 5ALCL 2YWYA 3NZ8A 5ESAA 3L3KB 5GGVL 4CW1A 4QOKE 2F8OA 4LHUA 4PRNB 1BM3H 3E6FA 4P2OD 3RVXC 3TM6A 2PUQT 4U1LA 1U8NB 4P5TB 5DJ0A 2PTTB 4OSUH 1T20A 5C0CA 2FSEB 5JO5A 4W6YB 3F7VB 3AREC 4K8RC 1P7QA 4QRPA 4JFHE 4DAGH 4WDIB 5E8NA 2H41A 2VZTA 2XWBA 4QXTA 4Z7QF 4KK5D 1A7BA 4JZNA 3VFTA 4U2YA 2W9LA 1RMFL 3NGBB 4KHTH 3UMTA 1GGTA 3VFWA 2NMSA 4IJ3C 32C2B 5ICYB 1GZPB 4GQ9L 4U7SA 2UZIL 3RAJH 1EUTA 5B39G 1AD0A 5CGTA 1BFVL 5C0AD 1FIEA 3CVHL 5F9AC 3W5NA 3FQTA 3O9WC 1S8DB 2EZ0D 1K6QH 4ZSOB 3FQXA 1XGUB 1RUMH 2NR6D 3H0TB 4MA7L 4NHUA 5F7WC 3CFCH 3P4MA 1KPVA 4JKKA 1OSPH 3PP4H 3V95A 4DZ8B 4HEPG 4YXLL 3O6ML 4OLWH 3S4SA 3MBEC 4XXDA 1J1XL 3FT4A 4I2XB 2XWJA 4R8WH 1FGVL 3QRFM 5HYFA 1C08A 3TN0D 2E27H 3MV8D 3VU2A 2VH5H 3OKLA 5T3XH 1WEJL 2MTPA 3ZTNL 4P2YA 3SKOB 4X0KB 4NN5C 1CE6A 3TC9A 4UTBH 4KVNL 5D7IF 2JB5L 5HI5D 5ACZB 1KPRA 4NZJA 1SBBA 4MVBC 4YHKH 3MRRA 2A6DA 5GS0C 5GSRA 2GJJA 5TFSH 2CMRH 4F9LC 1J0HA 3MNWB 2PXYA 4ZUSB 1EHAA 4BH8B 4Z6AT 4J6RL 5D71L 2NY1B 2FGWL 3QI9A 5JR1L 2FIKB 3TBWA 2HTLC 1N6VA 3WUZA 4HXBH 4QRRD 2V5RA 3K8LA 4PJFA 3ULVF 4GRLA 1KEGL 3E8UL 1QBLH 1QSEE 4JVPA 4KQ4H 1D5IH 4YDIH 4FHBD 4ETQA 5C0CB 3SKNA 3D1MC 3F7VA 3HE6B 1JYVA 4ODHH 3EGSA 4S1QL 1HQRB 3RPIB 2LV4A 4L9LA 1DQDH 4Z77A 1WBYA 5KZCB 4JGUA 5JHDD 1OTUC 4P5MA 3A6CL 5DQJA 1C1EH 3DYMA 1N64H 4GSDH 3JXAA 2X89D 5GHWH 5E6IA 3HZKA 3OHXA 4L1HA 4MZ3A 3E0GA 3QDGB 1NUDA 2FECI 4HZLB 4XRCA 1T89C 3F12A 1EEQA 4BSWB 1UB6A 3BGMA 4U1KA 2Q3AA 3BEWA 1OLLA 2Z4QA 3ZT5A 1FBIH 1F4XL 3O45B 1VGEH 1J5OL 1I7UA 4PJ8A 3P30H 4OF8A 3WSQH 3OPZL 25C8H 3QEQB 1KB5L 1SVCP 4XB8A 5C86A 4OCWL 1MCLA 3LRSB 3IXTA 3FCTA 4Q6IB 4M3KB 5FKPB 4PJ9B 2Z31B 1I7TB 5E4IA 2XZAL 4KKNA 5CP7A 3ROLB 4P4KD 3VXUA 2R1WB 1LO3H 4X0KA 5DFVC 3EZ8A 4DKFH 4FQLH 1KPRB 3SN6N 3FO0H 1S5IL 1CVSC 5ESQA 1AXSB 4Q9QL 5EU6B 4P4KC 3N1PC 1GGCL 5IHZB 4NRYB 3LV3B 5CSZA 4G6AD 4FQCH 4HCRH 3ZHLA 3RWIA 3EO0A 2ARJQ 4OJFL 1ZLUH 2F8XC 1QSFE 3OKNB 4LQFL 2QADC 5DC0A 1OQOA 4I48B 1Q9OB 3V4PL 3EOAA 1R24B 1TXKA 2ARJA 4LLAA 2ZKHL 3AAZB 3GSUA 1M6OA 1R5VB 2YMXH 1YEJH 5E1AB 4JZOA 2EC9U 2X5PA 3GSNA 2YKLL 1BEYL 1QKZH 3QDHA 2XT1B 1CDGA 4NKQB 5IBTL 3CXDL 2DMBA 5DUML 1QFOA 4KK9D 5AZ2L 4N9GB 4OZHB 3WMSA 3HRZA 4QXTB 1LILA 1CFBA 1K5NB 3V4UH 5D72L 2FBOJ 5B4MC 4QY8A 5DF0A 2DAVA 1PKOA 1WVZA 3DUHA 4MS8C 5FUZL 3TIDB 1Y0LB 3U9PH 2V2TA 3EJJX 3OHXB 