3HFNA

Crystal structure of an hfq protein from anabaena sp.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
60
Chain Sequence
SLPSIRQLQNLIKQAAPVEIKLVTGDAITGRVLWQDPTCVCIADRQTTIWKQAIAYLQPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Asl2047 protein
publication title Cyanobacteria contain a structural homologue of the Hfq protein with altered RNA-binding properties.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Rna binding protein
total genus 9
structure length 60
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hfnA00
1WPYA 2DTOA 4EMKA 5GANd 3QHSA 4XU2A 3RKWA 4C8QA 3JCMc 4A54A 1D3BB 4M77B 4PNOA 4M7DB 5GAN6 3JCMe 4Y91A 5GAOr 2HNIA 3JCMW 4M7AG 2DTHA 3EFSA 2DXTA 1JRIA 4M75F 5GANf 2DZ9A 4XTXA 1LOJA 4M75A 5GAMg 1M8VA 2VC8A 3RKXA 4EMHA 4M77E 2QTXA 4M7DE 1LJOA 5GAMj 4N0AA 4XTYA 5GAN7 3JCMJ 5GAN5 4XTVA 3FB9A 3JCMV 5GAMe 4MMLA 4NOYA 5GAOm 3HFOA 3RKYA 4PJOG 1BIBA 4XQ3A 2FB7A 2DJZA 2JN0A 4XU0A 4V2SA 4M7DG 1U1TA 3JB9D 4M78B 2EWNA 4C8QG 1TH7A 5DY9A 5GANh 4M7AD 4XU1A 4PJOB 2YHTA 2DVEA 1I4K1 5LJ5g 5GMKi 1JBMA 5LJ5h 5GAN3 2RM4A 2RD1A 4NL3A 1N9SA 2K57A 4C92B 2E65A 4M77C 1U1SA 3QUIA 3JB9J 4EMKB 3RESA 4C8QB 3V8KA 5GMKl 4M78E 4M75G 1H641 3BDUA 3GIBA 3QO3A 4PJOE 4XTUA 2ZGWA 5GAMd 4M77D 4C92E 2DEQA 4J5YA 3SWNC 4M75B 4RCBA 4M78G 2EAYA 4X9DA 1YCYA 4C8QE 2E10A 5GAN2 4C92A 1Y96A 4M7AC 3FIFA 3JCMX 3SB2A 5LJ3d 3HSBA 1HXDA 3V7SA 4C92G 4RCCA 4F7UF 3JCMP 2I2LA 3HFNA 5GANg 4F7UA 1KQ1A 4X9CA 5GAOq 3PGGA 3JCMd 2VXFA 1KQ2A 4M75E 3M4GA 3AHUA 3V7RA 4PJOC 1WQ7A 5GMKh 5GAN4 1M5Q1 5LJ3f 4MMKA 5GANe 5LJ5j 1WQWA 4XTZA 4M7DC 1B34A 5LJ5e 1I81A 3SWNA 4XU3A 3JCMQ 4C8QC 4M7AF 4M78D 4NL2A 3JCMf 3JB9F 4M7AA 1LNXA 1I8FA 4PJOD 3V8LA 2DKGA 1WNLA 2DTIA 2FYKA 4OP0A 5I21A 3VU3C 2YLBA 4C92D 4M7DD 2RA2A 2VXEA 4C8QD 5LJ3h 4M75C 5GAOp 2CGHA 3QSUA 4QVDA 5GAN8 4JRIA 4M77F 4A53A 4M7DF 5GAMf 2YLCA 1D3BA 4M77A 3JCMh 4M7DA 3JB9I 3L2ZA 3FJPA 2EJ9A 4HT9A 2E64A 4M78C 3RERA 4M75D 4XTWA 5LJ5d 5GANj 2E41A 1N9RA 4F7UB 3V8JA 3JB9H 4M7AE 5GMKj 3INZA 1I5LA 2DZCA 4J6XA 4C92C 3JB9G 5GMKm 3L1AA 5GMKe 3RUXA 4EMKC 5CAIA 5LJ3e 3BW1A 1B34B 3JCMb 5LJ5f 2DXUA 4JRKA 5GAMh 3SWNB 1HK9A 4WF2A 4M7AB 4HT8A 4F7UE 1X01A 3RIRA 4J6YA 4M78F 2EJFA 5GAOl 4JUVA 4EMGA 3V7CA 4M78A 2Y90A 3BY7A 4HA8A 2RB6A 4PJOF 4QVCA 1MGQA 5LJ3g 4M77G 5GAOn 5LJ3j 3BFMA 1BIAA 4C8QF 4PJOA 2EJGA 3EFRA 4N0AC 4C92F 4DQ2A 4F7UG 4J6WA 3JCMg 2E1HA 1Y96B 4JLIA
chains in the Genus database with same CATH superfamily
2DBKA 4HKEA 4XU2A 1ZUYA 2QQRA 3MCAB 5IXFA 2DETA 4GLMA 1IGQA 1WZOA 2BE7D 2DAQA 4M75F 2CH4A 1VQ5A 2RJFA 3RKXA 2W10A 1M1KU 4J9BA 3JCMV 3HFOA 1HJDA 1K8AU 4B9WA 2E3IA 4V2SA 2QQBA 3CCUQ 2XDPA 4P5NA 1BI3A 2M16A 5GMKi 2E3HA 1NZ9A 2LCCA 1SHGA 3CCMT 3CCQQ 5J26A 3AT1B 2DL7A 4A4HA 2ZGWA 2FRWA 2A36A 3SFMA 1XQHA 3M58A 1YCYA 1XOVA 1GL5A 1S1NA 3JCMX 4J9GA 1HXDA 4RCCA 4CI0C 2VXFA 4LNPA 1VYTA 5GAN4 3O5ZA 5GANe 5M9OA 4XU3A 2YRVA 3CCEA 5GJVB 2DTIA 1K73C 4C92D 4M7DD 2BZ8A 1N8RR 4FYYB 2DL5A 1NLPC 1Q82R 4M7DF 3OBYA 5GAMf 1Q86C 4DOVA 1JJ2S 1OOTA 2DXCA 1R8OB 3EG1A 3CD6A 4M78C 1HSQA 4ZN1A 3G4SA 4BI3A 2KVQG 2EYWA 2LC4A 3MEAA 3PTAA 4EMKC 1GCQA 2DBMA 4FT4A 4QQ6A 3SWNB 1QCFA 4FW2A 2CP5A 3OB9A 1M4ZA 1SRLA 3CPWA 4M78A 4IIMA 2EJGA 1VQ5T 1YJNA 3UPUA 4IKFA 2DXBA 4A54A 4EMKA 2F2VA 1YNZA 3QBYA 1JEGA 3RDVA 4M7AG 1MHNA 1RAHB 4XTXA 1WHLA 5IHKA 2RHUA 2XK0A 4EMHA 4M77E 3G71Q 5GAN5 2CREA 2DF6A 1M1FA 2FB7A 3LGLA 1GBQA 1TU0B 1I07A 2YHTA 4NL3A 4F14A 1QP3A 4FYVB 2KDSA 2CP3A 2ZPHB 2JTEA 2RK2A 2KRMA 3QO3A 4HXJA 2MWPA 3BE3A 2JNGA 4II1A 3TSZA 1VQPQ 1AZGB 3CCUA 3C0CA 4LD6A 2P84A 2EW3A 5CO7A 3X28B 3CCQA 2Y4YA 1QVPA 4FYWB 1K73R 4C0ZA 2BE9B 2RJDA 2NUPA 3HL8A 3M53A 7AT1B 3LH5A 2DNUA 3VKIA 3X20B 2M0OA 2KR3A 1I8FA 2X9HA 1TOVA 1JO8A 3G4ST 4O6JA 2KQWA 1QVGS 4EPCA 4Y28E 1U8RA 3KFVA 4RMOA 3CQTA 3I56Q 2EJ9A 2KXDA 1U5SA 2X4YA 3JB9H 4C5EA 2LNVA 4FW1A 3INZA 1BCMA 4ZNXA 4XK8E 1YJNT 1WXUA 2MK5A 1UDLA 3JCMb 4BDYA 4B6MA 2BZYA 4UC4A 4M77G 4KGXB 5EC7A 3VS1A 5D7UA 1P92A 4F7UG 1SKUB 2E4HA 1WHGA 1X69A 2XIDA 4M77B 4AFQC 2ZPIB 1X43A 2GTOA 1OULA 2JXBA 2COYA 3OSVA 3OSSC 3PNWC 4C0DC 5GAMj 3OS1A 1VQMQ 2D6FA 1WJQA 1NBEB 2EGAA 3CCLA 1BU1A 2YXYA 1MV3A 1AHJB 2CZ6B 2EWNA 5GANh 2EQMA 8ATCB 4CC2A 4A4EA 3CCUT 4JS5A 1U1SA 2K5LA 3OS5A 3G71A 1R0BG 1UEBA 3EHRA 2EPDA 1K9MU 3CCQT 4XTUA 2COZA 2RJEA 1X2QA 4C92E 2GGRA 5KE3A 3LX7A 1LCKA 3FLGA 4OB0B 5LJ3d 1ZQ1A 2PUOB 1Q7YU 2FPEA 2HD0A 3RR6A 5FU6B 2QQAA 3JCMd 3LWIA 2ROTA 1B34A 2JW4A 4C8QC 3EAEA 4M78D 3JB9F 3EG9B 2VVKA 2YUOA 1I0CA 4BY6B 1PKSA 1UB4A 3EGDB 2YT6A 1LVKA 4OB2B 1ZSGA 3SHWA 3NGPA 3EGXA 2E41A 1N9RA 4LUDA 2FZCB 3BW1A 3UF4A 3TREA 2R5MA 2VASA 2CZ1B 4JUVA 4YTLA 3WVEB 4K11A 4QVCA 3BFMA 3QYHB 4ORZA 2RQRA 4CC7A 1MNEA 3H6ZA 1VOMA 3EG0A 4L6V5 4IUPA 1IHVA 3C94A 2HNIA 2K3BA 4BD3A 1GBRA 2HEQA 1KC8C 3ULRB 3A8LB 2LT1A 2XMFA 1FX7A 3J80E 1QWFA 2EKHA 4IUVA 2E5KA 2QAZA 4M7DG 2AZSA 3R6NA 3CXCP 1VIFA 1QVGA 2VUBA 1EX4A 1ZLMA 1OYXA 2E6ZA 2ESWA 5LJ5g 1I4K1 2FHDA 2RD1A 5CR2A 2L3RA 4C92B 2HSPA 3UATA 4C5HA 2L3QA 1VQMA 3JV3A 3NTKA 3DLLA 2DJQA 1IZ6A 2XKOC 4AFZC 2R57A 1VQPT 2JMAA 3SB2A 1WHMA 2RHYA 1PM3A 3M59A 1WXBA 3EGUA 1PRMC 1TTHB 1V76A 1NE8A 4JDSA 3TQ7P 1UGRB 2H3EB 5FU7C 2J05A 5HY6A 2WACA 4M75C 5D6YA 3EFOA 1VUBA 2MI6A 5KYWA 3NFCA 2RHIA 3LYIA 1H3HA 1M90U 2HKQB 3I56T 1NEGA 3OYNA 3V8JA 1F1BB 1WJRA 5AT1B 4J9FA 1ZX6A 4QKUA 5GMKe 1Z9ZA 2ENMA 4R55A 2HQXA 1HK9A 2K6DA 2OTLQ 4HT8A 4C5GA 3UA6A 3P8BB 3OYLA 3M0QA 1MGQA 4F16A 4PJOA 3S3MA 2V8JA 2EYZA 2HBWA 1OU9A 2JMCA 3THKA 1BYMA 3OYAA 1C0MA 4M4ZA 4RTUA 4PJJA 2XHCA 1JRIA 1T0JA 4PKCC 2O4XB 1YWOA 3TEEA 2OI3A 1UECA 4MDXA 2HMAA 2G6FX 4ESRA 2FZKB 1BKBA 1VQMT 2M02A 2DD4A 3E2UA 2CZ7B 5HCKA 3M0PA 1BBZA 2DVEA 4Z02A 1G3TA 3SD4A 1RAEB 2D8JA 2RO0A 2E5QA 2XD0A 2EYXA 4OMOA 5KCOA 4M78E 4FSXA 2CP7A 1QKXA 2D8HA 4FSSA 1YHQA 3VV0A 3OW2S 2DEQA 5FRMA 2MF2A 1ZBXA 1CSKA 3REBB 1R77A 2K3XA 4JLGA 3V7SA 4IIOA 4X34A 2I2LA 1PSFA 3GNGA 4J9CA 2EFIA 1AWWA 1IHWA 4PFZA 2AZVA 4X9CA 2HQEA 2LQ8A 1WHHA 1VQOQ 2HDAA 2DK3A 2O9VA 1T0HA 3EG2A 3CCSQ 2RHZA 4HCCA 4R0KA 3CC4Q 5LL6S 2FPDA 1LNXA 4KUIA 2AK5A 4OB1B 1TUCA 3OYDA 5KYUA 2VXEA 4D6WA 2HCKA 3G6EQ 2A3LA 2YUQA 4M77F 1O75A 1D3BA 4Z88A 1JU5C 3UT1A 3P8HA 2QA4Q 3M5AA 1YI2Q 1G83A 2KK4A 3OYIA 4DEYA 3I35A 3RUXA 2DILA 4JRKA 3VRZA 3L42A 1PD0A 1XJWB 3I5SA 2XICA 2Y90A 1G3WA 4JRQA 2B8AA 2SEMA 3ASKA 2ZZDA 3JCMW 2E1HA 1Y96B 4PFPA 4JLIA 5CKFA 5GANd 2NUTA 3OYFA 2EGCA 1LPLA 1WFWA 1PCXA 3CCJQ 2GQVA 1M8VA 5GAMg 4PJLA 2QXFA 1M9SA 4C0FA 3VS3A 1SSHA 3ER0A 1RI0A 2JN0A 2EQJA 4OMFB 4M78B 4Z89A 3L2QA 2HQHA 1UUEA 3H9NA 4FIBA 2K9GA 4CRIA 4DBRA 2VKNA 4EMKB 1QVFP 2CH4W 1KJWA 3PMTA 3CCRQ 3OS0A 2GFAA 1GFDA 2EAYA 2ZPBB 3OYCA 3FIFA 1SHFA 2VWFA 4A4FA 4KBMB 3M0SA 3C4SA 2DE0X 5GMKh 5LJ3f 3KBGA 2GBQA 5LJ5j 