3HECA

P38 in complex with imatinib
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
348
structure length
329
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of imatinib and sorafenib binding to p38alpha compared with c-Abl and b-Raf provides structural insights for understanding the selectivity of inhibitors targeting the DFG-out form of protein kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 105
structure length 329
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hecA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hecA01
2VTLA 3BV3A 2WMUA 4GG7A 1XH4A 4UXQA 1GY3A 5CY3A 3SW4A 4EEVA 5FDPA 3R7UA 4IAIA 4TW9A 3FI8A 1SZMA 2YIYA 5JQ5A 5HKMA 1FVVA 5HCZA 4ACCA 5IG1A 2XIYA 2VWYA 2ZV8A 3MA3A 4F0FA 3EZRA 3GEQA 5EOBA 3ZZEA 2QOKA 4TYEA 2R3KA 2C5NA 4WBOA 3SQQA 3W55A 3ROCA 4E6DA 3W2OA 3TXOA 2X1NA 1R3CA 1Q4LA 5E8SA 5A14A 4XP3A 4ZTHA 1ZYCA 5KBRA 3CGFA 2QO7A 3MTFA 3D4QA 1XR1A 5HU3A 4NSTA 4UBAA 1YXXA 2OG8A 4FTQA 5CF5A 5L4QA 4BBEA 4ZP5A 3NVMB 4UWCA 5HX6A 4ANBA 5CNNA 4NM5A 4AE6A 4AGDA 4YJQA 3PSBA 1Z5MA 4EOIA 3CQWA 4BDKA 3EQRA 1H24A 3RALA 2QO9A 5M08A 1H00A 4MVFA 3QCXA 4L53A 3FQHA 3ORKA 2HAKA 1Q3DA 3D9VA 4IZAA 4X6RA 2WGJA 2VZ6A 2QR7A 4MK0A 4FT0A 3DBEA 4AX8A 4GFGA 5EYMA 3QFVA 4JBVA 2ITOA 3DBQA 3A62A 3MDYA 4RIYB 3ZO4A 2OXDA 3OMVA 1JKLA 4C34A 3DTWA 4TRLA 3MIYA 4LM5A 5LVOA 1P14A 3WBLA 3C9WA 3HNGA 2RIOA 3EH9A 5KE0A 4MNEB 3L9PA 4YMJA 2ITVA 3FSKA 4EOJA 2PUIA 4W9XA 3G33A 2C3LA 2JIVA 3KXGA 2VN9A 2YWPA 5LCKA 3TNIA 4F6SA 2CSNA 2YDIA 4ID7A 4B0GA 5EFQA 4O7YA 2QKRA 2I0YA 1NT2A 5BVDA 1BYGA 5K3YA 4RX7A 2C5OA 2OJIA 2J5FA 2WMWA 3ET7A 1YVJA 4X0MA 5JFVA 5KO1A 1IAJA 4CG8A 4AUAA 4FIHA 1J7IA 5FEEA 5D1JA 3ZEPA 3CPCA 3ROYA 3RGFA 4QMPA 5FM2A 2UW4A 5AIKA 4QTDA 3OCTA 4ZSAA 2P2HA 3R00A 3PZHA 4CLIA 3DKGA 2QLQA 3P0MA 3I79A 1KE5A 3TUDA 2X81A 4P2KA 4CXAA 1OGUA 4I5CA 4Z16A 4NTTA 2Y4IB 3PY1A 4I6BA 4OTRA 5JH6A 1G8AA 2WMTA 2XB7A 3F5PA 2WXVA 4IDVA 4NW5A 1ZYDA 5CALA 2P0CA 4FUXA 4TWNA 3ZSGA 3LFCA 2OIQA 4EK5A 2XNBA 4EL9A 4O84A 5AV1A 3A8XA 4KIPA 4RA4A 3QU0A 3VN9A 2ONLC 1CKPA 4RIYA 1S9JA 1V0PA 3EQHA 2WMAA 2WMXA 5CU3A 3WIKA 4DFXE 3FUPA 1HCLA 2C6EA 2X7FA 2XIKA 4GSBA 1DI8A 2BIYA 4F1OA 2R3OA 5IA0A 5ANJA 4YC3A 4B7TA 4BCOA 4DEBA 3KRLA 4V01A 4YHFA 3W18A 4QP2A 2UW8A 4NM7A 2V62A 4ACHA 3D0EA 4V05A 3EYGA 5LWNA 3BQCA 4F7LA 3LCOA 3R22A 3BYMA 3VS7A 4EONA 2BVAA 3Q4CA 1GIIA 2XEZA 3IS5A 3P9JA 4TY1A 3SD0A 3EMGA 4KSQA 2C5VA 4FV0A 4FKLA 3R83A 4WD5A 3NUSA 3QD3A 4BDHA 3AC8A 4I0RA 1A9UA 5FM3A 4IWOA 2VTMA 4YJPA 4CKJA 3KCFA 2IVUA 4RMZA 4DLIA 1ZYJA 2QONA 5CSWA 2JBPA 4NW6A 3WYYA 3BWJA 5AUZA 3VRYA 2ZYBA 4JDHA 1JKTA 3A4PA 3OTUA 4LMUA 2E9OA 5L3AA 3U6JA 2YACA 3G6GA 4P5QA 3ULZA 5AWMA 3M1SA 4NJDA 4FIEA 4FTAA 3VS3A 4K6ZA 1YWVA 3E5AA 3GVUA 4B4LA 3W10A 2R3FA 2C6OA 4FKJA 3ALOA 4CMUA 4LFIA 4L44A 5HORA 3P7AA 5HVJA 1A48A 3WZJA 4DFZE 2JLDA 3PA3A 3REPA 5EHOA 4YLLA 1YDSE 2FSLX 5BMMA 3Q4TA 5BPYA 4R5SA 4IH8A 3RPSA 3MESA 5LWMA 4FG7A 4OTIA 4U7ZA 5JKGA 3DAKA 4MXAA 4RC3A 3LIJA 4EK4A 2I0HA 2WTKC 5AP6A 3COMA 4HVHA 3KU2A 4JG7A 4C58A 4AZVA 4Y8DA 1PXOA 3KXMA 5GZ9A 1IAHA 3NYOA 5BNJA 4WG5A 1NW1A 2HZIA 2E9PA 4EYJA 3AT3A 4KBCA 2J0MB 2QU6A 3V5PA 3FI2A 4YJUA 4FA2A 4DF3A 3WF8A 2GCDA 2UZLA 5AJQA 2A2AA 2PMOX 4FE2A 4AOTA 3RWPA 3VAPA 1Q5KA 5HD4A 1KUTA 3ORMA 3T3UA 5J9YA 3BYUA 2I0VA 3AT4A 4MXCA 2CN8A 2C30A 2BMCA 3KB7A 4E5WA 3ZFXA 4ZIMA 4C4IA 4FODA 4G6NA 4FKRA 2Z7LA 4W4VA 1YI3A 4W4YA 3LCKA 3RBWA 2X9FA 4U6RA 5HI2A 2Y7JA 3UC4A 4E8AA 3KN5A 3VS5A 2HXLA 3LXLA 4DITA 3UTOA 4FTRA 4HGEA 3ELJA 4R7HA 4MYGA 2YHVA 2CGUA 2ITTA 3U8WA 3KQ7A 3TDVA 3MVJA 3RWQA 1BL6A 1T46A 3LM0A 4WA9A 1ZZLA 2WKMA 4AA5A 3EQFA 5HVYA 2GQSA 3EN7A 3TKUA 3KMMA 1KV1A 4D4YA 4DEAA 3ENMA 4ACGA 4QTEA 5HNIX 5LVNA 4N4SA 3AMBA 3D5WA 2YCFA 3LFFA 5GZAA 2Y4PA 4BI1A 3RAKA 3CTHA 1XWSA 3QXOA 4L52A 5DT4A 3FAAA 2Z60A 3RK9A 3VVHA 4A7CA 3E87A 4Z3VA 4RGJA 1YHWA 3A7HA 4XOZA 3ZBXA 5AMNA 5IEYA 2PE0A 3KVWA 2QOFA 4JLCA 1ZZ2A 4UZDA 3LPBA 2O63A 3VIDA 4RRVA 3TEIA 3OCBA 4I1ZA 3PIXA 4TYGA 3O7LB 3CD3A 3Q9WA 2J0IA 2R3GA 2RKUA 2REIA 3GP0A 3PIYA 5HQ0A 4WNPA 4A4OA 4WG3A 1OL6A 2W1FA 4BFMA 3UPZA 5GIPE 3LZBA 3LMIA 2Z2WA 3FL5A 4FTUA 4H3PA 4U8ZA 5EM6A 3Q4ZA 1ZYSA 4RWKA 4RWLA 4FVQA 4YJVA 1Y8YA 4AFJA 2WQNA 3GQIA 3R8LA 3RAHA 4M68A 3IOKA 1KE9A 4CRSA 2Z7SA 2DWBA 2BAJA 2QI8A 3QQHA 4JDKA 4M14A 5BUEA 3F7WA 3NW6A 3POZA 4ZZNA 2WB8A 4JR7A 3ODZX 3RAWA 3K54A 5E9EA 4IVCA 4FVPA 4DTBA 5AA9A 3BCEA 3GB2A 1VR2A 4UWYA 1OECA 4O0UA 5LQFA 3ZC6A 3MS9A 4JVGA 2F49A 3NUAA 1OKZA 4ANNA 4CFXA 4I92A 3POOA 3LOKA 4KAOA 3VS1A 3R7OA 4JS8A 4E3CA 2JITA 4IX5A 4FSNA 4NCTC 3Q9YA 4L8MA 2X4FA 4YTCA 3PRFA 4XS2A 3IW7A 3TNWA 2WPAA 1V0OA 4JOAA 4S30A 4BCIA 1OIQA 3CLYA 4I21A 4DFUA 4PTGA 4DEEA 2EWAA 4CYIA 2VX3A 2ERZE 3QD2B 3VULA 2QCSA 1FVTA 4JJRA 4QP1A 4S34A 2WU7A 3P1AA 2GNIA 5AX9A 4I93A 3IDBA 1RE8A 3V6RA 3S2PA 3RP9A 1CMKE 3ETAA 3GU6A 3H10A 2BFXA 3PY0A 4AWIA 3HZTA 2X6EA 4JBOA 5HEZA 5FEDA 5ETIA 4EOPA 3R8VA 5A54A 3DK7A 4W4XA 2XNEA 4CTCA 1UNHA 2W1IA 2IWIA 2Q83A 4BCFA 4EHEA 3FMNA 5A3XA 2B53A 4D1XA 5IQGA 5H8BA 2C68A 4QYEA 4AW2A 5TR6A 4K18A 3L1SA 3Q32A 5EQPA 2XEYA 