2NW2A 3MR9B 2W65A 1G7HB 3NCJL 4RWYH 5EA0H 3UTZA 2HLFC 3S34H 5DD1H 3QFDB 4RMSA 3F5WA 4C54A 4HIIA 5IB1B 5IMMA 2ZJSH 1YN6A 3H0TA 4WJ5A 4JZJA 3TT1H 4BQ8A 1P4LB 3M45A 2AQ3A 1DL7H 1UWGH 4EIZC 4KU1A 2EXYC 4NQSB 1HDMB 4Q97A 3ZDYF 3K2UL 4JFEE 5GS1A 1ZHBB 1JGLL 2I5YH 5JHDE 4P99A 4X7SL 1I7TA 3SE4C 1FAIL 4OB5L 5C08D 4M5YL 4JHAH 7FABL 3W0WD 3MODH 4HH9A 3O2VL 3TNNB 3KPRA 1NAKH 1CFQB 4RGMC 4LGSB 4EN3A 3MRGA 3RI5K 2B2XL 2NTFA 3EO1A 4XP6L 1TETL 5SV3A 4GG6F 2QQLL 3RZWA 3GMMB 1DQLL 4PRIE 4UV7L 1AXTL 3GMRA 5IVOA 5E8EB 2KKQA 3DBXA 1RJLA 4XP1H 5CS7A 3TFKC 4N0YL 3N1MC 2P8LB 4U3HA 1ULVA 5FO7B 1DVFC 2APBA 1NQBA 3PXJA 1MHPL 4GOSA 1T2JA 5EH1A 4EZMA 2AXHA 4B53A 4JFOB 4QWWC 1NFDA 2H1PH 2M26A 3VE0B 1U92A 4XNUL 3VI4E 2JK5B 3P73A 5ITFB 3BO8A 3S5LB 3BZEB 2PXYD 2CKBA 2P5WA 2J3SA 1TJIL 3WFCH 3UP1A 5K33A 4MA3B 2QHRL 1SEQL 3MRKB 1Z0MA 1ZHKA 1NBQA 3NFNB 3W81A 5LBSL 2GSGB 4H1LB 1MCHA 4OI8A 1QFWH 2DKSA 3V0WH 1NCTA 1XR8A 2OI9C 2YHGA 4JN2B 2R29H 2FEDC 3VXUE 2EEAA 3NZHL 4L4TE 1CFVH 4G6KH 3MBXL 4F57H 1RPQA 2DDQH 5K9OA 3LQZB 1MRDH 4JPKL 1A4JA 2X9XA 1KLUB 1A0QL 1UB6B 2R1YA 2FX9L 5DRWB 4PJXA 4MQTB 2XQBH 5DMJB 3OKDB 5EB9A 4RGOL 1L7TH 3SDAC 4MJ5B 1U3HA 3T77A 1DQTA 3ULUD 3IJSB 1MSPA 2BC4A 3TCXA 4PJGE 3O2WL 3MRBA 2D7PA 1KC5H 2LVCA 1RZJH 5C0CE 5DK3A 5I1LA 2BVOB 4WUKH 3VXNB 3TN0A 5GISL 4V2BA 3OXRB 4EI5D 1FLTX 1SJHA 4D8PB 1S3KL 1PKQA 1QLFA 3ZE2E 3TT3L 3MA9H 2APTA 2X9WA 4RRPG 3QEQE 1SY6A 3LHPH 2HMID 5HDOA 1HSBA 1FNEB 1T03L 1O5DT 1DBML 4OQ1A 2FLRT 1MCEA 4Z7UF 1J8KA 4R0LA 4NSKB 3S4SG 3BP6B 1BZ7B 2VZOA 3HTLX 1OAZH 3HNVH 5GJSH 3X3FH 3WFBL 4YHOH 3RY4A 1LWRA 3VJ6A 4CMMA 3IFOB 1E6JH 4GW1A 4Y16D 4GQ9H 1XIWA 5D96C 3RAJL 2J8OA 1I3GL 4WWKB 3N1FC 3VD4A 4OZHF 1R5WB 4S10A 2E9WA 1RK0B 5HGDB 3VWJA 5SWSD 1T89A 2MQ3A 5L7XL 2P48B 3MUGA 4L8DB 1SY6L 3VFUB 5FKAA 5I1HL 1WWCA 3KDMA 4NQVA 4WU7A 1KB9J 1QSVA 5TF1H 1OARH 1T7YA 1QBBA 1RZGA 3LSOA 3GMQA 1Q9LB 2NW2B 1YEFL 3WLBB 5IGXL 3F6IA 1WK0A 4X4MA 4QT5B 2DICA 1AGBA 1MY5A 3L3JB 5J56B 2H9GA 5BVPH 4TNWK 3PL6D 5HYSG 3C5ZB 3IETB 4R26H 4U1SB 5F7EH 3S96B 2P5WE 2OL3A 1MI5A 1T1XA 4ONOA 1LEIA 1QA9A 1V3LA 2AQ1A 3IDNA 3L3OB 5T1LA 2VSDA 5FCSH 4J3VA 1B2WH 1JFQL 2JB6A 1JNNL 2QR0A 5FYKH 1IAII 3QULB 1NBYA 4UQ2B 1U95A 4JO1H 2P5EE 1YEHL 5BW7A 1U8HA 2O5YH 4KC3B 1X5YA 5D6DC 1HIML 3MNVA 3VXUD 5ITBL 1LO2L 2UVFA 1A7PL 5SWQB 3ZO0A 