3HFNA

Crystal structure of an hfq protein from anabaena sp.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
63
structure length
60
Chain Sequence
b'SLPSIRQLQNLIKQAAPVEIKLVTGDAITGRVLWQDPTCVCIADRQTTIWKQAIAYLQPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Asl2047 protein
publication title Cyanobacteria contain a structural homologue of the Hfq protein with altered RNA-binding properties.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Rna binding protein
total genus 9
structure length 60
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hfnA00
3RERA 4M75A 2DXTA 4C8QC 4J5YA 1LJOA 4NL2A 3QHSA 1B34A 1U1SA 4J6XA 4M77G 1D3BB 4C92D 3JCMX 4XTWA 5GMKm 2EWNA 4M77A 5GAN3 3JB9I 4M78D 5LJ3j 5LJ5e 3JCMV 3RKWA 4J6WA 5GANf 2CGHA 3JCMQ 4PJOE 5GANd 4C92G 5I21A 4X9CA 5GAOl 3QO3A 1WPYA 2EJGA 1H641 3PGGA 4M75F 4M7DB 4M78G 4C8QE 4N0AC 3SWNA 4F7UG 4M7AF 2VC8A 2VXEA 2RD1A 5GANg 3AHUA 2DJZA 1YCYA 2EAYA 4M78A 4QVCA 5GMKe 4XU2A 4F7UA 4PNOA 1Y96B 4C8QA 4M77F 5GANe 4JUVA 5GAMf 4RCCA 4M7DC 3L1AA 1LNXA 4EMKA 4QVDA 1U1TA 3EFRA 5GAMd 3JCMf 4MMKA 2EJ9A 5GMKi 5LJ5g 3JCMd 4JRKA 2DXUA 2YLCA 4HT9A 4PJOD 4A53A 4X9DA 3JCMb 3HFOA 2FYKA 4C92F 4XU3A 5GAOn 4J6YA 3M4GA 4HA8A 1HXDA 5LJ3f 1D3BA 4C8QD 4XTYA 3JB9G 3GIBA 2QTXA 3EFSA 3BW1A 4M78F 3JCMg 5GAMe 5LJ3d 4M75B 2DTIA 2RB6A 4PJOG 3BY7A 3JCMe 1B34B 4M7AB 3SB2A 1KQ2A 4M7AE 1BIBA 4M7DE 5GAN6 4MMLA 4PJOA 4C8QG 4XTZA 3V8KA 2E41A 5LJ3g 4M77B 2Y90A 3BDUA 5LJ5h 1WQ7A 1I81A 2DEQA 1LOJA 2FB7A 4M75C 1JRIA 5LJ3e 1M8VA 4RCBA 3RKXA 4M7AC 2EJFA 3FIFA 2DZCA 4XTUA 2K57A 2DTOA 3RKYA 2E64A 3V8JA 5GAN2 5GAN5 3JCMP 3JB9D 4HT8A 2DVEA 4NL3A 4NOYA 1Y96A 4M77C 3RESA 1I5LA 2RA2A 4C92B 3QUIA 4XTVA 5GAOm 2RM4A 1I4K1 1I8FA 5GAN8 5GAOq 1M5Q1 5GAMg 4M78B 2VXFA 5GMKl 4PJOF 4F7UB 4M7DD 3L2ZA 1BIAA 4JRIA 5GANh 4M7AG 2ZGWA 4F7UF 5LJ5j 2JN0A 4JLIA 3FJPA 4M75E 4C8QF 4C92C 4EMKB 4N0AA 4EMHA 5GAOp 4M78C 4M7DG 3V7CA 3V7SA 2YLBA 2YHTA 1KQ1A 3JCMc 4M77E 3RUXA 1HK9A 5GAOr 4EMGA 4M7AA 4M7DA 3BFMA 4EMKC 4Y91A 1JBMA 5GAN7 5GMKj 2DTHA 5GAMh 1N9SA 4XU0A 2I2LA 3VU3C 5CAIA 5GANj 3FB9A 2E1HA 3JCMW 3HSBA 3JCMh 2E10A 3HFNA 3QSUA 3SWNB 4C92E 1MGQA 3JB9F 4PJOB 1TH7A 4M75D 3RIRA 3V7RA 3INZA 4A54A 1WQWA 3JCMJ 2DKGA 4M78E 5GMKh 4M7AD 4V2SA 4F7UE 4C8QB 5DY9A 4WF2A 5LJ3h 4XQ3A 4C92A 3V8LA 4M7DF 4M77D 4OP0A 1X01A 4XTXA 1WNLA 2DZ9A 1N9RA 3SWNC 5LJ5f 5GAN4 2E65A 4M75G 4PJOC 3JB9J 5GAMj 5LJ5d 3JB9H 2HNIA 4XU1A 4DQ2A
chains in the Genus database with same CATH superfamily
2P84A 4J9FA 4L6V5 4ZGEB 2L3QA 2AIRB 4M77G 1V1CA 3GP8A 3JCMX 1X2KA 2EYYA 3I5RA 1ABOA 3O5ZA 1YJNQ 1VQ9A 4J6WA 3VKIA 2C06A 2JTMA 1AD5A 1NE8A 2KK4A 4PFOA 2HAXA 4M78G 1PKTA 2RHYA 1M1GA 3RDVA 1VQ4A 1U06A 2KRSA 1Y96B 2V1RA 2YDLA 1JU5C 4E7IA 1JB0E 2R58A 1G3SA 1Q81R 2FL7A 2PVOB 2DXUA 3TSZA 2SRCA 2JTFA 1F1BB 1J3TA 2PUOB 4C5GA 2A28A 2L3PA 2LQWA 1YI2Q 1D3BA 1MV3A 1W4SA 2RJFA 2E70A 1JJ2A 1S72Q 3SB2A 1NPPA 2GNCA 2QXFA 3VUBA 4B9WA 4MMLA 1VQMQ 3EGUA 1HJDA 2E5QA 5FLXE 2LP5A 2DEQA 4M75C 4DBFA 5FU7C 3GNFB 2JW4A 4XTUA 3EG2A 3C4SA 3CPWS 4NOYA 2RQVA 3E1SA 1M1FA 1W70A 4GLMA 2DBKA 2QA4A 2DL8A 3OW2A 1OYXA 1KQ1A 5GAOr 1KJWA 4J9EA 1OX8A 3BFMA 1D0XA 2BIVA 3X25B 5CQXA 1O9SA 2E1HA 2F1LA 5CIUA 1R8OB 3KFVA 5HK0A 2FO0A 2MIOA 4QQGA 4HCZA 1AZGB 1UEBA 2E3IA 4C5HA 2RNAA 2EQKA 2EW3A 3GLXA 2I0NA 2VGNA 3NTKA 4ZTJA 4C8QC 1YJWT 3G4SQ 1U1SA 4UC4A 4BUGA 4C92D 4RTWA 1RL2A 1WYXA 4KUDK 3CBOA 5IN1A 1Q82C 2CT3A 3GOXA 3DB4A 3MHXA 3QO3A 2KSSA 3I56A 2D9TA 1LVKA 2HQXA 4LDVA 2QAZA 1RAIB 1T3LA 3CMEQ 3GF5A 4M7DC 1PD1A 2M16A 1KIKA 3UA7A 4JRKA 2YLCA 1B7TA 1X6BA 1YWPA 3S3OA 2E4HA 4DBHA 2X4WA 2P4RA 4FT2A 3CCQQ 2D1XA 2QK0A 2KROA 1TUGB 2XI9A 5I2MA 4FSSA 3M4YA 5IH2A 5LJ3e 2V26A 3RKYA 3CCMT 2CDTA 2DVEA 1G5VA 1GBRA 3HP9A 3QUIA 3SHWA 3H41A 5GJVB 2JVVA 3QZ5B 2BUDA 3L2ZA 4MDXA 4ELZC 5J26A 1RI0A 4JZ4A 2LX7A 2OTLQ 5HCKA 3CXCA 3NFCA 1YJWA 1M90R 2OX7A 5KYUB 2DPPB 1Q82U 5HY6A 1W2BP 2I2LA 3FB9A 4OB3B 3JCMW 1ZA1B 2DFUA 2DL7A 1IHVA 2LTOA 1WQWA 1VQ9Q 1N27A 1AOJA 4A63B 2KDSA 2FEIA 3QYGB 1RAFB 2FG0A 3QJ6A 4EPCA 4M77D 2EYQA 2DZ9A 1TXQA 3HRSA 2MK5A 2HNIA 1AVZC 4FYWB 1VQ4Q 2CZ0B 2DERA 2KI7A 2H3JA 2IG0A 3L2UA 2FPFA 1D3BB 3CCET 1UE9A 2JT4A 1K4US 4M78D 5LJ3j 5CKDA 3CCRT 5L23A 4PJOE 1SEMA 3UATA 3E19A 3TSWA 1QP3A 2O9SA 4OMOA 1C1AA 1YIJT 2RD1A 3LYIA 4HCBA 5GMKe 2GQIA 4QT7A 1T0HA 1C6VX 3PMTA 2DK3A 3EG3A 4WTOB 4FYYB 5A0LA 3QPHA 2XD0A 1T3SA 4HT9A 3HFOA 2YUNA 4XU3A 4RTZA 1YHQT 4XTYA 1NEBA 2HKQB 3JCMg 2KNBB 4DBRA 3M53A 1OPLA 2KMTA 3OYIA 1TUCA 1UDLA 2K4YA 2QA4Q 3BDUA 2MOXA 3LW5E 1JRIA 1BKBA 4MZMA 2CP3A 4HT8A 1I5LA 2R5MA 2J6FA 5GAOm 2KY9A 2RM4A 2A37A 2CP2A 3SFMA 1KQSP 1B3QA 2MMPA 1RLQC 1WHJA 3CC2T 3NTHA 1CSKA 2J06A 1VQ6A 1VQOT 3VS5A 3H0HA 1HK9A 2YRCA 2OJ2A 3CCEA 3QBYA 1Z9ZA 5GMKj 5KYWA 1Y57A 2C0TA 2ESWA 2E10A 5D6WA 1Y71A 2YUOA 1GCQA 3OB9A 1FXXA 3OYCA 3PE0A 4PJOB 2RJDA 2JS2A 3H0IA 1VQLT 1BB9A 1ZX6A 3I56Q 4M75G 7AT1B 5CKBA 3QKJA 1Y7XA 3NTIA 1BI1A 4J6XA 1LPLA 3A98A 4JRPA 3PIPA 2YSQA 3G6ET 2EKOA 2K5FA 3SDZA 1TG0A 3PVQA 4HVVA 3UWNA 5GAOl 3MP1A 5FU6C 3SWNA 2K9GA 2ED1A 1ZSZA 1QKXA 3EAEA 2FPEA 4KUIA 3OYHA 3EFRA 1SRMA 3QYHB 1TSFA 2HBPA 4J9DA 4VUBA 4AT1B 4BE0A 2HL3A 4JPBW 4C8QG 4XTZA 1OULA 2CKKA 2Y90A 1QCOA 1CKBA 2L5QA 1ZSGA 2RF0A 4GY5A 4BY6B 3UA6A 1WXUA 1FMVA 5GAN2 1AEYA 2J05A 2EVRA 2DLPA 2X51A 3OMGA 2HL5C 2RA2A 1W2BA 4IIOA 4PJOF 2DO3A 1O75A 1VQLA 3KBGA 2J6KA 4L59A 5D6YA 4M7DG 1KC8R 5GAN7 4AFZC 3URGA 2RJCA 4Z02A 4AG1C 3HRTA 4F04B 1G83A 4FU6A 4F7UE 5LJ3h 1R77A 1HYOA 5GAN4 2VASA 1Q82R 2LMJA 4XU1A 5CK9A 1IXDA 1WLPB 5EG2A 1YBYA 1SHFA 3KXTA 4AMCA 3OYDA 3S3MA 2X4XA 5D7UA 2CH4A 2CGHA 9ATCB 1GXIE 3QWYA 3QZ9B 1QCFA 5GANg 2DJZA 4C0FA 4E7HA 5KE3A 2H3EB 1OPKA 2XHCA 2XDBA 3L42A 1VUBA 1U1TA 5IHKA 1AHJB 2PTKA 1K0XA 3RMSA 5I11A 3N5BB 2WSFE 4PFPA 2DBMA 1WHKA 4J6YA 1QVGS 3CCUA 5LJ3f 1VQNQ 5LJ3d 4ZGDB 1M27C 2JTEA 1KQSA 3ASKA 2XIDA 1JXOA 3L2VA 1YITA 5KYWB 2EYXA 4QVZA 1IGQA 1VQ6Q 2KYMA 4Y28E 3M0RA 5C0MA 4M7AC 1Q86C 3VS6A 2CP6A 3RESA 1AT1B 2LVMA 3I55T 2E3HA 2ATCB 1I0CA 4F7UB 3OYYA 2EPDA 2QI2A 1ZUYA 2GBQA 4EMKB 2WACA 2OTLT 4D6WA 1MMNA 3V7CA 3V7SA 2YLBA 1Q7YC 2X3WD 3QIIA 1SHGA 1QP2A 2DF6A 2VVKA 2LRQA 5DLOA 1N9SA 5A2QE 1MMGA 2HBWA 1WHMA 3CC4T 3SWNB 4PJMA 1MGQA 3ER0A 4KH1B 3A8MB 1ZBXA 4C5IA 1TH7A 2W10A 4M75D 2DM1A 2MAMA 3QJYA 4JJBA 5KYYA 4C92A 3VS1A 3FLGA 3OYMA 4XAXB 3ULRB 3QWXX 1JEGA 2AT1B 1G8XA 2L0AA 4LUEA 3IQLA 3EG9A 4PJLA 2QQSA 2K6DA 1TS9A 5D6XA 2K2MA 2H8HA 2EYZA 1UGQB 3LWIA 4FT4A 3OW2S 1YJ9A 8ATCB 1VQ7A 2K3YA 