1MRVA 3V5LA 5AUUA 3QYWA 5CAOA 3Q9XA 4M0ZA 3UJGA 1ZY4A 2H9VA 4NZWB 5HGIA 3NCZA 2F4JA 1QPDA 4H36A 4EJNA 3I4BA 3OXTA 4DTAA 4F4PA 3NZ0A 4F6WA 2R9SA 4CMTA 2BRHA 4CFNA 4D1SA 5JK3A 3FLYA 2W05A 3AMAA 5CT0A 5IH6A 3CQEA 3RHXA 3TV7A 4IEBA 3VBVA 5DR9A 2VD5A 3FJQE 2BR1A 3OWKA 3PVUA 4HOKA 1BKXA 1F5QA 3QTSA 4L6QA 5CQWA 3W8LA 5DA3A 3IK3A 2QNJA 4FV7A 4FMQA 3ZYAA 3NIEA 1SM2A 2WMRA 2Y6OA 1OKYA 1M2PA 2QOLA 1UU7A 1OL1A 5I3RA 3FSFA 5AUWA 5J9ZA 5H9BA 4GV1A 3ODYX 5C01A 4EKLA 2EB2A 3FWQA 2GU8A 2QOCA 2HIWA 2HCKA 2VWUA 3TIYA 4YPDA 3E62A 3QXPA 4HYUA 4QYYA 2BZHB 4LUDA 2VAGA 4QP9A 3CPBA 2VTPA 4NTSA 5EQEA 3FKNA 4BKZA 3W2PA 4ZLYA 3WI6A 1I44A 5HICA 3B2TA 3ZEWA 4D1ZA 4YR8A 4KUJA 2VGPA 4E7WA 5CT7A 3O50A 2YERA 3D5XA 2QHMA 1O6KA 3NRMA 4UMPA 2CDZA 3P4KA 3HVCA 4DCEA 3HAVA 4ZS4A 5KCVA 5CZIA 3FLSA 2PMLX 4JAJA 4K0YA 4TWPA 4GFOA 5IA5A 3MH0A 2XK9A 4DBXA 3OG7A 1ZOEA 3HUCA 3ID6C 3TNPC 4BR3A 3EYHA 4ANMA 4RJ7A 2I1MA 3W1FA 5M53A 2R3MA 4D0WA 3C0GA 3OWPA 5KMMA 2E9VA 3PSDA 4WRGA 5BMSA 2V0DA 5AP0A 4ZMEA 4JAIA 4JX3A 3F5XA 3RZBA 3HP2A 4X2FA 3OW4A 4IB1A 1OB3A 3QLGA 3HV3A 3CGOA 2PULA 2QC6A 3FXXA 4KA3A 5LXMA 4EUUA 3D7TA 3EFLA 4UX9A 2PVJA 4NIFA 4IWDA 4RVTA 5J95A 3VS2A 4QQTA 4O21A 5L2QA 2J50A 4OAVB 3FZTA 3RK5A 4FYNA 2GQRA 2XK6A 3QHWA 3FI4A 3QLFA 3VS6A 2HY81 5HE1A 4WKQA 1LP4A 3UZRA 4W8DA 4QTAA 5IA2A 3D94A 2ZAZA 2YIQA 3DA6A 3FXWA 2WNTA 4M15A 4AU8A 4U3ZA 4R1YA 1W7HA 3QWJA 2UW5A 3UE4A 2PZ5A 3WIGA 3B8QA 4L43A 3PXRA 3TDWA 1MQ4A 3FMHA 5IPJA 3FPMA 3DBDA 2OICA 1B38A 1Q24A 4UWBA 5JFSA 3C4WA 1B6CB 4HGSA 1U54A 4IAKA 4RVKA 3GXLA 4WNMA 5EOLA 4O86A 3TIZA 1V0BA 3Q9ZA 4IVDA 3TN8A 5E8VA 4K11A 2YJSA 2R3IA 3K3IA 3M2WA 4XH6A 3SV0A 3TZ7A 2F7EE 2GNLA 3MFSA 3QRTA 3N4TA 4FSUA 5LMBA 4YURA 4BRXA 5E1SA 4DE4A 4I22A 5EQYA 2W9FB 4X21A 4BDGA 5B2MA 2BRGA 3FXZA 3ZSHA 4AA0A 1G3NA 2OGVA 2QG7A 3RK7A 3V5QA 4O7RA 3DFCB 1YHVA 2A0CX 4G16A 1URWA 5HLNA 1YXSA 3MB7A 5CF6A 4LV8A 4Z55A 2GNFA 2VWZA 4JL9A 3LFNA 1OBGA 3KREA 1MRYA 2ERKA 5H8GA 3CKXA 2W5AA 2GHMA 4U44A 4F99A 4HVIA 5JZJA 2G2IA 1H1SA 1R0EA 5B7VA 5F95A 2B0QA 3IGGA 5KMNA 3Q04A 4MXOA 5C1QB 5AA8A 1R1WA 2JDTA 1W98A 4DGMA 4AZEA 1IASA 3QD0A 4MF1A 4BDDA 4X3FC 5HCXA 3BX5A 4ASZA 5D10A 1FINA 3SG9A 2RFDA 2XS0A 4P4CA 5LMKC 3IGOA 3FEGA 4KIKB 1R78A 4WUNA 3FZPA 4PDYA 4EK6A 4IAAA 4B6LA 1OM1A 4XP0A 3UQCA 1STCE 4N70A 1MUOA 3DDPA 1YDTE 3C4ZA 3BGQA 3M11A 3V51A 5IQBA 1NVSA 2B9JA 4FT3A 2UVYA 2UZTA 2LAVA 2JAMA 4XEYA 4X2KA 3VJNA 2ZDUA 3QTIA 2XK8A 3Q4UA 1K9AA 3KGAA 4FKWA 4RIWA 4C38A 4C3RA 5KKRB 3AGMA 3DU8A 4AW1A 2XRWA 2P55A 4DHFA 5F9EA 4ERKA 4QMXA 5C03A 3MWUA 3NCGA 4IIRA 4OTQA 3QUPA 3BHTA 4YZNA 4O0SA 5A4QA 1FVRA 3R73A 1PXJA 2Y4IC 3KK8A 2YDJA 5AM7A 4K9YA 1P4FA 3WARA 2C3JA 5TO8A 1SVHA 5IISA 4BTFA 2BILB 4XV3A 5GHVA 2YAAA 2ZMCA 1WVXA 3HV6A 4YJOA 4C0TA 3C1XA 3VUGA 4FIIA 5IQAA 3IDCA 4E4NA 2XKFA 4E5BA 3SKCA 3IDPA 4DH1A 4I5PA 5A46A 4QMYA 3R04A 4TPTA 2C6MA 5H8EA 5FUTA 4P90A 1PF8A 4QD6A 5CI6A 4HVSA 2VX0A 4QMNA 3R0TA 5HVKA 2ZJWA 4ZSLA 2OIDA 5JRSA 2E9NA 3SOCA 4DH8A 1UA2A 2OSCA 3GUBA 4PP9A 4YZCA 5AV0A 4C4EA 4G3GA 4JIKA 4OUCA 4P7EA 2BCJA 1P2AA 4FOCA 5I3OA 2XJ0A 1L3RE 4UN0C 3MW1A 2JAVA 3W16A 5JQ8A 3PJ3A 2P4IA 5HO6A 3ZTXA 3QTQA 4FSWA 3M42A 4R3RA 4DG2E 4EZ3A 3ZRKA 1FGKA 4ZTSA 1YKRA 4GIHA 2W9ZB 4GRBA 2O8YA 2W5HA 4FX3A 4DT9A 2OU7A 2XNOA 1KOBA 3L8VA 1ZY5A 2CKPA 4X3FB 3DKCA 4S32A 3EFJA 3UVQA 2QQ7A 2UZVA 2XNMA 3DPKA 3F6XA 3R8MA 4F0GA 4PY1A 2PZYA 5JN2A 2X0GA 4YTFA 5EKNA 1LUFA 2OJJA 2V55A 2HENA 4M7IA 4PWNA 4UMQA 2WIHA 2NO3A 2P2IA 2W1GA 4GU6A 3ZS5A 5L8JA 3RMFA 2R3JA 4HW7A 1KE6A 3HGKA 3R9HA 3ZXTA 5A6NA 2OZAA 3MFRA 4JXFA 3ITZA 3E8DA 4GJ2A 5AP4A 1M17A 2CMWA 3UOHA 4FKOA 2PTKA 3QD4A 3AG9A 3ENHA 2PZPA 3UP2A 1U46A 1WVYA 4NM0A 3GBZA 2IZUA 3G9LX 4I24A 2BZIB 4GS6A 2XP2A 2GS7A 1XH6A 3DGKA 3FLWA 5FRIA 5GJGA 4D5HA 4EH7A 3DOGA 4GG5A 5I9WA 4EH8A 4FG9A 2EXMA 1FPUA 2ITPA 3KF7A 4IJPA 3U87A 4C2WA 4G5JA 3ZFYA 5AP1A 4L68A 5IQDA 4KABA 3PXZA 4BIDA 4QRCA 2WO6A 3KXXA 3N4UA 4HNFA 3DLZA 5DEWA 5ANOA 5ICPA 4K2RA 3VUKA 4O7TA 2R7BA 4ZY4A 2X2LA 1WBTA 3NUUA 3ORNA 3TM0A 2CCHA 2UVXA 3P5KA 3BE9A 2VO0A 4TYJA 2CCIA 4FT9A 2ZM1A 4D2WA 4FL2A 4BCQA 4YUQA 4JBPA 1A06A 4QP8A 3U4WA 1PJKA 4FK3A 2W4JA 4KIQA 4KNBA 3LCTA 4AE9A 4FSZA 5DBXA 4ZJIA 4Z9LA 1IA8A 2OZOA 4RVLA 3Q5IA 5DIAA 1DM2A 2YM8A 5HIBA 5CEIA 4C36A 3PXYA 5GIOE 3CS9A 3MVLA 3GCQA 2C6TA 5DGZA 4DLJA 4X7QA 4HNIA 2FH9A 4L9IA 2BTSA 4O1OA 1WCCA 3FZ1A 4QPMA 5M4UA 3PP0A 5AP5A 4RWJA 2BAKA 3NGAA 4GIIA 1XJDA 4XBUA 4HCUA 4YLKA 3UP7A 5CEQA 3EWHA 5DEYA 5GNKA 3UZPA 4FKTA 4F65A 1WVWA 5JGAA 3GENA 1ZWSA 4C62A 2BKZA 1OL7A 2C1AA 4FTMA 4HCTA 3UDBA 3HLLA 4D4RA 4EHVA 1YXUA 3LXPA 3PWDA 2PUNA 2GDOA 2YM3A 5AR5A 3WZUA 3BEGA 4BDAA 4ASEA 3GU5A 4JDJA 2UZEA 5I9XA 3KCKA 2ETKA 3EQDA 3S1HA 4H1JA 1J3HA 4DH5A 3FLQA 4FKQA 5JRQA 2CJMA 3Q60A 2OO8X 1LPUA 3TCPA 1W8CA 3GFWA 1GIHA 5H2UA 2O64A 4KKEA 4R78A 3KA0A 3UNJA 4J8NA 4YO6A 4ZOGA 3BYSA 3NYXA 3DJ6A 3P79A 4F7NA 4F9WA 3TUCA 3SDJA 4BB4A 4Q5EA 5GJDA 3MV5A 4ZJJA 1APME 1GZKA 5KX8A 3LQ5A 1CM8A 4QMLA 4IZ7A 2YLFA 4XHKB 3A4OX 4MEDA 1PHKA 2HY0A 3O0GA 3Q96A 4ZZOA 4OTGA 1Q99A 3QX4A 4XX9A 2PVHA 3L9LA 3RM7A 4OTPA 3CTJA 