3R8QA 4RAHA 1D5IL 3OTTA 1FZJB 4WHTA 3VWKC 5HVFB 1DDHA 1LD9A 2R0ZH 1IAIH 1IEAA 1MIEH 4OD3L 4XMKL 3BGFC 3QQ4A 4K07A 4L9DA 1CWVA 4G80B 4PRHA 5D1ZC 4PP1D 3SO3C 4U1NB 2DL2A 5AYUL 3QHFH 4PJEA 4EOWH 4XVSH 3UJJL 4ORZC 5FHAH 1JUFA 1HHGA 2WP3T 2YRLA 2J8HA 3HFML 3QG7L 4OV5A 1V7NH 5E2TL 1EMTL 1OAQL 3W0WA 3D48R 3QIBD 2AJYH 3STLB 1T66C 3S35H 1X5AA 1YN7A 3SY0B 2DWDB 3VXSE 1JWMB 2HT4C 3IU3B 3T09A 4P5KB 2ICWI 3SGDI 1DLHB 3PV6B 4L4TB 2YXFA 4GKNA 5GRUL 1J5OH 1UC6A 3KJ4C 1DBJH 1M05A 3BT2L 5EIQA 4YO0B 3EYSH 5K59E 3MRJA 3KNBA 1MHHA 1KCRL 5F9JA 1OP3K 4JG1H 4X9FA 2AEPH 5BQ7A 5F8QC 3V2AR 5D7LE 2GSIA 5D4QA 3AREB 3P9WB 5I71B 2APWA 2EECA 3C9NB 1UWEH 5ACMA 1HKFA 1FO0H 3BW9A 4M1GH 3F8UB 5L2KA 4NWUL 4LLYB 1T1XB 5FGSA 2VLRB 3MGTA 1I9IH 4HEME 4JQXA 1SBSL 3PL6B 1QPPA 3AC0A 5CEZL 5M95B 4HC1H 1I1AC 2VJXA 1QEWA 4ZODA 3P11H 3CX5J 2V2WA 4Z0XB 3T0EB 2OS7A 5DJYB 4L8CB 1CGSL 2N4IA 5LKNA 3O3EA 2EKSB 2WBJC 2LFGA 3IFNH 4YXHH 2BOBB 3OXRA 3DX6A 5BS0D 1DSFH 1I85C 1MELA 4PFEA 2CO6B 4JPIA 1OSPL 3ARVA 5EO9A 1IKNC 5TE6L 3S3SA 3QNYA 1ZEAH 1FL5A 3RWGA 5DJDB 4IDLA 3LPFA 3V9FA 1D3CA 2Z35A 4KZEL 1G9NL 4NIKB 1GHFH 2HP4A 4LNVA 3JWDL 3FQWB 5B8CA 4M5ZH 2RR3A 2F15A 1MLBA 1SMAA 3MX0A 1KIRB 1T2QL 5DMKA 1FFNB 3BOVA 4P3CH 3ULUC 1NCAL 2MNUA 3DMMC 3MCLL 4N1CA 4N0RA 1JP5A 5HDBE 3SKMB 5E6YA 1I85A 4RAVA 4LSRL 4I2XE 1N5AB 3L3IA 1XIWB 2E7BA 1HXMA 2GAZB 1YZZA 1U8OA 4LASL 3C2AH 1N7MH 4LDLB 3SY0A 4GXUN 4QHLB 3MRCB 3P4LA 1R5WA 3QCVL 5JXED 3DECA 5H94B 2NYYD 3WN5C 2I27N 2ZJSL 3QEUA 3NZ8B 4E42B 1J05A 1UWGL 5JA9A 4OM1L 3RVUC 5JNYA 4K8RL 1T7WA 4U1GB 3H9ZA 5I8KL 4PYHA 1P7HL 5IOPB 3NIDE 1JGLH 4X8XA 1RULH 1OGTB 5C07D 5I71C 3REVB 5KVDL 5DJZB 3CMOL 5HGAB 2Y5TA 4FXKB 5MI0B 1NCUA 2FO1A 5DEFA 3IDNB 2N56A 4JHBA 3WL9B 4JHWH 4PLOB 3CMGA 2GTWA 3CFBA 1XFPA 2E9IA 5MEQA 3E3QC 3O3EB 4LF3B 3VW3H 4X6CB 2YZ1A 1EK3A 1U8LB 2NX5E 2RCSL 1W72B 1ZAGA 3QIUB 4KTDL 4X6DA 4BM7A 3KPSA 3B5HA 3GMPB 4Q0XH 3P4MB 4YK4B 5F3BB 5DD6A 4AZ8A 5BZWB 4ONHA 3WLWC 3KPSE 1JHLH 1FH5H 2R2BB 3HB3D 3I6LE 3GHEH 4EDXA 4HWBA 2NW3A 4FQLL 4U1NA 3VA6A 2C9AA 4MAYD 3GRWL 3C60C 4OKVB 5IB5A 3PG2A 5TDOA 1XCQA 3WKNA 4V1DA 5I16B 1YNKL 2FZ3A 4Y5XB 3D25B 2ADFL 1LEGA 2EO9A 3TO4C 1NH6A 3STLA 4LQ1A 4Y4KA 1QRKA 1CDYA 4FQQB 3IGAA 4RNRB 4PRHD 1A9EA 3DHJA 3VI3F 4QHMB 4U33A 2ADIA 2WANA 1IGYB 2JJVA 4JRYD 3BHBB 3RHWK 3FHQA 