3CXCP 4R56A 4CC3A 5A0DA 3VUZA 2O31A 1OQKA 1RI9A 3MEUA 1IZ6A 2P4TA 1Q86U 4PLLA 3U23A 2AZVA 3LLRA 3GBQA 1X6OA 1ABQA 2DJQA 3M0SA 5GJWB 2EQUA 3OY9A 1NBEB 5KYUA 3NHNA 3M4GA 2X4YA 4C8QD 2F2XA 2J6OA 4BI4A 3A8HB 1YCSB 5KYXB 1LCKA 3M59A 3HPWA 1Q7YU 1X2QA 1WFWA 2L8DA 3Q1JA 1NPRA 2A08A 3WVDB 2HSEB 3MO8A 3X24B 1YP5A 3CCVA 2KRNA 3ZEHA 1M1KU 2LT4A 3CMAT 4XTVA 3OA6A 4M7DD 3EG0A 1FYNA 1ZA2B 3CCST 1PNJA 3UDCA 1ZSZC 4JS4A 3EH2A 2COZA 2ZPBB 3RUXA 2MCNA 3MKDA 2RHUA 1VQ8A 1WJRA 1PC0A 2QGGA 4MZPA 1SRLA 1Y0MA 4C92E 3RIRA 4OVAA 2CYZB 2LNVA 2P0QA 2DL4A 4FIBA 2NUZA 1WXTA 2YUQA 2V8KA 3EHQA 3JB9J 4KGVB 1G3TA 1QVFP 3CCJT 2LJ3A 3M0UA 2JNGA 1GCPA 1BU1A 1QWEA 2KEAA 2NWMA 2YWWA 3FDRA 4LD6A 2K2VA 1PD0A 2LT1A 2ZZDA 2M51A 2YT6A 1PM3A 3CCUQ 1KC8C 5DM7R 1RABB 5KE2A 3RNJA 1OOTA 4XU2A 3ME9A 4PNOA 4LUDA 2RI5A 1YITQ 2R5AA 3VYHB 4J9BA 1YN8A 1MUZA 2DVJA 4J7IA 2CT4A 1WX6A 3OS1A 2O2OA 1KQ2A 5FROA 1N6AA 3QXEB 4PJOA 2M02A 1Y07A 1EZZB 3M58A 2ECZA 3MPUB 3HKSA 2XK0A 3JCMP 1GL5A 1MMAA 2PZ1A 2CP7A 5ECAA 1AZEA 5KYYB 4C92B 2G3RA 1ZBJA 4IUPA 2NUTB 1I8FA 2EFIA 4E7SA 2HZYA 1PSFA 2EGAA 3CCLT 4PFZA 2P0PA 4K11A 3OYGA 2PVDB 4O5VA 4PK4A 1KHCA 3EG9B 4M77E 2K7AA 1QVPA 1G2BA 1PHTA 4Z89A 1XQHA 4LDWA 1I5OB 1X75C 3G71T 1PG5B 2K79A 3V7RA 1I1JA 2BE7D 4M78E 1KC8U 2F2WA 2CREA 2AZSA 2NUPB 2LX9A 1YJ9Q 3J7AF 1VQ7Q 1IHWA 1IREB 1WXBA 1JJ2S 4M7AG 3LX7A 4LDYA 4J5YA 4BE1A 1TWBA 2E5KA 2HD0A 5GAN3 3JB9I 1WIEA 1VQ5T 1T0JA 3RMQA 2QQBA 2RO0A 4F16A 1M3BA 2K3XA 3VRZA 2EAYA 1YCYA 2X4JA 2XU8A 5J3BA 4OB2B 1UFFA 3L1AA 3A5ZB 3DLLA 4N4GA 4LE9A 3CC7T 3D7SB 3CCVQ 1WHLA 2PNIA 3REAB 4R55A 3L2WA 5FWCA 3TREA 1VQNT 4C92F 4LNPA 3PNWC 1M30A 1OZ2A 3JB9G 2JMCA 2D0NA 1OU9A 1Q86R 3CD6T 1UTIA 1M3AA 2E41A 4M77B 4DEYA 1BI2A 3O8VA 2L2PA 1ZLMA 3CCMA 3FIFA 2DZCA 2YRVA 3PTAA 4NL3A 6AT1B 1UJ0A 2KE9A 1Q7YR 2CZ6B 1VQ8Q 1M5Q1 4E6RA 4M78B 2BE9B 4E2FB 5GAMg 2RHIA 1VQKT 2V8IA 1X27A 5CCAA 4OF1A 3HHTB 1VQPT 2X3XD 1WHGA 2KQWA 1JQQA 1M1KR 2V8JA 5C6SA 2HKNA 4Q5WA 4OMQA 2COYA 4Y91A 4X1VA 2OTJT 4XU0A 2KT8A 1QVFA 2RHXA 4FYXB 4F14A 5L8RE 1PKSA 4XTXA 2K5LA 2GFUA 2RI3A 4LDXA 2ED0A 2ZCFB 1W2BS 4JJDA 5GMKm 3CCRA 4RMOA 2PU9B 1KK7A 2MWPA 2QEXT 3CD6A 1W1FA 2WSEE 2AKKA 2F5KA 1YIJA 4F7UA 4CI0C 2OAUA 4M77F 4CC7A 1YWOA 4EMKA 1IB8A 1VYVA 1UUEA 4E7JA 2CS7A 2EKHA 1RAHB 1XNIA 2KRMA 1YJNT 2CH4W 3HL8A 3OYBA 1YHQA 4OMMA 3GIBA 3UT1A 4M78F 3OBWA 1K8AC 2RI2A 1VQPA 1PWTA 2ZPIB 4C0DB 1B34B 3M0PA 4M7AE 1RLPC 3CQTA 1ARKA 1I81A 3META 3OSVA 3M56A 4KT0E 4KBMB 4ELYC 3A8LB 2EJFA 4ME7A 2CUBA 1FMKA 4NS5A 1B07A 4TVRA 4OGEA 3FJ5A 1YI2T 4IKFA 1ZUKA 5GAN8 5GMKl 1PRMC 4C0ZA 1ACMB 2QQRA 4IIMA 3CC2A 3S3NA 1S72T 1FMWA 3FJPA 1JO8A 2MI6A 4OMLA 1VQMT 2KAFA 3J81E 2GQVA 3LGLA 1VQOA 4FSXA 3C12A 2YHTA 5FWBA 2LZ6B 2PUKB 5KYNA 4J9GA 4E7KA 3QDRB 4BD3A 1YJWQ 2LCLA 3VU3C 5I2SA 3HFNA 2ROTA 1SPKA 4M7AD 2D0QB 1CKAA 5IHNA 4D8DA 1M2VB 4XQ3A 2M0YA 3OMCA 4B9XA 1I07A 2LQKA 4JJNK 4PJOC 1UGSB 3VYGA 3LGFA 1OV3A 3RERA 2EBPA 2DXTA 4RTTA 3EGDB 1UJYA 5KYXA 4FYVB 3A1PA 3G6EA 1FWZA 3RKWA 1K8AU 1V76A 4J8OA 3I9QA 2DYIA 1AWWA 2VXEA 2KGTA 1TOVA 4C8QA 3G4ST 1OU8A 4ORZA 2FZCB 4X34A 3E9GA 4AFUC 3TU4K 4ZGJB 3CCMQ 2CP0A 3P8HA 3R6NA 5CKHA 4D8KA 3WXMB 1HXDA 1BYMA 2V1QA 3FEOA 4YTLA 4A4HA 2LCSA 1HD3A 4WCIA 2MYSA 5LJ3g 2QDYB 3CMET 3PT9A 1M8VA 2GGRA 4J9CA 2J7IA 2FZKB 2RQUA 2L3RA 4BY6C 1I4K1 3OS2A 4A4KA 4JLGA 4JRIA 5IXFA 3CCQT 2GCXA 4M75E 2EQMA 2G6FX 4MDWA 2BTTA 3TQ7P 2E12A 1RAEB 4IUVA 4DEXA 2CZ7B 3CCEQ 3ZL7C 2L3SA 3DKMA 4MZTA 5HKCA 3GNGA 2HQHA 1KD1C 2DD4A 2NYSA 3VS0A 4V2SA 5IXBA 5GMKh 3LH0A 2FRYA 1QLYA 1IRXA 4HKEA 2M1HA 3OYLA 2DD5A 3MEAA 4EDUA 1YIJQ 2AKLA 2EGCA 1NYFA 4JS5A 4QKUA 2CSIA 2DNUA 3QHSA 4GLKA 2EWNA 2K3BA 2VV5A 3JCMV 3OSSC 1VOMA 1M1KC 1VQ9T 2QTVA 2EIFA 3JCMQ 2CSQA 1YHQQ 2XDPA 4C8QE 1AWXA 2NUTA 2D8JA 3VS7A 4LDUA 1VQ4T 1GFCA 2VGMA 4JUVA 1IO6A 4QQ6A 1OX9A 3UF4A 1PSEA 3RR6A 2BZ8A 5LJ5g 3CPWP 1Q95G 1MV0B 1VIEA 3OYEA 2MF2A 3THKA 4HA8A 2KXDA 3MP8A 2DMOA 2QTXA 5GAMe 4M75B 5FU7B 3CC2Q 3JCMe 4JRQA 4M7DE 2M0OA 1K73C 3V8KA 1VQOQ 3HRUA 3REBB 3VS4A 2NUPA 3MEVA 3V8JA 4JJCA 1KD1U 4Y92A 3I55A 2CUDA 1GCQC 1RUWA 2ENMA 1E6GA 1D1CA 2VWFA 4F7UF 1QVGA 2OTLA 4Z88A 2HQEA 3NMZC 2KYBA 1VQLQ 2QA4T 4BACA 3MJXA 4RKUE 1V29B 4LXCA 1PCXA 1C0MA 4EMKC 2RK2A 2EGEA 3CC4A 5CAIA 3CEYA 1MMDA 4ANJA 2A0FB 3X28B 3G6EQ 3E9FA 4RTUA 3C95A 4CC4B 4C8QB 4WF2A 3QDFA 2FVUA 3SWNC 1WNLA 3L2QA 2E65A 3OYJA 5GAMj 3R6OA 3PIOA 3EFOB 4DA4A 3VJPA 1RAGB 2QDLA 4M77A 1KFZA 2Y4YA 1M9SA 2GTJA 4J83A 2GTOA 2F5TX 2QQ9A 4IURA 1R0BG 1H8KA 1DJ7B 1SG5A 3JV3A 4M7DB 4M75F 2LQ8A 2DEUA 1K73U 2KBTA 3I56T 4BI8B 5IHIA 4RG2A 2B8AA 4M78A 1WJQA 4QVCA 2DA9A 2R57A 1JXMA 2KVQG 4II1A 4E7LA 4PL6A 1K8AR 3CBPA 1LNXA 1K9MC 4KRTA 5CQYA 3AT1B 2E6ZA 3JCMb 2PQWA 5GAOn 1QWFA 2P0KA 4BDYA 4A4GA 3EFSA 3BW1A 4P5NA 4PJOG 1AWJA 3CXCS 4OMFB 4F17A 1BIBA 2CZ1B 3JB9F 2ABLA 1K76A 1WQ7A 1TUDA 2JS0A 2A36A 3RKXA 2XMFA 4AFQC 2RJEA 4KH0B 2E64A 5GAN5 2JUFA 3CMAA 3VS2A 1XTDA 1NZ9A 1EX4A 5GAOq 3BDLA 2F2VA 1X69A 3NPFA 4RTVA 3CCSA 4C8QF 4N0AA 4RG8A 4IUTA 5CKEA 3JSCA 1N8RR 4QW2A 4C5EA 4Z8AA 1TU0B 1D0ZA 3INZA 3JCMJ 2XDDA 1H3HA 5DY9A 1M4ZA 3EGXB 1G3WA 1SSHA 4M7DF 1K9MU 1QW1A 1LJOA 3CCJA 2RN8A 2DRKA 1B34A 3MP6A 3C94A 1N5ZA 4CC2A 3OYKA 2VUBA 1H92A 3P8BB 1K1ZA 3CPWA 2K5IA 1E6HA 1NG2A 4X9CA 1WPYA 2ROLA 1H641 3PGGA 2GF7A 1XOVA 4OGCA 3RBBB 5CO7A 3VRYA 4JZ3A 5GANe 3OQ5A 1QVFS 3M57A 1IGUA 2EJ9A 2BZXA 5GMKi 4L5GA 4A53A 4X9DA 3LWHA 2FYKA 4M4ZA 4BB7A 2RHZA 1WA7A 2JMAA 3I55Q 2JOYA 3E2UA 4FW1A 2RB6A 4C0GA 1H3ZA 3P8DA 1S1NA 1D0YA 3C0CA 4OMPA 2DL5A 4N4IA 5GAN6 2RPNA 3JAME 1LOJA 2DRMA 1M2VA 1SSFA 2O9VA 1KSWA 4RTXA 2K57A 2E6NA 3VS3A 3DB3A 3CC4Q 2RQWA 1SKUB 1UECA 3EGDA 3H0FA 3CCLA 2YUPA 3PMIA 3NGPA 1BI3A 1UHCA 1D09B 4C92C 4ESRA 4QQDA 5GAOp 1VQ6T 1BK2A 1NYGA 1HSQA 2DXCA 1KD1R 1NJIC 1OZ3A 4M7AA 1WGSA 2HMAA 3JRZA 1JBMA 1OEBA 1UG1A 4HXJA 5GAMh 5CR2A 3OBYA 1U5SA 2FZGB 5GANj 2KT1A 3G71A 3HSBA 3JCMh 2DIGA 4ZTFA 1EFNA 1WI7A 2DKGA 4B6MA 1BCMA 5CKFA 2AHJB 1UGVA 5KH6A 2ZPFB 2EQJA 2QGFB 3TEEA 3M9QA 2YRDA 2NLUA 3M54A 2VYTA 1QQJA 1U8RA 2MWOA 4XTWA 1GRIA 4DOWA 1VA7A 3A8OB 2DETA 5LJ5e 5FU6B 2KXCA 1VQ5A 3ZFJA 4BDZA 5CVIA 4R0KA 5I21A 3F70A 2OI3A 2EJGA 3J80E 4OB1B 4F7UG 1TTHB 1MNDA 2QQAA 3MCAB 2LQNA 1RADB 1K0SA 5GAMf 2DIQA 5GAMd 3JCMf 3CC7A 2VKNA 3JCMd 1YFNA 4PJOD 1VQNA 1K73R 3CMAQ 1QKWA 5FRNA 2AK5A 2ZPGB 4A4FA 4PJJA 1NLPC 1BI0A 1P92A 1Q81C 2FRWA 5FW9A 1A0NB 1UB4A 1OI1A 3CCSQ 1NJIU 3CBMA 4ZNXA 3OYFA 2X35A 2FB7A 2M9UA 4PKCC 1E7OA 4RCBA 5A0GA 4M77C 1VQKA 4FCYA 4PJNA 