4IM0A 5BUJA 2BHHA 4RZVA 5FP6A 3TJCA 3QQGA 5FBNC 4C8BA 4V0GA 1SNUA 5A4TA 4YZMA 4AOJA 4MXYA 4BWPA 5IQFA 1J7LA 3SRVB 3LFQA 3VBXA 4O83A 3G6HA 3QZHA 2I0EA 4QTCA 5D12A 4USDA 2R64A 1PXIA 3H3CA 1FOTA 3NR9A 4YJNA 5AP7A 4E4XA 4ALVA 3BLQA 1Y57A 3HA8A 2XYUA 2FSMX 2CKQA 2VTRA 4PX6A 2XM9A 3PVGA 4U97A 1JOWB 5DT0A 5CEMA 3OEFX 3TNQB 1IG1A 1PXNA 2W1HA 3C13A 4MXZA 1U5QA 4FZ7A 4TT7A 4AQCA 2CKEA 4OLIA 3GC8A 3KMWA 3QZIA 4ZTMA 4H3BA 5CU2A 2XUUA 3RPYA 4BDCA 5KHWA 4QMTA 5M51A 4EI4A 4USEA 1SNXA 4I0SA 1OKWA 5EYKA 3O7LD 2QODA 2W1CA 3Q53A 4GU9A 4FEQA 4HCVA 1Q8TA 5DWRA 2XRUA 4RIWB 5E1EA 3PPKA 3VBQA 3QCQA 1UU3A 5JMSA 3CKWA 4GT5A 3DQWA 3Q2JA 3TT0A 4QOXA 4U79A 1NVQA 3UO5A 4PL4A 3COHA 3KULA 4FGBA 3ZFMA 3ZMMA 4BN1A 2FSOX 5FEQA 1L8TA 4QPAA 3SXFA 2GMXA 3ZLWA 4UY9A 1PMEA 3MH1A 3UOLA 3U51A 4AN2A 2VTAA 4FVRA 1K3AA 3QTZA 4IBMA 1YOMA 2OIBA 5BVWA 3GCPA 4O6LA 4CEGA 5AFVA 4F1TA 4OTFA 5CU0A 1O6LA 1ZRZA 2HW7A 2RSVA 3JPVA 4XLVA 4D2VA 4YTIA 4BVUA 4J1RA 5D7AA 5J79A 4MNFA 4FTOA 1JQHA 2VWIA 4Y46A 3PA4A 3AXWA 3AD5A 1JLUE 2FB8A 3JY9A 4ZAUA 4ZJVA 2QOBA 3GT8A 5DN3A 4NM3A 4EH3A 3PIZA 1X8BA 4O0XA 4BI2A 2YLEA 1WFCA 4E5AX 4OTDA 4QQCA 2G15A 4G6LA 2ESMA 3I0OA 4RX9A 4X6QC 5HO8A 4IANA 2YZLA 3O8TA 1H26A 3FMLA 3R8ZA 3I0QA 2JKOA 2YM6A 1U59A 4U45A 3NPCA 2BFYA 4UMUA 2B54A 1H07A 5EDRA 4L7FA 2P3GX 3FC2A 2XBJA 5HO7A 4D2TA 3COIA 4M3QA 4X2JA 2XIRA 3FMKA 4LV5A 4MQ1A 4HYIA 2ZB1A 5IQIA 4D2SA 5CAQA 2QG5A 3QQFA 4II5A 4ACMA 3D14A 3NDMA 4HZSA 4L3PA 1IRKA 3EIDA 5KZ0A 5C8MA 2GFCA 3UZTA 2CNVA 3K5VA 5AV2A 3FBVA 3CIKA 1M52A 4YC6A 4YLJA 1WBSA 4YNOA 4EQMA 4CQEA 1KOAA 1Q97A 4DFLA 3E3BX 3HMIA 3G5DA 4L67A 3BELA 4CZYB 4C3FA 2QOHA 4FIGA 2RGPA 4YTHA 4IVAA 5HHWA 5I0BA 3COKA 4GKIA 4EH6A 3ZCLA 5C4KA 3RCJA 3U6IA 3VJOA 2KTYA 4QMUA 2JEDA 4BWKA 4ZSGA 4CKRA 3FHIA 3OEZA 2X6DA 4BCHA 3BU6A 5H3QA 4XV1A 3P7BA 3E8NA 4XRJA 2DYLA 3E8CA 3QCSA 3A99A 4ZEGA 2W96B 4IB5A 4YZDA 2QU5A 2ITZA 4BDEA 4FTTA 4HVDA 5IUIA 3MGYA 1Z57A 3MY0A 3OROA 4XG7A 3ANQA 3R7IA 2VWXA 1M14A 5AM6A 5EH0A 3LCSA 1BX6A 2VV9A 5IF1A 3PYYA 5CVGA 4D55A 4D2RA 3IQ7A 2OXXA 3B8RA 2QURA 4I5MA 3OTVA 4YBJA 2GPHA 2HWOA 3OBGA 3ZBFA 2X8EA 3P08A 5C26A 4JRNA 4LL0A 5KMLA 4UYAA 1GJOA 3WOWA 2JDSA 4MWHA 4OBPA 5A6OA 2PK9A 4JBQA 5IMXA 5DHJA 2JKQA 2WMBA 4YHTA 4QYHA 2XCKA 3IO7A 4DGOA 2UZBA 3TTIA 3PXFA 5I5ZA 4XG9A 4S2ZA 2EB3A 4FV8A 5HNGA 2OLCA 3PSCA 4YNEA 4F9BA 4LYNA 1Q8WA 4MXXA 3RKBA 2PWLA 5L6PA 3W32A 3CJFA 2HXQA 2JFMA 5KZIA 3NNXA 3MYGA 5M55A 4ARKA 5HBJA 2IPXA 2IN6A 2ITYA 5EI8A 4CYJA 3QRIA 4DGGA 3BYVA 4Z7GA 3RINA 2Q0NA 4GK4A 4NH1A 4U0IA 2C5XA 4PL3A 4IDTA 4D28A 3OZ6A 3WF5A 4G3DA 3QGWA 5DH3A 4I4FA 4AGUA 4O0RA 4B8LA 3VUIA 1E1XA 2JDVA 4NFNA 3QQJA 4MTAA 4RA5A 3UPXA 2VUWA 2UV2A 3GNIB 5EM8A 3ORZA 5CENA 4IFGA 2R2PA 2YITA 3RVGA 5E91A 2XJ1A 4YJSA 2I40A 3SXSA 3WILA 5JFWA 4I23A 3TNHA 4BGQA 3CSVA 3IECA 4Q9SA 4I6QA 4NEUA 1PXLA 3DBCA 3BLRA 3VNTA 2UZOA 4TN6A 3FMMA 2QKWB 5HE2A 2FGIA 4FSYA 4J95A 3PP1A 4I20A 4HZRA 4IQ6A 4Y95A 3ORIA 2VX1A 2W5BA 3FPQA 4ALUA 5LCJA 2XNGA 3HRBA 4YGAA 1YXVA 3ORPA 5HESA 3MA6A 2VTIA 5BX0A 5M57A 4N57A 4FV3A 4HYSA 4HYHA 4A07A 2RFSA 4CRLA 4GFMA 4BDIA 2OBJA 3R9NA 4FV9A 3FC1X 4IXPA 2X39A 4IZYA 5K0KA 3LLAA 2OW3A 1OVEA 5L8KA 3E3PA 3GU7A 2C6IA 3AD6A 3R7YA 2VTQA 2WQOA 2OF2A 2WOUA 3PY3A 4UYNA 3SXRA 3HDNA 1XO2B 3DT1A 5J8IA 1OPKA 4QNAA 3VS0A 4FKVA 2E2BA 3R2BA 3RI1A 3BPRA 4G6OA 2HZ0A 3QZGA 1ZLTA 3HV5A 4U41A 2X7GA 5B0XA 2B4SB 2UW3A 2XCHA 4MBJA 4O0VA 4N6YA 3VUHA 4A4XA 1M7NA 2OI4X 3UYTA 4EH2A 4DINA 4ZTLA 4Y5QA 4YPSA 3BV2A 4YC8A 3DXQA 4MF0A 1IA9A 2J5EA 2BDWA 5DE2A 4XG3A 5M06A 5C9CA 3VQUA 1URCA 4FZAB 5A9UA 3NW5A 3G9NA 1JKSA 1H0VA 2VTOA 3ANRA 3PLSA 4GVAA 4Y85A 5G6VA 3Q3BA 5CASA 1UVRA 4EOSA 1PKGA 1BMKA 2JDOA 2C69A 4LGHA 3QWKA 3R6XA 1PMUA 5IDNA 4A9UA 4KKHA 5HLPA 2Z7QA 4TKSA 3ZUTA 5ETFA 5CAUA 3W2QA 2YEXA 4FICA 4E6CA 4RFYA 5FTGA 4IC8A 2W06A 4FSTA 3KKVA 3DQXA 4OW8A 4PTEA 4FK6A 4AN9A 2JD5A 3DNEA 2YM5A 2YIXA 5ANIA 2Q0BA 4BZDA 1W83A 4MCVA 4HVGA 3I7BA 2XNPA 4C4GA 5CQUA 3NUXA 3MB6A 4OBQA 4GK2A 4OAUC 1XH5A 1FBNA 4TNDA 2QOIA 4E6QA 4GUBA 1SVEA 2VNYA 5E8ZA 2X8DA 4RSSA 5KMIA 4FNZA 3O8PA 4FTNA 2ITNA 4DG3E 2WELA 4NYEA 1GZNA 3VHEA 3V3VA 4BDBA 1RJBA 1M7QA 1YI4A 2WOTA 2QO2A 3PJ1A 3AGLA 4C4FA 1BUHA 4OTHA 5AV3A 3LJ1A 3VC4A 1YWNA 3OCSA 3O2MA 3KRJA 4HPUE 4BICA 2PZIA 4K1BA 2O65A 4M69A 3QUDA 4BGGA 3LQ8A 3G15A 4EOMA 3FY2A 1XH8A 2NRYA 5BVKA 3TZ9A 4ZK5A 4YJTA 3UIXA 3VUMA 3ZXZA 3VW8A 3FMJA 3GCVA 3OD6X 5C8KA 4Y83A 3BHYA 3E64A 1QMZA 4QMSA 2BALA 1QPEA 5DI1A 5F1ZA 4J71A 4E20A 1QL6A 2W4KA 2A19B 4APCA 3TZMA 3P7CA 2R3HA 5J87A 3UVRA 4QMOA 5KUPA 3QHRA 3HMOA 5CU4A 3R1NA 3AC5A 2IZSA 5I4NA 3HEGA 1G5SA 3UGCA 5CEOA 4M97A 4CTBA 3ZM9A 2I7QA 4EC8A 3F3TA 2YAKA 1P5EA 2WTCA 3ZH8A 3BHUA 4ANSA 1VZOA 3SX9A 4G34A 4JQ8A 4CT1A 4F1MA 2XNNA 5E92A 1Y6AA 3AC1A 4ZLOA 4MBIA 3LAUA 3VBYA 4C4HA 2OK1A 3PZEA 4UXLA 1DI9A 1S9IA 3BGZA 3UG1A 3LQ3A 3CY3A 2C5YA 1FMOE 5DVRA 3ACJA 4JIAA 4DGNA 2O2UA 2UVZA 2XK3A 4E26A 4CV8A 3DK6A 4QT1A 4WT6A 3QQLA 3F9NA 2BPMA 1W84A 5DR2A 4NFMA 1JNKA 3A7FA 3LJ2A 3QA0A 3QGYA 2PVNA 4MKCA 5IKWA 4AFEA 3G51A 5J5TA 4RZWA 5IQEA 2J90A 1OPLA 2G9XA 3C0HA 3LVPA 