1CU4H 3HNSL 3DV6A 1Y6MR 4NN7B 1MVUB 4B5EA 3MLUL 5EWIL 4GUPA 4RMQA 3HG1B 4TSBH 4X7DC 4AM0B 1A7RL 2BXZA 3MV8A 3WO4B 4HCRA 1KULA 2ITDA 3EGSB 4U0QB 3REVA 1KNOA 5DJZA 1JMXA 3G6DL 3DURB 3UTSA 5EPMB 4S11A 2EDOA 1T7VA 2HFEB 4JGJA 1INEH 3MV9A 3QUYC 4X4YA 4OZGE 4IIQB 1HQ4A 1IGJA 5CZXC 1UM5H 1DBBL 1RFDH 4JCLA 4TVPH 1ADQL 1BJ1J 1LEKB 1B0RA 4U6HA 1TJGL 1CLCA 3DRTA 3KJ6H 4QXUL 4XP4L 5J6HA 1I7ZB 3U0WL 5KAQG 1KCUL 3KPOB 2Z92A 2CRYA 2GT9B 3G08B 1WCQA 4OZGF 1WSST 3TA3A 5C0AA 3JWOC 1CXEA 3TF7C 1CIDA 5E1HB 5DC9B 1IM9D 4N9OB 1YNLH 4DFHA 2YPVH 1HI6A 3V7MA 1IAKA 4NNYA 2BVQA 3SGDH 5I6XB 3T8XA 4WI2A 1LP9B 5L8JB 1DQDL 4MS8D 4XBEL 3MCG1 4PBWD 1VCAA 3A6CH 4MXWH 4X4ME 1T5WB 2XA3A 5H2BA 5SX4H 2DKMA 2R4SH 4IRSC 2COQA 3FRUA 4PD4K 1SHMA 2DLFH 4Y5VA 5DT1L 3C09B 4OLVH 4M1DL 3D5OF 4GRLD 2HN7B 4YGVA 3MLTB 1OP3H 5AUMA 3WJLA 3MYJB 3ALPA 4G9DB 1P7KB 4XPHL 3RY5A 1PG7H 2B8OT 5C2BL 5H94A 1EBAA 4O2FA 3JTTA 2GYSA 1CD1A 1IBGL 3IJYA 1MCQA 5DI8A 4Y5XC 2ZG3A 1MHEB 1PAMA 4RBPK 1JMZA 3C5SA 5F7LB 5E1AA 3MOAH 5EULV 3SDAB 3GB7A 1EAJA 4HC1A 2JIXD 1ZK9A 5F1SA 5J11C 1ZWIA 1KOAA 1N6QL 4R4NC 3O2DH 2A1WH 3QDAA 4WFHE 3DX7B 4ZYKA 5I15L 5IB4A 2NXZD 3CSBA 3HUJF 2F54D 3TPUA 2DQHL 4R4ND 3EJYC 5MENE 4MNQD 1Y0LA 3BQUB 3DYOA 1RK1A 1NGYB 4KKCD 1GC1H 3WS6A 4PRHE 5C07A 2HJLA 4G9FE 3CFEA 1OY3B 1BD2D 2HWZH 4X98B 2CKBH 3QH3B 1NAMB 1I7ZA 3OXSB 2ORBL 4DN4H 1NSNL 3D0VA 4OIIH 3I02A 1B3JA 1RVFH 2DM3A 3GK8H 4UU9B 5KSVB 1MF2H 4IBLT 3MV7B 5D9SA 3RU8H 3QG6A 3HE7C 1Z6JT 4NOBA 3M8OH 4N5ED 3LKNA 1HH9A 5MI0C 2X9YA 3SDCC 4XPFH 3HI1B 4HMDA 3VXPB 1BX2B 3MCKA 12E8H 2VL5A 1ZLSH 3WIIL 5HDBF 1AC0A 4KKAC 3X13B 5IVXB 1O7SA 4M9PA 3N85H 4H0IA 4LDOB 1RJCA 1H9VA 1S7UA 3IFLL 4Z5RB 3FO9A 3DIFA 1NGWA 2F19H 4S2SB 1RURL 4L8SC 5DD5H 2OTWA 4OZGB 4FQPA 4PGEB 2JJWA 1IGFH 1C16A 3MRPB 4TOYL 2YN5A 2NXZC 1MJJA 1YPZB 2GFBA 1MCOH 4NZDA 3I6GA 1MCBA 2EH7L 4P2OB 3I3DA 3G5ZB 5HGBB 2ZPKL 3LN9A 2HH0L 1A9EB 1PY4A 2HMIC 1RJYB 4AQ1B 1I9IL 5E7BA 4OCSH 2AXFA 2NNAB 4MD4B 1NJ9A 3TVMB 4Y4KD 4KRPC 3GUTA 4NM8L 1QBLL 4QHUA 4X4XA 5EU5A 3SGJA 2FH6A 2BJML 3O4LA 3BZEA 2X4QA 2F53B 3CLEL 3O6LH 3P9MA 4MXVF 1ZWIB 2WMPA 2Y7QA 3V7AG 4CADB 2Z91A 2VISA 3RPIA 4OB5H 4QRRE 3HUJA 5F1IA 3LS5L 4PV9B 1NL0L 4P2RD 4JO4L 1AP2A 5HYJD 4JRXD 5I1JL 3MV9B 3QUMA 1OARL 2FH8A 3VI4F 4UV7H 5F7DB 3ARRA 2WINB 4X9HA 5D7IB 3QEGH 2EDJA 