3HFDA

Nucleosome assembly protein 1 from plasmodium knowlesi
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
249
structure length
214
Chain Sequence
TDLTEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGNGEAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYIKKEGFILSFHFAPNPFFSNSVLTKTYHMKPVLLHTEATVIDWYDNKNILKKNVVKVQQTVNRDSFFHFFTSHKVPEVAQLEMIIEGDYEVALTIKERIIPYAVDYFLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nucleosome Assembly Protein 1 from Plasmodium knowlesi
rcsb
source organism Plasmodium knowlesi strain h
molecule tags Chaperone, protein transport
molecule keywords Nucleosome assembly protein 1
total genus 60
structure length 214
sequence length 249
ec nomenclature
pdb deposition date 2009-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3hfdA02
3FS3A 3GYWA 5DAYA 2E50A 3GYVA 3HFDA
chains in the Genus database with same CATH superfamily
1Q4OA 4NK7A 4LKLA 3Q1IA 4RS6A 2I9ZA 2UV8G 3P34A 4CYSA 2OGQA 4N7ZA 5J19A 1FSUA 4WHLA 4DFWA 3GYVA 1Q4KA 1UMWA 1E2SP 4X9WA 1E1ZP 1HDHA 4HCOA 3RQ7A 3FS3A 4O9WA 5DMSA 3HIKA 4YYPA 5DNJA 4RCPA 3HMJG 2OJXA 4J7BB 4XB0A 5DMVC 4E9CA 4NKBA 1E3CP 4HY2A 5AJ9A 2IA9A 4CXUA 4E9DA 2QZUA 3GYWA 1F32A 4CXKA 3P35A 4N7VA 3C5LA 4HABA 4CXSA 4FDJA 4N9JA 1N2KA 4FDIA 4X9RA 4O6WA 4G7NA 5LHZA 1F34B 2I9XA 4WHKA 1E33P 4O56A 4E67A 3BZIA 3LM3A 4CYRA 3HIHA 1AUKA 2E50A 4X9VA 3HFDA 3P2WA 1E2TA 5DAYA 3KDRA 4WHHA 1P49A 4H5XA 4H71A 1A87A 2N19A 3P2ZA 3FVHA 2VKZG 3P36A 3LXQA 4LKMA 3P37A 3ED4A 1N2LA
chains in the Genus database with same CATH topology
4N7VA 3FS3A 4NK7A 4CXSA 4FDJA 2E50A 4N9JA 3HFDA 1N2KA 4FDIA 3HMJG 1E2TA 2UV8G 4CYSA 5DAYA 3KDRA 4G7NA 4N7ZA 1FSUA 1P49A 4NKBA 1E3CP 1E33P 3GYVA 2VKZG 5AJ9A 1E2SP 4CXUA 1E1ZP 2QZUA 3GYWA 3LXQA 1HDHA 3LM3A 4CYRA 3ED4A 4CXKA 1AUKA 1N2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FS3 A;  3GYW A;  5DAY A;  2E50 A;  3GYV A;  3HFD A; 
#chains in the Genus database with same CATH topology
 1Q4O A;  4NK7 A;  4LKL A;  3Q1I A;  4RS6 A;  2I9Z A;  2UV8 G;  3P34 A;  4CYS A;  2OGQ A;  4N7Z A;  5J19 A;  1FSU A;  4WHL A;  4DFW A;  3GYV A;  1Q4K A;  1UMW A;  1E2S P;  4X9W A;  1E1Z P;  1HDH A;  4HCO A;  3RQ7 A;  3FS3 A;  4O9W A;  5DMS A;  3HIK A;  4YYP A;  5DNJ A;  4RCP A;  3HMJ G;  2OJX A;  4J7B B;  4XB0 A;  5DMV C;  4E9C A;  4NKB A;  1E3C P;  4HY2 A;  5AJ9 A;  2IA9 A;  4CXU A;  4E9D A;  2QZU A;  3GYW A;  1F32 A;  4CXK A;  3P35 A;  4N7V A;  3C5L A;  4HAB A;  4CXS A;  4FDJ A;  4N9J A;  1N2K A;  4FDI A;  4X9R A;  4O6W A;  4G7N A;  5LHZ A;  1F34 B;  2I9X A;  4WHK A;  1E33 P;  4O56 A;  4E67 A;  3BZI A;  3LM3 A;  4CYR A;  3HIH A;  1AUK A;  2E50 A;  4X9V A;  3HFD A;  3P2W A;  1E2T A;  5DAY A;  3KDR A;  4WHH A;  1P49 A;  4H5X A;  4H71 A;  1A87 A;  2N19 A;  3P2Z A;  3FVH A;  2VKZ G;  3P36 A;  3LXQ A;  4LKM A;  3P37 A;  3ED4 A;  1N2L A; 
#chains in the Genus database with same CATH homology
 4N7V A;  3FS3 A;  4NK7 A;  4CXS A;  4FDJ A;  2E50 A;  4N9J A;  3HFD A;  1N2K A;  4FDI A;  3HMJ G;  1E2T A;  2UV8 G;  4CYS A;  5DAY A;  3KDR A;  4G7N A;  4N7Z A;  1FSU A;  1P49 A;  4NKB A;  1E3C P;  1E33 P;  3GYV A;  2VKZ G;  5AJ9 A;  1E2S P;  4CXU A;  1E1Z P;  2QZU A;  3GYW A;  3LXQ A;  1HDH A;  3LM3 A;  4CYR A;  3ED4 A;  4CXK A;  1AUK A;  1N2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...