4EWHA 3WF9A 3DFAA 3CJGA 3LFBA 2BRBA 4H58A 3RTPA 4PDSA 3FMEA 4LGDA 3HX4A 3BI6A 3QUEA 3BIZA 3PXKA 1UWJA 1YDRE 3KK9A 2WIPA 4XG8A 5CLPA 3RAIA 4ZTQA 4KB8A 3ZO2A 3C7QA 3MIAA 5EK7A 4IADA 4EKKA 4M66A 5E90A 1EH4A 3NYNA 5EM5A 4XG6A 4A06A 1O6YA 3KULB 4FTKA 2RG6A 5M09A 4CFWA 4G2FA 5DPVA 4AGWA 1GZ8A 3BE2A 4H3QA 4KIOA 4AF3A 4BHZA 1SMHA 1KE8A 1PW2A 1UU9A 2W4OA 1F0QA 4QPSA 5DRDA 2WTIA 3KRWA 3R28A 5BQ0A 3QKKA 3RZFA 4R7IA 4NUSA 4CMOA 3V01A 3VWAA 1LEWA 3E88A 5CF4A 2V7OA 4M67A 5IUGA 3F66A 5L2IA 5E4HA 2BZKB 3C5IA 2AC3A 3CTQA 2ONLA 3TKHA 5C8NA 3E92A 4LQMA 3QKMA 4E73A 4FZDB 4E6AA 4F0IA 2OKRA 4R3PA 4MNEA 2W0JA 1WBWA 4IWQA 5CVFA 4G5PA 4BGHA 4GKHA 3GC9A 3TKIA 4QMQA 3PFQA 4LRJA 4R3CA 2XJ2A 3QBNA 3TUBA 5LARA 2ETRA 1DAYA 3ORLA 3G0EA 4WBBB 3V8WA 3TTJA 4BCKA 4DFNA 3HMMA 1ZMUA 4IAFA 2BDJA 3GC0A 4FL3A 4AN3A 3PRIA 2PU8A 2JFLA 4TTHB 5TKDA 5D41A 2XVDA 4TWCA 2YJRA 3BU5A 3LFAA 3N9XA 4O96A 4V04A 4W4WA 4WSYA 4XMOA 3W2RA 4YSMA 2HW6A 4RX5A 3KL8A 1H8FA 4EK8A 4IB0A 4LOOA 5AR7A 3ZRMA 5AR4A 5EM7A 5CX9A 4AS0A 4U42A 5L2WA 3CCNA 3MY5A 2H8HA 1QCFA 2ZV7A 4QTBA 3A2CA 3QC9A 4FEUA 5HG5A 3OT8A 3D15A 3OC1A 3PPJA 1H0WA 4ZTNA 1NA7A 5CSPA 5LOHA 3RNIA 1PXKA 4OR5A 4EBWA 4GVJA 3R2YA 2ZOQA 1RDQE 2XIXA 2R0UA 4NKAA 4YZ9A 4ANOA 5EKOA 1H01A 5HTIA 3SG8A 5EW8A 1WBPA 5ITAA 1XBAA 3A61A 3QTXA 5M44A 2OJFE 3UQFA 5CEKA 4O0WA 4H1MA 3DKOA 4WRSA 3UOJA 2CKOA 1YW2A 5CWZA 3FZOA 5BYZA 1KV2A 2AUHA 4UZHA 4BBMA 2ZVAA 3AC3A 2PVMA 3BYOA 5FXSA 1AD5A 3UQGA 3GC7A 2JKKA 3L8PA 2GNGA 2WTJA 5J1VA 4KRCA 4TYHB 4PTCA 4G3FA 1RW8A 4AT4A 1TQPA 2WQEA 2QD9A 4PMTA 2OF4A 1GIJA 3T8OA 4U81A 4F08A 2J51A 4JG8A 3ZDUA 2Y0AA 4S31A 4FV5A 2RFNA 2XK4A 5ANDA 5ANGA 5IH5A 2Y6MA 4IWPA 4D4SA 4O7SA 5JSMA 1NXKA 1YWRA 3V8TA 4AACA 2LGCA 3TWJA 4GCJA 3DY7A 1ERKA 3S3IA 5BVFA 4NWMA 3PA5A 2FYSA 5I9VA 4OTWA 2BKKA 5E8YA 1K2PA 2BDFA 1H1RA 2BRMA 3CR0A 3IKAA 3FV8A 5HZNA 4FV4A 4FKSA 4I94A 4PP7A 1Q41A 2C6KA 5B2KA 2JIUA 4F9YA 3AQVA 2UW0A 2WU6A 3JUHA 3P78A 2O5KA 4ALWA 2XKDA 4PUZA 4QYFA 4BTKA 4FR4A 2OH0E 4BI0A 3NAXA 2VGOA 2Y8OA 4R1VA 3SLSA 4J53A 4K33A 2IZTA 5IEXA 3DJ7A 4IAYA 3TG1A 4QQ5A 5BVEA 3IW5A 3BLHA 3UVPA 1Y91A 4CFMA 4IB3A 4EHZA 3LE6A 2OXYA 3EQPA 4KKGA 5FXRA 3H0YA 1NVRA 4TNBA 4XJ0A 2GHGA 4B8MA 4BCGA 1YHSA 4G1WA 4LMNA 3QTWA 2IW6A 3DZQA 4U40A 5KBQA 5LVMA 2IVVA 1UU8A 3LFDA 1Q3WA 2WZJA 2YFXA 4FZFB 1PXPA 2XBAA 4J96A 3SC1A 4CLJA 5E8TA 4FOBA 4LRKA 2X2MA 4W8EA 4CSVA 1WBOA 3MPMA 3Q5ZA 3QTUA 4EORA 3DDQA 4QMWA 5HOAA 4EHGA 3HV7A 3ZZWA 4CCBA 5GINE 4O6EA 4MAOA 4DGLC 2WAJA 1OPJA 2CNQA 3UBDA 5D11A 3V5JA 3OOMA 5J5SA 2BROA 1CDKA 2QVSE 1BI8A 5M4CA 2VWBA 2WQMA 4GYIA 4MD9E 5CSVA 5ETCA 3F2NA 4EH5A 4YSJA 1T45A 4QYGA 2WQBA 5AR8A 3VF9A 4CCUA 2IVSA 2PVKA 1OMWA 3KMUA 5J1WA 4PV0A 4J99A 5LVPA 5CXZA 5TE0A 4LGGA 1W0XC 3LJ0A 3WE4A 3ZSIA 5CSHA 4YO4A 5K0XA 2PY3A 2XYNA 3E8EA 4OGRA 1OBDA 3F88A 4FV2A 4M13A 1DAWA 3NX8A 4PMSA 3ZLSA 4E4LA 5L2TA 5AIRA 2P33A 3EJ1A 2RG5A 3RHKA 3KFAA 1OKVA 3JXWA 4ASDA 4RJ6A 5IQHA 1ATPE 1UNLA 5JGDA 4YBKA 2YCRA 3WZKA 3S00A 3PXQA 5K5XA 4JQ7A 3CE3A 1M2QA 2UW9A 1J7UA 2R3PA 4FKGA 4QP4A 3CD8A 3F3ZA 4MX9A 4O2PA 4QNYA 5FXQA 1FMKA 2A1AB 3A7GA 4KSPA 5DT3A 3GCUA 3BHVA 4LI5A 5HG8A 3WF6A 4C59A 3ZHPC 2H34A 2XKCA 3FI3A 5D7VA 5HU9A 5CXHA 3R63A 4ZLZA 3FHRA 3ALNA 3LM5A 5IZFA 4O22A 3U54A 3NYVA 5HTBA 4LL5A 5HBHA 5CANA 3R30A 2B9HA 2F57A 4NIFB 2C0TA 2RF9A 5LMKA 4JQEA 2ZV2A 3KRXA 4RBLA 4MWIA 4E4MA 4CG9A 4RG0A 1UV5A 3FLNC 4FTIA 3EKKA 3KRRA 4IMYA 4FZ6A 5CF8A 3EQGA 2R5TA 1KE7A 1ZMVA 2CPKE 4XOYA 4WOVA 5CI7A 4FSQA 2VTNA 4AW0A 2ZB0A 3HL7A 3HMNA 4D0XA 4WUAA 4ZMFA 5T6KA 3II5A 4FTJA 4U80A 3OFMA 2UZWE 3NLBA 3V04A 3OW3A 4C33A 3DB6A 4XYFA 5FLFA 4C61A 2W17A 5AAGA 3DXPA 3QTRA 4EOLA 3IPHA 3I81A 1OIUA 4XV2A 3ZC5A 1OUKA 1Z9XA 2VTHA 5AUTA 5AR2A 5ANKA 4I3ZA 4BDJA 3NWWA 1WAKA 1JWHA 2XM8A 3UMXA 1U54B 2YM7A 3KN6A 5DG5A 2WTDA 4Y72A 1J91A 3EOCA 2B52A 3KXZA 3LMGA 1UKIA 1CTPE 1H1PA 5B2LA 4CV9A 3SRVA 4NJ3A 3QRKA 5DR6A 3KXNA 3JYAA 3R1YA 1GNGA 3EN4A 4F9CA 2ITUA 1NY3A 2WMVA 1BLXA 3MFTA 5KHXA 4Z7HA 3H4JA 4CFVA 4EH9A 4AAAA 2YZAA 1Q62A 4ERWA 4Y73A 3PWYA 4GT3A 4EK3A 4WG4A 1TKIA 4GYGA 4BC6A 2NNWB 3DK3A 1P4OA 5G1XA 5HIEA 4J98A 3EFWA 1V1KA 5A4EA 5E8XA 3EHAA 4CFFA 4GW8A 2OJGA 3PTGA 3PE2A 2CGVA 4GH2A 3I1AA 1OL5A 3QRUA 4KS7A 3FQSA 3U9NA 4BY9E 3NUNA 4F64A 3KVXA 3I6UA 4F09A 4FT7A 4RJ4A 2WHBA 3S95A 3EFKA 3GU4A 3LXNA 3U4UA 3BKBA 2Z02A 5ACKA 4DEDA 3UC3A 4UMRA 4L3JA 4ONAA 3TL8A 1MRUA 4BZNA 2EVAA 4TZRA 3I60A 4FEWA 3OXIA 1M2RA 5ACBC 4ENYA 2IG7A 4ZY5A 3NW7A 1XBCA 4KRDA 4FNYA 3UODA 2CGXA 3O23A 1JPAA 3OT3A 5FWKK 3R8PA 1YOLA 4AXAA 3W2CA 1OZ1A 4U9AA 2C0IA 3LHJA 2VTTA 3UG2A 4WO5A 3WE8A 3DCVA 4ZY6A 3MH2A 3HKOA 3QC4A 3VQHA 4ENXA 1Y6BA 2ZV9A 1JBPE 5M07A 5TOZA 4EBVA 3U6HA 3D2IA 3TACA 5HIDA 4H05A 3V6SA 2ZM4A 1JSUA 2F9GA 4MD7E 2GTNA 1UNGA 3DBFA 3MPAA 3C4EA 3K5UA 3VS4A 5ETAA 1KSWA 3HP5A 4QP3A 4RJ3A 5A4CA 4IZ5A 5IA3A 4O7LA 2R3RA 3FMDA 3EN9A 4FIJA 3K2LA 4EQUA 4C4JA 4BTJA 5IMEA 3R9RA 3LLTA 4F7JA 4JDIA 4O7NA 1TQIA 2BRNA 3ORTA 4I5HA 5IDPA 1XQZA 3HUBA 3V8SA 4NKSA 4BYJA 2VNWA 1ZXEA 4AW5A 4L42A 2ITXA 4G9RA 5GZ8A 3PJCA 4X2NA 4X2GA 4BYIA 4C57A 4CFUA 4ZSJA 