3VXSA 1GHFL 1CIUA 1YY9D 5CCKL 1ZA3B 5JOPD 1DBAL 4OM0L 4R7DB 3RDTD 2AJXL 1X5HA 1XGPA 4O00A 3WNNA 5DMYA 3UTQA 4YIQB 5GS0H 1IGML 5F88B 2QBWA 3K80A 3D2UA 2B39A 5LWYL 4AMKL 4S1RL 3QEQA 4WI6A 25C8L 1FG9C 5GS1C 2X4NB 4HJ0D 5HYQA 2YMXL 1KN2H 3U48A 3W5MA 4PS4L 2Y5EA 3LRSA 4I2XA 1YMHB 1P9MC 2QLVB 4PP2B 4TNWF 4U2ZA 3HAEA 2WBWB 5D1QC 1MAKA 1TJIH 1BJ1H 2OZ4H 3WFCL 5MEPA 4HFUL 4EXKA 1QACA 3GIZL 4FQ2L 5DMIH 3BP7A 3EOTL 4XCFH 3CLFH 1J9CT 4DGIL 3T8XB 4LLMB 3HLAA 2CRZA 5MEND 1J12A 1NCDH 3ALXA 3O3BB 4JLRB 1PKQB 1CR9H 1YUHA 1G7IA 1CXIA 3IB4A 2HJFB 2GQHA 3ZDYE 4ORGB 4RWHA 5AAMA 2KUTA 4N68A 3GHBH 4OLZL 4F3FB 1JNJA 1LK2A 2XN9D 1MFEH 1MJJB 1YPZA 3QCTH 1WUNT 4AEEA 4OLYH 4JFQB 1Z5LB 4GKOA 2FX9H 5IG7B 1MIEL 3ULSB 3UBXG 4MXVE 4NP4L 1LQSR 4NQED 2QSCH 5GZND 3LB6C 1EGJH 3DXAB 4JY4A 3DVNB 3CK0H 4LCCC 5DS8B 5J89A 3DGCR 4PJFB 4K3JL 4GQPH 4WW2B 4PGBB 3DO3A 4HJGB 4M48L 4PJ8C 4XTRD 4HPYH 3HNTH 2D0GA 1X9QA 1CXFA 2F53A 3ULVH 2XFXA 4POZD 5KSAB 3IF1A 4M7JL 4LSTL 1FVCB 4XC1H 2OR7A 3H42L 4MCYA 2IPUK 3O0RH 4WFFD 2DI7A 4YR6B 1DANU 4ONFL 2PYFA 1YA5A 2AV1B 1FORL 4LU5L 5HVHC 3FO2B 4W81A 5D2LA 3BKMH 4NQVB 2D7TL 2FBJH 4Q0XL 5BV7L 4I18B 2BOCA 4YE4H 1DQLH 2FNBA 4GBXA 1Q9LA 3RGVC 5D7SH 5DHYA 5EA0L 4RWYL 4HS6B 2E6QA 1AGCB 1D6VH 5DURD 1F3RB 1XGPB 4UIMA 3G6AA 2A6IB 3NFPA 3QXWA 1T3FB 4JZJB 3P30L 4YHOL 1I7UB 4G6MH 4XXCC 4OCWH 4L4VA 5C6TH 1NFIA 5KOVC 2ICEB 3QJHA 3P11L 3MROA 4R0LC 2BVUA 4K3GA 4HIXH 1MH5A 4FXGB 3EDEA 4NPYB 1ACYL 1XCTA 3DYPA 4JFEA 4PUBL 1DSFL 1NLDH 3KPMA 2YD2A 3DIFB 4NJ9H 8CGTA 4JQVA 4PJDB 3RBSA 1U8JB 4LCWD 5BRZD 4Z7UE 1UM4L 1J8HA 2CIIA 2EDNA 5FYJH 3VFGH 3G5YB 4UNVA 4LEXL 1NEZG 5IHBA 3W0WE 2OQJB 3GJFH 4QKXB 1A7RH 3BMWA 1BZ9B 5EDXA 3LN4B 5D1QA 3TVMD 4PY7A 5JQ6H 1ZXQA 4HLJA 4YGAB 3FFDB 4Z76A 1U42A 3T04D 4WWKC 3T2QA 3Q0HA 2MHAB 4QOKA 4XWGL 4RA3A 4QHUB 5T3ZL 3IYLW 3LVEA 2R15A 4PTUA 4JFXA 4TVPL 3GSNB 4ODWA 3HAEH 1S5HA 5FV2A 2V17H 2DWDA 1ZHKB 4QRSB 5F97E 4NQCE 5ADPL 2LVEA 4FQHB 2EDFA 1H0DB 1J88A 5GPRA 1HK6A 1LDPL 1NFDF 4YBQD 2CD0A 4FQ1H 4PGZA 3LHPL 4UNUA 3QXAA 5ICYA 4P23C 4MD0B 3E6HA 3P0VL 4J4PD 5I8KH 4ZQKA 1P7QD 1RZ7L 3PJSA 4QRPD 4YBQC 3U0TA 5FM5O 5HYJA 2OCFD 4JQIL 5DD1L 5FF6B 5JR1H 2NXYB 1MI5E 43C9A 4R96B 5AYUH 4WUUD 2VLRD 1LO5A 4WGVB 5IT2L 1YC7A 3QG7H 5JHLH 3DTXB 1HDMA 2VE6A 1CD0A 2A0LC 3GBLA 3DOSA 1NDMB 3OKLB 4OV6F 2XTJC 