4LD9K 2P4RA 1PG5B 1QP2A 2MCNA 3JCMf 2X51A 4PJOD 2O31A 2OAUA 2YLBA 2CUDA 2J06A 2YRCA 1Y71A 4ATOA 2QYZA 1VQOA 4A53A 4RTXA 3VS0A 3FC3A 1AVZC 4A4GA 3CCSA 5A2QE 2KMTA 3CC4A 3OQ5A 2E6NA 1X6GA 1QWEA 2NUPB 1RAFB 2K5IA 1QMCA 2AT1B 4OMLA 5DLOA 3L2WA 1J3TA 1VQ8Q 2RQVA 1W4SA 2OTLT 5GAOl 3OW2A 4ANJA 4E7SA 3I55Q 2EKOA 3BY7A 1Q7YC 1YI2A 1X2KA 5GJWB 4EDUA 3CXCS 4C92F 4DQ2A 5D6WA 1OEBA 2WSFE 3OYYA 3FEOA 1KK7A 2M51A 3N5BB 3H0FA 4AFUC 2DTHA 4WCIA 9ATCB 3DB3A 4KUDK 2MOXA 3H41A 3MEVA 4XTYA 4NOYA 5EG2A 4XQ3A 3CCJA 1W6XA 5C0MA 2X3WD 2GCXA 2MMPA 3V8KA 1T3SA 1M2VA 3UWNA 2D0NA 4AT1B 3C95A 2RK1A 1UJYA 1FYNA 4ZTFA 4RCBA 1M27C 8AT1B 1RAAB 3M55A 5CKDA 5HK3A 3X25B 1UGQB 2RMOA 4BI4A 3HRSA 5KCHA 1X6OA 1G2BA 3O8VA 3E1SA 1KD1C 3CCRA 1VQOT 1I81A 2CSQA 3LLRA 4FCYA 3CCST 4Z8AA 3CC4T 4GLKA 4JRPA 4ZGJB 3BDLA 3G6ET 5L23A 4RKUE 2QA4T 1OU8A 1YI2T 5GMKm 2CZ0B 1EZZB 1B34B 1Q86R 3A8HB 1PWTA 2LZ6B 2RB6A 5LJ3j 3PE0A 2A7YA 1OV3A 1GCPA 1WPYA 2DTOA 5I22A 4JZ3A 2RHXA 2VB6A 1N8RU 2KRNA 3EGXB 1JQQA 4PK4A 3CCJT 1Q82U 3I55A 4QW2A 2A37A 1WHJA 2V1QA 2DLPA 1AOJA 4ZGDB 2FO0A 1UFFA 1JXOA 4PLIA 2IG0A 2PQWA 2CT3A 1WA7A 2RH2A 1SRMA 4BE1A 2LJ3A 2L89A 4LDYA 2YUNA 1RUWA 4RTTA 2XDDA 3WVDB 1H641 2KXCA 1W2BP 4PJOE 1MMGA 2KE9A 3PMIA 5KYXA 1I1JA 1NJIC 3OYGA 1PSEA 2P4TA 1W70A 3CCRT 2XDBA 4M7AC 4L59A 3F70A 1WDXA 1UGSB 4F17A 2F5KA 3OBWA 1YN8A 3CXCA 1CKAA 3CBMA 3G7ZA 1WQ7A 5IXBA 4E7ZA 3L2RA 2K2MA 4E7LA 4J9DA 3P8DA 3JRZA 2JVVA 1VYVA 4M7AA 2EQIA 3CBOA 3OMCA 2EQKA 2DRKA 1H3ZA 4KH0B 3H8ZA 1VQKQ 4GY5A 1KSWA 1RACB 2KT1A 2QQ9A 2G3RA 1G5VA 2PUKB 1VQPA 1G8XA 2F5TX 1VQ6Q 2CS7A 2FPFA 2RPNA 3PT9A 1DJ7B 1KQSP 1K73U 1X01A 1YITQ 3E9FA 2MYSA 4M78F 2B86A 1VQ8T 2VGNA 3V7CA 3A5ZB 1M3AA 4HA8A 3CC7Q 4DEXA 2JTMA 3I55T 1TXQA 3H0IA 1OZ2A 1Q86U 4JZ4A 3EFOB 3JB9J 2RN8A 5KYWB 4C8QA 3MP1A 2ATCB 5GAN6 1NM7A 1OX9A 3CMAQ 2H8HA 5FU7B 4BB7A 5GANf 2DZ9A 3KUFA 3CMEQ 1IO6A 4PFOA 3I56A 4PJOG 4MZMA 1TH7A 3QJ6A 3CC2Q 4XU1A 2RNAA 4E7JA 5GAN3 4PJOB 1K0SA 3RNJA 1NJIR 2K5FA 2DEUA 4M77C 3PIPA 3HP9A 5FWBA 3DB4A 2JM9A 3NTIA 5GAMd 2LMJA 3WXMB 3DKMA 1GFCA 1NLOC 1WX6A 4LUEA 3J81E 2GF7A 3H0HA 5CKEA 1MMNA 1Q81C 3ME9A 3JSCA 2OTJQ 2BTTA 2KGTA 4C92G 4FYXB 2E70A 4HCKA 1S72Q 3D7SB 4F7UA 3PGGA 4KT0E 4AMCA 4PL6A 1M5Q1 5CKBA 2JUFA 5FRNA 4DBQA 2EVRA 1B7TA 3U23A 2PVDB 2DYIA 1YP5A 1RL2A 4LDVA 1WNLA 2FYKA 2ECZA 2CYZB 4BACA 5AYFA 2SRCA 1ABQA 2OAWA 4MDWA 1JJ2P 3ZFJA 1I5OB 5FU6C 4E7HA 3ZEHA 3MPUB 4FT2A 3NTHA 4KULA 4LDWA 5IAYA 1ZSZC 4OVAA 2PVGB 4JJDA 1SSFA 1UHFA 1XTDA 1VQKA 3QZ9B 1SF9A 2VGMA 1M1KC 1AEYA 1PKTA 4VUBA 3PVQA 2LQKA 3GF5A 3RIRA 3E9GA 1K8AC 4OGEA 2C06A 1ZSZA 4RTVA 1E6HA 2DA9A 2K3YA 2CSIA 3M54A 2W0ZA 3SEMA 1D3BB 5GAOr 2JZ2A 1Y07A 1YJ9Q 5FW9A 2KT8A 1VQNQ 3A1PA 2JOYA 2XG8D 2BIVA 4FL6A 4FU6A 1YITA 1OZ3A 1Y0MA 2YUPA 4M75A 2J6OA 2O01E 4E6RA 1MV0B 5GAMe 3S3OA 2D9TA 2LQWA 2ZAEA 2BKDN 1MUZA 2JM8A 4XU0A 2J6FA 4BUGA 4KRTA 5DY9A 3CMAA 2PU9B 4M7AD 2EGEA 1KC8R 1W1FA 5DM7R 1N9SA 4Q5WA 2OX7A 2NUTB 3CMEA 1Q81R 1X6BA 3QIIA 1UJ0A 5A0LA 1D09B 2KY9A 1QW1A 2L3PA 3A8OB 5IN1A 5HK0A 3LGFA 4J9HA 4O5VA 2QTVA 4Y92A 3OYEA 2RF0A 1SEMA 1QLYA 1ZUUA 1WLPB 4M7DC 2DM1A 4HCBA 1HD3A 3X26B 2DO3A 1QVFA 4ZTJA 2LX9A 2M1HA 2JT4A 2NWMA 4N4IA 5I2SA 1CKBA 5KYNA 1AWJA 4BDZA 3MEWA 2OTJA 1S72A 3META 2NLUA 2XI9A 4C8QD 5GAOp 4RG2A 2QGFB 4KGVB 4QVDA 4HVUA 3URGA 1VQKT 2YLCA 4M7DA 1BI1A 1M1KR 1FMVA 2F1LA 2O88A 3EHQA 4QQDA 4A4KA 1K8AR 2MAMA 5KH6A 2ED0A 3VRYA 4RG8A 1OPKA 2DPPB 3Q1JA 4B9XA 5I11A 2EBPA 1VQ6T 3RBBB 3VUBA 4J9IA 5LJ3g 2KNBB 1D0YA 1YITT 3PIOA 2FZGB 2DYBA 3CC7T 4J6WA 3JCMg 2RI2A 3OA6A 3RKWA 2DX1A 1E7OA 1TG0A 1E6GA 2CP6A 1W2BS 4HVVA 3CMAT 1LOJA 5IHNA 2QG9B 2IPOB 2JJ9A 2QTXA 1KHCA 3UA7A 2MPXC 2CDTA 3CMET 1BIBA 2MIOA 3QWYA 1OX8A 1YJ9A 1VQNA 1FMKA 4QVZA 2L8DA 2LT4A 5FLXE 5CQYA 3CC2T 3M9QA 3RESA 2OTLA 3CD6Q 2F2XA 3VS5A 1M30A 2J6KA 3OY9A 5D6XA 1M3CA 2F2WA 4MZTA 1KIKA 3M0UA 4J7IA 3HPWA 1KC8U 2DRMA 2EQUA 3A8GB 4M78G 4X9DA 5GAN2 1IB8A 2CP0A 4J83A 1BB9A 4KH1B 1SPKA 3HFNA 4FM4B 5GAOq 2OTJT 4JS4A 1N8RC 1A0NB 1IXDA 1S72T 2KSSA 2D1XA 4MMKA 4QQGA 3TU4K 1PHTA 3I5RA 2L0AA 1SG5A 1NG2A 2NYSA 4N4HA 1G3YA 1M2VB 2FG0A 3QJYA 4OP0A 1Y7XA 2JS2A 2RA2A 1K76A 2PVOB 2HL5C 2AKLA 2C0TA 1RAGB 2LJ1A 3MHXA 3REAB 3FJPA 2DL8A 2E12A 2LX7A 2ZPEB 4M75D 4EIKA 3VUZA 1BI0A 1VQ7Q 4J6XA 4L5GA 2Y4XA 3M0RA 5CAIA 2LNHB 2MWOA 5GAMh 2FEIA 4J9EA 2VYTA 1ZHIA 3SDZA 1PD1A 2GNCA 4PJOF 2LTOA 4AFSC 1MMAA 2M9UA 1H8KA 1UGVA 4KGZB 5KYYA 4M7AE 5IHIA 3JCMc 2DL4A 4PNOA 3CPFA 3NPFA 1K9MC 4DOWA 3I9QA 4PJNA 2KAFA 2L3SA 1YJ9T 3MP6A 1VQNT 2DL3A 2JS0A 5DLQE 3G6EA 3E19A 5GAN7 4A63B 4OB3B 2QK0A 4MMLA 2BZXA 2QA4A 3VS7A 3GPLA 1YFNA 2R5AA 4C5IA 2FL7A 1D1CA 4NS5A 3EG3A 1N6AA 3QG1A 5CK9A 3QPHA 1ACMB 5GMKl 2RQTA 4J5YA 1GCQC 1VQ4Q 1WI7A 2DVJA 4C8QE 2P0QA 1Y96A 3ZL7C 6AT1B 1KG1A 3MEUA 3JCMP 1FWZA 1KQ1A 1Y57A 3M4GA 2KROA 3IQLA 1ZA2B 1V29B 1GRIA 2EIFA 4QT7A 4D8KA 1NYFA 4BE2A 1W2BA 1FXXA 2V26A 1D1BA 1TUDA 3LW5E 4DBFA 3GNFB 1B07A 2CGHA 3GLXA 3HTRA 5KYXB 1BI2A 4LDUA 3L2VA 1PNJA 3RERA 4IUQA 5LJ5d 3CCLQ 3QDRB 1OPLA 4E7KA 1WJSA 3A8MB 4C0DB 2BUDA 2DXUA 1H92A 4M7AB 4F7UE 4GBQA 3VS6A 4EMGA 2LCSA 1K9MR 3OMGA 2XU8A 3EFRA 3L2UA 1VQ7A 3M0TA 1OQKA 2YSQA 2I0NA 3VS2A 2DFUA 1NEBA 2JTFA 2RQWA 4Y91A 1VQLQ 2WSCE 1Q7YR 1AZEA 1K4US 1WIEA 4X1VA 4OGCA 3JCMJ 4AG1C 5GAOm 3VYHB 2KEAA 1D0ZA 1KQSA 4J8OA 3S6WA 2DJZA 2LVMA 4RUGA 3CCET 1U1TA 1RABB 1IRXA 4C8QG 2ABLA 2RI5A 1WHKA 3MKDA 2E65A 5FROA 4ME7A 4C8QB 4RTZA 3KXTA 1OI1A 1VQ8A 4C0GA 3CD6T 2FVUA 5CIUA 1PRLC 2GTJA 2HZYA 2V8IA 3OW2P 3SWNC 5A0GA 5J3BA 2QEXQ 1M1GA 2X35A 2PZ1A 1TSFA 1M90C 1YIJQ 2A08A 5GANg 2LCLA 1VA7A 2GFUA 3CCVQ 1VQ9Q 4M75E 3QKJA 4OMMA 3FRNA 1R0CB 1WGSA 1WQWA 3LH0A 3FJ5A 1JXMA 5LJ5e 3SWNA 1VQ4A 4NL2A 2QDYB 1YJWQ 1PC0A 3HHTB 3RMQA 3CPWP 1ZBJA 2RQUA 1Z9QA 1KD1R 2ZPGB 3VYGA 3OYKA 1ZUKA 2QDLA 2IVWA 4E2FB 4DBHA 1K9AA 3CEYA 1QCNA 2P0KA 4F7UB 4JJCA 3VS4A 5GMKj 1I5LA 2A28A 3PVLA 1D0XA 1ARKA 3ZBDA 1N5ZA 1VIEA 1VQ7T 2V8KA 4ZGEB 1WXTA 2X4JA 2K7AA 2X4WA 3HKSA 3GBQA 4N0AC 5CQXA 1JJ2A 5IH2A 2QQSA 2DD5A 2KRSA 1JB0E 1QCOA 2WSEE 1IGUA 2KYMA 4OMPA 5A0DA 2DXTA 3NHNA 4MZPA 4PLLA 4M7DE 1LJOA 2KYBA 4N0AA 3R6OA 3A98A 2Z0WA 3M4YA 2ED1A 3HRTA 3OS2A 1VQLA 3JB9D 1JBMA 1ZSZB 2K57A 2QASA 3QUIA 1RLQC 1RI9A 1MNDA 2F69A 1QVFS 4M75G 1BCOA 3GIBA 1M90R 3OYJA 2VV5A 4M75B 2HBPA 2CUBA 1VQ4T 1UE9A 1AWOA 4LXCA 3OYHA 1K1ZA 5IT9E 2X3XD 1B3QA 2AIRB 3V7RA 4DA4A 2DIGA 4IUTA 2PTKA 5L8RE 2ZCFB 2L5QA 2O2OA 4BI8B 2QEXA 1AT1B 3QZ5B 3V8LA 2LJ0A 4F04B 3TVTA 4WTOB 2RJCA 1YIJA 3QWXX 3CCVA 1VQ9A 2YWWA 1M3BA 1YWPA 3HRUA 4M77A 4XAXB 4HT9A 4TVRA 3GP8A 1YJWA 3GOXA 4AG2C 3JAME 3G1JA 1KD1U 4D8DA 3CCLT 2P0PA 4RTYA 1AWXA 2A0FB 1AD5A 5KE2A 3G71T 2CT4A 5GAOn 1YHQQ 1TUGB 1RAIB 5LJ3e 4E7IA 3FDRA 1UTIA 1M8MA 4M7DB 3JCMe 1T3LA 2C0OA 2NUZA 