4EUTA 3IW4A 3D5UA 5FTQA 1DS5A 3R9DA 5IUHA 3QKLA 4FBXA 4FEVA 2J7TA 2GNHA 4K77A 3QX2A 3VUDA 3K3JA 2PZRA 4XRLA 3R9OA 4PMPA 2ZM3A 5LVLA 3OVVA 4A9SA 3W2SA 3S0OA 4DFBA 3AT2A 1ZYLA 2PVYA 2UW6A 3H9RA 5K9IA 4FI1A 2HZNA 4XNEA 2IJMA 3R7GA 3WYXA 4DFYA 2ACXA 3R01A 4FTCA 5K5NA 3CEKA 3FE3A 3SA0A 2FO0A 2YN8A 2JDRA 4RIOA 1XBBA 3PPZA 2CNUA 5EW9A 4D9TA 3W8QA 3C51A 3KXHA 3DS6A 3R02A 4FSRA 2R3QA 4ITJA 2GHLA 4IW0A 3PE1A 4BZOA 1U5RA 5DOSA 5EYCA 4PRJA 4TYIA 4GUEA 4NK9A 3FY0A 3D83A 3D2KA 5BVNA 4QMZA 3UMWA 3WF7A 3AC2A 2X8IA 3Q52A 5CTPA 4C37A 4LOPA 1UKHA 5JGBA 3PJ8A 3F61A 4DH7A 3DNDA 4RJ5A 4IM3A 3AD4A 4A9RA 2C47A 2UW7A 5HCYA 4QMMA 3A7IA 3EZVA 5TF9A 4BHNA 4EOQA 3PLAE 1GZOA 3MN3A 4QQJA 2G2FA 4D4VA 1YQJA 3NSZA 2GS6A 3NS9A 2W1DA 4UMTA 3VRZA 2F7XE 5CSXA 2DS1A 4GT4A 5EI2A 4AG8A 2JGZA 4XLIA 3ERKA 5JFXA 2PVFA 4JI9A 4Q9ZA 2C3IB 3T9IA 4DCAA 4IC7A 3I5ZA 3A8WA 2VU3A 4RJ8A 1Y8GA 5AUXA 3BGPA 3L9NA 4JR3A 5FGKA 3DB8A 3NNVA 4S33A 3F5GA 1WZYA 4BF2A 3OWLA 4M69B 4LUEA 3A60A 3R1SA 1VJYA 2BZJA 4XG2A 3OS3A 4BCNA 1OIYA 3H9OA 1MP8A 2A4LA 2HWPA 2KULA 2VO3A 3PVBA 1AGWA 3QALE 4HGLA 2XK7A 3BEAA 2UZNA 4FKPA 5JZNA 3HA6A 4YHJA 3QCYA 3EL8A 4DYMA 3P23A 3EB0A 4FNXA 4G3EA 2C4GA 1J1BA 1BI7A 4KD1A 4C02A 2EU9A 5HE0A 3I6WA 4DAWA 4UB7A 4RFZA 5AUYA 1YXTA 4GL9A 4RPVA 4FL1A 4K8AA 1WBNA 3T9TA 3SOAA 4FGRA 4FV1A 2EXCX 4XCUA 5BUIA 3IW6A 3QYZA 2X4ZA 4O91A 3OXZA 4WNKA 4J97A 4P5ZA 4U5JA 4N0SA 4I4EA 3C4FA 3FKOA 3N51A 5M4FA 3FQEA 4CZUA 4TL0A 4RT7A 1JKKA 4GJ3A 4NCTA 4YZBA 4KS8A 3SW7A 4KIKA 1J1CA 3DXNA 5FDXA 5DLSA 4ZZMA 5KMOA 4OT6A 4XUFA 4ZS0A 4O0YA 3ZDIA 5CAPA 4RX8A 3L9MA 4IM2A 5HLWA 4E1ZA 2HZ4A 4ITIA 2B55A 5LJJA 4L7SA 5HX8A 3LKMA 4NL0A 5EDQA 4RQVA 3RPVA 4BKJA 3I7CA 3C0IA 3OOGA 1Q61A 3EN6A 5FG8A 3A7JA 3D5VA 3E7VA 5AEPA 3RCDA 4EZ7A 2WTWA 5BYYA 3L8XA 4F6UA 2UZUE 3DKFA 4GK3A 4RC4A 4KINA 5FQDC 3WZEA 3OUKA 2H96A 2G2HA 5CNOA 3KY2A 4O7ZA 1IR3A 5FBOA 1GOLA 4ITHA 2I6LA 3F3UA 1YRPA 4RIXB 3ZOSA 2ITWA 2PE2A 3UO4A 3BBTB 3BWFA 1VEBA 3CBLA 4RQKA 1ZAOA 2OH4A 4J8MA 4FIFA 1REJA 3BU3A 3MFUA 4PL5A 3RPRA 4V0GB 3V5TA 5K4JA 4RFMA 4D58A 1LR4A 3T3VA 4EJ7A 1CKJA 5AAEA 3F2AA 2QLUA 2QOQA 3ZUUA 3N4VA 1PY5A 3RM6A 2AYPA 2JBOA 4FKIA 4F70A 2Y9QA 4ACDA 5LMAA 5I9YA 1B39A 5E7RA 1QPJA 3DTCA 3PJ2A 3ZM4A 2C6LA 4DEGA 3QF9A 3VF8A 3MTLA 4IAZA 1Q8UA 4TWOA 4FTLA 4O7WA 5IEVA 2Z8CA 3C4XA 3JY0A 5HE3A 5J7BA 5DYJA 4YP8A 3ULIA 2EUFB 2VO6A 3WZDA 1BL7A 1KWPA 5DNRA 5BVOA 2W1EA 5FD2A 2JKMA 2IW8A 4EH4A 2IO6A 3MH3A 3GFEA 3OP5A 2GSFA 4O7VA 2VO7A 4NU1A 2V22A 5CS6A 4BL1A 3JR1A 1SYKA 1PXMA 3FYJX 3SAYA 1E9HA 4PPBA 2NP8A 3R7EA 2DQ7X 3ZO1A 1PMVA 4DA5A 3LW0A 5AAFA 4D5KA 2FUMA 2XMYA 5IA4A 1JAMA 5AV4A 3I5NA 4BWXA 5L8LA 4R7BA 4A9YA 1O9UA 2PE1A 2PVLA 4PQNA 5KMJA 5FP5A 1OI9A 2WMSA 3NNWA 2F2UA 4A4LA 3ZONA 4EYMA 2GFSA 3R21A 2PHKA 3JVSA 3MVHA 1OITA 2C0OA 3CQUA 4OBOA 4PDOA 4CQGA 5C27A 4O38A 3JS2A 4GMYA 4DEIA 3KEXA 3HMPA 4G9CA 1HCKA 2RFEA 2WEIA 2W1ZA 4JT3A 4I0TA 3O96A 5IA1A 4AZFA 3U55A 4X3JA 3S4QA 3SHEA 3NEWA 4D2PA 3OWJA 1PYXA 2O3PA 4ANQA 3SVVA 5AUVA 2G01A 2H6DA 4C35A 5L6OA 3HRFA 1TQMA 1JVPP 4JG6A 4WSQA 2V5QA 2GQGA 2PUUA 3W33A 3AOXA 4QMVA 4ASXA 4E93A 4JX7A 1PKDA 4BKYA 5CVHA 4KBAA 2FA2A 3LFEA 5TT7A 3NIZA 4G31A 5HTCA 2DUVA 3GI3A 4DG0E 2HELA 1I09A 1OIRA 4F7SA 3L8SA 3OBJA 4IHPA 1AQ1A 4CKIA 2YA9A 3FKLA 1LEZA 2J2IB 5EHYA 4EOOA 2PSQA 1H25A 1CKIA 5AP2A 3O51A 5EYDA 1R0PA 4EZ5A 4QP6A 3B2WA 2VWWA 2G1TA 2ZDTA 5CAVA 3HAMA 4O81A 3DV3A 4IACA 3VHKA 1UWHA 4Q5HA 5F20A 3TZ8A 3ACKA 3LXKA 3EL7A 5EG3A 4A9TA 3IONA 1TVOA 3AC4A 2CHLA 2RL5A 4PDPA 5DFPA 5I9ZA 4Q2AA 5CYIA 3THBA 3RPOA 4BIBA 3PVWA 4XG4A 1XKKA 2B9FA 4FNWA 1WBVA 2PMNX 5IU2A 2BUJA 2YWVA 4DEHA 2J9MA 5CZHA 5L6WL 3EKNA 3QA8A 3JVRA 5M4IA 3UIUA 4DTKA 3RJCA 4APPA 2JC6A 3GGFA 4MQ2A 3UYSA 3PDTA 2C3KA 3PG1A 3KC3A 2QHNA 5CU6A 1FQ1B 4EOKA 4YJRA 3LMHA 2PUPA 4ZXTA 4IX4A 1HOWA 2E9UA 5AR3A 1H4LA 5DRBA 5IQCA 3HDMA 4LOQA 5EI6A 3P86A 2NPQA 3FL4A 3H9FA 3C50A 2R4BA 2YABA 3NMUF 1QPCA 4O2ZA 2YDKA 4BDFA 2OZAB 3GU8A 4UEUA 1XH7A 2VRXA 3ZO3A 3QQUA 4UALA 2J4ZA 4FG8A 3VO3A 5ANEA 3BRBA 2PL0A 2VTSA 3ORXA 3ZLXA 4DBNA 2W7XA 4FV6A 2BAQA 4AZTA 3ZRLA 1JSTA 3TV6A 4QP7A 3UNZA 3NUYA 3H0ZA 2PVRA 4L45A 5FTOA 4PPAA 3ZLYA 1WMKA 3VW6A 3DJ5A 3HECA 4J52A 4AP7A 4AT5A 4BTMA 5C4LA 2F7ZE 4TYHA 2OFUA 2YISA 1ZOHA 3BZ3A 3FLZA 1R39A 4EC9A 2WTKB 5E8WA 5KKRC 3F3WA 3LFSA 3QAME 4EQCA 3BBWA 3R8UA 4BCMA 3NUPA 2GTMA 2C6DA 4O0TA 4RWIA 4BCPA 4FF8A 4W9WA 3E93A 3KF4A 4CVAA 4U3YA 4B9DA 2ZMDA 3MVMA 4PNKA 3OUNB 5JT2A 1PYEA 2R3LA 4QO9A 4DN5A 4PNIA 2X9EA 1G8SA 2JIIA 2BHEA 2WD1A 2R3NA 3MBLA 5AX3A 2PYWA 4FSMA 5IH4A 4BCJA 1ZOGA 4F63A 2C1BA 2OFVA 4RVMA 2QR8A 4F9AA 2B7AA 4PMMA 3PG3A 3GQLA 3CXWA 3VBTA 3HRCA 1H1QA 4IE9A 4AGCA 5KNJA 3CC6A 3O71A 3LCDA 4FT5A 5T3QA 5DMZA 2YIWA 3TV4A 4R8QA 4M0YA 4AZSA 4JNWA 4L3LA 2ITQA 3GCSA 3IOPA 3TI1A 4C3PA 2WTVA 4C7TA 4AOIA 3IW8A 1Q8YA 1W82A 3R71A 1REKA 1MQBA 4IX6A 3F82A 2B1PA 3D7ZA 4CZTA 4RLKA 3UNKA 2VTJA 2J0LA 4HPTE 3VUTA 2R0IA 1F3MC 2HYYA 4G3CA 4LG4A 4R5YA 4GEOA 4MH7A 1H08A 2OWBA 3BQRA 5EW3A 3QRJA 4CNHA 3UIMA 2QOOA 1VYWA 4FC0A 4N6ZA 3SGCA 2XIZA 4Y5HA 4UV0A 3QQKA 3DLSA 4D9UA 4MD8E 4L01A 