3HFDA

Nucleosome assembly protein 1 from plasmodium knowlesi
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
249
structure length
214
Chain Sequence
TDLTEEQKETLKKLKLYQKEYYDYESKFEYELFLLRQKYHDLYGPIYDKRREALVGNGEAKIGTPNLPEFWLRALRNNNTVSHVIEDHDEEILVYLNDIRCDYIKKEGFILSFHFAPNPFFSNSVLTKTYHMKPVLLHTEATVIDWYDNKNILKKNVVKVQQTVNRDSFFHFFTSHKVPEVAQLEMIIEGDYEVALTIKERIIPYAVDYFLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleosome assembly protein 1
publication title Nucleosome Assembly Protein 1 from Plasmodium knowlesi
rcsb
source organism Plasmodium knowlesi strain h
molecule tags Chaperone, protein transport
total genus 60
structure length 214
sequence length 249
ec nomenclature
pdb deposition date 2009-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.90 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain Arylsulfatase, C-terminal domain 3hfdA02
3GYVA 2E50A 3HFDA 3GYWA 5DAYA 3FS3A
chains in the Genus database with same CATH superfamily
3HIKA 4RCPA 3P35A 3KDRA 1N2KA 5DMSA 4N7ZA 3P2ZA 3HIHA 1E3CP 4E9DA 1Q4KA 2OJXA 3P34A 4CXSA 5J19A 4LKMA 4O9WA 2QZUA 3P37A 1P49A 5DAYA 4H71A 2I9ZA 5DNJA 4LKLA 4HY2A 2UV8G 4X9WA 3LM3A 4HCOA 4E67A 2VKZG 4O6WA 1FSUA 1E1ZP 4J7BB 2IA9A 3FVHA 4CYRA 1E33P 1E2SP 2I9XA 4FDIA 2E50A 1F32A 2N19A 1A87A 5DMVC 4CYSA 5LHZA 4FDJA 4N9JA 4CXKA 1HDHA 3FS3A 1Q4OA 4G7NA 4RS6A 3HFDA 4XB0A 4YYPA 4E9CA 3C5LA 4CXUA 1F34B 3RQ7A 4H5XA 5AJ9A 3ED4A 1N2LA 3GYVA 4N7VA 3BZIA 4NK7A 1AUKA 4X9RA 3Q1IA 2OGQA 3P2WA 4WHKA 4NKBA 4X9VA 3GYWA 4DFWA 4O56A 3HMJG 3P36A 1UMWA 1E2TA 3LXQA 4WHHA 4WHLA 4HABA
chains in the Genus database with same CATH topology
1N2LA 3GYVA 4N7VA 4FDIA 2E50A 2UV8G 4NK7A 3LM3A 1AUKA 3KDRA 4CYSA 1N2KA 2VKZG 4FDJA 4N9JA 4CXKA 1HDHA 1FSUA 4N7ZA 1E1ZP 3FS3A 1E3CP 4NKBA 4G7NA 4CXSA 3HFDA 3GYWA 2QZUA 3HMJG 4CYRA 4CXUA 1P49A 1E33P 5DAYA 1E2SP 1E2TA 3LXQA 5AJ9A 3ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYV A;  2E50 A;  3HFD A;  3GYW A;  5DAY A;  3FS3 A; 
#chains in the Genus database with same CATH topology
 3HIK A;  4RCP A;  3P35 A;  3KDR A;  1N2K A;  5DMS A;  4N7Z A;  3P2Z A;  3HIH A;  1E3C P;  4E9D A;  1Q4K A;  2OJX A;  3P34 A;  4CXS A;  5J19 A;  4LKM A;  4O9W A;  2QZU A;  3P37 A;  1P49 A;  5DAY A;  4H71 A;  2I9Z A;  5DNJ A;  4LKL A;  4HY2 A;  2UV8 G;  4X9W A;  3LM3 A;  4HCO A;  4E67 A;  2VKZ G;  4O6W A;  1FSU A;  1E1Z P;  4J7B B;  2IA9 A;  3FVH A;  4CYR A;  1E33 P;  1E2S P;  2I9X A;  4FDI A;  2E50 A;  1F32 A;  2N19 A;  1A87 A;  5DMV C;  4CYS A;  5LHZ A;  4FDJ A;  4N9J A;  4CXK A;  1HDH A;  3FS3 A;  1Q4O A;  4G7N A;  4RS6 A;  3HFD A;  4XB0 A;  4YYP A;  4E9C A;  3C5L A;  4CXU A;  1F34 B;  3RQ7 A;  4H5X A;  5AJ9 A;  3ED4 A;  1N2L A;  3GYV A;  4N7V A;  3BZI A;  4NK7 A;  1AUK A;  4X9R A;  3Q1I A;  2OGQ A;  3P2W A;  4WHK A;  4NKB A;  4X9V A;  3GYW A;  4DFW A;  4O56 A;  3HMJ G;  3P36 A;  1UMW A;  1E2T A;  3LXQ A;  4WHH A;  4WHL A;  4HAB A; 
#chains in the Genus database with same CATH homology
 1N2L A;  3GYV A;  4N7V A;  4FDI A;  2E50 A;  2UV8 G;  4NK7 A;  3LM3 A;  1AUK A;  3KDR A;  4CYS A;  1N2K A;  2VKZ G;  4FDJ A;  4N9J A;  4CXK A;  1HDH A;  1FSU A;  4N7Z A;  1E1Z P;  3FS3 A;  1E3C P;  4NKB A;  4G7N A;  4CXS A;  3HFD A;  3GYW A;  2QZU A;  3HMJ G;  4CYR A;  4CXU A;  1P49 A;  1E33 P;  5DAY A;  1E2S P;  1E2T A;  3LXQ A;  5AJ9 A;  3ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...