1YBYA 3VJPA 1VQLT 2H3JA 4ELYC 2RI3A 4N4GA 3OYMA 5J39A 1EFNA 1IREB 2LP5A 1GXIE 2ROLA 2KI7A 4BY6C 1X27A 5KYUB 5HKCA 2KBTA 1BK2A 4BE0A 4IURA 5CVIA 5LJ5h 3CCMQ 2LRQA 1VQ6A 3EG9A 2K79A 1G3SA 3CC7A 3EGDA 2AHJB 1KFZA 2D0QB 3HSBA 1M2OA 4ZN3A 2YRDA 2QEXT 1C1AA 2L2PA 4CC4B 1QQJA 3AHUA 1YIJT 1U3OA 4PJMA 4PJOC 5CKHA 3DLMA 2K2VA 3CCVT 1VQ9T 2DIQA 1O9SA 4M7AF 3JCMQ 1RLPC 2QGGA 3M56A 1YJWT 2HKNA 2HL3A 1HYOA 1NJIU 1V1CA 3CC2A 1WYXA 1FMWA 4JRIA 3TSWA 4HCZA 2EYQA 3EH2A 3JB9I 4LDXA 1XNIA 2E64A 4XTWA 5GANj 3EH1A 4C92C 5LJ5f 3CBPA 1D1AA 4OF1A 1X75C 5I2MA 2YDLA 1NPRA 4CC3A 1MMDA 4OMQA 1UHCA 1VQ5Q 1QVGP 2K4YA 5ECAA 2M0YA 3RMSA 2AKKA 4C92A 5FWCA 4C8QF 2PNIA 3QHSA 1KHIA 2LQNA 3QXEB 3MO8A 2FRYA 3EFSA 5CCAA 2VC8A 4JPBW 2X4XA 5C6SA 4IUUA 4XTVA 3FB9A 3RKYA 3MJXA 3NMZC 4JJBA 4E47A 3T9NA 3J7AF 1ZA1B 1TS9A 1EIFA 2RM4A 5KYYB 1U06A 3LWHA 1QKWA 3X24B 2ZPFB 1N27A 3BDUA 4LN2A 4M77D 4OMNA 2EYYA 3PFSA 2IIMA 3CPWS 3OYBA 2E10A 3CCEQ 4ELZC 3CCMA 2V1RA 4F7UF 1KQ2A 1UGPB 3QDFA 3C12A 2HAXA 4LE9A 4XTZA 2HSEB 4R56A 4HVWA 1UG1A 3S3NA 4RTWA 2DKGA 3G4SQ 2CP2A 1K0XA 5I21A 3VU3C 2DERA 2DMOA 1RADB 1NYGA 3UDCA 2O9SA 5LJ3h 3QSUA 1VYUA 3M57A 5GAN8 4J7FA 2C0IA 3TCJA 1Q81U 2CKKA 2LDMA 3JCMh 3L2ZA 2COWA 2OJ2A 2R58A 1NPPA 3MP8A 1YJNQ 1Q95G 3QYGB 2DZCA 2J7IA 2O4XA 3JB9G 3L1AA 1Q82C 1ABOA 1TWBA 4JJNK 2GQIA 4WF2A 4J6YA 1KQSS 2EJFA 2QI2A 1YCSB 1BIAA 1C6VX 1YHQT
chains in the Genus database with same CATH topology
4HKEA 3JB9J 4XU2A 4C8QA 3MP1A 2QQRA 3MCAB 5GAN6 2JTFA 4Y91A 1BYMA 3OYAA 2WSCE 5FU7B 2XHCA 2DAQA 4BB7A 1JRIA 4M75F 5GANf 2DZ9A 1VQ5A 4PKCC 2RJFA 2O4XB 3RKXA 3TEEA 3KUFA 4OGCA 1M1KU 3JCMJ 4MDXA 5GAOm 3JCMV 3VYHB 3HFOA 3I56A 4J8OA 4PJOG 3S6WA 1KQSA 1BKBA 2DJZA 1VQMT 2LVMA 1K8AU 4B9WA 3CCET 4MZMA 4V2SA 2DD4A 1U1TA 2CZ7B 2QQBA 4C8QG 1TH7A 3QJ6A 2XDPA 4P5NA 4XU1A 4PJOB 2RI5A 1BI3A 2DVEA 2M16A 5GAN3 4Z02A 5GMKi 4E7JA 1G3TA 3SD4A 2K5FA 1NZ9A 2LCCA 2E65A 4M77C 2RO0A 3CCMT 2E5QA 5J26A 5FROA 4ME7A 4C8QB 3KXTA 2XD0A 1OI1A 3PIPA 1VQ8A 4C0GA 5KCOA 3HP9A 4M78E 4FSXA 3DB4A 3CD6T 4A4HA 2FVUA 3NTIA 2ZGWA 5CIUA 5GAMd 2V8IA 3WXMB 1YHQA 3DKMA 3VV0A 3OW2S 2DEQA 5FRMA 3SWNC 2MF2A 5A0GA 3SFMA 1XQHA 3M58A 1YCYA 5J3BA 3J81E 2GF7A 1XOVA 1ZBXA 5CKEA 1Q81C 3ME9A 3JCMX 2K3XA 1M1GA 2X35A 4JLGA 3JSCA 1HXDA 3V7SA 4X34A 4C92G 4RCCA 2E70A 2I2LA 1PSFA 3GNGA 4CI0C 2EFIA 2LCLA 4F7UA 4X9CA 2GFUA 5GANg 3PGGA 2HQEA 2LQ8A 2VXFA 4KT0E 4M75E 4PL6A 3QKJA 3FRNA 5GAN4 1M5Q1 5CKBA 2DK3A 2JUFA 5GANe 1WGSA 1WQWA 5M9OA 3LH0A 5FRNA 5LJ5e 2RHZA 3SWNA 4XU3A 4HCCA 1VQ4A 2PVDB 2YRVA 4NL2A 2QDYB 1RL2A 5LL6S 4KUIA 1LNXA 4LDVA 3CCEA 4OB1B 1WNLA 2DTIA 2FYKA 3HHTB 3RMQA 1K73C 2CYZB 4C92D 4BACA 4M7DD 3OYDA 5AYFA 2VXEA 4D6WA 2ZPGB 3VYGA 2A3LA 4MDWA 4M77F 3OYKA 4M7DF 3ZFJA 3OBYA 1O75A 5GAMf 4DOVA 1Q86C 1D3BA 1JJ2S 2DXCA 2IVWA 3UT1A 3P8HA 5FU6C 1R8OB 4E7HA 3CD6A 3M5AA 3CEYA 4M78C 2P0KA 3ZEHA 4ZN1A 2KK4A 4FT2A 3NTHA 4KULA 3OYIA 4LDWA 5IAYA 4F7UB 3G4SA 4BI3A 5GMKj 2KVQG 4OVAA 1I5LA 2LC4A 2PVGB 1SSFA 3MEAA 3ZBDA 3PTAA 3RUXA 4EMKC 1VIEA 1XTDA 3QZ9B 1VQ7T 1VQKA 2VGMA 2V8KA 4ZGEB 2X4JA 4JRKA 4FT4A 4QQ6A 3SWNB 1M1KC 4VUBA 3L42A 2LQKA 3OB9A 1M4ZA 3GF5A 3RIRA 3E9GA 3CPWA 2XICA 1K8AC 4M78A 2Y90A 4OGEA 1G3WA 4JRQA 2C06A 2B8AA 2X4WA 3HKSA 3ASKA 2EJGA 2ZZDA 4N0AC 5CQXA 1YJNA 3UPUA 1VQ5T 3JCMW 1JJ2A 4IKFA 2E1HA 1Y96B 2QQSA 2DXBA 4JLIA 2K3YA 4A54A 5CKFA 4EMKA 5GANd 3M54A 2DD5A 1D3BB 3OYFA 3QBYA 5GAOr 2JZ2A 1Y07A 1JB0E 2JOYA 4M7AG 2WSEE 2XG8D 2BIVA 4FL6A 4FU6A 1YITA 5A0DA 1MHNA 2DXTA 1OZ3A 2GQVA 4XTXA 4M75A 5GAMg 4MZPA 2QXFA 2RHUA 1M8VA 2XK0A 4PLLA 1M9SA 4M77E 4EMHA 4C0FA 1LJOA 4M7DE 4N0AA 2O01E 3R6OA 3ER0A 5GAN5 1RI0A 5GAMe 3S3OA 2D9TA 3M4YA 2BKDN 1M1FA 2FB7A 3HRTA 2JN0A 3OS2A 2EQJA 3LGLA 4XU0A 1VQLA 4BUGA 4OMFB 4M78B 5DY9A 3CMAA 2PU9B 3L2QA 4M7AD 2YHTA 5DM7R 4NL3A 3JB9D 1JBMA 4FIBA 4CRIA 1N9SA 2K57A 1QP3A 3QUIA 2KDSA 4Q5WA 2ZPHB 4EMKB 3CMEA 3QIIA 2F69A 2RK2A 1QVFS 4M75G 5A0LA 3GIBA 3QO3A 2KY9A 1QW1A 2MWPA 3OYJA 2JNGA 3PMTA 4II1A 3OS0A 2GFAA 3A8OB 2VV5A 4M75B 3CCUA 5IN1A 2EAYA 2ZPBB 5HK0A 3OYCA 4LD6A 2HBPA 3FIFA 3LGFA 1VQ4T 4A4FA 5CO7A 4O5VA 3X28B 3CCQA 3OYHA 4KBMB 2Y4YA 1QVPA 5IT9E 3C4SA 4C0ZA 3V7RA 3OYEA 2DIGA 5GMKh 4DA4A 2RJDA 5LJ3f 3KBGA 4LD9K 5LJ5j 3HL8A 4IUTA 3M53A 5L8RE 4M7DC 1QP2A 2ZCFB 3VKIA 2L5QA 3X20B 2DO3A 3X26B 4HCBA 3JCMf 2M0OA 1QVFA 4ZTJA 2LX9A 4BI8B 2M1HA 1I8FA 3QZ5B 5I2SA 4N4IA 3V8LA 2QEXA 4PJOD 2OAUA 2YLBA 3MEWA 4BDZA 2OTJA 3G4ST 4O6JA 2RJCA 3META 2NLUA 2XI9A 1Y71A 4C8QD 1YIJA 1S72A 4ATOA 5GAOp 4RG2A 3CCVA 1VQ9A 2KQWA 4QVDA 1QVGS 3URGA 4EPCA 1VQKT 1VQOA 4A53A 4Y28E 2YLCA 3HRUA 3FC3A 4M77A 4A4GA 1U8RA 1BI1A 4RMOA 4M7DA 4XAXB 3CCSA 2EJ9A 5A2QE 4TVRA 4HT9A 3GP8A 2KMTA 2X4YA 1YJWA 3CC4A 3OQ5A 2E6NA 3GOXA 3JB9H 4C5EA 4QQDA 2LNVA 3JAME 4A4KA 3INZA 2MAMA 1KD1U 3CCLT 4XK8E 5KH6A 2P0PA 1YJNT 4RG8A 2K5IA 2DPPB 3Q1JA 3JCMb 4B9XA 5DLOA 3L2WA 4BDYA 5KE2A 1VQ6T 1W4SA 3G71T 2OTLT 5GAOl 3OW2A 3VUBA 2EKOA 3BY7A 5LJ3g 1Q7YC 4UC4A 1YI2A 5GAOn 1YITT 4M77G 4EDUA 3PIOA 3CXCS 3CC7T 4C92F 4DQ2A 1P92A 4F7UG 5LJ3e 4J6WA 3JCMg 3FDRA 4E7IA 5D6WA 2RI2A 3OA6A 3RKWA 2WSFE 3OYYA 2XIDA 4M77B 4M7DB 3FEOA 2ZPIB 3JCMe 1YBYA 3N5BB 3VJPA 1VQLT 2H3JA 4ELYC 2DTHA 2RI3A 4N4GA 3OYMA 1W2BS 3CMAT 5J39A 3DB3A 1LOJA 1IREB 1GXIE 3OSVA 3OSSC 2QTXA 1KHCA 3PNWC 4C0DC 5GAMj 4KUDK 3MEVA 4XTYA 3OS1A 4NOYA 5EG2A 3CMET 2D6FA 1BIBA 4XQ3A 4BY6C 1WJQA 3CCLA 1YJ9A 5HKCA 3CCJA 1AHJB 1VQNA 4BE0A 2CZ6B 2EWNA 5GANh 2EQMA 4IURA 2L8DA 4QVZA 5CVIA 4A4EA 5C0MA 2LT4A 5FLXE 5CQYA 5LJ5h 3CCUT 4JS5A 3CC2T 1U1SA 2GCXA 2MMPA 2LRQA 2K5LA 3M9QA 3OS5A 3RESA 3G71A 2OTLA 3V8KA 1UEBA 1VQ6A 1K9MU 3OY9A 5D6XA 3CCQT 4MZTA 1G3SA 3UWNA 4XTUA 3CC7A 3C95A 3HPWA 2RJEA 2RK1A 4J7IA 1KC8U 4C92E 2EQUA 4ZTFA 2AHJB 5KE3A 4RCBA 3A8GB 4M78G 4X9DA 3LX7A 5GAN2 4J83A 3FLGA 3M55A 5CKDA 2D0QB 5HK3A 4OB0B 3X25B 5LJ3d 1UGQB 1ZQ1A 3HSBA 2PUOB 4BI4A 2HD0A 3HRSA 4ZN3A 5FU6B 5KCHA 1X6OA 2QEXT 1Q7YU 2QQAA 3HFNA 4FM4B 3JCMd 5GAOq 2OTJT 4JS4A 1N8RC 3AHUA 3O8VA 1YIJT 1S72T 4PJOC 2KSSA 5CKHA 3E1SA 1KD1C 3DLMA 2K2VA 4MMKA 4QQGA 3CCVT 3LWIA 3TU4K 3CCRA 2DIQA 1VQ9T 1B34A 1O9SA 1VQOT 4M7AF 1I81A 3JCMQ 4C8QC 3EAEA 4M78D 3JB9F 3LLRA 4N4HA 3CCST 3M56A 1G3YA 4OP0A 3CC4T 3QJYA 1YJWT 4GLKA 1Y7XA 4JRPA 2RA2A 4BY6B 1NJIU 1UB4A 2PVOB 3CC2A 4ZGJB 3BDLA 4JRIA 3G6ET 3MHXA 4HCZA 2EYQA 4OB2B 3JB9I 3FJPA 4LDXA 1XNIA 2E64A 2E12A 2ZPEB 4M75D 4RKUE 4XTWA 5GANj 2E41A 1N9RA 2QA4T 3VUZA 1BI0A 1YI2T 4J6XA 4L5GA 4C92C 2Y4XA 5GMKm 5CAIA 2CZ0B 2MWOA 3BW1A 1B34B 5GAMh 5LJ5f 3TREA 3CBPA 2VYTA 4OF1A 1X75C 2R5MA 3A8HB 1ZHIA 5I2MA 1NPRA 3SDZA 2CZ1B 4JUVA 4YTLA 3WVEB 2RB6A 4PJOF 4QVCA 2K4YA 2LTOA 3BFMA 5LJ3j 3QYHB 2M9UA 3RMSA 2A7YA 4C92A 4M7AE 3H6ZA 1WPYA 2DTOA 4C8QF 4L6V5 3QHSA 3JCMc 1KHIA 4PNOA 4IUPA 3CPFA 