1F8TL 5LXGH 1F13A 2AK4A 5K59F 2FIRT 1S3KH 2DLGA 3B9KD 3BH9A 5E0QA 4UB0L 2A73B 5JOFA 1PDKA 5FGCE 1MJ8L 3RWCA 1KJ3H 5SX4I 4U1IA 1HSBB 3WO3B 1JHTA 3JUZA 3R06A 4JFPB 4PJHB 4Z7NE 1WV7T 2UZYB 3IDUA 4KKCC 5IGXH 2AJUL 5ANMA 3S5LG 4BH8A 2BFVL 1KXTB 4JFZL 4LARL 4LGRB 4JREC 1KJ2L 1N5YH 4QRUA 1FPTL 4AEIH 1NMBL 4HKZB 2M2DA 4L3EA 2MWCA 5CJQH 1HXYA 3CNKA 3MV7D 1YY9C 2GK0B 2DBLL 1ZHNB 4F7CA 1N5AA 3L3IB 2FATL 3SKNB 2JE8A 1FN4B 3H3BC 3HZMA 5B39B 1UKTA 1MCNA 1N26A 3PF2A 3OL2A 1A6PA 1QOKA 4UOW1 4MVBD 1PKQE 1IL1A 1P4BH 3BUYA 3OJVC 5IR1B 1X7QA 3OB8A 1H8NA 2ZG2A 4E42A 5D2LB 4DGVH 2VC2H 5TF1L 1ZEAL 2CXGA 2DLIA 4P49A 1GGIL 5I17A 4K9EC 4YEEA 1JNLH 4KI5D 3PJSB 1TPXC 1ZLVH 2OR9L 4LHUG 5B3JE 4FTVB 1T22B 1W8OA 1LNUA 4XNMA 2QSTA 3AROA 4RDQG 3SE4A 1X4XA 2DQCH 4X80L 3ZE2F 1LEIB 4S0TD 1BMGA 4NBXB 4P3CL 5F7HA 4Y2DD 4YXLH 2V5MA 1BREA 3CX2A 3LDBC 5EC2B 5IHUL 5D7JC 4U1JB 1FYTA 4AL8H 3O4LE 1RZJL 4Q6IA 3EO9L 4XAKE 1VEPA 4OZFB 4YPGB 1NEZB 5CP7B 4OGXL 1D5MB 4EUPA 2P7TB 5KSUB 4XPGL 1RUQL 1DBJL 1PLGH 3UJTH 1WCBB 3RVVD 1U0QA 5IEKA 4OZHE 3RGVD 4IMLB 4CMHC 5CZVH 3QDGD 2DLEA 4NZTH 3GNML 1F3DH 2VDML 3O6LL 3WNLA 5FUOL 2VR4A 1U8QA 1G9MC 4LPWA 5SWZE 4JFED 4DK3A 4R4BB 2FGWH 4L4VD 4WI8A 4LLQA 3G04B 5KVFH 3FT3B 2YEZB 5JHDA 3FT2B 4PJHF 4F58L 2R4SL 3IU4L 4DVRL 5TDOB 5I18L 1I3GH 1KCVL 4QRQA 1CBVL 3P0GB 3BVNB 1CFNB 2G5BA 5C2UB 2BSRB 3QEGL 1CQKA 2CDFA 4QTIH 1IC7H 4H88H 5E2VH 2BRRL 2YD8A 3PWNA 5DRNB 2W0PA 4Y88A 2OL3H 5I30H 3MA7A 3CH8A 5HHOE 5ESAB 4CW1B 1IEBA 5HGGS 5K9QI 2B20A 3AM8A 2EEBA 4XPTL 6FABL 4CRPA 1IZKA 1A3LH 2R4RL 3FONA 1DLFH 4YDKH 1G7HA 4BUGA 2CKNA 3GSWB 4J3TA 4O2CB 4ZQKB 3HKFA 1IZJA 4JDVA 5DUBB 2R0KL 3OAUL 4LCUB 3C9NA 3P77A 2MFNA 2QQQA 5E4EB 1UZ8B 5I1GL 1CXKA 2DQIL 2W60B 2CUIA 4K3EL 3VGDA 2JELH 1WIPA 2X70B 4OTXL 4YC2B 4NQSA 2AQ2A 3GZKA 5CKAA 3R8BB 3STZB 4OCXL 1YEDA 5DHVB 1CFSA 2VOTA 3ARUA 3QCTL 3TCLB 5TF0A 3V6OE 2BSTA 4KK9C 5E08L 4P46A 1SEQH 5GS2H 3BYYA 3RWEA 3LMJH 1A6WH 4MA8H 1G7LA 1JBJA 4GS7B 3K1DA 3GM8A 4PJBE 3TH3T 1UZ6E 3H3PH 3MLXL 3AXLA 1AIFA 3WE6A 4A6YB 2P45B 4ZFGL 5JORA 1A7PH 3RL1A 3H9HA 2O93L 2Y23A 3RU8L 3L5HA 5D2LE 1W72L 4K7FB 5SWQA 2CLZB 2K9UA 4Y4HB 5LQBL 3BRDA 3S4SB 1FL5B 1GGCH 4RMTA 2YSSA 1HYRC 5CGYC 1UJ3A 3WNPA 1XR9B 3VMPA 2NY0B 3ILQD 1DQJB 4ISVA 2DWEB 5CEYB 2XQBL 1TITA 5L8KB 5C0GA 1NFDB 1JJUA 5IV2B 3C8HA 