3S6WA 1BIAA 5EC7A 5LJ5j 4JLIA 4HCKA 4JDSA 5HK3A 4EMHA 5IT9E 3KUFA 2QYZA 4M78C 3A8GB 3G1JA 2OTJA 4AG2C 2O01E 3CCJQ 2DTHA 1NLOC 2LCCA 2QG9B 1D1BA 4FL6A 4E7ZA 2YXYA 4HVWA 2LC4A 1UHFA 4IUUA 2Z0WA 4ATOA 2FPDA 3TVTA 2LDMA 2MPXC 2BKDN 1N9RA 1QCNA 4PLIA 2WSCE 4RUGA 4BE2A 2ZPEB 3SD4A 5KCHA 1SF9A 4M75A 3T9NA 2JZ2A 2QASA 2DYBA 3G7ZA 1UGRB 2RQRA 4ZN1A 3EHRA 1QVGP 3LH5A 1KQSS 1Q81U 2QEXA 4ZN3A 5LL6S 1KHIA 1K9MR 3HTRA 3OYNA 2XICA 3M0QA 1WZOA 4N0AC 1N8RC 1K9AA 3AHUA 4RTYA 2HCKA 5I22A 5AYFA 1GFDA 4E47A 2C0IA 2HSPA 4HVUA 4QVDA 2CP5A 4DOVA 2O4XA 2Y4XA 4MMKA 1ZQ1A 4O6JA 4KGZB 2EYWA 2OAWA 3FC3A 1YJNA 3H9NA 4XK8E 1PRLC 2F69A 3H8ZA 1G3YA 4J7FA 3X20B 3CCUT 2LNHB 2XKOC 1GBQA 3BY7A 3CCLQ 4M7AB 3M55A 3H6ZA 3QG1A 2DE0X 4OMNA 3M5AA 1YITT 1BBZA 4J9HA 2W0ZA 2JM8A 4N4HA 4C0DC 3OS0A 2DX1A 2DTOA 3OYAA 1VYTA 2HDAA 3JB9D 1Y96A 1YI2A 1XJWB 3EFOA 5KCOA 2X9HA 2D6FA 3G71Q 1JJ2P 4A4EA 1M3CA 2VXFA 2DAQA 2A3LA 2ZPHB 1NM7A 4CRIA 1S72A 5GANh 4FM4B 2JXBA 2ZGWA 2JN0A 5J39A 3I35A 1VQMA 1X6GA 2IIMA 2DL3A 2RQTA 3JCMc 4EMGA 4M7DA 2GFAA 1R0CB 2ZAEA 2DILA 4EIKA 4GBQA 3X26B 1VIFA 1M90C 4A54A 3EG1A 1VQ5Q 3OW2P 1KG1A 3L2RA 1N8RU 3V8LA 3CPFA 2HEQA 3EH1A 4OP0A 3DLMA 3JB9H 1D1AA 4NL2A 4BI3A 3FRNA 2XG8D 1ZHIA 1ZUUA 2DXBA 2RK1A 3CC7Q 4LD9K 5GANf 5FRMA 3CCRQ 5GANd 1U3OA 4C92G 3VV0A 5DLQE 2A7YA 1UGPB 1YJ9T 3I5SA 2JJ9A 1VQ7T 4J9IA 3GPLA 2SEMA 4M7AF 2VC8A 3M0TA 2LJ0A 4LN2A 3CD6Q 3G4SA 3UPUA 3PVLA 1BCOA 4RCCA 1Z9QA 5AT1B 2KR3A 4DBQA 4OB0B 1FX7A 2C0OA 1MHNA 1VQKQ 3BE3A 2DTIA 1X43A 2L89A 2O88A 3WVEB 1AWOA 1VQPQ 2COWA 4IUQA 3CMEA 3MEWA 5LJ5h 2RH2A 1VYUA 2D8HA 3ZBDA 2LJ1A 3EGXA 1MNEA 1WJSA 5M9OA 1RACB 3CCVT 2OTJQ 2FHDA 3TCJA 1M90U 1M2OA 1NJIR 1ZSZB 3SEMA 3CCQA 1EIFA 2JM9A 4HCCA 1QMCA 1NEGA 4AFSC 2PVGB 4FW2A 2VB6A 4KULA 4KGXB 1YNZA 8AT1B 1WDXA 3QSUA 2IVWA 2EQIA 1VQ8T 2RMOA 2IPOB 1M8MA 2B86A 2BZYA 3PFSA 1WHHA 2QEXQ 1RAAB 1X01A 1W6XA 5LJ5f 2O4XB 5IAYA 3OS5A 5LJ5d 4DQ2A
chains in the Genus database with same CATH topology
2RI3A 1K9MU 4L6V5 1QW1A 1LJOA 4ZGEB 5CK9A 3CCJA 4LDXA 1B34A 3MP6A 4M77G 3C94A 5EG2A 1YBYA 2ZCFB 3GP8A 3JCMX 1W2BS 3KXTA 5GMKm 3CCRA 3OYDA 3OYKA 4RMOA 2VUBA 2PU9B 1VQ9A 3P8BB 3S3MA 4J6WA 2X4XA 3VKIA 3CPWA 2C06A 2CGHA 2JTMA 1NE8A 2K5IA 2MWPA 2KK4A 4X9CA 2QEXT 2HAXA 1GXIE 1WPYA 3CD6A 1H641 2WSEE 3PGGA 2F5KA 4M78G 2GF7A 3QZ9B 1XOVA 1YIJA 2RHYA 4OGCA 5GANg 5CO7A 1M1GA 2DJZA 4C0FA 1VQ4A 4F7UA 4E7HA 1Y96B 4CI0C 2OAUA 5KE3A 4M77F 5GANe 3OQ5A 2XHCA 1QVFS 2XDBA 4E7IA 1JB0E 3L42A 4ELYC 1VUBA 3M57A 1U1TA 2R58A 1G3SA 4EMKA 2EJ9A 2FL7A 1AHJB 2PVOB 5GMKi 2CS7A 4L5GA 2DXUA 3RMSA 4E7JA 1XNIA 1YJNT 3N5BB 2WSFE 4X9DA 4A53A 2JTFA 3HL8A 3LWHA 2PUOB 2FYKA 4C5GA 3OYBA 1YHQA 4J6YA 4BB7A 1QVGS 3CCUA 2RHZA 1D3BA 5LJ3f 1W4SA 3GIBA 3UT1A 4M78F 3OBWA 1K8AC 2RJFA 2JOYA 2RI2A 5LJ3d 4ZGDB 1VQPA 2E70A 2RB6A 4C0GA 2ZPIB 1H3ZA 4C0DB 3P8DA 1JJ2A 1B34B 3SB2A 4M7AE 1KQSA 1NPPA 2QXFA 3ASKA 2XIDA 4N4IA 3VUBA 4B9WA 4MMLA 5GAN6 3L2VA 1YITA 4QVZA 2E5QA 4Y28E 3JAME 5FLXE 1I81A 2DEQA 1LOJA 3M56A 3META 3OSVA 4KBMB 4KT0E 4M75C 5FU7C 1SSFA 3A8LB 3GNFB 2EJFA 5C0MA 4M7AC 4ME7A 4XTUA 2K57A 1Q86C 2E6NA 3C4SA 4NS5A 3CPWS 4NOYA 3RESA 4TVRA 4OGEA 1YI2T 4IKFA 3DB3A 2LVMA 3E1SA 5GAN8 3I55T 1M1FA 5GMKl 4F7UB 4C0ZA 3OYYA 2QQRA 3CC2A 3CCLA 3PMIA 2QI2A 1BI3A 3S3NA 1S72T 3FJPA 4C92C 2MI6A 4EMKB 2WACA 2KAFA 3J81E 2GQVA 3LGLA 2QA4A 1VQMT 1VQOA 3OW2A 2OTLT 4QQDA 5GAOp 4D6WA 1VQ6T 4FSXA 3V7CA 3C12A 2DXCA 2YLBA 2YHTA 1OYXA 1KQ1A 3V7SA 1Q7YC 1NJIC 2PUKB 1OZ3A 3QIIA 5GAOr 4M7AA 1QP2A 1WGSA 3BFMA 4E7KA 3JRZA 1JBMA 2LRQA 3QDRB 2BIVA 4BD3A 5DLOA 5GAMh 3X25B 2LCLA 1N9SA 5CR2A 3OBYA 3VU3C 5A2QE 5I2SA 5CQXA 1O9SA 2E1HA 3G71A 3JCMh 3CC4T 2DIGA 3HFNA 5CIUA 1R8OB 4ZTFA 3HSBA 3SWNB 1MGQA 3ER0A 4C5IA 3A8MB 1ZBXA 5HK0A 1TH7A 4M75D 4QQGA 1JJ2S 2MAMA 3QJYA 2DKGA 4M7AD 2D0QB 4HCZA 5CKFA 2AHJB 4C92A 1UEBA 4XQ3A 4C5HA 5KH6A 2ZPFB 3OMCA 2EQJA 3TEEA 4B9XA 2LQKA 3M9QA 3FLGA 4JJNK 4PJOC 1UGSB 2EQKA 2NLUA 3VYGA 3GLXA 3M54A 3OYMA 2VYTA 2VGNA 3LGFA 3NTKA 4XAXB 4ZTJA 3RERA 2DXTA 4C8QC 1U8RA 1YJWT 1U1SA 4UC4A 4BUGA 4C92D 2MWOA 4XTWA 4DOWA 1RL2A 4KUDK 3A8OB 3CBOA 5IN1A 3G6EA 1Q82C 1FWZA 2QQSA 5FU6B 5D6XA 5LJ5e 3GOXA 3RKWA 3DB4A 1VQ5A 3ZFJA 3MHXA 4BDZA 1K8AU 1UGQB 3LWIA 4FT4A 3OW2S 5CVIA 1YJ9A 5I21A 4J8OA 3F70A 1VQ7A 2K3YA 3QO3A 2EJGA 2KSSA 3J80E 3I56A 2D9TA 4OB1B 4F7UG 2HQXA 4R56A 2VXEA 4LDVA 5A0DA 3VUZA 2QQAA 3MCAB 4C8QA 3MEUA 3G4ST 1IZ6A 2P4TA 3GF5A 5GAMf 1Q86U 4M7DC 2DIQA 2M16A 4PLLA 5GAMd 4X34A 3E9GA 3JCMf 3CC7A 3LLRA 3TU4K 1X6OA 4ZGJB 3JCMd 4JRKA 2YLCA 2EQUA 4PJOD 3P8HA 3OY9A 1VQNA 5CKHA 3S3OA 2X4WA 3M4GA 2X4YA 3WXMB 1HXDA 4C8QD 5FRNA 2ZPGB 1BYMA 4A4FA 1BI0A 1P92A 4BI4A 3A8HB 1Q81C 3FEOA 4FT2A 4YTLA 1UB4A 4A4HA 3M59A 1OI1A 3HPWA 1Q7YU 1NJIU 2L8DA 3CBMA 4DQ2A 3Q1JA 5LJ3g 2QDYB 2XI9A 3OYFA 3CMET 1NPRA 3PT9A 2X35A 5I2MA 3WVDB 2FB7A 2M9UA 3M4YA 4PKCC 5LJ3e 1M8VA 4RCBA 3MO8A 3X24B 5GANj 3CCVA 3RKYA 3CCMT 5A0GA 2DVEA 3ZEHA 1M1KU 2LT4A 4M77C 1G5VA 3HP9A 3CMAT 3QUIA 4XTVA 2L3RA 3OA6A 4BY6C 1I4K1 3OS2A 2JVVA 1VQKA 3QZ5B 4A4KA 2BUDA 4M7DD 3S6WA 3L2ZA 4JLGA 1BIAA 4JRIA 4MDXA 4ELZC 3CCQT 5LJ5j 5J26A 2GCXA 4JLIA 1RI0A 4M75E 4JDSA 3CCST 5HK3A 2EQMA 4MDWA 3UDCA 4EMHA 5IT9E 3KUFA 4JS4A 4M78C 3A8GB 3CXCA 3NFCA 1YJWA 2ZPBB 3RUXA 2E12A 4IUVA 2OTJA 2DPPB 2CZ7B 2O01E 2DTHA 1Q82U 5HY6A 2I2LA 2LCCA 2RHUA 3FB9A 4OB3B 3JCMW 1VQ8A 1WJRA 3DKMA 4MZPA 4MZTA 5HKCA 4FL6A 3GNGA 4C92E 1KD1C 2DD4A 3RIRA 2LTOA 1WQWA 4V2SA 2CYZB 1N27A 2LC4A 4IUUA 4OVAA 5GMKh 2KDSA 3LH0A 3QYGB 4ATOA 2LNVA 2P0QA 3QJ6A 4EPCA 4HKEA 2M1HA 2LDMA 3OYLA 2BKDN 2EYQA 4FIBA 4M77D 2DD5A 1N9RA 2DZ9A 3HRSA 2V8KA 3JB9J 4PLIA 2WSCE 3MEAA 4EDUA 4BE2A 2HNIA 2ZPEB 3SD4A 5KCHA 4JS5A 4M75A 3T9NA 2CZ0B 1G3TA 2H3JA 2IG0A 3QHSA 4GLKA 3L2UA 3CCJT 1D3BB 3CCET 2JZ2A 2JNGA 3G7ZA 2EWNA 4M78D 5LJ3j 1UGRB 4ZN1A 5CKDA 3FDRA 2VV5A 3JCMV 3CCRT 3OSSC 4LD6A 2K2VA 1M1KC 1VQ9T 2EIFA 3JCMQ 4PJOE 1KQSS 2LT1A 2ZZDA 3E19A 2QEXA 1Q81U 4ZN3A 1QP3A 1KHIA 5LL6S 2XDPA 3OYNA 2XICA 1KC8C 4C8QE 5DM7R 4N0AC 5KE2A 1N8RC 1YIJT 2RD1A 3LYIA 3AHUA 4HCBA 5GMKe 4LDUA 4XU2A 3ME9A 4PNOA 1VQ4T 5AYFA 2RI5A 2VGMA 2R5AA 4JUVA 4E47A 3PMTA 2DK3A 4QQ6A 3VYHB 4QVDA 4DOVA 1PSEA 5A0LA 2O4XA 3QPHA 2XD0A 2Y4XA 4MMKA 5LJ5g 1ZQ1A 4O6JA 3FC3A 1YJNA 4HT9A 1VIEA 4XK8E 3OYEA 3HFOA 2F69A 2MF2A 3H8ZA 1G3YA 4XU3A 4HA8A 4J7FA 3X20B 3MP8A 4J7IA 1YHQT 4XTYA 2QTXA 3JCMg 3CCUT 5GAMe 3OS1A 4M75B 2XKOC 3M53A 3BY7A 5FU7B 3JCMe 4JRQA 4M7AB 5FROA 1KQ2A 1N6AA 3M55A 4M7DE 2M0OA 3H6ZA 3QXEB 2KMTA 3OYIA 