2RHXA 3C94A 3QXEB 1N8RU 3MO8A 2HNIA 1K9MC 4BD3A 4DOWA 2KAFA 1YJ9T 3CCJT 3EFSA 3MP6A 1VQNT 1Q82U 3I55A 4QW2A 1KC8C 5DLQE 3G6EA 5CCAA 2VC8A 3E19A 3A8LB 2X4XA 5C6SA 5GAN7 4IUUA 4OB3B 2LT1A 4XTVA 3FB9A 4ZGDB 4MMLA 3RKYA 1FX7A 4PLIA 3J80E 2QA4A 2IG0A 2PQWA 4IUVA 4E47A 3T9NA 3GPLA 2RH2A 4M7DG 1QVGA 1VIFA 2R5AA 2VUBA 4BE1A 4C5IA 3J7AF 2E6ZA 1OYXA 2FL7A 4NS5A 2L89A 5LJ5g 1I4K1 2FHDA 1EIFA 4LDYA 2RM4A 2RD1A 5CR2A 2L3RA 4C92B 3LWHA 4C5HA 1N6AA 3QG1A 2XDDA 5CK9A 3QPHA 3X24B 1M90C 5GMKl 1VQMA 2ZPFB 3WVDB 1H641 1N27A 3BDUA 3NTKA 4PJOE 3DLLA 4M77D 3PMIA 2XKOC 1IZ6A 3PFSA 3CPWS 4J5YA 3OYGA 1NJIC 1PSEA 2P4TA 2R57A 4C8QE 3CCRT 1VQPT 3OYBA 2E10A 2XDBA 2P0QA 1Y96A 4L59A 4M7AC 4ELZC 3F70A 3CCMA 3SB2A 2RHYA 1UGSB 1KG1A 3MEUA 3M59A 2F5KA 4F7UF 3JCMP 3OBWA 3CXCA 1KQ2A 1FWZA 1KQ1A 1UGPB 3M4GA 1NE8A 3CBMA 3C12A 1WQ7A 3G7ZA 2HAXA 1V29B 3L2RA 4E7LA 4XTZA 3P8DA 4JDSA 2EIFA 3JRZA 1UGRB 2JVVA 4M7AA 4R56A 3S3NA 3CBOA 5FU7C 3OMCA 4BE2A 2DKGA 1W2BA 1FXXA 5I21A 2EQKA 5HY6A 3VU3C 1H3ZA 3LW5E 2WACA 3H8ZA 3GNFB 5LJ3h 3UDCA 4M75C 3QSUA 2CGHA 4GY5A 3GLXA 3M57A 5D6YA 5GAN8 4J7FA 1BI2A 1VUBA 4LDUA 3TCJA 2MI6A 1Q81U 3NFCA 3L2VA 2RHIA 2CKKA 2LDMA 3JCMh 3LYIA 3L2ZA 1M90U 3RERA 4IUQA 3I56T 2QQ9A 5LJ5d 2R58A 2G3RA 3OYNA 1G5VA 3QDRB 3V8JA 1NPPA 3MP8A 3QYGB 4E7KA 2PUKB 1WJRA 2DZCA 1VQPA 3JB9G 2O4XA 1Q82C 3L1AA 5GMKe 1WJSA 2F5TX 3A8MB 4JJNK 4C0DB 4R55A 2BUDA 2DXUA 2CS7A 1HK9A 2HQXA 4WF2A 3PT9A 4M7AB 1DJ7B 4HT8A 4C5GA 3P8BB 4F7UE 3OYLA 1K73U 1X01A 4J6YA 3E9FA 4M78F 2EJFA 2QI2A 1KQSS 4EMGA 1VQ8T 2VGNA 3V7CA 3A5ZB 4HA8A 3OMGA 1MGQA 1BIAA 4PJOA 2JTMA 3I55T 2XU8A 3S3MA 2V8JA 3EFRA 3L2UA 1VQ7A 1OZ2A 1YHQT 1Q86U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPY A;  2DTO A;  4EMK A;  5GAN d;  3QHS A;  4XU2 A;  3RKW A;  4C8Q A;  3JCM c;  4A54 A;  1D3B B;  4M77 B;  4PNO A;  4M7D B;  5GAN 6;  3JCM e;  4Y91 A;  5GAO r;  2HNI A;  3JCM W;  4M7A G;  2DTH A;  3EFS A;  2DXT A;  1JRI A;  4M75 F;  5GAN f;  2DZ9 A;  4XTX A;  1LOJ A;  4M75 A;  5GAM g;  1M8V A;  2VC8 A;  3RKX A;  4EMH A;  4M77 E;  2QTX A;  4M7D E;  1LJO A;  5GAM j;  4N0A A;  4XTY A;  5GAN 7;  3JCM J;  5GAN 5;  4XTV A;  3FB9 A;  3JCM V;  5GAM e;  4MML A;  4NOY A;  5GAO m;  3HFO A;  3RKY A;  4PJO G;  1BIB A;  4XQ3 A;  2FB7 A;  2DJZ A;  2JN0 A;  4XU0 A;  4V2S A;  4M7D G;  1U1T A;  3JB9 D;  4M78 B;  2EWN A;  4C8Q G;  1TH7 A;  5DY9 A;  5GAN h;  4M7A D;  4XU1 A;  4PJO B;  2YHT A;  2DVE A;  1I4K 1;  5LJ5 g;  5GMK i;  1JBM A;  5LJ5 h;  5GAN 3;  2RM4 A;  2RD1 A;  4NL3 A;  1N9S A;  2K57 A;  4C92 B;  2E65 A;  4M77 C;  1U1S A;  3QUI A;  3JB9 J;  4EMK B;  3RES A;  4C8Q B;  3V8K A;  5GMK l;  4M78 E;  4M75 G;  1H64 1;  3BDU A;  3GIB A;  3QO3 A;  4PJO E;  4XTU A;  2ZGW A;  5GAM d;  4M77 D;  4C92 E;  2DEQ A;  4J5Y A;  3SWN C;  4M75 B;  4RCB A;  4M78 G;  2EAY A;  4X9D A;  1YCY A;  4C8Q E;  2E10 A;  5GAN 2;  4C92 A;  1Y96 A;  4M7A C;  3FIF A;  3JCM X;  3SB2 A;  5LJ3 d;  3HSB A;  1HXD A;  3V7S A;  4C92 G;  4RCC A;  4F7U F;  3JCM P;  2I2L A;  3HFN A;  5GAN g;  4F7U A;  1KQ1 A;  4X9C A;  5GAO q;  3PGG A;  3JCM d;  2VXF A;  1KQ2 A;  4M75 E;  3M4G A;  3AHU A;  3V7R A;  4PJO C;  1WQ7 A;  5GMK h;  5GAN 4;  1M5Q 1;  5LJ3 f;  4MMK A;  5GAN e;  5LJ5 j;  1WQW A;  4XTZ A;  4M7D C;  1B34 A;  5LJ5 e;  1I81 A;  3SWN A;  4XU3 A;  3JCM Q;  4C8Q C;  4M7A F;  4M78 D;  4NL2 A;  3JCM f;  3JB9 F;  4M7A A;  1LNX A;  1I8F A;  4PJO D;  3V8L A;  2DKG A;  1WNL A;  2DTI A;  2FYK A;  4OP0 A;  5I21 A;  3VU3 C;  2YLB A;  4C92 D;  4M7D D;  2RA2 A;  2VXE A;  4C8Q D;  5LJ3 h;  4M75 C;  5GAO p;  2CGH A;  3QSU A;  4QVD A;  5GAN 8;  4JRI A;  4M77 F;  4A53 A;  4M7D F;  5GAM f;  2YLC A;  1D3B A;  4M77 A;  3JCM h;  4M7D A;  3JB9 I;  3L2Z A;  3FJP A;  2EJ9 A;  4HT9 A;  2E64 A;  4M78 C;  3RER A;  4M75 D;  4XTW A;  5LJ5 d;  5GAN j;  2E41 A;  1N9R A;  4F7U B;  3V8J A;  3JB9 H;  4M7A E;  5GMK j;  3INZ A;  1I5L A;  2DZC A;  4J6X A;  4C92 C;  3JB9 G;  5GMK m;  3L1A A;  5GMK e;  3RUX A;  4EMK C;  5CAI A;  5LJ3 e;  3BW1 A;  1B34 B;  3JCM b;  5LJ5 f;  2DXU A;  4JRK A;  5GAM h;  3SWN B;  1HK9 A;  4WF2 A;  4M7A B;  4HT8 A;  4F7U E;  1X01 A;  3RIR A;  4J6Y A;  4M78 F;  2EJF A;  5GAO l;  4JUV A;  4EMG A;  3V7C A;  4M78 A;  2Y90 A;  3BY7 A;  4HA8 A;  2RB6 A;  4PJO F;  4QVC A;  1MGQ A;  5LJ3 g;  4M77 G;  5GAO n;  5LJ3 j;  3BFM A;  1BIA A;  4C8Q F;  4PJO A;  2EJG A;  3EFR A;  4N0A C;  4C92 F;  4DQ2 A;  4F7U G;  4J6W A;  3JCM g;  2E1H A;  1Y96 B;  4JLI A; 
#chains in the Genus database with same CATH topology
 2DBK A;  4HKE A;  4XU2 A;  1ZUY A;  2QQR A;  3MCA B;  5IXF A;  2DET A;  4GLM A;  1IGQ A;  1WZO A;  2BE7 D;  2DAQ A;  4M75 F;  2CH4 A;  1VQ5 A;  2RJF A;  3RKX A;  2W10 A;  1M1K U;  4J9B A;  3JCM V;  3HFO A;  1HJD A;  1K8A U;  4B9W A;  2E3I A;  4V2S A;  2QQB A;  3CCU Q;  2XDP A;  4P5N A;  1BI3 A;  2M16 A;  5GMK i;  2E3H A;  1NZ9 A;  2LCC A;  1SHG A;  3CCM T;  3CCQ Q;  5J26 A;  3AT1 B;  2DL7 A;  4A4H A;  2ZGW A;  2FRW A;  2A36 A;  3SFM A;  1XQH A;  3M58 A;  1YCY A;  1XOV A;  1GL5 A;  1S1N A;  3JCM X;  4J9G A;  1HXD A;  4RCC A;  4CI0 C;  2VXF A;  4LNP A;  1VYT A;  5GAN 4;  3O5Z A;  5GAN e;  5M9O A;  4XU3 A;  2YRV A;  3CCE A;  5GJV B;  2DTI A;  1K73 C;  4C92 D;  4M7D D;  2BZ8 A;  1N8R R;  4FYY B;  2DL5 A;  1NLP C;  1Q82 R;  4M7D F;  3OBY A;  5GAM f;  1Q86 C;  4DOV A;  1JJ2 S;  1OOT A;  2DXC A;  1R8O B;  3EG1 A;  3CD6 A;  4M78 C;  1HSQ A;  4ZN1 A;  3G4S A;  4BI3 A;  2KVQ G;  2EYW A;  2LC4 A;  3MEA A;  3PTA A;  4EMK C;  1GCQ A;  2DBM A;  4FT4 A;  4QQ6 A;  3SWN B;  1QCF A;  4FW2 A;  2CP5 A;  3OB9 A;  1M4Z A;  1SRL A;  3CPW A;  4M78 A;  4IIM A;  2EJG A;  1VQ5 T;  1YJN A;  3UPU A;  4IKF A;  2DXB A;  4A54 A;  4EMK A;  2F2V A;  1YNZ A;  3QBY A;  1JEG A;  3RDV A;  4M7A G;  1MHN A;  1RAH B;  4XTX A;  1WHL A;  5IHK A;  2RHU A;  2XK0 A;  4EMH A;  4M77 E;  3G71 Q;  5GAN 5;  2CRE A;  2DF6 A;  1M1F A;  2FB7 A;  3LGL A;  1GBQ A;  1TU0 B;  1I07 A;  2YHT A;  4NL3 A;  4F14 A;  1QP3 A;  4FYV B;  2KDS A;  2CP3 A;  2ZPH B;  2JTE A;  2RK2 A;  2KRM A;  3QO3 A;  4HXJ A;  2MWP A;  3BE3 A;  2JNG A;  4II1 A;  3TSZ A;  1VQP Q;  1AZG B;  3CCU A;  3C0C A;  4LD6 A;  2P84 A;  2EW3 A;  5CO7 A;  3X28 B;  3CCQ A;  2Y4Y A;  1QVP A;  4FYW B;  1K73 R;  4C0Z A;  2BE9 B;  2RJD A;  2NUP A;  3HL8 A;  3M53 A;  7AT1 B;  3LH5 A;  2DNU A;  3VKI A;  3X20 B;  2M0O A;  2KR3 A;  1I8F A;  2X9H A;  1TOV A;  1JO8 A;  3G4S T;  4O6J A;  2KQW A;  1QVG S;  4EPC A;  4Y28 E;  1U8R A;  3KFV A;  4RMO A;  3CQT A;  3I56 Q;  2EJ9 A;  2KXD A;  1U5S A;  2X4Y A;  3JB9 H;  4C5E A;  2LNV A;  4FW1 A;  3INZ A;  1BCM A;  4ZNX A;  4XK8 E;  1YJN T;  1WXU A;  2MK5 A;  1UDL A;  3JCM b;  4BDY A;  4B6M