1RUAH 1P2CB 3QFJA 2HLAB 3RWJB 5ILTH 1INQA 1BZQK 4RAUA 2IPUG 2ZUYA 5DEZA 4MB3A 3ZTJH 3T0XA 3QNZA 2ZPKH 2KQNA 3B9KA 4N0CD 4LIQL 4GW4A 2PTVA 1WZ1L 3HZYB 3FQUA 4GKNB 3T3ME 1CK0H 1WBXA 3QDGE 1A4KA 1MAML 5J1TC 5L88L 1UT9A 3L5XH 5HHXH 2ZSWA 4ELMF 3QRGL 2Z0BA 4APQB 1VACA 5IK3B 3LQZA 1AGFB 3TA3D 5FM5M 4GG6B 3QIBC 1EEYB 5IM7B 3TNMB 2A2QT 2B5IC 4J4PA 3DMMD 1QUNA 4P3DB 5SWZB 1S7WA 2B0SH 3BSZL 2OBGA 5L2KB 3FQRB 1YDPB 1WBYB 5GQBA 5LJYH 5J6GB 5GGTL 2BERA 4LPCA 3WL9A 2IBZX 4EUPH 4GMSH 3RIAF 1U6AH 4G42B 5C07E 5F7NC 4WEMB 3MC0A 1FFOA 3MV9D 4PJCE 2V2WB 3GKWL 2UUDH 4WV1A 5HHOD 3MRLA 3BIKB 4XMLL 1MLCB 2WIMA 1D9KA 3F65A 2NY5L 3O9WB 4GRMB 2CH8A 1BIIA 2Q8BL 2Q7YB 2VL4A 1EVTC 4AMKH 3GO1L 3T2NL 2W1NA 4Y5YC 4NKOA 1XF2B 4UDTA 2P5WD 2YD4A 2FWOA 2DM4A 1CLYH 1A5FL 1RUPH 3NGBC 2VYRE 2NX5D 1UJ3B 4YHZH 4TSBL 1N4XH 3QFJE 1HOCB 4JY5L 2QQNH 4UOJA 3CUPA 4M5ZL 1EFXA 2OXGA 5DHVH 3KYMB 1RJZB 1I75A 4M1CC 2EIZB 2DLHA 4P2QE 1R5IA 3HE7A 2J6EH 4JR9L 2FL5B 2QADD 1INEL 4ZO9A 4J1UB 3C8DA 5C0BD 2VXVH 3I3BA 4HMEA 1NGQH 3L95B 2DQUH 2BNQD 1NEUA 1JNNH 1C16B 1KCSL 3GBMH 3KVQA 1IQDB 5E5UB 5ERWA 3C2SA 3KJ6L 4RNRA 3WN5B 1CS6A 1INDL 2NY2C 4IHOB 5EU7E 4ZFZA 1P9MA 2GI7A 1HEZA 5I66B 2NCMA 3EDJA 3WLBA 4KK8C 2HVKA 3QP3A 2YBRA 2IANA 12E8L 4ZXBC 5CUSL 2AKRA 4M03A 4ZDHB 4WDIA 1U58A 5E8NB 3TIEA 1U91B 2XWBB 4PLJD 3FQRA 4YHMH 1CG9A 1KCKA 1EHNA 5ACLA 1UEYA 4L8BB 4POZC 1JF1A 4E41D 2D7TH 2FBJL 5C3LD 4X6CE 4AG4L 3QNXA 1GZPA 4M7KH 5HYSA 5DEGA 5E24E 3C6SB 1CQYA 1IGJB 2QR0B 2FR4A 3U7YH 3CZFA 3R1GH 3X14A 1AO7D 3EYVA 1B0RB 1T7XA 4IM8A 4X5XB 3I75B 1XGUA 4WV1C 2VDLH 5HTSA 2ED7A 3QFDA 5MHSE 4K71C 1C5CL 1JWSB 4OCRL 1MCPH 1QNZH 5E5MA 2IAMC 4JKPH 4RX4D 1NCBH 4R90H 2RAMA 1UACL 1ED3A 4LCCB 4PLKD 4PJIE 4PP2A 3P9LA 1JZ6A 4PJDE 2EE2A 5DRXA 3QUYD 1M4KA 4HXAL 2IGFH 4MJID 1N3NA 1LE5A 3S97C 4PBXA 3HLAB 4PJEB 1DN0A 3KPLA 2DTMH 4TVPE 5AWNL 1CFQA 1DEEA 4FP8H 1PYWA 3SPVB 3GMNA 5EBGA 5EOCL 2IADB 3MRNB 2Q76A 2CSPA 3KLAA 3RL2B 1CGSH 5DXWA 4G9DA 3ULSA 5HI5C 3B9KB 3QI9B 4ZD3H 2FJGA 5CZKA 3NPSB 5KVGL 2XKSA 5F7MC 3DSNA 1MHEA 4DKDC 2ZCLH 1UM6H 3BN9C 5IHUH 3IDMA 2DJUA 1FYTE 1AGFA 3GSXA 1K2DB 1G0XA 2J12B 1CTNA 1IFHL 4I0KA 5H35B 2FRGP 5F7YC 3VH8A 2V9RA 1I8LC 2FSEA 3JWDH 1I3RA 2M1KA 1UFUA 3H9SD 3FOMA 2X1XR 4MAYC 2V5SA 5D2NA 3N85L 3NFNA 1ONQA 4MLIA 4D0BB 3ZYZA 3U46B 1QHPA 2PYFB 