4MHAA 1GAGA 2HOGA 3GOKA 2VWVA 3IG7A 4RC2A 3RNYA 1H28A 4CD0A 2IZRA 4IFCA 3EQIA 4PPCA 5HD7A 1YOJA 3UIBA 5HNBA 4XV9A 4I41A 3R1QA 5E8UA 4B99A 4ZTRA 3NVKI 4FUYA 1OL2A 1OUYA 3OY1A 2UZDA 3MJ2A 1XHAA 3QZFA 1XH9A 4YU2A 5T68A 5J7HA 4U43A 4R77A 3HV4A 4ANLA 3E7OA 3EQCA 4AT3A 5J9LA 2XH5A 3F7ZA 4H39A 2R7IA 3AMYA 4O82A 2F2CB 2GS2A 5L2SA 4NT4A 3D7TB 4O27B 4RLLA 3R7VA 2GNJA 2OJ9A 2HK5A 4ZSEA 4KWPA 2FSTX 1U4DA 4R6VA 5GJFA 2CLQA 2NRUA 5AP3A 2J0KA 4ORKA 2YIRA 3TJDA 5JEBA 2SRCA 4J7BA 4FYOA 2YM4A 1CSNA 1H27A 4L46A 3VBWA 3ZU7A 2CLXA 4WHZA 2XA4A 3EQBA 3O17A 2WMQA 3BHHA 5M56A 3E63A 3FZRA 3UO6A 4JRVA 2YCQA 2WFYA 3OHTA 5I9UA 3G90X 4AZWA 3ATSA 3NAYA 2CN5A 4DT8A 2EXEA 2YCSA 3DAJA 3G2FA 2J0JA 3GOPA 4OT5A 4M12A 4CT2A 3OCGA 4EWQA 2PPQA 3Q6WA 4I6HA 4IVBA 2O0UA 4L00A 2X7OA 5HG9A 3UOKA 3G0FA 2IW9A 3FDNA 4FKUA 4G17A 4HJOA 4I6FA 3U9CA 5KMKA 4KBKA 3MSSA 3C5UA 4XBRA 3MPTA 4M8TA 5BYLA 3OF0A 3Q6UA 4FEXA 3CY2A 4PF4A 3NNUA 2A27A 3MJ1A 5EDPA 2PMIA 2XKEA 3OY3A 4XP2A 5F4NA 1PRYA 1E1VA 4TXCA 5D9HA 4USFA 2BTRA 3F3VA 1IEPA 2BIKB 4WNOA 3ZUVA 3CP9A 4WIHA 3O8UA 1ZARA 2XZSA 2J6MA 2Z7RA 1ND4A 2UUEA 3V5WA 4IX3A 3HYHA 1PMNA 4RIXA 3DZOA 4O1PA 1VYZA 2XF0A 5HG7A 2B9IA 1JSVA 1SVGA 3ATTA 4DC2A 3FZSA 5EHLA 4AA4A 3MY1A 4IJ9A 5F94A 2IVTA 3DAEA 4HGTA 1H1WA 4BBFA 4MBLA 4DH3A 2FVDA 3PUPA 1YI6A 3FYKX 4X3FA 3F2RA 3C4CA 5CEPA 3QL8A 3Q2MA 3MI9A 4C2VA 3F5UA 2CGWA 4CGAA 5K4IA 2WEVA 4LRMA 2AC5A 1FGIA 5HBEA 3H30A 1Q8ZA 2W99B 4M84A 4BIEA 1RQQA 2V7AA 2ETMA 3EN5A 5AADA 5A4LA 3F69A 1ZMWA 2X2KA
chains in the Genus database with same CATH superfamily
2VTLA 3BV3A 2WMUA 4GG7A 1XH4A 4UXQA 1GY3A 5CY3A 3SW4A 4EEVA 5FDPA 3R7UA 4IAIA 4TW9A 3FI8A 1SZMA 2YIYA 5JQ5A 5HKMA 1FVVA 5HCZA 4ACCA 5IG1A 2XIYA 2VWYA 2ZV8A 3MA3A 4F0FA 1W2CA 3EZRA 3GEQA 5EOBA 3ZZEA 2QOKA 4TYEA 2R3KA 2C5NA 4WBOA 3SQQA 3W55A 3ROCA 4E6DA 3W2OA 3TXOA 2X1NA 1R3CA 1Q4LA 4I6LA 5E8SA 5A14A 4XP3A 4ZTHA 1ZYCA 5KBRA 3CGFA 2QO7A 3MTFA 3D4QA 1XR1A 5HU3A 4NSTA 4UBAA 1YXXA 2OG8A 4FTQA 5CF5A 2IF8A 5L4QA 4BBEA 4ZP5A 3NVMB 4UWCA 5HX6A 4ANBA 5CNNA 4NM5A 4AE6A 4AGDA 4YJQA 3PSBA 1Z5MA 4EOIA 3CQWA 4BDKA 3EQRA 1H24A 3RALA 2QO9A 5M08A 1H00A 4MVFA 3QCXA 4L53A 3FQHA 3ORKA 2HAKA 1Q3DA 3D9VA 4IZAA 4X6RA 2WGJA 2VZ6A 2QR7A 4MK0A 4FT0A 3DBEA 4AX8A 4GFGA 5EYMA 3QFVA 4JBVA 2ITOA 3DBQA 3A62A 3MDYA 4RIYB 3ZO4A 2OXDA 3OMVA 1JKLA 4C34A 3DTWA 4TRLA 3MIYA 4LM5A 5LVOA 1P14A 3WBLA 3C9WA 3HNGA 2RIOA 3EH9A 5KE0A 4MNEB 3L9PA 4YMJA 2ITVA 3FSKA 4EOJA 2PUIA 4W9XA 3G33A 2C3LA 2JIVA 3KXGA 1TZDA 2VN9A 2YWPA 5LCKA 3TNIA 4F6SA 2CSNA 2YDIA 4ID7A 4B0GA 5EFQA 4O7YA 2QKRA 2I0YA 1NT2A 5BVDA 1BYGA 5K3YA 4RX7A 2C5OA 2OJIA 2J5FA 2WMWA 3ET7A 1YVJA 4X0MA 5JFVA 5KO1A 1IAJA 4CG8A 4AUAA 4FIHA 1J7IA 5FEEA 5D1JA 3ZEPA 3CPCA 3ROYA 3RGFA 4QMPA 5FM2A 2UW4A 5AIKA 4QTDA 3OCTA 4ZSAA 2P2HA 3R00A 3PZHA 4CLIA 3DKGA 2QLQA 3P0MA 3I79A 1KE5A 3TUDA 2X81A 4P2KA 4CXAA 1OGUA 4I5CA 4Z16A 4NTTA 2Y4IB 3PY1A 4I6BA 4OTRA 5JH6A 1G8AA 2WMTA 2XB7A 3F5PA 2WXVA 4IDVA 4NW5A 1ZYDA 5CALA 2P0CA 4FUXA 4TWNA 3ZSGA 3LFCA 2OIQA 4EK5A 2XNBA 4EL9A 4O84A 5AV1A 3A8XA 4KIPA 4RA4A 3QU0A 3VN9A 2ONLC 3NFGB 1CKPA 4RIYA 1S9JA 1V0PA 3EQHA 2WMAA 2WMXA 5CU3A 3WIKA 4DFXE 3FUPA 1HCLA 2C6EA 2X7FA 2XIKA 4GSBA 1DI8A 2BIYA 4F1OA 4AXEA 2R3OA 5IA0A 5ANJA 4YC3A 4B7TA 4BCOA 4DEBA 3KRLA 4V01A 4YHFA 3W18A 4QP2A 2UW8A 4NM7A 2V62A 4ACHA 3D0EA 4V05A 3EYGA 5LWNA 3BQCA 4F7LA 3LCOA 3R22A 3BYMA 3VS7A 4EONA 2BVAA 3Q4CA 1GIIA 2XEZA 3IS5A 3P9JA 4TY1A 3SD0A 3EMGA 4KSQA 2C5VA 4FV0A 4FKLA 3R83A 4WD5A 3NUSA 3QD3A 4BDHA 3AC8A 4I0RA 1A9UA 5FM3A 4IWOA 2VTMA 4YJPA 4CKJA 3KCFA 2IVUA 4RMZA 4DLIA 1ZYJA 2QONA 5CSWA 2JBPA 4NW6A 3WYYA 3BWJA 5AUZA 3VRYA 2ZYBA 4JDHA 1JKTA 3A4PA 3OTUA 4LMUA 2E9OA 4BJJA 5L3AA 3U6JA 2YACA 3G6GA 4P5QA 3ULZA 5AWMA 3M1SA 4NJDA 4FIEA 4FTAA 3VS3A 4K6ZA 1YWVA 3E5AA 3GVUA 4B4LA 3W10A 2R3FA 2C6OA 4FKJA 3ALOA 4CMUA 4LFIA 4L44A 5HORA 3P7AA 5HVJA 1A48A 3WZJA 4DFZE 2JLDA 3PA3A 3REPA 5EHOA 4YLLA 1YDSE 2FSLX 5BMMA 3Q4TA 5BPYA 4R5SA 4IH8A 3RPSA 3MESA 5LWMA 4FG7A 4OTIA 4U7ZA 5JKGA 3DAKA 4MXAA 4RC3A 3LIJA 4EK4A 2I0HA 2WTKC 5AP6A 3COMA 4HVHA 3KU2A 4JG7A 4C58A 4AZVA 4Y8DA 1PXOA 3KXMA 5GZ9A 1IAHA 3NYOA 5BNJA 4WG5A 1NW1A 2HZIA 2E9PA 4EYJA 3AT3A 4KBCA 2J0MB 2QU6A 3V5PA 3FI2A 4YJUA 4FA2A 4DF3A 3WF8A 2GCDA 2UZLA 5AJQA 2A2AA 2PMOX 4FE2A 4AOTA 3RWPA 3VAPA 1Q5KA 5HD4A 1KUTA 3ORMA 3T3UA 5J9YA 3BYUA 2I0VA 3AT4A 4MXCA 2CN8A 2C30A 2BMCA 3KB7A 4E5WA 3ZFXA 4ZIMA 4C4IA 4FODA 3W0QA 4G6NA 4FKRA 2Z7LA 4W4VA 1YI3A 4W4YA 3LCKA 3RBWA 2X9FA 4U6RA 5HI2A 2Y7JA 3UC4A 4E8AA 3KN5A 3VS5A 2HXLA 3LXLA 4DITA 3UTOA 4FTRA 4HGEA 3ELJA 4R7HA 4MYGA 2YHVA 2CGUA 2ITTA 4MUQA 3U8WA 3KQ7A 3TDVA 3MVJA 3RWQA 1BL6A 1T46A 3LM0A 4WA9A 1ZZLA 2WKMA 4AA5A 3EQFA 5HVYA 2GQSA 3EN7A 3TKUA 3KMMA 1KV1A 4D4YA 4DEAA 3ENMA 4ACGA 4QTEA 5HNIX 5LVNA 4N4SA 3AMBA 3D5WA 2YCFA 3LFFA 5GZAA 2Y4PA 4BI1A 3RAKA 3CTHA 1XWSA 3QXOA 4L52A 5DT4A 3FAAA 2Z60A 3RK9A 3VVHA 4A7CA 3E87A 4Z3VA 4RGJA 1YHWA 3A7HA 4XOZA 3ZBXA 5AMNA 5IEYA 2PE0A 3KVWA 2QOFA 4JLCA 1ZZ2A 4UZDA 3LPBA 2O63A 3VIDA 4RRVA 3TEIA 3OCBA 4I1ZA 3PIXA 4TYGA 3O7LB 3CD3A 3Q9WA 2J0IA 2R3GA 2RKUA 