3QG1A 1K73C 4PJOA 2K4YA 3M5AA 3V8KA 1Y07A 3M58A 3HRUA 1YITT 3BDUA 3HKSA 1JRIA 3LW5E 4N4HA 1BKBA 4C0DC 3MEVA 2XK0A 4MZMA 3OS0A 3JCMP 2DTOA 3V8JA 3OYAA 4HT8A 3JB9D 1Y96A 1YI2A 1KD1U 1I5LA 4C92B 2R5MA 2G3RA 5KCOA 4IUPA 5GAOm 3I55A 2KY9A 2RM4A 1I8FA 2D6FA 2EFIA 3SFMA 4A4EA 2VXFA 1PSFA 2MMPA 2DAQA 2A3LA 2ZPHB 4CRIA 1S72A 5GANh 4FM4B 3CCLT 3CC2T 2ZGWA 4F7UF 1QVGA 2JN0A 5J39A 3NTHA 1VQMA 2OTLA 2P0PA 2HQEA 1VQ6A 3OYGA 1VQOT 2QA4T 4BACA 2PVDB 4O5VA 3JCMc 1KHCA 4M77E 1HK9A 1QVPA 4RKUE 4EMGA 4M7DA 1V29B 3CCEA 4EMKC 3QBYA 2GFAA 2RK2A 1XQHA 5GMKj 3CC4A 4LDWA 5CAIA 3CEYA 2E10A 1X75C 1Y71A 5D6WA 3G71T 3X28B 3OB9A 3X26B 1FXXA 1VIFA 3E9FA 3OYCA 3V7RA 1M90C 4PJOB 4A54A 4M78E 3C95A 2RJDA 1KC8U 1KG1A 4C8QB 3L2RA 1N8RU 4WF2A 2LX9A 3V8LA 1VQLT 2FVUA 3CPFA 4OP0A 1IREB 3J7AF 3SWNC 1WNLA 3L2QA 2E65A 4M75G 3DLMA 3OYJA 5GAMj 3R6OA 3PIOA 3JB9H 4M7AG 3LX7A 4LDYA 4DA4A 5CKBA 3QKJA 3VJPA 4J5YA 4NL2A 4BI3A 1Y7XA 3FRNA 4BE1A 3NTIA 2XG8D 1BI1A 4J6XA 1ZHIA 2DXBA 4JRPA 2HD0A 2RK1A 4M77A 5GAN3 3JB9I 3PIPA 2Y4YA 1M9SA 4J83A 3G6ET 4LD9K 5GANf 5FRMA 2F5TX 2QQ9A 4IURA 1VQ5T 2EKOA 2K5FA 5GANd 1DJ7B 4C92G 3SDZA 3VV0A 5DLQE 2A7YA 1UGPB 3UWNA 5GAOl 1YJ9T 4M7DB 1VQ7T 3RMQA 3MP1A 2LQ8A 2QQBA 4M75F 2RO0A 5FU6C 3SWNA 3I56T 3GPLA 1K73U 4BI8B 2K3XA 4M7AF 2VC8A 4RG2A 2B8AA 2EAYA 1YCYA 2X4JA 1WJQA 2XU8A 3EAEA 4M78A 4OB2B 2R57A 2KVQG 4II1A 5J3BA 4QVCA 3G4SA 3UPUA 4E7LA 4KUIA 4PL6A 4RCCA 3L1AA 3A5ZB 1LNXA 3CBPA 3OYHA 3EFRA 3DLLA 1K9MC 4N4GA 5CQYA 4OB0B 3CC7T 2E6ZA 3QYHB 3JCMb 4R55A 1FX7A 2PQWA 3TREA 3L2WA 4C92F 5GAOn 1VQNT 3PNWC 2HBPA 2P0KA 4VUBA 1OZ2A 4BDYA 1MHNA 3JB9G 4A4GA 3EFSA 3BW1A 4P5NA 2DTIA 4PJOG 4BE0A 3CXCS 4OMFB 2L89A 1BIBA 2CZ1B 3WVEB 3CD6T 4IUQA 3JB9F 4C8QG 4XTZA 3CMEA 2E41A 2CKKA 4M77B 2Y90A 3MEWA 1WQ7A 2L5QA 2RH2A 4GY5A 5LJ5h 1BI2A 4BY6B 3ZBDA 3O8VA 3RKXA 3CCMA 3FIFA 2DZCA 2RJEA 2YRVA 5GAN2 5GAN5 2E64A 1WJSA 5M9OA 3PTAA 2JUFA 3CCVT 4NL3A 3CMAA 1XTDA 3OMGA 2FHDA 2RA2A 1NZ9A 3TCJA 1M90U 5GAOq 2CZ6B 1W2BA 1M5Q1 5GAMg 4M78B 1VQKT 3BDLA 2RHIA 4PJOF 2V8IA 2DO3A 5CCAA 3CCQA 1EIFA 1O75A 1VQLA 4OF1A 3CCSA 3KBGA 4HCCA 3HHTB 4C8QF 4N0AA 1VQPT 4L59A 2KQWA 5D6YA 4M7DG 2V8JA 5C6SA 4RG8A 2PVGB 4IUTA 5CKEA 4Q5WA 3JSCA 4Y91A 4KULA 2OTJT 5GAN7 4XU0A 3URGA 1QVFA 2RHXA 2RJCA 4QW2A 3QSUA 4Z02A 2IVWA 4C5EA 1VQ8T 3HRTA 3INZA 3JCMJ 5L8RE 4FU6A 4F7UE 3PFSA 2XDDA 5DY9A 5LJ3h 1M4ZA 1G3WA 4M7DF 4XTXA 1X01A 5LJ5f 5GAN4 2K5LA 2O4XB 5IAYA 3OS5A 5LJ5d 4XU1A 2GFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RER A;  4M75 A;  2DXT A;  4C8Q C;  4J5Y A;  1LJO A;  4NL2 A;  3QHS A;  1B34 A;  1U1S A;  4J6X A;  4M77 G;  1D3B B;  4C92 D;  3JCM X;  4XTW A;  5GMK m;  2EWN A;  4M77 A;  5GAN 3;  3JB9 I;  4M78 D;  5LJ3 j;  5LJ5 e;  3JCM V;  3RKW A;  4J6W A;  5GAN f;  2CGH A;  3JCM Q;  4PJO E;  5GAN d;  4C92 G;  5I21 A;  4X9C A;  5GAO l;  3QO3 A;  1WPY A;  2EJG A;  1H64 1;  3PGG A;  4M75 F;  4M7D B;  4M78 G;  4C8Q E;  4N0A C;  3SWN A;  4F7U G;  4M7A F;  2VC8 A;  2VXE A;  2RD1 A;  5GAN g;  3AHU A;  2DJZ A;  1YCY A;  2EAY A;  4M78 A;  4QVC A;  5GMK e;  4XU2 A;  4F7U A;  4PNO A;  1Y96 B;  4C8Q A;  4M77 F;  5GAN e;  4JUV A;  5GAM f;  4RCC A;  4M7D C;  3L1A A;  1LNX A;  4EMK A;  4QVD A;  1U1T A;  3EFR A;  5GAM d;  3JCM f;  4MMK A;  2EJ9 A;  5GMK i;  5LJ5 g;  3JCM d;  4JRK A;  2DXU A;  2YLC A;  4HT9 A;  4PJO D;  4A53 A;  4X9D A;  3JCM b;  3HFO A;  2FYK A;  4C92 F;  4XU3 A;  5GAO n;  4J6Y A;  3M4G A;  4HA8 A;  1HXD A;  5LJ3 f;  1D3B A;  4C8Q D;  4XTY A;  3JB9 G;  3GIB A;  2QTX A;  3EFS A;  3BW1 A;  4M78 F;  3JCM g;  5GAM e;  5LJ3 d;  4M75 B;  2DTI A;  2RB6 A;  4PJO G;  3BY7 A;  3JCM e;  1B34 B;  4M7A B;  3SB2 A;  1KQ2 A;  4M7A E;  1BIB A;  4M7D E;  5GAN 6;  4MML A;  4PJO A;  4C8Q G;  4XTZ A;  3V8K A;  2E41 A;  5LJ3 g;  4M77 B;  2Y90 A;  3BDU A;  5LJ5 h;  1WQ7 A;  1I81 A;  2DEQ A;  1LOJ A;  2FB7 A;  4M75 C;  1JRI A;  5LJ3 e;  1M8V A;  4RCB A;  3RKX A;  4M7A C;  2EJF A;  3FIF A;  2DZC A;  4XTU A;  2K57 A;  2DTO A;  3RKY A;  2E64 A;  3V8J A;  5GAN 2;  5GAN 5;  3JCM P;  3JB9 D;  4HT8 A;  2DVE A;  4NL3 A;  4NOY A;  1Y96 A;  4M77 C;  3RES A;  1I5L A;  2RA2 A;  4C92 B;  3QUI A;  4XTV A;  5GAO m;  2RM4 A;  1I4K 1;  1I8F A;  5GAN 8;  5GAO q;  1M5Q 1;  5GAM g;  4M78 B;  2VXF A;  5GMK l;  4PJO F;  4F7U B;  4M7D D;  3L2Z A;  1BIA A;  4JRI A;  5GAN h;  4M7A G;  2ZGW A;  4F7U F;  5LJ5 j;  2JN0 A;  4JLI A;  3FJP A;  4M75 E;  4C8Q F;  4C92 C;  4EMK B;  4N0A A;  4EMH A;  5GAO p;  4M78 C;  4M7D G;  3V7C A;  3V7S A;  2YLB A;  2YHT A;  1KQ1 A;  3JCM c;  4M77 E;  3RUX A;  1HK9 A;  5GAO r;  4EMG A;  4M7A A;  4M7D A;  3BFM A;  4EMK C;  4Y91 A;  1JBM A;  5GAN 7;  5GMK j;  2DTH A;  5GAM h;  1N9S A;  4XU0 A;  2I2L A;  3VU3 C;  5CAI A;  5GAN j;  3FB9 A;  2E1H A;  3JCM W;  3HSB A;  3JCM h;  2E10 A;  3HFN A;  3QSU A;  3SWN B;  4C92 E;  1MGQ A;  3JB9 F;  4PJO B;  1TH7 A;  4M75 D;  3RIR A;  3V7R A;  3INZ A;  4A54 A;  1WQW A;  3JCM J;  2DKG A;  4M78 E;  5GMK h;  4M7A D;  4V2S A;  4F7U E;  4C8Q B;  5DY9 A;  4WF2 A;  5LJ3 h;  4XQ3 A;  4C92 A;  3V8L A;  4M7D F;  4M77 D;  4OP0 A;  1X01 A;  4XTX A;  1WNL A;  2DZ9 A;  1N9R A;  3SWN C;  5LJ5 f;  5GAN 4;  2E65 A;  4M75 G;  4PJO C;  3JB9 J;  5GAM j;  5LJ5 d;  3JB9 H;  2HNI A;  4XU1 A;  4DQ2 A; 
#chains in the Genus database with same CATH topology
 2P84 A;  4J9F A;  4L6V 5;  4ZGE B;  2L3Q A;  2AIR B;  4M77 G;  1V1C A;  3GP8 A;  3JCM X;  1X2K A;  2EYY A;  3I5R A;  1ABO A;  3O5Z A;  1YJN Q;  1VQ9 A;  4J6W A;  3VKI A;  2C06 A;  2JTM A;  1AD5 A;  1NE8 A;  2KK4 A;  4PFO A;  2HAX A;  4M78 G;  1PKT A;  2RHY A;  1M1G A;  3RDV A;  1VQ4 A;  1U06 A;  2KRS A;  1Y96 B;  2V1R A;  2YDL A;  1JU5 C;  4E7I A;  1JB0 E;  2R58 A;  1G3S A;  1Q81 R;  2FL7 A;  2PVO B;  2DXU A;  3TSZ A;  2SRC A;  2JTF A;  1F1B B;  1J3T A;  2PUO B;  4C5G A;  2A28 A;  2L3P A;  2LQW A;  1YI2 Q;  1D3B A;  1MV3 A;  1W4S A;  2RJF A;  2E70 A;  1JJ2 A;  1S72 Q;  3SB2 A;  1NPP A;  2GNC A;  2QXF A;  3VUB A;  4B9W A;  4MML A;  1VQM Q;  3EGU A;  1HJD A;  2E5Q A;  5FLX E;  2LP5 A;  2DEQ A;  4M75 C;  4DBF A;  5FU7 C;  3GNF B;  2JW4 A;  4XTU A;  3EG2 A;  3C4S A;  3CPW S;  4NOY A;  2RQV A;  3E1S A;  1M1F A;  1W70 A;  4GLM A;  2DBK A;  2QA4 A;  2DL8 A;  3OW2 A;  1OYX A;  1KQ1 A;  5GAO r;  1KJW A;  4J9E A;  1OX8 A;  3BFM A;  1D0X A;  2BIV A;  3X25 B;  5CQX A;  1O9S A;  2E1H A;  2F1L A;  5CIU A;  1R8O B;  3KFV A;  5HK0 A;  2FO0 A;  2MIO A;  4QQG A;  4HCZ A;  1AZG B;  1UEB A;  2E3I A;  4C5H A;  2RNA A;  2EQK A;  2EW3 A;  3GLX A;  2I0N A;  2VGN A;  3NTK A;  4ZTJ A;  4C8Q C;  1YJW T;  3G4S Q;  1U1S A;  4UC4 A;  4BUG A;  4C92 D;  4RTW A;  1RL2 A;  1WYX A;  4KUD K;  3CBO A;  5IN1 A;  1Q82 C;  2CT3 A;  3GOX A;  3DB4 A;  3MHX A;  3QO3 A;  2KSS A;  3I56 A;  2D9T A;  1LVK A;  2HQX A;  4LDV A;  2QAZ A;  1RAI B;  1T3L A;  3CME Q;  3GF5 A;  4M7D C;  1PD1 A;  2M16 A;  1KIK A;  3UA7 A;  4JRK A;  2YLC A;  1B7T A;  1X6B A;  1YWP A;  3S3O A;  2E4H A;  4DBH A;  2X4W A;  2P4R A;  4FT2 A;  3CCQ Q;  2D1X A;  2QK0 A;  2KRO A;  1TUG B;  2XI9 A;  5I2M A;  4FSS A;  3M4Y A;  5IH2 A;  5LJ3 e;  2V26 A;  3RKY A;  3CCM T;  2CDT A;  2DVE A;  1G5V A;  1GBR A;  3HP9 A;  3QUI A;  3SHW A;  3H41 A;  5GJV B;  2JVV A;  3QZ5 B;  2BUD A;  3L2Z A;  4MDX A;  4ELZ C;  5J26 A;  1RI0 A;  4JZ4 A;  2LX7 A;  2OTL Q;  5HCK A;  3CXC A;  3NFC A;  1YJW A;  1M90 R;  2OX7 A;  5KYU B;  2DPP B;  1Q82 U;  5HY6 A;  1W2B P;  2I2L A;  3FB9 A;  4OB3 B;  3JCM W;  1ZA1 B;  2DFU A;  2DL7 A;  1IHV A;  2LTO A;  1WQW A;  1VQ9 Q;  1N27 A;  1AOJ A;  4A63 B;  2KDS A;  2FEI A;  3QYG B;  1RAF B;  2FG0 A;  3QJ6 A;  4EPC A;  4M77 D;  2EYQ A;  2DZ9 A;  1TXQ A;  3HRS A;  2MK5 A;  2HNI A;  1AVZ C;  4FYW B;  1VQ4 Q;  2CZ0 B;  2DER A;  2KI7 A;  2H3J A;  2IG0 A;  3L2U A;  2FPF A;  1D3B B;  3CCE T;  1UE9 A;  2JT4 A;  1K4U S;  4M78 D;  5LJ3 j;  5CKD A;  3CCR T;  5L23 A;  4PJO E;  1SEM A;  3UAT A;  3E19 A;  3TSW A;  1QP3 A;  2O9S A;  4OMO A;  1C1A A;  1YIJ T;  2RD1 A;  3LYI A;  4HCB A;  5GMK e;  2GQI A;  4QT7 A;  1T0H A;  1C6V X;  3PMT A;  2DK3 A;  3EG3 A;  4WTO B;  4FYY B;  5A0L A;  3QPH A;  2XD0 A;  1T3S A;  4HT9 A;  3HFO A;  2YUN A;  4XU3 A;  4RTZ A;  1YHQ T;  4XTY A;  1NEB A;  2HKQ B;  3JCM g;  2KNB B;  4DBR A;  3M53 A;  1OPL A;  2KMT A;  3OYI A;  1TUC A;  1UDL A;  2K4Y A;  2QA4 Q;  3BDU A;  2MOX A;  3LW5 E;  1JRI A;  1BKB A;  4MZM A;  2CP3 A;  4HT8 A;  1I5L A;  2R5M A;  2J6F A;  5GAO m;  2KY9 A;  2RM4 A;  2A37 A;  2CP2 A;  3SFM A;  1KQS P;  1B3Q A;  2MMP A;  1RLQ C;  1WHJ A;  3CC2 T;  3NTH A;  1CSK A;  2J06 A;  1VQ6 A;  1VQO T;  3VS5 A;  3H0H A;  1HK9 A;  2YRC A;  2OJ2 A;  3CCE A;  3QBY A;  1Z9Z A;  5GMK j;  5KYW A;  1Y57 A;  2C0T A;  2ESW A;  2E10 A;  5D6W A;  1Y71 A;  2YUO A;  1GCQ A;  3OB9 A;  1FXX A;  3OYC A;  3PE0 A;  4PJO B;  2RJD A;  2JS2 A;  3H0I A;  1VQL T;  1BB9 A;  1ZX6 A;  3I56 Q;  4M75 G;  7AT1 B;  5CKB A;  3QKJ A;  1Y7X A;  3NTI A;  1BI1 A;  4J6X A;  1LPL A;  3A98 A;  4JRP A;  3PIP A;  2YSQ A;  3G6E T;  2EKO A;  2K5F A;  3SDZ A;  1TG0 A;  3PVQ A;  4HVV A;  3UWN A;  5GAO l;  3MP1 A;  5FU6 C;  3SWN A;  2K9G A;  2ED1 A;  1ZSZ A;  1QKX A;  3EAE A;  2FPE A;  4KUI A;  3OYH A;  3EFR A;  1SRM A;  3QYH B;  1TSF A;  2HBP A;  4J9D A;  4VUB A;  4AT1 B;  4BE0 A;  2HL3 A;  4JPB W;  4C8Q G;  4XTZ A;  1OUL A;  2CKK A;  2Y90 A;  1QCO A;  1CKB A;  2L5Q A;  1ZSG A;  2RF0 A;  4GY5 A;  4BY6 B;  3UA6 A;  1WXU A;  1FMV A;  5GAN 2;  1AEY A;  2J05 A;  2EVR A;  2DLP A;  2X51 A;  3OMG A;  2HL5 C;  2RA2 A;  1W2B A;  4IIO A;  4PJO F;  2DO3 A;  1O75 A;  1VQL A;  3KBG A;  2J6K A;  4L59 A;  5D6Y A;  4M7D G;  1KC8 R;  5GAN 7;  4AFZ C;  3URG A;  2RJC A;  4Z02 A;  4AG1 C;  3HRT A;  4F04 B;  1G83 A;  4FU6 A;  4F7U E;  5LJ3 h;  1R77 A;  1HYO A;  5GAN 4;  2VAS A;  1Q82 R;  2LMJ A;  4XU1 A;  5CK9 A;  1IXD A;  1WLP B;  5EG2 A;  1YBY A;  1SHF A;  3KXT A;  4AMC A;  3OYD A;  3S3M A;  2X4X A;  5D7U A;  2CH4 A;  2CGH A;  9ATC B;  1GXI E;  3QWY A;  3QZ9 B;  1QCF A;  5GAN g;  2DJZ A;  4C0F A;  4E7H A;  5KE3 A;  2H3E B;  1OPK A;  2XHC A;  2XDB A;  3L42 A;  1VUB A;  1U1T A;  5IHK A;  1AHJ B;  2PTK A;  1K0X A;  3RMS A;  5I11 A;  3N5B B;  2WSF E;  4PFP A;  2DBM A;  1WHK A;  4J6Y A;  1QVG S;  3CCU A;  5LJ3 f;  1VQN Q;  5LJ3 d;  4ZGD B;  1M27 C;  2JTE A;  1KQS A;  3ASK A;  2XID A;  1JXO A;  3L2V A;  1YIT A;  5KYW B;  2EYX A;  4QVZ A;  1IGQ A;  1VQ6 Q;  2KYM A;  4Y28 E;  3M0R A;  5C0M A;  4M7A C;  1Q86 C;  3VS6 A;  2CP6 A;  3RES A;  1AT1 B;  2LVM A;  3I55 T;  2E3H A;  2ATC B;  1I0C A;  4F7U B;  3OYY A;  2EPD A;  2QI2 A;  1ZUY A;  2GBQ A;  4EMK B;  2WAC A;  2OTL T;  4D6W A;  1MMN A;  3V7C A;  3V7S A;  2YLB A;  1Q7Y C;  2X3W D;  3QII A;  1SHG A;  1QP2 A;  2DF6 A;  2VVK A;  2LRQ A;  5DLO A;  1N9S A;  5A2Q E;  1MMG A;  2HBW A;  1WHM A;  3CC4 T;  3SWN B;  4PJM A;  1MGQ A;  3ER0 A;  4KH1 B;  3A8M B;  1ZBX A;  4C5I A;  1TH7 A;  2W10 A;  4M75 D;  2DM1 A;  2MAM A;  3QJY A;  4JJB A;  5KYY A;  4C92 A;  3VS1 A;  3FLG A;  3OYM A;  4XAX B;  3ULR B;  3QWX X;  1JEG A;  2AT1 B;  1G8X A;  2L0A A;  4LUE A;  3IQL A;  3EG9 A;  4PJL A;  2QQS A;  2K6D A;  1TS9 A;  5D6X A;  2K2M A;  2H8H A;  2EYZ A;  1UGQ B;  3LWI A;  4FT4 A;  3OW2 S;  1YJ9 A;  8ATC B;  1VQ7 A;  2K3Y A;  3CXC P;  4R56 A;  4CC3 A;  5A0D A;  3VUZ A;  2O31 A;  1OQK A;  1RI9 A;  3MEU A;  1IZ6 A;  2P4T A;  1Q86 U;  4PLL A;  3U23 A;  2AZV A;  3LLR A;  3GBQ A;  1X6O A;  1ABQ A;  2DJQ A;  3M0S A;  5GJW B;  2EQU A;  3OY9 A;  1NBE B;  5KYU A;  3NHN A;  3M4G A;  2X4Y A;  4C8Q D;  2F2X A;  2J6O A;  4BI4 A;  3A8H B;  1YCS B;  5KYX B;  1LCK A;  3M59 A;  3HPW A;  1Q7Y U;  1X2Q A;  1WFW A;  2L8D A;  3Q1J A;  1NPR A;  2A08 A;  3WVD B;  2HSE B;  3MO8 A;  3X24 B;  1YP5 A;  3CCV A;  2KRN A;  3ZEH A;  1M1K U;  2LT4 A;  3CMA T;  4XTV A;  3OA6 A;  4M7D D;  3EG0 A;  1FYN A;  1ZA2 B;  3CCS T;  1PNJ A;  3UDC A;  1ZSZ C;  4JS4 A;  3EH2 A;  2COZ A;  2ZPB B;  3RUX A;  2MCN A;  3MKD A;  2RHU A;  1VQ8 A;  1WJR A;  1PC0 A;  2QGG A;  4MZP A;  1SRL A;  1Y0M A;  4C92 E;  3RIR A;  4OVA A;  2CYZ B;  2LNV A;  2P0Q A;  2DL4 A;  4FIB A;  2NUZ A;  1WXT A;  2YUQ A;  2V8K A;  3EHQ A;  3JB9 J;  4KGV B;  1G3T A;  1QVF P;  3CCJ T;  2LJ3 A;  3M0U A;  2JNG A;  1GCP A;  1BU1 A;  1QWE A;  2KEA A;  2NWM A;  2YWW A;  3FDR A;  4LD6 A;  2K2V A;  1PD0 A;  2LT1 A;  2ZZD A;  2M51 A;  2YT6 A;  1PM3 A;  3CCU Q;  1KC8 C;  5DM7 R;  1RAB B;  5KE2 A;  3RNJ A;  1OOT A;  4XU2 A;  3ME9 A;  4PNO A;  4LUD A;  2RI5 A;  1YIT Q;  2R5A A;  3VYH B;  4J9B A;  1YN8 A;  1MUZ A;  2DVJ A;  4J7I A;  2CT4 A;  1WX6 A;  3OS1 A;  2O2O A;  1KQ2 A;  5FRO A;  1N6A A;  3QXE B;  4PJO A;  2M02 A;  1Y07 A;  1EZZ B;  3M58 A;  2ECZ A;  3MPU B;  3HKS A;  2XK0 A;  3JCM P;  1GL5 A;  1MMA A;  2PZ1 A;  2CP7 A;  5ECA A;  1AZE A;  5KYY B;  4C92 B;  2G3R A;  1ZBJ A;  4IUP A;  2NUT B;  1I8F A;  2EFI A;  4E7S A;  2HZY A;  1PSF A;  2EGA