3HFDA

Nucleosome assembly protein 1 from plasmodium knowlesi
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
249
structure length
214
Chain Sequence
b'TDLTEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGNGEAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYIKKEGFILSFHFAPNPFFSNSVLTKTYHMKPVLLHTEATVIDWYDNKNILKKNVVKVQQTVNRDSFFHFFTSHKVPEVAQLEMIIEGDYEVALTIKERIIPYAVDYFLGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome assembly protein 1
publication title Nucleosome Assembly Protein 1 from Plasmodium knowlesi
rcsb
source organism Plasmodium knowlesi strain h
molecule tags Chaperone, protein transport
total genus 60
structure length 214
sequence length 249
ec nomenclature
pdb deposition date 2009-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3hfdA02
3FS3A 3GYWA 5DAYA 3GYVA 3HFDA 2E50A
chains in the Genus database with same CATH superfamily
3Q1IA 1P49A 4X9RA 4FDIA 4N7ZA 3BZIA 1A87A 2E50A 4O9WA 4WHHA 3HMJG 2I9ZA 4X9VA 3HIKA 4WHKA 3C5LA 3P34A 4CXSA 4N7VA 5DMSA 3P37A 1FSUA 3RQ7A 1Q4OA 2I9XA 1Q4KA 2OGQA 4CYSA 4H71A 3HIHA 4HABA 2OJXA 4X9WA 3P2WA 4FDJA 1E1ZP 3GYVA 4CYRA 1N2LA 1E3CP 1N2KA 4XB0A 3P35A 4DFWA 4LKLA 3LM3A 1HDHA 1E2SP 3P36A 1E2TA 3GYWA 2VKZG 3LXQA 4G7NA 4H5XA 4E9DA 4CXKA 1AUKA 5J19A 4HY2A 4O6WA 3FVHA 4O56A 1F34B 4J7BB 3KDRA 4LKMA 3HFDA 2QZUA 2IA9A 4E67A 3P2ZA 4YYPA 1UMWA 4RS6A 4NK7A 5DNJA 5DAYA 3ED4A 4E9CA 4WHLA 4RCPA 1E33P 4N9JA 3FS3A 1F32A 5DMVC 2UV8G 5AJ9A 4HCOA 5LHZA 4NKBA 2N19A 4CXUA
chains in the Genus database with same CATH topology
1P49A 1E2TA 3GYWA 2VKZG 3LXQA 4G7NA 4FDIA 4N7ZA 4CYSA 2E50A 4NK7A 4CXKA 1AUKA 5DAYA 3ED4A 3HMJG 1E33P 4N9JA 3FS3A 4FDJA 1E1ZP 3GYVA 2UV8G 4CYRA 5AJ9A 4CXSA 1N2LA 2QZUA 1E3CP 1N2KA 3KDRA 4NKBA 4N7VA 3LM3A 3HFDA 1FSUA 1HDHA 1E2SP 4CXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FS3 A;  3GYW A;  5DAY A;  3GYV A;  3HFD A;  2E50 A; 
#chains in the Genus database with same CATH topology
 3Q1I A;  1P49 A;  4X9R A;  4FDI A;  4N7Z A;  3BZI A;  1A87 A;  2E50 A;  4O9W A;  4WHH A;  3HMJ G;  2I9Z A;  4X9V A;  3HIK A;  4WHK A;  3C5L A;  3P34 A;  4CXS A;  4N7V A;  5DMS A;  3P37 A;  1FSU A;  3RQ7 A;  1Q4O A;  2I9X A;  1Q4K A;  2OGQ A;  4CYS A;  4H71 A;  3HIH A;  4HAB A;  2OJX A;  4X9W A;  3P2W A;  4FDJ A;  1E1Z P;  3GYV A;  4CYR A;  1N2L A;  1E3C P;  1N2K A;  4XB0 A;  3P35 A;  4DFW A;  4LKL A;  3LM3 A;  1HDH A;  1E2S P;  3P36 A;  1E2T A;  3GYW A;  2VKZ G;  3LXQ A;  4G7N A;  4H5X A;  4E9D A;  4CXK A;  1AUK A;  5J19 A;  4HY2 A;  4O6W A;  3FVH A;  4O56 A;  1F34 B;  4J7B B;  3KDR A;  4LKM A;  3HFD A;  2QZU A;  2IA9 A;  4E67 A;  3P2Z A;  4YYP A;  1UMW A;  4RS6 A;  4NK7 A;  5DNJ A;  5DAY A;  3ED4 A;  4E9C A;  4WHL A;  4RCP A;  1E33 P;  4N9J A;  3FS3 A;  1F32 A;  5DMV C;  2UV8 G;  5AJ9 A;  4HCO A;  5LHZ A;  4NKB A;  2N19 A;  4CXU A; 
#chains in the Genus database with same CATH homology
 1P49 A;  1E2T A;  3GYW A;  2VKZ G;  3LXQ A;  4G7N A;  4FDI A;  4N7Z A;  4CYS A;  2E50 A;  4NK7 A;  4CXK A;  1AUK A;  5DAY A;  3ED4 A;  3HMJ G;  1E33 P;  4N9J A;  3FS3 A;  4FDJ A;  1E1Z P;  3GYV A;  2UV8 G;  4CYR A;  5AJ9 A;  4CXS A;  1N2L A;  2QZU A;  1E3C P;  1N2K A;  3KDR A;  4NKB A;  4N7V A;  3LM3 A;  3HFD A;  1FSU A;  1HDH A;  1E2S P;  4CXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...