5IB4B 3CJJA 3WYRA 4N0UB 1G7PA 2AABL 4DEPB 3RHWF 5HYSB 4KKBD 1OSZA 4I0PB 1T5XB 1AGEA 1N59A 3WD5L 2D9QB 4PJ7A 2AGJH 5D6DA 3VXRE 4PRPA 1TJGH 3BEWB 5DQDH 2O26U 1XT5A 2GITA 2QSCL 1TENA 3G6AB 4Q9BA 1JWSA 1RVFL 5FA3A 1K3ZA 5K9JH 4Z7QE 1WAAA 3THML 1HWHB 3D3VD 1QRNB 4KRPB 3HNTL 2CRMA 3SGKA 1XGRA 2O5XH 2W9DH 4YDVB 3FFCE 2LAGB 4Y16B 4AYFA 2OJEB 4Z78A 1A7OL 1RJZA 4ONFH 4R2GC 1CE6B 1J86A 3QIUD 5TE4H 2C3VB 4NQEA 3W2DH 2VIRB 2W38A 3IT8D 1YEEH 4KHXH 1B0GA 1WFTA 5F1NB 4TRPH 4DGYL 1J8HB 2KDGA 1AHWB 3ES6A 4YDKL 3RWIB 1DR9A 2PXYB 4KTEH 3U6RA 4ZS6C 3S88L 1I7RA 2X7LB 1MJUH 4MQXC 3RY6C 1BIHA 2YD6A 4KV5E 1JZ4A 4GBXD 2DQIH 4KK8D 3N9GL 1F6FB 2WUCL 3U0PB 5DK2B 2EE9A 3P4NA 4MD5B 3EYSL 2PF6A 1KCRH 3IDMB 5EUKA 1KSRA 4GAJL 4IRSD 2BP3A 1I9JL 3GB7B 5IOPA 2G75B 1QBML 1TQCC 5EN2B 3L3GA 3ARYA 3QUML 4M1GL 3ZMRA 2C7UB 4QRRA 4HSQA 5C0DB 5HGDA 4N9GA 1JGDB 2E8YA 2F53D 3LEXA 3VWJB 4LCIH 1R3HA 3MXWL 3X11B 2F58L 5HGAA 4X5WA 2HRPL 2A0LD 3PDDA 4PRPE 4ZUVA 3GRWH 5HXMA 4Z7WB 5BS0A 4G8IB 5F9DC 4DGVL 2ADGA 3B2VL 3V4VL 1XF3A 4LEXH 3NIFF 4NFCA 1QR1B 4OLYL 3L7FB 3V8OA 2H9GB 1FVDA 1J1PL 4CDHA 1HCFX 2XY2A 3C5ZA 5IB1A 1EGJL 4NZUH 5AYQA 3QJFA 2BRQA 1C8PA 1RHHA 4FA8A 3MJ9H 4DQOH 1NCWL 4K3JH 3KAAA 3OR7B 4MCZB 4EI6B 4ZOEA 4PRDB 1F4HA 1PBYA 4R97C 3MLUH 5EWIH 1PGRB 4BFGA 3NABL 1JNHA 3WFEH 1U95B 1F4WH 3QBTB 3QUXA 4NO5A 2XIDA 5JZ7D 1ZVHA 4OGXH 4R6UA 3F7YA 5A2KH 3K4AA 4YHNB 2Y06H 1NGWB 4XNXH 1GAFH 2CUMA 3MCLH 1DEEB 1YECH 2PCPA 4F3FA 5ADOL 1H3XA 2OSLA 5I0DA 5E00A 5HVWA 4PJHA 2ZCHL 5E8EA 3VG9B 2OI9B 4Y4KB 4J3XA 4XHJC 1MY7A 3HN3A 1N7ML 1FGNL 4MQ7B 3RL2A 5FO7A 3QIWC 4HS3B 2LAAA 3ARDD 3TH4T 5HPMA 2VR5A 1Q0YL 3MRMB 3BSZH 1IGYA 4LAJH 2VDRH 3U0PA 1PFCA 4HWNA 2VXSH 3LH2H 4L3EB 1OP5H 2AXFB 1CICC 3E6FB 4UTAH 5DLMH 4BQBA 4HT1H 4DVRH 4P9ML 4O9HL 3RPKA 4GKSA 3CC5A 2CKBB 2P5WB 4M61B 1U8NA 1MVUA 3T08A 3NCCB 5EUOA 1GGUA 1C7TA 4ZUTB 4BQCA 3V5KA 3OF6D 4H8WH 3IAQA 1YN7B 1FN4A 2Q6WA 3VH8B 3BPCA 3QHZH 5C0JA 1JCKA 4Z7WF 1WAAF 1R3HB 1DVFB 35C8L 2XTJE 4NJ9L 3TYGL 1ITCA 2B4CL 3T4YA 4XPTH 4Q2ZA 5JW5B 3WEXB 3CDFA 3QWQB 3QUMB 4JHWL 5DT1H 3ZE1F 3MJ8A 3CU7A 2FYYB 2YC1B 2NY7H 1AKJD 4AEHH 2RFXB 2K3TA 1YJDC 1B9ZA 5D7SL 5I73C 5FYLH 4PJXB 1A3RH 3OKDA 1FNSL 4K3EH 4XNMB 1T3FA 3DPBA 5IMKB 3QYCA 5F44A 1RZJC 1EFQA 2EDYA 4XWGH 2VXVL 3IJSA 1ZGLM 1OCWH 2IF7A 5EC2A 1Z9MA 2F53E 2P44B