A;  3CCL T;  4PFZ A;  2P0P A;  4K11 A;  3OYG A;  2PVD B;  4O5V A;  4PK4 A;  1KHC A;  3EG9 B;  4M77 E;  2K7A A;  1QVP A;  1G2B A;  1PHT A;  4Z89 A;  1XQH A;  4LDW A;  1I5O B;  1X75 C;  3G71 T;  1PG5 B;  2K79 A;  3V7R A;  1I1J A;  2BE7 D;  4M78 E;  1KC8 U;  2F2W A;  2CRE A;  2AZS A;  2NUP B;  2LX9 A;  1YJ9 Q;  3J7A F;  1VQ7 Q;  1IHW A;  1IRE B;  1WXB A;  1JJ2 S;  4M7A G;  3LX7 A;  4LDY A;  4J5Y A;  4BE1 A;  1TWB A;  2E5K A;  2HD0 A;  5GAN 3;  3JB9 I;  1WIE A;  1VQ5 T;  1T0J A;  3RMQ A;  2QQB A;  2RO0 A;  4F16 A;  1M3B A;  2K3X A;  3VRZ A;  2EAY A;  1YCY A;  2X4J A;  2XU8 A;  5J3B A;  4OB2 B;  1UFF A;  3L1A A;  3A5Z B;  3DLL A;  4N4G A;  4LE9 A;  3CC7 T;  3D7S B;  3CCV Q;  1WHL A;  2PNI A;  3REA B;  4R55 A;  3L2W A;  5FWC A;  3TRE A;  1VQN T;  4C92 F;  4LNP A;  3PNW C;  1M30 A;  1OZ2 A;  3JB9 G;  2JMC A;  2D0N A;  1OU9 A;  1Q86 R;  3CD6 T;  1UTI A;  1M3A A;  2E41 A;  4M77 B;  4DEY A;  1BI2 A;  3O8V A;  2L2P A;  1ZLM A;  3CCM A;  3FIF A;  2DZC A;  2YRV A;  3PTA A;  4NL3 A;  6AT1 B;  1UJ0 A;  2KE9 A;  1Q7Y R;  2CZ6 B;  1VQ8 Q;  1M5Q 1;  4E6R A;  4M78 B;  2BE9 B;  4E2F B;  5GAM g;  2RHI A;  1VQK T;  2V8I A;  1X27 A;  5CCA A;  4OF1 A;  3HHT B;  1VQP T;  2X3X D;  1WHG A;  2KQW A;  1JQQ A;  1M1K R;  2V8J A;  5C6S A;  2HKN A;  4Q5W A;  4OMQ A;  2COY A;  4Y91 A;  4X1V A;  2OTJ T;  4XU0 A;  2KT8 A;  1QVF A;  2RHX A;  4FYX B;  4F14 A;  5L8R E;  1PKS A;  4XTX A;  2K5L A;  2GFU A;  2RI3 A;  4LDX A;  2ED0 A;  2ZCF B;  1W2B S;  4JJD A;  5GMK m;  3CCR A;  4RMO A;  2PU9 B;  1KK7 A;  2MWP A;  2QEX T;  3CD6 A;  1W1F A;  2WSE E;  2AKK A;  2F5K A;  1YIJ A;  4F7U A;  4CI0 C;  2OAU A;  4M77 F;  4CC7 A;  1YWO A;  4EMK A;  1IB8 A;  1VYV A;  1UUE A;  4E7J A;  2CS7 A;  2EKH A;  1RAH B;  1XNI A;  2KRM A;  1YJN T;  2CH4 W;  3HL8 A;  3OYB A;  1YHQ A;  4OMM A;  3GIB A;  3UT1 A;  4M78 F;  3OBW A;  1K8A C;  2RI2 A;  1VQP A;  1PWT A;  2ZPI B;  4C0D B;  1B34 B;  3M0P A;  4M7A E;  1RLP C;  3CQT A;  1ARK A;  1I81 A;  3MET A;  3OSV A;  3M56 A;  4KT0 E;  4KBM B;  4ELY C;  3A8L B;  2EJF A;  4ME7 A;  2CUB A;  1FMK A;  4NS5 A;  1B07 A;  4TVR A;  4OGE A;  3FJ5 A;  1YI2 T;  4IKF A;  1ZUK A;  5GAN 8;  5GMK l;  1PRM C;  4C0Z A;  1ACM B;  2QQR A;  4IIM A;  3CC2 A;  3S3N A;  1S72 T;  1FMW A;  3FJP A;  1JO8 A;  2MI6 A;  4OML A;  1VQM T;  2KAF A;  3J81 E;  2GQV A;  3LGL A;  1VQO A;  4FSX A;  3C12 A;  2YHT A;  5FWB A;  2LZ6 B;  2PUK B;  5KYN A;  4J9G A;  4E7K A;  3QDR B;  4BD3 A;  1YJW Q;  2LCL A;  3VU3 C;  5I2S A;  3HFN A;  2ROT A;  1SPK A;  4M7A D;  2D0Q B;  1CKA A;  5IHN A;  4D8D A;  1M2V B;  4XQ3 A;  2M0Y A;  3OMC A;  4B9X A;  1I07 A;  2LQK A;  4JJN K;  4PJO C;  1UGS B;  3VYG A;  3LGF A;  1OV3 A;  3RER A;  2EBP A;  2DXT A;  4RTT A;  3EGD B;  1UJY A;  5KYX A;  4FYV B;  3A1P A;  3G6E A;  1FWZ A;  3RKW A;  1K8A U;  1V76 A;  4J8O A;  3I9Q A;  2DYI A;  1AWW A;  2VXE A;  2KGT A;  1TOV A;  4C8Q A;  3G4S T;  1OU8 A;  4ORZ A;  2FZC B;  4X34 A;  3E9G A;  4AFU C;  3TU4 K;  4ZGJ B;  3CCM Q;  2CP0 A;  3P8H A;  3R6N A;  5CKH A;  4D8K A;  3WXM B;  1HXD A;  1BYM A;  2V1Q A;  3FEO A;  4YTL A;  4A4H A;  2LCS A;  1HD3 A;  4WCI A;  2MYS A;  5LJ3 g;  2QDY B;  3CME T;  3PT9 A;  1M8V A;  2GGR A;  4J9C A;  2J7I A;  2FZK B;  2RQU A;  2L3R A;  4BY6 C;  1I4K 1;  3OS2 A;  4A4K A;  4JLG A;  4JRI A;  5IXF A;  3CCQ T;  2GCX A;  4M75 E;  2EQM A;  2G6F X;  4MDW A;  2BTT A;  3TQ7 P;  2E12 A;  1RAE B;  4IUV A;  4DEX A;  2CZ7 B;  3CCE Q;  3ZL7 C;  2L3S A;  3DKM A;  4MZT A;  5HKC A;  3GNG A;  2HQH A;  1KD1 C;  2DD4 A;  2NYS A;  3VS0 A;  4V2S A;  5IXB A;  5GMK h;  3LH0 A;  2FRY A;  1QLY A;  1IRX A;  4HKE A;  2M1H A;  3OYL A;  2DD5 A;  3MEA A;  4EDU A;  1YIJ Q;  2AKL A;  2EGC A;  1NYF A;  4JS5 A;  4QKU A;  2CSI A;  2DNU A;  3QHS A;  4GLK A;  2EWN A;  2K3B A;  2VV5 A;  3JCM V;  3OSS C;  1VOM A;  1M1K C;  1VQ9 T;  2QTV A;  2EIF A;  3JCM Q;  2CSQ A;  1YHQ Q;  2XDP A;  4C8Q E;  1AWX A;  2NUT A;  2D8J A;  3VS7 A;  4LDU A;  1VQ4 T;  1GFC A;  2VGM A;  4JUV A;  1IO6 A;  4QQ6 A;  1OX9 A;  3UF4 A;  1PSE A;  3RR6 A;  2BZ8 A;  5LJ5 g;  3CPW P;  1Q95 G;  1MV0 B;  1VIE A;  3OYE A;  2MF2 A;  3THK A;  4HA8 A;  2KXD A;  3MP8 A;  2DMO A;  2QTX A;  5GAM e;  4M75 B;  5FU7 B;  3CC2 Q;  3JCM e;  4JRQ A;  4M7D E;  2M0O A;  1K73 C;  3V8K A;  1VQO Q;  3HRU A;  3REB B;  3VS4 A;  2NUP A;  3MEV A;  3V8J A;  4JJC A;  1KD1 U;  4Y92 A;  3I55 A;  2CUD A;  1GCQ C;  1RUW A;  2ENM A;  1E6G A;  1D1C A;  2VWF A;  4F7U F;  1QVG A;  2OTL A;  4Z88 A;  2HQE A;  3NMZ C;  2KYB A;  1VQL Q;  2QA4 T;  4BAC A;  3MJX A;  4RKU E;  1V29 B;  4LXC A;  1PCX A;  1C0M A;  4EMK C;  2RK2 A;  2EGE A;  3CC4 A;  5CAI A;  3CEY A;  1MMD A;  4ANJ A;  2A0F B;  3X28 B;  3G6E Q;  3E9F A;  4RTU A;  3C95 A;  4CC4 B;  4C8Q B;  4WF2 A;  3QDF A;  2FVU A;  3SWN C;  1WNL A;  3L2Q A;  2E65 A;  3OYJ A;  5GAM j;  3R6O A;  3PIO A;  3EFO B;  4DA4 A;  3VJP A;  1RAG B;  2QDL A;  4M77 A;  1KFZ A;  2Y4Y A;  1M9S A;  2GTJ A;  4J83 A;  2GTO A;  2F5T X;  2QQ9 A;  4IUR A;  1R0B G;  1H8K A;  1DJ7 B;  1SG5 A;  3JV3 A;  4M7D B;  4M75 F;  2LQ8 A;  2DEU A;  1K73 U;  2KBT A;  3I56 T;  4BI8 B;  5IHI A;  4RG2 A;  2B8A A;  4M78 A;  1WJQ A;  4QVC A;  2DA9 A;  2R57 A;  1JXM A;  2KVQ G;  4II1 A;  4E7L A;  4PL6 A;  1K8A R;  3CBP A;  1LNX A;  1K9M C;  4KRT A;  5CQY A;  3AT1 B;  2E6Z A;  3JCM b;  2PQW A;  5GAO n;  1QWF A;  2P0K A;  4BDY A;  4A4G A;  3EFS A;  3BW1 A;  4P5N A;  4PJO G;  1AWJ A;  3CXC S;  4OMF B;  4F17 A;  1BIB A;  2CZ1 B;  3JB9 F;  2ABL A;  1K76 A;  1WQ7 A;  1TUD A;  2JS0 A;  2A36 A;  3RKX A;  2XMF A;  4AFQ C;  2RJE A;  4KH0 B;  2E64 A;  5GAN 5;  2JUF A;  3CMA A;  3VS2 A;  1XTD A;  1NZ9 A;  1EX4 A;  5GAO q;  3BDL A;  2F2V A;  1X69 A;  3NPF A;  4RTV A;  3CCS A;  4C8Q F;  4N0A A;  4RG8 A;  4IUT A;  5CKE A;  3JSC A;  1N8R R;  4QW2 A;  4C5E A;  4Z8A A;  1TU0 B;  1D0Z A;  3INZ A;  3JCM J;  2XDD A;  1H3H A;  5DY9 A;  1M4Z A;  3EGX B;  1G3W A;  1SSH A;  4M7D F;  1K9M U;  1QW1 A;  1LJO A;  3CCJ A;  2RN8 A;  2DRK A;  1B34 A;  3MP6 A;  3C94 A;  1N5Z A;  4CC2 A;  3OYK A;  2VUB A;  1H92 A;  3P8B B;  1K1Z A;  3CPW A;  2K5I A;  1E6H A;  1NG2 A;  4X9C A;  1WPY A;  2ROL A;  1H64 1;  3PGG A;  2GF7 A;  1XOV A;  4OGC A;  3RBB B;  5CO7 A;  3VRY A;  4JZ3 A;  5GAN e;  3OQ5 A;  1QVF S;  3M57 A;  1IGU A;  2EJ9 A;  2BZX A;  5GMK i;  4L5G A;  4A53 A;  4X9D A;  3LWH A;  2FYK A;  4M4Z A;  4BB7 A;  2RHZ A;  1WA7 