2REIA 3GP0A 3PIYA 5HQ0A 4WNPA 4A4OA 4WG3A 1OL6A 2W1FA 4BFMA 3UPZA 5GIPE 3LZBA 3LMIA 2Z2WA 3FL5A 4FTUA 4H3PA 4U8ZA 5EM6A 3Q4ZA 1ZYSA 4RWKA 4RWLA 4FVQA 4YJVA 1Y8YA 4AFJA 2WQNA 3GQIA 3R8LA 3RAHA 4M68A 3IOKA 1KE9A 4CRSA 2Z7SA 2DWBA 2BAJA 2QI8A 3QQHA 4JDKA 4M14A 5BUEA 3F7WA 3NW6A 3POZA 4ZZNA 2WB8A 4JR7A 3ODZX 3RAWA 3K54A 5E9EA 4IVCA 4FVPA 4DTBA 5AA9A 3BCEA 3GB2A 1VR2A 4UWYA 1OECA 4O0UA 5LQFA 3ZC6A 3MS9A 4JVGA 2F49A 3NUAA 1OKZA 4ANNA 4CFXA 4I92A 3POOA 3LOKA 4KAOA 3VS1A 3R7OA 4AXDA 4JS8A 4E3CA 2JITA 4IX5A 4FSNA 4NCTC 3Q9YA 4L8MA 2X4FA 4YTCA 3PRFA 4XS2A 3IW7A 3TNWA 2WPAA 1V0OA 4JOAA 4S30A 4BCIA 1OIQA 3CLYA 4I21A 4DFUA 4PTGA 4DEEA 2EWAA 4CYIA 2VX3A 2ERZE 3QD2B 3VULA 2QCSA 1FVTA 4JJRA 4QP1A 4S34A 2WU7A 3P1AA 2GNIA 5AX9A 4I93A 3IDBA 1RE8A 3V6RA 3S2PA 3RP9A 1CMKE 3ETAA 3GU6A 3H10A 2BFXA 3PY0A 4AWIA 4DHZA 3HZTA 2X6EA 4JBOA 5HEZA 5FEDA 5ETIA 4EOPA 3R8VA 5A54A 3DK7A 4W4XA 2XNEA 4CTCA 1UNHA 2W1IA 2IWIA 2Q83A 4BCFA 4EHEA 3FMNA 5A3XA 2B53A 4D1XA 5IQGA 5H8BA 2C68A 4QYEA 4AW2A 5TR6A 4K18A 3L1SA 3Q32A 5EQPA 2XEYA 1MRVA 3V5LA 5AUUA 3QYWA 5CAOA 3Q9XA 4M0ZA 3UJGA 1ZY4A 2H9VA 4NZWB 5HGIA 3NCZA 2F4JA 1QPDA 4H36A 4EJNA 3I4BA 3OXTA 4DTAA 4F4PA 3NZ0A 4F6WA 2R9SA 4CMTA 2BRHA 4CFNA 4D1SA 5JK3A 3FLYA 2W05A 3AMAA 2XARA 5CT0A 5IH6A 3CQEA 3RHXA 3TV7A 4QEBA 4IEBA 3VBVA 5DR9A 2VD5A 3FJQE 2BR1A 3OWKA 3PVUA 4HOKA 1BKXA 1F5QA 3QTSA 4L6QA 5CQWA 3W8LA 5DA3A 3IK3A 2QNJA 4FV7A 4FMQA 4O4BB 3NIEA 1SM2A 3ZYAA 2WMRA 2Y6OA 1OKYA 1M2PA 2QOLA 1UU7A 1OL1A 5I3RA 3FSFA 5AUWA 5J9ZA 5H9BA 4LDTA 4GV1A 3ODYX 4AQKA 5C01A 4EKLA 2EB2A 3FWQA 2GU8A 2QOCA 2HIWA 2HCKA 2VWUA 3TIYA 4YPDA 3E62A 3QXPA 4HYUA 4QYYA 2BZHB 4LUDA 2VAGA 4QP9A 3CPBA 2VTPA 4NTSA 5EQEA 3FKNA 4BKZA 3W2PA 4ZLYA 3WI6A 1I44A 5HICA 3B2TA 3ZEWA 4D1ZA 4YR8A 4KUJA 2VGPA 4E7WA 5CT7A 3O50A 2YERA 3D5XA 2QHMA 1O6KA 3NRMA 4UMPA 2CDZA 3P4KA 3HVCA 4DCEA 3HAVA 4ZS4A 5KCVA 5CZIA 3FLSA 2PMLX 4JAJA 4K0YA 4TWPA 4GFOA 5IA5A 3MH0A 2XK9A 4DBXA 3OG7A 1ZOEA 3HUCA 3ID6C 3TNPC 4BR3A 3EYHA 4ANMA 4RJ7A 2I1MA 3W1FA 5M53A 2R3MA 4D0WA 3C0GA 3OWPA 5KMMA 2E9VA 3PSDA 4WRGA 5BMSA 2V0DA 5AP0A 4ZMEA 4JAIA 4JX3A 3F5XA 3RZBA 3HP2A 4X2FA 3OW4A 4IB1A 1OB3A 2X0OA 3QLGA 3HV3A 3CGOA 2PULA 2QC6A 3FXXA 4KA3A 5LXMA 4EUUA 3D7TA 3EFLA 4UX9A 4DDIA 2PVJA 4NIFA 4IWDA 4RVTA 5J95A 1TFFA 3VS2A 4QQTA 4O21A 5L2QA 2J50A 4OAVB 3FZTA 3RK5A 4FYNA 2GQRA 2XK6A 3QHWA 3FI4A 3QLFA 3VS6A 2HY81 5HE1A 4WKQA 1LP4A 3UZRA 4W8DA 4QTAA 5IA2A 3D94A 2ZAZA 2YIQA 3DA6A 3FXWA 2WNTA 4M15A 4AU8A 4U3ZA 4R1YA 1W7HA 3QWJA 2UW5A 3UE4A 2PZ5A 3WIGA 4AAYA 3B8QA 4L43A 1G8KA 3PXRA 3TDWA 1MQ4A 3W0RA 3FMHA 5IPJA 3FPMA 3DBDA 2OICA 1B38A 1Q24A 4UWBA 5JFSA 3C4WA 1B6CB 4HGSA 1U54A 4IAKA 4RVKA 3GXLA 4WNMA 5EOLA 4O86A 3TIZA 1V0BA 3Q9ZA 4IVDA 3TN8A 5E8VA 4K11A 2YJSA 2R3IA 3K3IA 3M2WA 4XH6A 3SV0A 3TZ7A 2F7EE 2GNLA 3MFSA 3QRTA 3N4TA 4FSUA 5LMBA 4YURA 4BRXA 5E1SA 4DE4A 4I22A 5EQYA 2W9FB 4X21A 4BDGA 5B2MA 2BRGA 3FXZA 3ZSHA 4AA0A 1G3NA 2OGVA 2QG7A 3RK7A 3V5QA 4O7RA 3DFCB 1YHVA 2A0CX 4G16A 1URWA 5HLNA 1YXSA 3MB7A 5CF6A 4LV8A 4Z55A 2GNFA 2VWZA 4JL9A 3LFNA 1OBGA 3KREA 1MRYA 2ERKA 5H8GA 3CKXA 2W5AA 2GHMA 4U44A 4F99A 4HVIA 5JZJA 2G2IA 1H1SA 1R0EA 5B7VA 5F95A 2B0QA 3IGGA 5KMNA 3Q04A 4MXOA 5C1QB 5AA8A 1R1WA 2JDTA 1W98A 4DGMA 4AZEA 1IASA 3QD0A 4MF1A 4BDDA 4X3FC 5HCXA 3BX5A 4ASZA 5D10A 1FINA 3SG9A 2RFDA 2XS0A 4P4CA 5LMKC 3IGOA 3FEGA 4KIKB 1R78A 4DDGA 4WUNA 3FZPA 4PDYA 4EK6A 4IAAA 4B6LA 1OM1A 4XP0A 3UQCA 1STCE 4N70A 1MUOA 3DDPA 1YDTE 3C4ZA 3BGQA 3M11A 3V51A 5IQBA 1NVSA 2B9JA 2A98A 4FT3A 2UVYA 2UZTA 2LAVA 2JAMA 4XEYA 4X2KA 3VJNA 2ZDUA 3QTIA 2XK8A 3Q4UA 1K9AA 3KGAA 4FKWA 4RIWA 4C38A 4C3RA 5KKRB 3AGMA 3DU8A 4AW1A 2XRWA 2P55A 4DHFA 5F9EA 4ERKA 4QMXA 5C03A 3MWUA 3NCGA 4IIRA 4OTQA 3QUPA 3BHTA 4YZNA 4O0SA 5A4QA 1FVRA 3R73A 1PXJA 2Y4IC 3KK8A 2YDJA 5AM7A 4K9YA 1P4FA 3WARA 2C3JA 5TO8A 1SVHA 5IISA 4BTFA 1G8JA 2BILB 4XV3A 5GHVA 2YAAA 2ZMCA 1WVXA 3HV6A 4YJOA 4C0TA 3C1XA 3VUGA 4FIIA 5IQAA 3IDCA 4E4NA 2XKFA 4E5BA 3SKCA 3IDPA 4DH1A 4I5PA 5A46A 4QMYA 3R04A 4TPTA 2C6MA 5H8EA 5FUTA 4P90A 1PF8A 4QD6A 5CI6A 4HVSA 2VX0A 4QMNA 3R0TA 5HVKA 2ZJWA 4ZSLA 2OIDA 5JRSA 2E9NA 3SOCA 4DH8A 1UA2A 2OSCA 3GUBA 4PP9A 4YZCA 5AV0A 4C4EA 4G3GA 4JIKA 4OUCA 4P7EA 2BCJA 3UDSA 1P2AA 4FOCA 5I3OA 2XJ0A 1L3RE 4UN0C 3MW1A 2JAVA 3W16A 5JQ8A 3PJ3A 2P4IA 5HO6A 3ZTXA 3QTQA 4FSWA 3M42A 4R3RA 4DG2E 4EZ3A 3ZRKA 1FGKA 4ZTSA 1YKRA 4GIHA 2W9ZB 4GRBA 2O8YA 2W5HA 4FX3A 4DT9A 2OU7A 2XNOA 1KOBA 3L8VA 1ZY5A 2CKPA 4X3FB 3DKCA 4S32A 3EFJA 3UVQA 2QQ7A 2UZVA 2XNMA 3DPKA 3F6XA 3R8MA 4F0GA 4PY1A 2PZYA 5JN2A 2X0GA 3NFFB 4YTFA 5EKNA 1LUFA 2OJJA 2V55A 2HENA 4M7IA 4PWNA 4UMQA 2WIHA 2NO3A 2P2IA 2W1GA 4GU6A 3ZS5A 5L8JA 3RMFA 2R3JA 4HW7A 1KE6A 3HGKA 3R9HA 3ZXTA 5A6NA 2OZAA 3MFRA 4JXFA 3ITZA 3E8DA 4GJ2A 5AP4A 1M17A 3AKKA 2CMWA 4DHIB 3UOHA 4FKOA 2PTKA 3QD4A 3AG9A 3ENHA 2PZPA 3UP2A 1U46A 1WVYA 4NM0A 3GBZA 2IZUA 3G9LX 4I24A 2BZIB 4GS6A 3TYKA 2XP2A 2GS7A 1XH6A 3DGKA 3FLWA 5FRIA 5GJGA 4D5HA 4EH7A 3DOGA 4GG5A 5I9WA 4EH8A 4FG9A 2EXMA 1FPUA 2ITPA 3KF7A 4IJPA 3U87A 4C2WA 4G5JA 3ZFYA 5AP1A 4L68A 5IQDA 4KABA 3PXZA 4BIDA 