A;  2BZY A;  4UC4 A;  4M77 G;  4KGX B;  5EC7 A;  3VS1 A;  5D7U A;  1P92 A;  4F7U G;  1SKU B;  2E4H A;  1WHG A;  1X69 A;  2XID A;  4M77 B;  4AFQ C;  2ZPI B;  1X43 A;  2GTO A;  1OUL A;  2JXB A;  2COY A;  3OSV A;  3OSS C;  3PNW C;  4C0D C;  5GAM j;  3OS1 A;  1VQM Q;  2D6F A;  1WJQ A;  1NBE B;  2EGA A;  3CCL A;  1BU1 A;  2YXY A;  1MV3 A;  1AHJ B;  2CZ6 B;  2EWN A;  5GAN h;  2EQM A;  8ATC B;  4CC2 A;  4A4E A;  3CCU T;  4JS5 A;  1U1S A;  2K5L A;  3OS5 A;  3G71 A;  1R0B G;  1UEB A;  3EHR A;  2EPD A;  1K9M U;  3CCQ T;  4XTU A;  2COZ A;  2RJE A;  1X2Q A;  4C92 E;  2GGR A;  5KE3 A;  3LX7 A;  1LCK A;  3FLG A;  4OB0 B;  5LJ3 d;  1ZQ1 A;  2PUO B;  1Q7Y U;  2FPE A;  2HD0 A;  3RR6 A;  5FU6 B;  2QQA A;  3JCM d;  3LWI A;  2ROT A;  1B34 A;  2JW4 A;  4C8Q C;  3EAE A;  4M78 D;  3JB9 F;  3EG9 B;  2VVK A;  2YUO A;  1I0C A;  4BY6 B;  1PKS A;  1UB4 A;  3EGD B;  2YT6 A;  1LVK A;  4OB2 B;  1ZSG A;  3SHW A;  3NGP A;  3EGX A;  2E41 A;  1N9R A;  4LUD A;  2FZC B;  3BW1 A;  3UF4 A;  3TRE A;  2R5M A;  2VAS A;  2CZ1 B;  4JUV A;  4YTL A;  3WVE B;  4K11 A;  4QVC A;  3BFM A;  3QYH B;  4ORZ A;  2RQR A;  4CC7 A;  1MNE A;  3H6Z A;  1VOM A;  3EG0 A;  4L6V 5;  4IUP A;  1IHV A;  3C94 A;  2HNI A;  2K3B A;  4BD3 A;  1GBR A;  2HEQ A;  1KC8 C;  3ULR B;  3A8L B;  2LT1 A;  2XMF A;  1FX7 A;  3J80 E;  1QWF A;  2EKH A;  4IUV A;  2E5K A;  2QAZ A;  4M7D G;  2AZS A;  3R6N A;  3CXC P;  1VIF A;  1QVG A;  2VUB A;  1EX4 A;  1ZLM A;  1OYX A;  2E6Z A;  2ESW A;  5LJ5 g;  1I4K 1;  2FHD A;  2RD1 A;  5CR2 A;  2L3R A;  4C92 B;  2HSP A;  3UAT A;  4C5H A;  2L3Q A;  1VQM A;  3JV3 A;  3NTK A;  3DLL A;  2DJQ A;  1IZ6 A;  2XKO C;  4AFZ C;  2R57 A;  1VQP T;  2JMA A;  3SB2 A;  1WHM A;  2RHY A;  1PM3 A;  3M59 A;  1WXB A;  3EGU A;  1PRM C;  1TTH B;  1V76 A;  1NE8 A;  4JDS A;  3TQ7 P;  1UGR B;  2H3E B;  5FU7 C;  2J05 A;  5HY6 A;  2WAC A;  4M75 C;  5D6Y A;  3EFO A;  1VUB A;  2MI6 A;  5KYW A;  3NFC A;  2RHI A;  3LYI A;  1H3H A;  1M90 U;  2HKQ B;  3I56 T;  1NEG A;  3OYN A;  3V8J A;  1F1B B;  1WJR A;  5AT1 B;  4J9F A;  1ZX6 A;  4QKU A;  5GMK e;  1Z9Z A;  2ENM A;  4R55 A;  2HQX A;  1HK9 A;  2K6D A;  2OTL Q;  4HT8 A;  4C5G A;  3UA6 A;  3P8B B;  3OYL A;  3M0Q A;  1MGQ A;  4F16 A;  4PJO A;  3S3M A;  2V8J A;  2EYZ A;  2HBW A;  1OU9 A;  2JMC A;  3THK A;  1BYM A;  3OYA A;  1C0M A;  4M4Z A;  4RTU A;  4PJJ A;  2XHC A;  1JRI A;  1T0J A;  4PKC C;  2O4X B;  1YWO A;  3TEE A;  2OI3 A;  1UEC A;  4MDX A;  2HMA A;  2G6F X;  4ESR A;  2FZK B;  1BKB A;  1VQM T;  2M02 A;  2DD4 A;  3E2U A;  2CZ7 B;  5HCK A;  3M0P A;  1BBZ A;  2DVE A;  4Z02 A;  1G3T A;  3SD4 A;  1RAE B;  2D8J A;  2RO0 A;  2E5Q A;  2XD0 A;  2EYX A;  4OMO A;  5KCO A;  4M78 E;  4FSX A;  2CP7 A;  1QKX A;  2D8H A;  4FSS A;  1YHQ A;  3VV0 A;  3OW2 S;  2DEQ A;  5FRM A;  2MF2 A;  1ZBX A;  1CSK A;  3REB B;  1R77 A;  2K3X A;  4JLG A;  3V7S A;  4IIO A;  4X34 A;  2I2L A;  1PSF A;  3GNG A;  4J9C A;  2EFI A;  1AWW A;  1IHW A;  4PFZ A;  2AZV A;  4X9C A;  2HQE A;  2LQ8 A;  1WHH A;  1VQO Q;  2HDA A;  2DK3 A;  2O9V A;  1T0H A;  3EG2 A;  3CCS Q;  2RHZ A;  4HCC A;  4R0K A;  3CC4 Q;  5LL6 S;  2FPD A;  1LNX A;  4KUI A;  2AK5 A;  4OB1 B;  1TUC A;  3OYD A;  5KYU A;  2VXE A;  4D6W A;  2HCK A;  3G6E Q;  2A3L A;  2YUQ A;  4M77 F;  1O75 A;  1D3B A;  4Z88 A;  1JU5 C;  3UT1 A;  3P8H A;  2QA4 Q;  3M5A A;  1YI2 Q;  1G83 A;  2KK4 A;  3OYI A;  4DEY A;  3I35 A;  3RUX A;  2DIL A;  4JRK A;  3VRZ A;  3L42 A;  1PD0 A;  1XJW B;  3I5S A;  2XIC A;  2Y90 A;  1G3W A;  4JRQ A;  2B8A A;  2SEM A;  3ASK A;  2ZZD A;  3JCM W;  2E1H A;  1Y96 B;  4PFP A;  4JLI A;  5CKF A;  5GAN d;  2NUT A;  3OYF A;  2EGC A;  1LPL A;  1WFW A;  1PCX A;  3CCJ Q;  2GQV A;  1M8V A;  5GAM g;  4PJL A;  2QXF A;  1M9S A;  4C0F A;  3VS3 A;  1SSH A;  3ER0 A;  1RI0 A;  2JN0 A;  2EQJ A;  4OMF B;  4M78 B;  4Z89 A;  3L2Q A;  2HQH A;  1UUE A;  3H9N A;  4FIB A;  2K9G A;  4CRI A;  4DBR A;  2VKN A;  4EMK B;  1QVF P;  2CH4 W;  1KJW A;  3PMT A;  3CCR Q;  3OS0 A;  2GFA A;  1GFD A;  2EAY A;  2ZPB B;  3OYC A;  3FIF A;  1SHF A;  2VWF A;  4A4F A;  4KBM B;  3M0S A;  3C4S A;  2DE0 X;  5GMK h;  5LJ3 f;  3KBG A;  2GBQ A;  5LJ5 j;  4LD9 K;  2P4R A;  1PG5 B;  1QP2 A;  2MCN A;  3JCM f;  2X51 A;  4PJO D;  2O31 A;  2OAU A;  2YLB A;  2CUD A;  2J06 A;  2YRC A;  1Y71 A;  4ATO A;  2QYZ A;  1VQO A;  4A53 A;  4RTX A;  3VS0 A;  3FC3 A;  1AVZ C;  4A4G A;  3CCS A;  5A2Q E;  2KMT A;  3CC4 A;  3OQ5 A;  2E6N A;  1X6G A;  1QWE A;  2NUP B;  1RAF B;  2K5I A;  1QMC A;  2AT1 B;  4OML A;  5DLO A;  3L2W A;  1J3T A;  1VQ8 Q;  2RQV A;  1W4S A;  2OTL T;  5GAO l;  3OW2 A;  4ANJ A;  4E7S A;  3I55 Q;  2EKO A;  3BY7 A;  1Q7Y C;  1YI2 A;  1X2K A;  5GJW B;  4EDU A;  3CXC S;  4C92 F;  4DQ2 A;  5D6W A;  1OEB A;  2WSF E;  3OYY A;  3FEO A;  1KK7 A;  2M51 A;  3N5B B;  3H0F A;  4AFU C;  2DTH A;  4WCI A;  9ATC B;  3DB3 A;  4KUD K;  2MOX A;  3H41 A;  3MEV A;  4XTY A;  4NOY A;  5EG2 A;  4XQ3 A;  3CCJ A;  1W6X A;  5C0M A;  2X3W D;  2GCX A;  2MMP A;  3V8K A;  1T3S A;  1M2V A;  3UWN A;  2D0N A;  4AT1 B;  3C95 A;  2RK1 A;  1UJY A;  1FYN A;  4ZTF A;  4RCB A;  1M27 C;  8AT1 B;  1RAA B;  3M55 A;  5CKD A;  5HK3 A;  3X25 B;  1UGQ B;  2RMO A;  4BI4 A;  3HRS A;  5KCH A;  1X6O A;  1G2B A;  3O8V A;  3E1S A;  1KD1 C;  3CCR A;  1VQO T;  1I81 A;  2CSQ A;  3LLR A;  4FCY A;  3CCS T;  4Z8A A;  3CC4 T;  4GLK A;  4JRP A;  4ZGJ B;  3BDL A;  3G6E T;  5L23 A;  4RKU E;  2QA4 T;  1OU8 A;  1YI2 T;  5GMK m;  2CZ0 B;  1EZZ B;  1B34 B;  1Q86 R;  3A8H B;  1PWT A;  2LZ6 B;  2RB6 A;  5LJ3 j;  3PE0 A;  2A7Y A;  1OV3 A;  1GCP A;  1WPY A;  2DTO A;  5I22 A;  4JZ3 A;  2RHX A;  2VB6 A;  1N8R U;  2KRN A;  3EGX B;  1JQQ A;  4PK4 A;  3CCJ T;  1Q82 U;  3I55 A;  4QW2 A;  2A37 A;  1WHJ A;  2V1Q A;  2DLP A;  1AOJ A;  4ZGD B;  2FO0 A;  1UFF A;  1JXO A;  4PLI A;  2IG0 A;  2PQW A;  2CT3 A;  1WA7 A;  2RH2 A;  1SRM A;  4BE1 A;  2LJ3 A;  2L89 A;  4LDY A;  2YUN A;  1RUW A;  4RTT A;  2XDD A;  3WVD B;  1H64 1;  2KXC A;  1W2B P;  4PJO E;  1MMG A;  2KE9 A;  3PMI A;  5KYX A;  1I1J A;  1NJI C;  3OYG A;  1PSE A;  2P4T A;  1W70 A;  3CCR T;  2XDB A;  4M7A C;  4L59 A;  3F70 A;  1WDX A;  1UGS B;  4F17 A;  2F5K A;  3OBW A;  1YN8 A;  3CXC A;  1CKA A;  3CBM A;  3G7Z A;  1WQ7 A;  5IXB A;  4E7Z A;  3L2R A;  2K2M A;  4E7L A;  4J9D A;  3P8D A;  3JRZ A;  2JVV A;  1VYV A;  4M7A A;  2EQI A;  3CBO A;  3OMC A;  2EQK A;  2DRK A;  1H3Z A;  4KH0 B;  3H8Z A;  1VQK Q;  4GY5 A;  1KSW A;  1RAC B;  2KT1 A;  2QQ9 A;  2G3R A;  1G5V A;  2PUK B;  1VQP A;  1G8X A;  2F5T X;  1VQ6 Q;  2CS7 A;  2FPF A;  2RPN A;  3PT9 A;  1DJ7 B;  1KQS P;  1K73 U;  1X01 A;  1YIT Q;  3E9F A;  2MYS A;  4M78 F;  2B86 A;  1VQ8 T;  2VGN