A;  2JMA A;  3I55 Q;  2JOY A;  3E2U A;  4FW1 A;  2RB6 A;  4C0G A;  1H3Z A;  3P8D A;  1S1N A;  1D0Y A;  3C0C A;  4OMP A;  2DL5 A;  4N4I A;  5GAN 6;  2RPN A;  3JAM E;  1LOJ A;  2DRM A;  1M2V A;  1SSF A;  2O9V A;  1KSW A;  4RTX A;  2K57 A;  2E6N A;  3VS3 A;  3DB3 A;  3CC4 Q;  2RQW A;  1SKU B;  1UEC A;  3EGD A;  3H0F A;  3CCL A;  2YUP A;  3PMI A;  3NGP A;  1BI3 A;  1UHC A;  1D09 B;  4C92 C;  4ESR A;  4QQD A;  5GAO p;  1VQ6 T;  1BK2 A;  1NYG A;  1HSQ A;  2DXC A;  1KD1 R;  1NJI C;  1OZ3 A;  4M7A A;  1WGS A;  2HMA A;  3JRZ A;  1JBM A;  1OEB A;  1UG1 A;  4HXJ A;  5GAM h;  5CR2 A;  3OBY A;  1U5S A;  2FZG B;  5GAN j;  2KT1 A;  3G71 A;  3HSB A;  3JCM h;  2DIG A;  4ZTF A;  1EFN A;  1WI7 A;  2DKG A;  4B6M A;  1BCM A;  5CKF A;  2AHJ B;  1UGV A;  5KH6 A;  2ZPF B;  2EQJ A;  2QGF B;  3TEE A;  3M9Q A;  2YRD A;  2NLU A;  3M54 A;  2VYT A;  1QQJ A;  1U8R A;  2MWO A;  4XTW A;  1GRI A;  4DOW A;  1VA7 A;  3A8O B;  2DET A;  5LJ5 e;  5FU6 B;  2KXC A;  1VQ5 A;  3ZFJ A;  4BDZ A;  5CVI A;  4R0K A;  5I21 A;  3F70 A;  2OI3 A;  2EJG A;  3J80 E;  4OB1 B;  4F7U G;  1TTH B;  1MND A;  2QQA A;  3MCA B;  2LQN A;  1RAD B;  1K0S A;  5GAM f;  2DIQ A;  5GAM d;  3JCM f;  3CC7 A;  2VKN A;  3JCM d;  1YFN A;  4PJO D;  1VQN A;  1K73 R;  3CMA Q;  1QKW A;  5FRN A;  2AK5 A;  2ZPG B;  4A4F A;  4PJJ A;  1NLP C;  1BI0 A;  1P92 A;  1Q81 C;  2FRW A;  5FW9 A;  1A0N B;  1UB4 A;  1OI1 A;  3CCS Q;  1NJI U;  3CBM A;  4ZNX A;  3OYF A;  2X35 A;  2FB7 A;  2M9U A;  4PKC C;  1E7O A;  4RCB A;  5A0G A;  4M77 C;  1VQK A;  4FCY A;  4PJN A;  3S6W A;  1BIA A;  5EC7 A;  5LJ5 j;  4JLI A;  4HCK A;  4JDS A;  5HK3 A;  4EMH A;  5IT9 E;  3KUF A;  2QYZ A;  4M78 C;  3A8G B;  3G1J A;  2OTJ A;  4AG2 C;  2O01 E;  3CCJ Q;  2DTH A;  1NLO C;  2LCC A;  2QG9 B;  1D1B A;  4FL6 A;  4E7Z A;  2YXY A;  4HVW A;  2LC4 A;  1UHF A;  4IUU A;  2Z0W A;  4ATO A;  2FPD A;  3TVT A;  2LDM A;  2MPX C;  2BKD N;  1N9R A;  1QCN A;  4PLI A;  2WSC E;  4RUG A;  4BE2 A;  2ZPE B;  3SD4 A;  5KCH A;  1SF9 A;  4M75 A;  3T9N A;  2JZ2 A;  2QAS A;  2DYB A;  3G7Z A;  1UGR B;  2RQR A;  4ZN1 A;  3EHR A;  1QVG P;  3LH5 A;  1KQS S;  1Q81 U;  2QEX A;  4ZN3 A;  5LL6 S;  1KHI A;  1K9M R;  3HTR A;  3OYN A;  2XIC A;  3M0Q A;  1WZO A;  4N0A C;  1N8R C;  1K9A A;  3AHU A;  4RTY A;  2HCK A;  5I22 A;  5AYF A;  1GFD A;  4E47 A;  2C0I A;  2HSP A;  4HVU A;  4QVD A;  2CP5 A;  4DOV A;  2O4X A;  2Y4X A;  4MMK A;  1ZQ1 A;  4O6J A;  4KGZ B;  2EYW A;  2OAW A;  3FC3 A;  1YJN A;  3H9N A;  4XK8 E;  1PRL C;  2F69 A;  3H8Z A;  1G3Y A;  4J7F A;  3X20 B;  3CCU T;  2LNH B;  2XKO C;  1GBQ A;  3BY7 A;  3CCL Q;  4M7A B;  3M55 A;  3H6Z A;  3QG1 A;  2DE0 X;  4OMN A;  3M5A A;  1YIT T;  1BBZ A;  4J9H A;  2W0Z A;  2JM8 A;  4N4H A;  4C0D C;  3OS0 A;  2DX1 A;  2DTO A;  3OYA A;  1VYT A;  2HDA A;  3JB9 D;  1Y96 A;  1YI2 A;  1XJW B;  3EFO A;  5KCO A;  2X9H A;  2D6F A;  3G71 Q;  1JJ2 P;  4A4E A;  1M3C A;  2VXF A;  2DAQ A;  2A3L A;  2ZPH B;  1NM7 A;  4CRI A;  1S72 A;  5GAN h;  4FM4 B;  2JXB A;  2ZGW A;  2JN0 A;  5J39 A;  3I35 A;  1VQM A;  1X6G A;  2IIM A;  2DL3 A;  2RQT A;  3JCM c;  4EMG A;  4M7D A;  2GFA A;  1R0C B;  2ZAE A;  2DIL A;  4EIK A;  4GBQ A;  3X26 B;  1VIF A;  1M90 C;  4A54 A;  3EG1 A;  1VQ5 Q;  3OW2 P;  1KG1 A;  3L2R A;  1N8R U;  3V8L A;  3CPF A;  2HEQ A;  3EH1 A;  4OP0 A;  3DLM A;  3JB9 H;  1D1A A;  4NL2 A;  4BI3 A;  3FRN A;  2XG8 D;  1ZHI A;  1ZUU A;  2DXB A;  2RK1 A;  3CC7 Q;  4LD9 K;  5GAN f;  5FRM A;  3CCR Q;  5GAN d;  1U3O A;  4C92 G;  3VV0 A;  5DLQ E;  2A7Y A;  1UGP B;  1YJ9 T;  3I5S A;  2JJ9 A;  1VQ7 T;  4J9I A;  3GPL A;  2SEM A;  4M7A F;  2VC8 A;  3M0T A;  2LJ0 A;  4LN2 A;  3CD6 Q;  3G4S A;  3UPU A;  3PVL A;  1BCO A;  4RCC A;  1Z9Q A;  5AT1 B;  2KR3 A;  4DBQ A;  4OB0 B;  1FX7 A;  2C0O A;  1MHN A;  1VQK Q;  3BE3 A;  2DTI A;  1X43 A;  2L89 A;  2O88 A;  3WVE B;  1AWO A;  1VQP Q;  2COW A;  4IUQ A;  3CME A;  3MEW A;  5LJ5 h;  2RH2 A;  1VYU A;  2D8H A;  3ZBD A;  2LJ1 A;  3EGX A;  1MNE A;  1WJS A;  5M9O A;  1RAC B;  3CCV T;  2OTJ Q;  2FHD A;  3TCJ A;  1M90 U;  1M2O A;  1NJI R;  1ZSZ B;  3SEM A;  3CCQ A;  1EIF A;  2JM9 A;  4HCC A;  1QMC A;  1NEG A;  4AFS C;  2PVG B;  4FW2 A;  2VB6 A;  4KUL A;  4KGX B;  1YNZ A;  8AT1 B;  1WDX A;  3QSU A;  2IVW A;  2EQI A;  1VQ8 T;  2RMO A;  2IPO B;  1M8M A;  2B86 A;  2BZY A;  3PFS A;  1WHH A;  2QEX Q;  1RAA B;  1X01 A;  1W6X A;  5LJ5 f;  2O4X B;  5IAY A;  3OS5 A;  5LJ5 d;  4DQ2 A; 
#chains in the Genus database with same CATH homology
 2RI3 A;  1K9M U;  4L6V 5;  1QW1 A;  1LJO A;  4ZGE B;  5CK9 A;  3CCJ A;  4LDX A;  1B34 A;  3MP6 A;  4M77 G;  3C94 A;  5EG2 A;  1YBY A;  2ZCF B;  3GP8 A;  3JCM X;  1W2B S;  3KXT A;  5GMK m;  3CCR A;  3OYD A;  3OYK A;  4RMO A;  2VUB A;  2PU9 B;  1VQ9 A;  3P8B B;  3S3M A;  4J6W A;  2X4X A;  3VKI A;  3CPW A;  2C06 A;  2CGH A;  2JTM A;  1NE8 A;  2K5I A;  2MWP A;  2KK4 A;  4X9C A;  2QEX T;  2HAX A;  1GXI E;  1WPY A;  3CD6 A;  1H64 1;  2WSE E;  3PGG A;  2F5K A;  4M78 G;  2GF7 A;  3QZ9 B;  1XOV A;  1YIJ A;  2RHY A;  4OGC A;  5GAN g;  5CO7 A;  1M1G A;  2DJZ A;  4C0F A;  1VQ4 A;  4F7U A;  4E7H A;  1Y96 B;  4CI0 C;  2OAU A;  5KE3 A;  4M77 F;  5GAN e;  3OQ5 A;  2XHC A;  1QVF S;  2XDB A;  4E7I A;  1JB0 E;  3L42 A;  4ELY C;  1VUB A;  3M57 A;  1U1T A;  2R58 A;  1G3S A;  4EMK A;  2EJ9 A;  2FL7 A;  1AHJ B;  2PVO B;  5GMK i;  2CS7 A;  4L5G A;  2DXU A;  3RMS A;  4E7J A;  1XNI A;  1YJN T;  3N5B B;  2WSF E;  4X9D A;  4A53 A;  2JTF A;  3HL8 A;  3LWH A;  2PUO B;  2FYK A;  4C5G A;  3OYB A;  1YHQ A;  4J6Y A;  4BB7 A;  1QVG S;  3CCU A;  2RHZ A;  1D3B A;  5LJ3 f;  1W4S A;  3GIB A;  3UT1 A;  4M78 F;  3OBW A;  1K8A C;  2RJF A;  2JOY A;  2RI2 A;  5LJ3 d;  4ZGD B;  1VQP A;  2E70 A;  2RB6 A;  4C0G A;  2ZPI B;  1H3Z A;  4C0D B;  3P8D A;  1JJ2 A;  1B34 B;  3SB2 A;  4M7A E;  1KQS A;  1NPP A;  2QXF A;  3ASK A;  2XID A;  4N4I A;  3VUB A;  4B9W A;  4MML A;  5GAN 6;  3L2V A;  1YIT A;  4QVZ A;  2E5Q A;  4Y28 E;  3JAM E;  5FLX E;  1I81 A;  2DEQ A;  1LOJ A;  3M56 A;  3MET A;  3OSV A;  4KBM B;  4KT0 E;  4M75 C;  5FU7 C;  1SSF A;  3A8L B;  3GNF B;  2EJF A;  5C0M A;  4M7A C;  4ME7 A;  4XTU A;  2K57 A;  1Q86 C;  2E6N A;  3C4S A;  4NS5 A;  3CPW S;  4NOY A;  3RES A;  4TVR A;  4OGE A;  1YI2 T;  4IKF A;  3DB3 A;  2LVM A;  3E1S A;  5GAN 8;  3I55 T;  1M1F A;  5GMK l;  4F7U B;  4C0Z A;  3OYY A;  2QQR A;  3CC2 A;  3CCL A;  3PMI A;  2QI2 A;  1BI3 A;  3S3N