4QRCA 2WO6A 3KXXA 3N4UA 4HNFA 3DLZA 5DEWA 5ANOA 5ICPA 4K2RA 3VUKA 4O7TA 2R7BA 4ZY4A 2X2LA 1WBTA 3NUUA 3ORNA 3TM0A 2CCHA 2UVXA 3P5JC 3P5KA 3BE9A 2VO0A 4TYJA 2XALA 2CCIA 4FT9A 2ZM1A 4D2WA 4FL2A 4BCQA 4YUQA 4JBPA 1A06A 4QP8A 3U4WA 1PJKA 4FK3A 2W4JA 4KIQA 4KNBA 3LCTA 4AE9A 4FSZA 5DBXA 4ZJIA 4Z9LA 1IA8A 2OZOA 4RVLA 3Q5IA 5DIAA 1DM2A 2YM8A 5HIBA 5CEIA 4C36A 3PXYA 5GIOE 3CS9A 3MVLA 3GCQA 2C6TA 5DGZA 4DLJA 4X7QA 4HNIA 2FH9A 4L9IA 2BTSA 4O1OA 1WCCA 3FZ1A 4QPMA 5M4UA 3PP0A 5AP5A 4RWJA 2BAKA 3NGAA 4GIIA 1XJDA 4XBUA 4HCUA 4YLKA 3UP7A 5CEQA 3EWHA 5DEYA 5GNKA 3UZPA 4FKTA 4F65A 1WVWA 5JGAA 3GENA 1ZWSA 4C62A 2BKZA 1OL7A 2C1AA 4FTMA 4HCTA 3UDBA 3HLLA 4D4RA 4EHVA 1YXUA 3LXPA 3PWDA 2PUNA 2GDOA 2YM3A 5AR5A 3WZUA 3BEGA 4BDAA 4ASEA 3GU5A 4JDJA 2UZEA 5I9XA 3KCKA 2ETKA 3EQDA 3S1HA 4H1JA 1J3HA 4DH5A 3FLQA 4FKQA 5JRQA 2CJMA 3Q60A 2OO8X 2ZFYA 1LPUA 3TCPA 1W8CA 3GFWA 1GIHA 5H2UA 2O64A 4KKEA 4R78A 1W2DA 3KA0A 3UNJA 4J8NA 4YO6A 4ZOGA 3BYSA 3NYXA 3DJ6A 3P79A 4F7NA 4F9WA 3TUCA 3SDJA 4BB4A 4Q5EA 5GJDA 3MV5A 4ZJJA 1APME 1GZKA 5KX8A 3LQ5A 1CM8A 4QMLA 4IZ7A 2YLFA 4XHKB 3A4OX 4MEDA 1PHKA 2HY0A 3O0GA 3Q96A 4ZZOA 4OTGA 1Q99A 3QX4A 4XX9A 2PVHA 3L9LA 3RM7A 4OTPA 3CTJA 4IM0A 5BUJA 2BHHA 4RZVA 5FP6A 3TJCA 3QQGA 5FBNC 4C8BA 4V0GA 1SNUA 5A4TA 4YZMA 4AOJA 4MXYA 4BWPA 5IQFA 1J7LA 3SRVB 3LFQA 3VBXA 4O83A 3G6HA 3QZHA 2I0EA 4QTCA 5D12A 4USDA 2R64A 1PXIA 3H3CA 1FOTA 3NR9A 4YJNA 5AP7A 4E4XA 4ALVA 3BLQA 1Y57A 3HA8A 2XYUA 2FSMX 2CKQA 2VTRA 4PX6A 2XM9A 3PVGA 4U97A 1JOWB 5DT0A 5CEMA 3OEFX 3TNQB 1IG1A 1PXNA 2W1HA 3C13A 4MXZA 1U5QA 4FZ7A 4TT7A 4AQCA 2CKEA 4OLIA 3GC8A 3KMWA 3QZIA 4ZTMA 4H3BA 5CU2A 2XUUA 3RPYA 4BDCA 5KHWA 4QMTA 5M51A 4EI4A 4USEA 1SNXA 4I0SA 1OKWA 5EYKA 3O7LD 2QODA 2W1CA 3Q53A 4GU9A 4FEQA 4HCVA 1Q8TA 5DWRA 2XRUA 4RIWB 5E1EA 3PPKA 3VBQA 3QCQA 1UU3A 5JMSA 3CKWA 4GT5A 3DQWA 3Q2JA 3ML1A 3TT0A 4QOXA 4U79A 1NVQA 3UO5A 4PL4A 3COHA 3KULA 4FGBA 3ZFMA 3ZMMA 4BN1A 2FSOX 5FEQA 1L8TA 4QPAA 3SXFA 2GMXA 3ZLWA 4UY9A 1PMEA 3MH1A 3UOLA 3U51A 4AN2A 2VTAA 4FVRA 1K3AA 3QTZA 4IBMA 1YOMA 2OIBA 5BVWA 3GCPA 4O6LA 4CEGA 5AFVA 4F1TA 4OTFA 5CU0A 1O6LA 1ZRZA 2HW7A 2RSVA 3JPVA 4XLVA 4D2VA 4FRFA 4YTIA 4BVUA 4J1RA 5D7AA 5J79A 4MNFA 4FTOA 1JQHA 2VWIA 4Y46A 3PA4A 3AXWA 3AD5A 1JLUE 2FB8A 3JY9A 4ZAUA 4ZJVA 2QOBA 3GT8A 5DN3A 4NM3A 4EH3A 3PIZA 1X8BA 4O0XA 4BI2A 2YLEA 1WFCA 3UDTA 4E5AX 4OTDA 4QQCA 2G15A 4G6LA 2ESMA 3I0OA 4RX9A 4X6QC 5HO8A 4IANA 2YZLA 3O8TA 1H26A 3FMLA 3R8ZA 3I0QA 2JKOA 2YM6A 1U59A 4U45A 3NPCA 2BFYA 4UMUA 2B54A 1H07A 5EDRA 4L7FA 2P3GX 3FC2A 2XBJA 5HO7A 1XMMA 4D2TA 3COIA 4M3QA 3UDZA 4X2JA 2XIRA 3FMKA 4LV5A 4MQ1A 4HYIA 2ZB1A 5IQIA 4D2SA 5CAQA 2QG5A 3QQFA 4II5A 4ACMA 3D14A 3NDMA 4HZSA 4L3PA 1IRKA 3EIDA 5KZ0A 5C8MA 2GFCA 3UZTA 2CNVA 3K5VA 5AV2A 3FBVA 3CIKA 1M52A 4YC6A 4YLJA 1WBSA 4YNOA 4EQMA 4CQEA 1KOAA 1Q97A 4DFLA 3E3BX 3HMIA 3G5DA 4L67A 3BELA 4CZYB 4C3FA 2QOHA 4FIGA 2RGPA 4YTHA 4IVAA 5HHWA 5I0BA 3COKA 4GKIA 4EH6A 3ZCLA 3VONA 5C4KA 3RCJA 3U6IA 3VJOA 2KTYA 4QMUA 2JEDA 4BWKA 4ZSGA 4CKRA 3FHIA 3OEZA 2X6DA 4BCHA 3BU6A 5H3QA 4XV1A 3P7BA 3E8NA 4XRJA 2DYLA 3E8CA 3QCSA 3A99A 4ZEGA 2W96B 4IB5A 4YZDA 2QU5A 2ITZA 4BDEA 4FTTA 4HVDA 5IUIA 3MGYA 1Z57A 3MY0A 3OROA 4XG7A 3ANQA 3R7IA 2X0QA 2VWXA 1M14A 5AM6A 5EH0A 3LCSA 1BX6A 2VV9A 5IF1A 3PYYA 5CVGA 4D55A 4D2RA 3IQ7A 2OXXA 3B8RA 2QURA 4I5MA 3OTVA 4YBJA 2GPHA 2HWOA 3OBGA 3ZBFA 2X8EA 3P08A 5C26A 4JRNA 4LL0A 5KMLA 4UYAA 1GJOA 3WOWA 2JDSA 4MWHA 4OBPA 5A6OA 2PK9A 4JBQA 5IMXA 5DHJA 2JKQA 2WMBA 4YHTA 4QYHA 2XCKA 3IO7A 4DGOA 2UZBA 3TTIA 3PXFA 5I5ZA 4XG9A 4S2ZA 2EB3A 4FV8A 5HNGA 2OLCA 3PSCA 4YNEA 4F9BA 4LYNA 1Q8WA 4MXXA 3RKBA 2PWLA 5L6PA 3W32A 3CJFA 2HXQA 2AQXA 2JFMA 5KZIA 3NNXA 3MYGA 5M55A 4ARKA 5HBJA 2IPXA 2IN6A 2ITYA 5EI8A 4CYJA 3QRIA 4DGGA 3BYVA 4Z7GA 3RINA 2Q0NA 4GK4A 4NH1A 4U0IA 2C5XA 4PL3A 4IDTA 4D28A 3OZ6A 3WF5A 4G3DA 3QGWA 5DH3A 4I4FA 4AGUA 4O0RA 4B8LA 3VUIA 1E1XA 2JDVA 4NFNA 3QQJA 4MTAA 4RA5A 3UPXA 2VUWA 2UV2A 3GNIB 5EM8A 3ORZA 5CENA 3W0PA 4IFGA 2R2PA 2YITA 3RVGA 5E91A 2XJ1A 4YJSA 2I40A 3SXSA 3WILA 5JFWA 4I23A 3TNHA 4BGQA 3CSVA 3IECA 4Q9SA 4I6QA 4NEUA 1PXLA 3DBCA 3BLRA 3VNTA 2UZOA 4TN6A 3FMMA 2QKWB 5HE2A 2FGIA 4FSYA 4J95A 3PP1A 4I20A 4HZRA 4IQ6A 4Y95A 3ORIA 2VX1A 2W5BA 3FPQA 4ALUA 5LCJA 2XNGA 3HRBA 4YGAA 4QDVA 1YXVA 3ORPA 5HESA 3MA6A 2VTIA 5BX0A 5M57A 4N57A 4FV3A 4HYSA 4HYHA 4A07A 2RFSA 4CRLA 4GFMA 4BDIA 2OBJA 3R9NA 4FV9A 3FC1X 4IXPA 2X39A 4IZYA 5K0KA 3LLAA 2OW3A 1OVEA 5L8KA 3E3PA 3GU7A 2C6IA 3AD6A 3R7YA 2VTQA 2WQOA 2OF2A 2WOUA 3PY3A 4UYNA 3SXRA 3HDNA 1XO2B 3DT1A 5J8IA 1OPKA 4QNAA 3VS0A 4FKVA 2E2BA 3R2BA 3RI1A 3BPRA 4G6OA 2HZ0A 3QZGA 1ZLTA 3HV5A 4U41A 2X7GA 5B0XA 2B4SB 2UW3A 2XCHA 4MBJA 4O0VA 4N6YA 3VUHA 4A4XA 1M7NA 2OI4X 3UYTA 4EH2A 4DINA 4ZTLA 4Y5QA 4YPSA 3BV2A 4YC8A 3DXQA 4MF0A 1IA9A 2J5EA 2BDWA 5DE2A 4XG3A 5M06A 5C9CA 3VQUA 1URCA 4FZAB 5A9UA 3NW5A 3KIOC 3G9NA 1JKSA 1H0VA 2VTOA 3ANRA 3PLSA 4GVAA 4Y85A 5G6VA 3Q3BA 5CASA 1UVRA 4EOSA 1PKGA 1BMKA 2JDOA 2C69A 4LGHA 3QWKA 3R6XA 1PMUA 5IDNA 4A9UA 4KKHA 5HLPA 2Z7QA 4TKSA 3ZUTA 5ETFA 5CAUA 3W2QA 2YEXA 4FICA 4E6CA 4RFYA