A;  3V7C A;  3A5Z B;  1M3A A;  4HA8 A;  3CC7 Q;  4DEX A;  2JTM A;  3I55 T;  1TXQ A;  3H0I A;  1OZ2 A;  1Q86 U;  4JZ4 A;  3EFO B;  3JB9 J;  2RN8 A;  5KYW B;  4C8Q A;  3MP1 A;  2ATC B;  5GAN 6;  1NM7 A;  1OX9 A;  3CMA Q;  2H8H A;  5FU7 B;  4BB7 A;  5GAN f;  2DZ9 A;  3KUF A;  3CME Q;  1IO6 A;  4PFO A;  3I56 A;  4PJO G;  4MZM A;  1TH7 A;  3QJ6 A;  3CC2 Q;  4XU1 A;  2RNA A;  4E7J A;  5GAN 3;  4PJO B;  1K0S A;  3RNJ A;  1NJI R;  2K5F A;  2DEU A;  4M77 C;  3PIP A;  3HP9 A;  5FWB A;  3DB4 A;  2JM9 A;  3NTI A;  5GAM d;  2LMJ A;  3WXM B;  3DKM A;  1GFC A;  1NLO C;  1WX6 A;  4LUE A;  3J81 E;  2GF7 A;  3H0H A;  5CKE A;  1MMN A;  1Q81 C;  3ME9 A;  3JSC A;  2OTJ Q;  2BTT A;  2KGT A;  4C92 G;  4FYX B;  2E70 A;  4HCK A;  1S72 Q;  3D7S B;  4F7U A;  3PGG A;  4KT0 E;  4AMC A;  4PL6 A;  1M5Q 1;  5CKB A;  2JUF A;  5FRN A;  4DBQ A;  2EVR A;  1B7T A;  3U23 A;  2PVD B;  2DYI A;  1YP5 A;  1RL2 A;  4LDV A;  1WNL A;  2FYK A;  2ECZ A;  2CYZ B;  4BAC A;  5AYF A;  2SRC A;  1ABQ A;  2OAW A;  4MDW A;  1JJ2 P;  3ZFJ A;  1I5O B;  5FU6 C;  4E7H A;  3ZEH A;  3MPU B;  4FT2 A;  3NTH A;  4KUL A;  4LDW A;  5IAY A;  1ZSZ C;  4OVA A;  2PVG B;  4JJD A;  1SSF A;  1UHF A;  1XTD A;  1VQK A;  3QZ9 B;  1SF9 A;  2VGM A;  1M1K C;  1AEY A;  1PKT A;  4VUB A;  3PVQ A;  2LQK A;  3GF5 A;  3RIR A;  3E9G A;  1K8A C;  4OGE A;  2C06 A;  1ZSZ A;  4RTV A;  1E6H A;  2DA9 A;  2K3Y A;  2CSI A;  3M54 A;  2W0Z A;  3SEM A;  1D3B B;  5GAO r;  2JZ2 A;  1Y07 A;  1YJ9 Q;  5FW9 A;  2KT8 A;  1VQN Q;  3A1P A;  2JOY A;  2XG8 D;  2BIV A;  4FL6 A;  4FU6 A;  1YIT A;  1OZ3 A;  1Y0M A;  2YUP A;  4M75 A;  2J6O A;  2O01 E;  4E6R A;  1MV0 B;  5GAM e;  3S3O A;  2D9T A;  2LQW A;  2ZAE A;  2BKD N;  1MUZ A;  2JM8 A;  4XU0 A;  2J6F A;  4BUG A;  4KRT A;  5DY9 A;  3CMA A;  2PU9 B;  4M7A D;  2EGE A;  1KC8 R;  1W1F A;  5DM7 R;  1N9S A;  4Q5W A;  2OX7 A;  2NUT B;  3CME A;  1Q81 R;  1X6B A;  3QII A;  1UJ0 A;  5A0L A;  1D09 B;  2KY9 A;  1QW1 A;  2L3P A;  3A8O B;  5IN1 A;  5HK0 A;  3LGF A;  4J9H A;  4O5V A;  2QTV A;  4Y92 A;  3OYE A;  2RF0 A;  1SEM A;  1QLY A;  1ZUU A;  1WLP B;  4M7D C;  2DM1 A;  4HCB A;  1HD3 A;  3X26 B;  2DO3 A;  1QVF A;  4ZTJ A;  2LX9 A;  2M1H A;  2JT4 A;  2NWM A;  4N4I A;  5I2S A;  1CKB A;  5KYN A;  1AWJ A;  4BDZ A;  3MEW A;  2OTJ A;  1S72 A;  3MET A;  2NLU A;  2XI9 A;  4C8Q D;  5GAO p;  4RG2 A;  2QGF B;  4KGV B;  4QVD A;  4HVU A;  3URG A;  1VQK T;  2YLC A;  4M7D A;  1BI1 A;  1M1K R;  1FMV A;  2F1L A;  2O88 A;  3EHQ A;  4QQD A;  4A4K A;  1K8A R;  2MAM A;  5KH6 A;  2ED0 A;  3VRY A;  4RG8 A;  1OPK A;  2DPP B;  3Q1J A;  4B9X A;  5I11 A;  2EBP A;  1VQ6 T;  3RBB B;  3VUB A;  4J9I A;  5LJ3 g;  2KNB B;  1D0Y A;  1YIT T;  3PIO A;  2FZG B;  2DYB A;  3CC7 T;  4J6W A;  3JCM g;  2RI2 A;  3OA6 A;  3RKW A;  2DX1 A;  1E7O A;  1TG0 A;  1E6G A;  2CP6 A;  1W2B S;  4HVV A;  3CMA T;  1LOJ A;  5IHN A;  2QG9 B;  2IPO B;  2JJ9 A;  2QTX A;  1KHC A;  3UA7 A;  2MPX C;  2CDT A;  3CME T;  1BIB A;  2MIO A;  3QWY A;  1OX8 A;  1YJ9 A;  1VQN A;  1FMK A;  4QVZ A;  2L8D A;  2LT4 A;  5FLX E;  5CQY A;  3CC2 T;  3M9Q A;  3RES A;  2OTL A;  3CD6 Q;  2F2X A;  3VS5 A;  1M30 A;  2J6K A;  3OY9 A;  5D6X A;  1M3C A;  2F2W A;  4MZT A;  1KIK A;  3M0U A;  4J7I A;  3HPW A;  1KC8 U;  2DRM A;  2EQU A;  3A8G B;  4M78 G;  4X9D A;  5GAN 2;  1IB8 A;  2CP0 A;  4J83 A;  1BB9 A;  4KH1 B;  1SPK A;  3HFN A;  4FM4 B;  5GAO q;  2OTJ T;  4JS4 A;  1N8R C;  1A0N B;  1IXD A;  1S72 T;  2KSS A;  2D1X A;  4MMK A;  4QQG A;  3TU4 K;  1PHT A;  3I5R A;  2L0A A;  1SG5 A;  1NG2 A;  2NYS A;  4N4H A;  1G3Y A;  1M2V B;  2FG0 A;  3QJY A;  4OP0 A;  1Y7X A;  2JS2 A;  2RA2 A;  1K76 A;  2PVO B;  2HL5 C;  2AKL A;  2C0T A;  1RAG B;  2LJ1 A;  3MHX A;  3REA B;  3FJP A;  2DL8 A;  2E12 A;  2LX7 A;  2ZPE B;  4M75 D;  4EIK A;  3VUZ A;  1BI0 A;  1VQ7 Q;  4J6X A;  4L5G A;  2Y4X A;  3M0R A;  5CAI A;  2LNH B;  2MWO A;  5GAM h;  2FEI A;  4J9E A;  2VYT A;  1ZHI A;  3SDZ A;  1PD1 A;  2GNC A;  4PJO F;  2LTO A;  4AFS C;  1MMA A;  2M9U A;  1H8K A;  1UGV A;  4KGZ B;  5KYY A;  4M7A E;  5IHI A;  3JCM c;  2DL4 A;  4PNO A;  3CPF A;  3NPF A;  1K9M C;  4DOW A;  3I9Q A;  4PJN A;  2KAF A;  2L3S A;  1YJ9 T;  3MP6 A;  1VQN T;  2DL3 A;  2JS0 A;  5DLQ E;  3G6E A;  3E19 A;  5GAN 7;  4A63 B;  4OB3 B;  2QK0 A;  4MML A;  2BZX A;  2QA4 A;  3VS7 A;  3GPL A;  1YFN A;  2R5A A;  4C5I A;  2FL7 A;  1D1C A;  4NS5 A;  3EG3 A;  1N6A A;  3QG1 A;  5CK9 A;  3QPH A;  1ACM B;  5GMK l;  2RQT A;  4J5Y A;  1GCQ C;  1VQ4 Q;  1WI7 A;  2DVJ A;  4C8Q E;  2P0Q A;  1Y96 A;  3ZL7 C;  6AT1 B;  1KG1 A;  3MEU A;  3JCM P;  1FWZ A;  1KQ1 A;  1Y57 A;  3M4G A;  2KRO A;  3IQL A;  1ZA2 B;  1V29 B;  1GRI A;  2EIF A;  4QT7 A;  4D8K A;  1NYF A;  4BE2 A;  1W2B A;  1FXX A;  2V26 A;  1D1B A;  1TUD A;  3LW5 E;  4DBF A;  3GNF B;  1B07 A;  2CGH A;  3GLX A;  3HTR A;  5KYX B;  1BI2 A;  4LDU A;  3L2V A;  1PNJ A;  3RER A;  4IUQ A;  5LJ5 d;  3CCL Q;  3QDR B;  1OPL A;  4E7K A;  1WJS A;  3A8M B;  4C0D B;  2BUD A;  2DXU A;  1H92 A;  4M7A B;  4F7U E;  4GBQ A;  3VS6 A;  4EMG A;  2LCS A;  1K9M R;  3OMG A;  2XU8 A;  3EFR A;  3L2U A;  1VQ7 A;  3M0T A;  1OQK A;  2YSQ A;  2I0N A;  3VS2 A;  2DFU A;  1NEB A;  2JTF A;  2RQW A;  4Y91 A;  1VQL Q;  2WSC E;  1Q7Y R;  1AZE A;  1K4U S;  1WIE A;  4X1V A;  4OGC A;  3JCM J;  4AG1 C;  5GAO m;  3VYH B;  2KEA A;  1D0Z A;  1KQS A;  4J8O A;  3S6W A;  2DJZ A;  2LVM A;  4RUG A;  3CCE T;  1U1T A;  1RAB B;  1IRX A;  4C8Q G;  2ABL A;  2RI5 A;  1WHK A;  3MKD A;  2E65 A;  5FRO A;  4ME7 A;  4C8Q B;  4RTZ A;  3KXT A;  1OI1 A;  1VQ8 A;  4C0G A;  3CD6 T;  2FVU A;  5CIU A;  1PRL C;  2GTJ A;  2HZY A;  2V8I A;  3OW2 P;  3SWN C;  5A0G A;  5J3B A;  2QEX Q;  1M1G A;  2X35 A;  2PZ1 A;  1TSF A;  1M90 C;  1YIJ Q;  2A08 A;  5GAN g;  2LCL A;  1VA7 A;  2GFU A;  3CCV Q;  1VQ9 Q;  4M75 E;  3QKJ A;  4OMM A;  3FRN A;  1R0C B;  1WGS A;  1WQW A;  3LH0 A;  3FJ5 A;  1JXM A;  5LJ5 e;  3SWN A;  1VQ4 A;  4NL2 A;  2QDY B;  1YJW Q;  1PC0 A;  3HHT B;  3RMQ A;  3CPW P;  1ZBJ A;  2RQU A;  1Z9Q A;  1KD1 R;  2ZPG B;  3VYG A;  3OYK A;  1ZUK A;  2QDL A;  2IVW A;  4E2F B;  4DBH A;  1K9A A;  3CEY A;  1QCN A;  2P0K A;  4F7U B;  4JJC A;  3VS4 A;  5GMK j;  1I5L A;  2A28 A;  3PVL A;  1D0X A;  1ARK A;  3ZBD A;  1N5Z A;  1VIE A;  1VQ7 T;  2V8K A;  4ZGE B;  1WXT A;  2X4J A;  2K7A A;  2X4W A;  3HKS A;  3GBQ A;  4N0A C;  5CQX A;  1JJ2 A;  5IH2 A;  2QQS A;  2DD5 A;  2KRS A;  1JB0 E;  1QCO A;  2WSE E;  1IGU A;  2KYM A;  4OMP A;  5A0D A;  2DXT A;  3NHN A;  4MZP A;  4PLL A;  4M7D E;  1LJO A;  2KYB A;  4N0A A;  3R6O A;  3A98 A;  2Z0W A;  3M4Y A;  2ED1 A;  3HRT A;  3OS2 A;  1VQL A;  3JB9 D;  1JBM A;  1ZSZ B;  2K57 A;  2QAS A;  3QUI A;  1RLQ C;  1RI9 A;  1MND A;  2F69 A;  1QVF S;  4M75 G;  1BCO A;  3GIB A;  1M90 R;  3OYJ A;  2VV5 A;  4M75 B;  2HBP A;  2CUB A;  1VQ4 T;  1UE9 A;  1AWO A;  4LXC A;  3OYH A;  1K1Z A;  5IT9 E;  2X3X D;  1B3Q A;  2AIR B;  3V7R A;  4DA4 A;  2DIG A;  4IUT A;  2PTK A;  5L8R E;  2ZCF B;  2L5Q A;  2O2O A;  4BI8 B;  2QEX A;  1AT1 B;  3QZ5 B;  3V8L A;  2LJ0 A;  4F04 B;  3TVT A;  4WTO B;  2RJC A;  1YIJ A;  3QWX X;  3CCV A;  1VQ9 A;  2YWW A;  1M3B A;  1YWP A;  3HRU A;  4M77 A;  4XAX B;  4HT9 A;  4TVR A;  3GP8 A;  1YJW A;  3GOX A;  4AG2 C;  3JAM E;  3G1J A;  1KD1 U;  4D8D A;  3CCL T;  2P0P A;  4RTY A;  1AWX A;  2A0F B;  1AD5 A;  5KE2 A;  3G71 T;  2CT4 A;  5GAO n;  1YHQ Q;  1TUG B;  1RAI B;  5LJ3 e;  4E7I A;  3FDR A;  1UTI A;  1M8M A;  4M7D B;  3JCM e;  1T3L A;  2C0O A;  2NUZ A;  1YBY A;  3VJP A;  1VQL T;  2H3J A;  4ELY C;  2RI3 A;  4N4G A;  3OYM A;  5J39 A;  1EFN A;  1IRE B;  2LP5 A;  1GXI E;  2ROL A;  2KI7 A;  4BY6 C;  1X27 A;  5KYU B;  5HKC A;  2KBT A;  1BK2 A;  4BE0 A;  4IUR A;  5CVI A;  5LJ5 h;  3CCM Q;  2LRQ A;  1VQ6 A;  3EG9 A;  2K79 A;  1G3S A;  3CC7 A;  3EGD A;  2AHJ B;  1KFZ A;  2D0Q B;  3HSB A;  1M2O A;  4ZN3 A;  2YRD A;  2QEX T;  1C1A A;  2L2P A;  4CC4 B;  1QQJ A;  3AHU A;  1YIJ T;  1U3O A;  4PJM A;  4PJO C;  5CKH A;  3DLM A;  2K2V A;  3CCV T;  1VQ9 T;  2DIQ A;  1O9S A;  4M7A F;  3JCM Q;  1RLP C;  2QGG A;  3M56 A;  1YJW T;  2HKN A;  2HL3 A;  1HYO A;  1NJI U;  1V1C A;  3CC2 A;  1WYX A;  1FMW A;  4JRI A;  3TSW A;  4HCZ A;  2EYQ A;  3EH2 A;  3JB9 I;  4LDX A;  1XNI A;  2E64 A;  4XTW A;  5GAN j;  3EH1 A;  4C92 C;  5LJ5 f;  3CBP A;  1D1A A;  4OF1 A;  1X75 C;  5I2M A;  2YDL A;  1NPR A;  4CC3 A;  1MMD A;  4OMQ A;  1UHC A;  1VQ5 Q;  1QVG P;  2K4Y A;  5ECA A;  2M0Y A;  3RMS A;  2AKK A;  4C92 A;  5FWC A;  4C8Q F;  2PNI A;  3QHS A;  1KHI A;  2LQN A;  3QXE B;  3MO8 A;  2FRY A;  3EFS A;  5CCA A;  2VC8 A;  4JPB W;  2X4X A;  5C6S A;  4IUU A;  4XTV A;  3FB9 A;  3RKY A;  3MJX A;  3NMZ C;  4JJB A;  4E47 A;  3T9N A;  3J7A F;  1ZA1 B;  1TS9 A;  1EIF A;  2RM4 A;  5KYY B;  1U06 A;  3LWH A;  1QKW A;  3X24 B;  2ZPF B;  1N27 A;  3BDU A;  4LN2 A;  4M77 D;  4OMN A;  2EYY A;  3PFS A;  2IIM A;  3CPW S;  3OYB A;  2E10 A;  3CCE Q;  4ELZ C;  3CCM A;  2V1R A;  4F7U F;  1KQ2 A;  1UGP B;  3QDF A;  3C12 A;  2HAX A;  4LE9 A;  4XTZ A;  2HSE B;  4R56 A;  4HVW A;  1UG1 A;  3S3N A;  4RTW A;  2DKG A;  3G4S Q;  2CP2 A;  1K0X A;  5I21 A;  3VU3 C;  2DER A;  2DMO A;  1RAD B;  1NYG A;  3UDC A;  2O9S A;  5LJ3 h;  3QSU A;  1VYU A;  3M57 A;  5GAN 8;  4J7F A;  2C0I A;  3TCJ A;  1Q81 U;  2CKK A;  2LDM A;  3JCM h;  3L2Z A;  2COW A;  2OJ2 A;  2R58 A;  1NPP A;  3MP8 A;  1YJN Q;  1Q95 G;  3QYG B;  2DZC A;  2J7I A;  2O4X A;  3JB9 G;  3L1A A;  1Q82 C;  1ABO A;  1TWB A;  4JJN K;  2GQI A;  4WF2 A;  4J6Y A;  1KQS S;  2EJF A;  2QI2 A;  1YCS B;  1BIA A;  1C6V X;  1YHQ T; 
#chains in the Genus database with same CATH homology
 4HKE A;  3JB9 J;  4XU2 A;  4C8Q A;  3MP1 A;  2QQR A;  3MCA B;  5GAN 6;  2JTF A;  4Y91 A;  1BYM A;  3OYA A;  2WSC E;  5FU7 B;  2XHC A;  2DAQ A;  4BB7 A;  1JRI A;  4M75 F;  5GAN f;  2DZ9 A;  1VQ5 A;  4PKC C;  2RJF A;  2O4X B;  3RKX A;  3TEE A;  3KUF A;  4OGC A;  1M1K U;  3JCM J;  4MDX A;  5GAO m;  3JCM V;  3VYH B;  3HFO A;  3I56 A;  4J8O A;  4PJO G;  3S6W A;  1KQS A;  1BKB A;  2DJZ A;  1VQM T;  2LVM A;  1K8A U;  4B9W A;  3CCE T;  4MZM A;  4V2S A;  2DD4 A;  1U1T A;  2CZ7 B;  2QQB A;  4C8Q G;  1TH7 A;  3QJ6 A;  2XDP A;  4P5N A;  4XU1 A;  4PJO B;  2RI5 A;  1BI3 A;  2DVE A;  2M16 A;  5GAN 3;  4Z02 A;  5GMK i;  4E7J A;  1G3T A;  3SD4 A;  2K5F A;  1NZ9 A;  2LCC A;  2E65 A;  4M77 C;  2RO0 A;  3CCM T;  2E5Q A;  5J26 A;  5FRO A;  4ME7 A;  4C8Q B;  3KXT A;  2XD0 A;  1OI1 A;  3PIP A;  1VQ8 A;  4C0G A;  5KCO A;  3HP9 A;  4M78 E;  4FSX A;  3DB4 A;  3CD6 T;  4A4H A;  2FVU A;  3NTI A;  2ZGW A;  5CIU A;  5GAM d;  2V8I A;  3WXM B;  1YHQ A;  3DKM A;  3VV0 A;  3OW2 S;  2DEQ A;  5FRM A;  3SWN C;  2MF2 A;  5A0G A;  3SFM A;  1XQH A;  3M58 A;  1YCY A;  5J3B A;  3J81 E;  2GF7 A;  1XOV A;  1ZBX A;  5CKE A;  1Q81 C;  3ME9 A;  3JCM X;  2K3X A;  1M1G A;  2X35 A;  4JLG A;  3JSC A;  1HXD A;  3V7S A;  4X34 A;  4C92 G;  4RCC A;  2E70 A;  2I2L A;  1PSF A;  3GNG A;  4CI0 C;  2EFI A;  2LCL A;  4F7U A;  4X9C A;  2GFU A;  5GAN g;  3PGG A;  2HQE A;  2LQ8 A;  2VXF A;  4KT0 E;  4M75 E;  4PL6 A;  3QKJ A;  3FRN A;  5GAN 4;  1M5Q 1;  5CKB A;  2DK3 A;  2JUF A;  5GAN e;  1WGS A;  1WQW A;  5M9O A;  3LH0 A;  5FRN A;  5LJ5 e;  2RHZ A;  3SWN A;  4XU3 A;  4HCC A;  1VQ4 A;  2PVD B;  2YRV A;  4NL2 A;  2QDY B;  1RL2 A;  5LL6 S;  4KUI A;  1LNX A;  4LDV A;  3CCE A;  4OB1 B;  1WNL A;  2DTI A;  2FYK A;  3HHT B;  3RMQ A;  1K73 C;  2CYZ B;  4C92 D;  4BAC A;  4M7D D;  3OYD A;  5AYF A;  2VXE A;  4D6W A;  2ZPG B;  3VYG A;  2A3L A;  4MDW A;  4M77 F;  3OYK A;  4M7D F;  3ZFJ A;  3OBY A;  1O75 A;  5GAM f;  4DOV A;  1Q86 C;  1D3B A;  1JJ2 S;  2DXC A;  2IVW A;  3UT1 A;  3P8H A;  5FU6 C;  1R8O B;  4E7H A;  3CD6 A;  3M5A A;  3CEY A;  4M78 C;  2P0K A;  3ZEH A;  4ZN1 A;  2KK4 A;  4FT2 A;  3NTH A;  4KUL A;  3OYI A;  4LDW A;  5IAY A;  4F7U B;  3G4S A;  4BI3 A;  5GMK j;  2KVQ G;  4OVA A;  1I5L A;  2LC4 A;  2PVG B;  1SSF A;  3MEA A;  3ZBD A;  3PTA A;  3RUX A;  4EMK C;  1VIE A;  1XTD A;  3QZ9 B;  1VQ7 T;  1VQK A;  2VGM A;  2V8K A;  4ZGE B;  2X4J A;  4JRK A;  4FT4 A;  4QQ6 A;  3SWN B;  1M1K C;  4VUB A;  3L42 A;  2LQK A;  3OB9 A;  1M4Z A;  3GF5 A;  3RIR A;  3E9G A;  3CPW A;  2XIC A;  1K8A C;  4M78 A;  2Y90 A;  4OGE A;  1G3W A;  4JRQ A;  2C06 A;  2B8A A;  2X4W A;  3HKS A;  3ASK A;  2EJG A;  2ZZD A;  4N0A C;  5CQX A;  1YJN A;  3UPU A;  1VQ5 T;  3JCM W;  1JJ2 A;  4IKF A;  2E1H A;  1Y96 B;  2QQS A;  2DXB A;  4JLI A;  2K3Y A;  4A54 A;  5CKF A;  4EMK A;  5GAN d;  3M54 A;  2DD5 A;  1D3B B;  3OYF A;  3QBY A;  5GAO r;  2JZ2 A;  1Y07 A;  1JB0 E;  2JOY A;  4M7A G;  2WSE E;  2XG8 D;  2BIV A;  4FL6 A;  4FU6 A;  1YIT A;  5A0D A;  1MHN A;  2DXT A;  1OZ3 A;  2GQV A;  4XTX A;  4M75 A;  5GAM g;  4MZP A;  2QXF A;  2RHU A;  1M8V A;  2XK0 A;  4PLL A;  1M9S A;  4M77 E;  4EMH A;  4C0F A;  1LJO A;  4M7D E;  4N0A A;  2O01 E;  3R6O A;  3ER0 A;  5GAN 5;  1RI0 A;  5GAM e;  3S3O A;  2D9T A;  3M4Y A;  2BKD N;  1M1F A;  2FB7 A;  3HRT A;  2JN0 A;  3OS2 A;  2EQJ A;  3LGL A;  4XU0 A;  1VQL A;  4BUG A;  4OMF B;  4M78 B;  5DY9 A;  3CMA A;  2PU9 B;  3L2Q A;  4M7A D;  2YHT A;  5DM7 R;  4NL3 A;  3JB9 D;  1JBM A;  4FIB A;  4CRI A;  1N9S A;  2K57 A;  1QP3 A;  3QUI A;  2KDS A;  4Q5W A;  2ZPH B;  4EMK B;  3CME A;  3QII A;  2F69 A;  2RK2 A;  1QVF S;  4M75 G;  5A0L A;  3GIB A;  3QO3 A;  2KY9 A;  1QW1 A;  2MWP A;  3OYJ A;  2JNG A;  3PMT A;  4II1 A;  3OS0 A;  2GFA A;  3A8O B;  2VV5 A;  4M75 B;  3CCU A;  5IN1 A;  2EAY A;  2ZPB B;  5HK0 A;  3OYC A;  4LD6 A;  2HBP A;  3FIF A;  3LGF A;  1VQ4 T;  4A4F A;  5CO7 A;  4O5V A;  3X28 B;  3CCQ A;  3OYH A;  4KBM B;  2Y4Y A;  1QVP A;  5IT9 E;  3C4S A;  4C0Z A;  3V7R A;  3OYE A;  2DIG A;  5GMK h;  4DA4 A;  2RJD A;  5LJ3 f;  3KBG A;  4LD9 K;  5LJ5 j;  3HL8 A;  4IUT A;  3M53 A;  5L8R E;  4M7D C;  1QP2 A;  2ZCF B;  3VKI A;  2L5Q A;  3X20 B;  2DO3 A;  3X26 B;  4HCB A;  3JCM f;  2M0O A;  1QVF A;  4ZTJ A;  2LX9 A;  4BI8 B;  2M1H A;  1I8F A;  3QZ5 B;  5I2S A;  4N4I A;  3V8L A;  2QEX A;  4PJO D;  2OAU A;  2YLB A;  3MEW A;  4BDZ A;  2OTJ A;  3G4S T;  4O6J A;  2RJC A;  3MET A;  2NLU A;  2XI9 A;  1Y71 A;  4C8Q D;  1YIJ A;  1S72 A;  4ATO A;  5GAO p;  4RG2 A;  3CCV A;  1VQ9 A;  2KQW A;  4QVD A;  1QVG S;  3URG A;  4EPC A;  1VQK T;  1VQO A;  4A53 A;  4Y28 E;  2YLC A;  3HRU A;  3FC3 A;  4M77 A;  4A4G A;  1U8R A;  1BI1 A;  4RMO A;  4M7D A;  4XAX B;  3CCS A;  2EJ9 A;  5A2Q E;  4TVR A;  4HT9 A;  3GP8 A;  2KMT A;  2X4Y A;  1YJW A;  3CC4 A;  3OQ5 A;  2E6N A;  3GOX A;  3JB9 H;  4C5E A;  4QQD A;  2LNV A;  3JAM E;  4A4K A;  3INZ A;  2MAM A;  1KD1 U;  3CCL T;  4XK8 E;  5KH6 A;  2P0P A;  1YJN T;  4RG8 A;  2K5I A;  2DPP B;  3Q1J A;  3JCM b;  4B9X A;  5DLO A;  3L2W A;  4BDY A;  5KE2 A;  1VQ6 T;  1W4S A;  3G71 T;  2OTL T;  5GAO l;  3OW2 A;  3VUB A;  2EKO A;  3BY7 A;  5LJ3 g;  1Q7Y C;  4UC4 A;  1YI2 A;  5GAO n;  1YIT T;  4M77 G;  4EDU A;  3PIO A;  3CXC S;  3CC7 T;  4C92 F;  4DQ2 A;  1P92 A;  4F7U G;  5LJ3 e;  4J6W A;  3JCM g;  3FDR A;  4E7I A;  5D6W A;  2RI2 A;  3OA6 A;  3RKW A;  2WSF E;  3OYY A;  2XID A;  4M77 B;  4M7D B;  3FEO A;  2ZPI B;  3JCM e;  1YBY A;  3N5B B;  3VJP A;  1VQL T;  2H3J A;  4ELY C;  2DTH A;  2RI3 A;  4N4G A;  3OYM A;  1W2B S;  3CMA T;  5J39 A;  3DB3 A;  1LOJ A;  1IRE B;  1GXI E;  3OSV A;  3OSS C;  2QTX A;  1KHC A;  3PNW C;  4C0D C;  5GAM j;  4KUD K;  3MEV A;  4XTY A;  3OS1 A;  4NOY A;  5EG2 A;  3CME T;  2D6F A;  1BIB A;  4XQ3 A;  4BY6 C;  1WJQ A;  3CCL A;  1YJ9 A;  5HKC A;  3CCJ A;  1AHJ B;  1VQN A;  4BE0 A;  2CZ6 B;  2EWN A;  5GAN h;  2EQM A;  4IUR A;  2L8D A;  4QVZ A;  5CVI A;  4A4E A;  5C0M A;  2LT4 A;  5FLX E;  5CQY A;  5LJ5 h;  3CCU T;  4JS5 A;  3CC2 T;  1U1S A;  2GCX A;  2MMP A;  2LRQ A;  2K5L A;  3M9Q A;  3OS5 A;  3RES A;  3G71 A;  2OTL A;  3V8K A;  1UEB A;  1VQ6 A;  1K9M U;  3OY9 A;  5D6X A;  3CCQ T;  4MZT A;  1G3S A;  3UWN A;  4XTU A;  3CC7 A;  3C95 A;  3HPW A;  2RJE A;  2RK1 A;  4J7I A;  1KC8 U;  4C92 E;  2EQU A;  4ZTF A;  2AHJ B;  5KE3 A;  4RCB A;  3A8G B;  4M78 G;  4X9D A;  3LX7 A;  5GAN 2;  4J83 A;  3FLG A;  3M55 A;  5CKD A;  2D0Q B;  5HK3 A;  4OB0 B;  3X25 B;  5LJ3 d;  1UGQ B;  1ZQ1 A;  3HSB A;  2PUO B;  4BI4 A;  2HD0 A;  3HRS A;  4ZN3 A;  5FU6 B;  5KCH A;  1X6O A;  2QEX T;  1Q7Y U;  2QQA A;  3HFN A;  4FM4 B;  3JCM d;  5GAO q;  2OTJ T;  4JS4 A;  1N8R C;  3AHU A;  3O8V A;  1YIJ T;  1S72 T;  4PJO C;  2KSS A;  5CKH A;  3E1S A;  1KD1 C;  3DLM A;  2K2V A;  4MMK A;  4QQG A;  3CCV T;  3LWI A;  3TU4 K;  3CCR A;  2DIQ A;  1VQ9 T;  1B34 A;  1O9S A;  1VQO T;  4M7A F;  1I81 A;  3JCM Q;  4C8Q C;  3EAE A;  4M78 D;  3JB9 F;  3LLR A;  4N4H A;  3CCS T;  3M56 A;  1G3Y A;  4OP0 A;  3CC4 T;  3QJY A;  1YJW T;  4GLK A;  1Y7X A;  4JRP A;  2RA2 A;  4BY6 B;  1NJI U;  1UB4 A;  2PVO B;  3CC2 A;  4ZGJ B;  3BDL A;  4JRI A;  3G6E T;  3MHX A;  4HCZ A;  2EYQ A;  4OB2 B;  3JB9 I;  3FJP A;  4LDX A;  1XNI A;  2E64 A;  2E12 A;  2ZPE B;  4M75 D;  4RKU E;  4XTW A;  5GAN j;  2E41 A;  1N9R A;  2QA4 T;  3VUZ A;  1BI0 A;  1YI2 T;  4J6X A;  4L5G A;  4C92 C;  2Y4X A;  5GMK m;  5CAI A;  2CZ0 B;  2MWO A;  3BW1 A;  1B34 B;  5GAM h;  5LJ5 f;  3TRE A;  3CBP A;  2VYT A;  4OF1 A;  1X75 C;  2R5M A;  3A8H B;  1ZHI A;  5I2M A;  1NPR A;  3SDZ A;  2CZ1 B;  4JUV A;  4YTL A;  3WVE B;  2RB6 A;  4PJO F;  4QVC A;  2K4Y A;  2LTO A;  3BFM A;  5LJ3 j;  3QYH B;  2M9U A;  3RMS A;  2A7Y A;  4C92 A;  4M7A E;  3H6Z A;  1WPY A;  2DTO A;  4C8Q F;  4L6V 5;  3QHS A;  3JCM c;  1KHI A;  4PNO A;  4IUP A;  3CPF A;  2RHX A;  3C94 A;  3QXE B;  1N8R U;  3MO8 A;  2HNI A;  1K9M C;  4BD3 A;  4DOW A;  2KAF A;  1YJ9 T;  3CCJ T;  3EFS A;  3MP6 A;  1VQN T;  1Q82 U;  3I55 A;  4QW2 A;  1KC8 C;  5DLQ E;  3G6E A;  5CCA A;  2VC8 A;  3E19 A;  3A8L B;  2X4X A;  5C6S A;  5GAN 7;  4IUU A;  4OB3 B;  2LT1 A;  4XTV A;  3FB9 A;  4ZGD B;  4MML A;  3RKY A;  1FX7 A;  4PLI A;  3J80 E;  2QA4 A;  2IG0 A;  2PQW A;  4IUV A;  4E47 A;  3T9N A;  3GPL A;  2RH2 A;  4M7D G;  1QVG A;  1VIF A;  2R5A A;  2VUB A;  4BE1 A;  4C5I A;  3J7A F;  2E6Z A;  1OYX A;  2FL7 A;  4NS5 A;  2L89 A;  5LJ5 g;  1I4K 1;  2FHD A;  1EIF A;  4LDY A;  2RM4 A;  2RD1 A;  5CR2 A;  2L3R A;  4C92 B;  3LWH A;  4C5H A;  1N6A A;  3QG1 A;  2XDD A;  5CK9 A;  3QPH A;  3X24 B;  1M90 C;  5GMK l;  1VQM A;  2ZPF B;  3WVD B;  1H64 1;  1N27 A;  3BDU A;  3NTK A;  4PJO E;  3DLL A;  4M77 D;  3PMI A;  2XKO C;  1IZ6 A;  3PFS A;  3CPW S;  4J5Y A;  3OYG A;  1NJI C;  1PSE A;  2P4T A;  2R57 A;  4C8Q E;  3CCR T;  1VQP T;  3OYB A;  2E10 A;  2XDB A;  2P0Q A;  1Y96 A;  4L59 A;  4M7A C;  4ELZ C;  3F70 A;  3CCM A;  3SB2 A;  2RHY A;  1UGS B;  1KG1 A;  3MEU A;  3M59 A;  2F5K A;  4F7U F;  3JCM P;  3OBW A;  3CXC A;  1KQ2 A;  1FWZ A;  1KQ1 A;  1UGP B;  3M4G A;  1NE8 A;  3CBM A;  3C12 A;  1WQ7 A;  3G7Z A;  2HAX A;  1V29 B;  3L2R A;  4E7L A;  4XTZ A;  3P8D A;  4JDS A;  2EIF A;  3JRZ A;  1UGR B;  2JVV A;  4M7A A;  4R56 A;  3S3N A;  3CBO A;  5FU7 C;  3OMC A;  4BE2 A;  2DKG A;  1W2B A;  1FXX A;  5I21 A;  2EQK A;  5HY6 A;  3VU3 C;  1H3Z A;  3LW5 E;  2WAC A;  3H8Z A;  3GNF B;  5LJ3 h;  3UDC A;  4M75 C;  3QSU A;  2CGH A;  4GY5 A;  3GLX A;  3M57 A;  5D6Y A;  5GAN 8;  4J7F A;  1BI2 A;  1VUB A;  4LDU A;  3TCJ A;  2MI6 A;  1Q81 U;  3NFC A;  3L2V A;  2RHI A;  2CKK A;  2LDM A;  3JCM h;  3LYI A;  3L2Z A;  1M90 U;  3RER A;  4IUQ A;  3I56 T;  2QQ9 A;  5LJ5 d;  2R58 A;  2G3R A;  3OYN A;  1G5V A;  3QDR B;  3V8J A;  1NPP A;  3MP8 A;  3QYG B;  4E7K A;  2PUK B;  1WJR A;  2DZC A;  1VQP A;  3JB9 G;  2O4X A;  1Q82 C;  3L1A A;  5GMK e;  1WJS A;  2F5T X;  3A8M B;  4JJN K;  4C0D B;  4R55 A;  2BUD A;  2DXU A;  2CS7 A;  1HK9 A;  2HQX A;  4WF2 A;  3PT9 A;  4M7A B;  1DJ7 B;  4HT8 A;  4C5G A;  3P8B B;  4F7U E;  3OYL A;  1K73 U;  1X01 A;  4J6Y A;  3E9F A;  4M78 F;  2EJF A;  2QI2 A;  1KQS S;  4EMG A;  1VQ8 T;  2VGN A;  3V7C A;  3A5Z B;  4HA8 A;  3OMG A;  1MGQ A;  1BIA A;  4PJO A;  2JTM A;  3I55 T;  2XU8 A;  3S3M A;  2V8J A;  3EFR A;  3L2U A;  1VQ7 A;  1OZ2 A;  1YHQ T;  1Q86 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...