A;  1S72 T;  3FJP A;  4C92 C;  2MI6 A;  4EMK B;  2WAC A;  2KAF A;  3J81 E;  2GQV A;  3LGL A;  2QA4 A;  1VQM T;  1VQO A;  3OW2 A;  2OTL T;  4QQD A;  5GAO p;  4D6W A;  1VQ6 T;  4FSX A;  3V7C A;  3C12 A;  2DXC A;  2YLB A;  2YHT A;  1OYX A;  1KQ1 A;  3V7S A;  1Q7Y C;  1NJI C;  2PUK B;  1OZ3 A;  3QII A;  5GAO r;  4M7A A;  1QP2 A;  1WGS A;  3BFM A;  4E7K A;  3JRZ A;  1JBM A;  2LRQ A;  3QDR B;  2BIV A;  4BD3 A;  5DLO A;  5GAM h;  3X25 B;  2LCL A;  1N9S A;  5CR2 A;  3OBY A;  3VU3 C;  5A2Q E;  5I2S A;  5CQX A;  1O9S A;  2E1H A;  3G71 A;  3JCM h;  3CC4 T;  2DIG A;  3HFN A;  5CIU A;  1R8O B;  4ZTF A;  3HSB A;  3SWN B;  1MGQ A;  3ER0 A;  4C5I A;  3A8M B;  1ZBX A;  5HK0 A;  1TH7 A;  4M75 D;  4QQG A;  1JJ2 S;  2MAM A;  3QJY A;  2DKG A;  4M7A D;  2D0Q B;  4HCZ A;  5CKF A;  2AHJ B;  4C92 A;  1UEB A;  4XQ3 A;  4C5H A;  5KH6 A;  2ZPF B;  3OMC A;  2EQJ A;  3TEE A;  4B9X A;  2LQK A;  3M9Q A;  3FLG A;  4JJN K;  4PJO C;  1UGS B;  2EQK A;  2NLU A;  3VYG A;  3GLX A;  3M54 A;  3OYM A;  2VYT A;  2VGN A;  3LGF A;  3NTK A;  4XAX B;  4ZTJ A;  3RER A;  2DXT A;  4C8Q C;  1U8R A;  1YJW T;  1U1S A;  4UC4 A;  4BUG A;  4C92 D;  2MWO A;  4XTW A;  4DOW A;  1RL2 A;  4KUD K;  3A8O B;  3CBO A;  5IN1 A;  3G6E A;  1Q82 C;  1FWZ A;  2QQS A;  5FU6 B;  5D6X A;  5LJ5 e;  3GOX A;  3RKW A;  3DB4 A;  1VQ5 A;  3ZFJ A;  3MHX A;  4BDZ A;  1K8A U;  1UGQ B;  3LWI A;  4FT4 A;  3OW2 S;  5CVI A;  1YJ9 A;  5I21 A;  4J8O A;  3F70 A;  1VQ7 A;  2K3Y A;  3QO3 A;  2EJG A;  2KSS A;  3J80 E;  3I56 A;  2D9T A;  4OB1 B;  4F7U G;  2HQX A;  4R56 A;  2VXE A;  4LDV A;  5A0D A;  3VUZ A;  2QQA A;  3MCA B;  4C8Q A;  3MEU A;  3G4S T;  1IZ6 A;  2P4T A;  3GF5 A;  5GAM f;  1Q86 U;  4M7D C;  2DIQ A;  2M16 A;  4PLL A;  5GAM d;  4X34 A;  3E9G A;  3JCM f;  3CC7 A;  3LLR A;  3TU4 K;  1X6O A;  4ZGJ B;  3JCM d;  4JRK A;  2YLC A;  2EQU A;  4PJO D;  3P8H A;  3OY9 A;  1VQN A;  5CKH A;  3S3O A;  2X4W A;  3M4G A;  2X4Y A;  3WXM B;  1HXD A;  4C8Q D;  5FRN A;  2ZPG B;  1BYM A;  4A4F A;  1BI0 A;  1P92 A;  4BI4 A;  3A8H B;  1Q81 C;  3FEO A;  4FT2 A;  4YTL A;  1UB4 A;  4A4H A;  3M59 A;  1OI1 A;  3HPW A;  1Q7Y U;  1NJI U;  2L8D A;  3CBM A;  4DQ2 A;  3Q1J A;  5LJ3 g;  2QDY B;  2XI9 A;  3OYF A;  3CME T;  1NPR A;  3PT9 A;  2X35 A;  5I2M A;  3WVD B;  2FB7 A;  2M9U A;  3M4Y A;  4PKC C;  5LJ3 e;  1M8V A;  4RCB A;  3MO8 A;  3X24 B;  5GAN j;  3CCV A;  3RKY A;  3CCM T;  5A0G A;  2DVE A;  3ZEH A;  1M1K U;  2LT4 A;  4M77 C;  1G5V A;  3HP9 A;  3CMA T;  3QUI A;  4XTV A;  2L3R A;  3OA6 A;  4BY6 C;  1I4K 1;  3OS2 A;  2JVV A;  1VQK A;  3QZ5 B;  4A4K A;  2BUD A;  4M7D D;  3S6W A;  3L2Z A;  4JLG A;  1BIA A;  4JRI A;  4MDX A;  4ELZ C;  3CCQ T;  5LJ5 j;  5J26 A;  2GCX A;  4JLI A;  1RI0 A;  4M75 E;  4JDS A;  3CCS T;  5HK3 A;  2EQM A;  4MDW A;  3UDC A;  4EMH A;  5IT9 E;  3KUF A;  4JS4 A;  4M78 C;  3A8G B;  3CXC A;  3NFC A;  1YJW A;  2ZPB B;  3RUX A;  2E12 A;  4IUV A;  2OTJ A;  2DPP B;  2CZ7 B;  2O01 E;  2DTH A;  1Q82 U;  5HY6 A;  2I2L A;  2LCC A;  2RHU A;  3FB9 A;  4OB3 B;  3JCM W;  1VQ8 A;  1WJR A;  3DKM A;  4MZP A;  4MZT A;  5HKC A;  4FL6 A;  3GNG A;  4C92 E;  1KD1 C;  2DD4 A;  3RIR A;  2LTO A;  1WQW A;  4V2S A;  2CYZ B;  1N27 A;  2LC4 A;  4IUU A;  4OVA A;  5GMK h;  2KDS A;  3LH0 A;  3QYG B;  4ATO A;  2LNV A;  2P0Q A;  3QJ6 A;  4EPC A;  4HKE A;  2M1H A;  2LDM A;  3OYL A;  2BKD N;  2EYQ A;  4FIB A;  4M77 D;  2DD5 A;  1N9R A;  2DZ9 A;  3HRS A;  2V8K A;  3JB9 J;  4PLI A;  2WSC E;  3MEA A;  4EDU A;  4BE2 A;  2HNI A;  2ZPE B;  3SD4 A;  5KCH A;  4JS5 A;  4M75 A;  3T9N A;  2CZ0 B;  1G3T A;  2H3J A;  2IG0 A;  3QHS A;  4GLK A;  3L2U A;  3CCJ T;  1D3B B;  3CCE T;  2JZ2 A;  2JNG A;  3G7Z A;  2EWN A;  4M78 D;  5LJ3 j;  1UGR B;  4ZN1 A;  5CKD A;  3FDR A;  2VV5 A;  3JCM V;  3CCR T;  3OSS C;  4LD6 A;  2K2V A;  1M1K C;  1VQ9 T;  2EIF A;  3JCM Q;  4PJO E;  1KQS S;  2LT1 A;  2ZZD A;  3E19 A;  2QEX A;  1Q81 U;  4ZN3 A;  1QP3 A;  1KHI A;  5LL6 S;  2XDP A;  3OYN A;  2XIC A;  1KC8 C;  4C8Q E;  5DM7 R;  4N0A C;  5KE2 A;  1N8R C;  1YIJ T;  2RD1 A;  3LYI A;  3AHU A;  4HCB A;  5GMK e;  4LDU A;  4XU2 A;  3ME9 A;  4PNO A;  1VQ4 T;  5AYF A;  2RI5 A;  2VGM A;  2R5A A;  4JUV A;  4E47 A;  3PMT A;  2DK3 A;  4QQ6 A;  3VYH B;  4QVD A;  4DOV A;  1PSE A;  5A0L A;  2O4X A;  3QPH A;  2XD0 A;  2Y4X A;  4MMK A;  5LJ5 g;  1ZQ1 A;  4O6J A;  3FC3 A;  1YJN A;  4HT9 A;  1VIE A;  4XK8 E;  3OYE A;  3HFO A;  2F69 A;  2MF2 A;  3H8Z A;  1G3Y A;  4XU3 A;  4HA8 A;  4J7F A;  3X20 B;  3MP8 A;  4J7I A;  1YHQ T;  4XTY A;  2QTX A;  3JCM g;  3CCU T;  5GAM e;  3OS1 A;  4M75 B;  2XKO C;  3M53 A;  3BY7 A;  5FU7 B;  3JCM e;  4JRQ A;  4M7A B;  5FRO A;  1KQ2 A;  1N6A A;  3M55 A;  4M7D E;  2M0O A;  3H6Z A;  3QXE B;  2KMT A;  3OYI A;  3QG1 A;  1K73 C;  4PJO A;  2K4Y A;  3M5A A;  3V8K A;  1Y07 A;  3M58 A;  3HRU A;  1YIT T;  3BDU A;  3HKS A;  1JRI A;  3LW5 E;  4N4H A;  1BKB A;  4C0D C;  3MEV A;  2XK0 A;  4MZM A;  3OS0 A;  3JCM P;  2DTO A;  3V8J A;  3OYA A;  4HT8 A;  3JB9 D;  1Y96 A;  1YI2 A;  1KD1 U;  1I5L A;  4C92 B;  2R5M A;  2G3R A;  5KCO A;  4IUP A;  5GAO m;  3I55 A;  2KY9 A;  2RM4 A;  1I8F A;  2D6F A;  2EFI A;  3SFM A;  4A4E A;  2VXF A;  1PSF A;  2MMP A;  2DAQ A;  2A3L A;  2ZPH B;  4CRI A;  1S72 A;  5GAN h;  4FM4 B;  3CCL T;  3CC2 T;  2ZGW A;  4F7U F;  1QVG A;  2JN0 A;  5J39 A;  3NTH A;  1VQM A;  2OTL A;  2P0P A;  2HQE A;  1VQ6 A;  3OYG A;  1VQO T;  2QA4 T;  4BAC A;  2PVD B;  4O5V A;  3JCM c;  1KHC A;  4M77 E;  1HK9 A;  1QVP A;  4RKU E;  4EMG A;  4M7D A;  1V29 B;  3CCE A;  4EMK C;  3QBY A;  2GFA A;  2RK2 A;  1XQH A;  5GMK j;  3CC4 A;  4LDW A;  5CAI A;  3CEY A;  2E10 A;  1X75 C;  1Y71 A;  5D6W A;  3G71 T;  3X28 B;  3OB9 A;  3X26 B;  1FXX A;  1VIF A;  3E9F A;  3OYC A;  3V7R A;  1M90 C;  4PJO B;  4A54 A;  4M78 E;  3C95 A;  2RJD A;  1KC8 U;  1KG1 A;  4C8Q B;  3L2R A;  1N8R U;  4WF2 A;  2LX9 A;  3V8L A;  1VQL T;  2FVU A;  3CPF A;  4OP0 A;  1IRE B;  3J7A F;  3SWN C;  1WNL A;  3L2Q A;  2E65 A;  4M75 G;  3DLM A;  3OYJ A;  5GAM j;  3R6O A;  3PIO A;  3JB9 H;  4M7A G;  3LX7 A;  4LDY A;  4DA4 A;  5CKB A;  3QKJ A;  3VJP A;  4J5Y A;  4NL2 A;  4BI3 A;  1Y7X A;  3FRN A;  4BE1 A;  3NTI A;  2XG8 D;  1BI1 A;  4J6X A;  1ZHI A;  2DXB A;  4JRP A;  2HD0 A;  2RK1 A;  4M77 A;  5GAN 3;  3JB9 I;  3PIP A;  2Y4Y A;  1M9S A;  4J83 A;  3G6E T;  4LD9 K;  5GAN f;  5FRM A;  2F5T X;  2QQ9 A;  4IUR A;  1VQ5 T;  2EKO A;  2K5F A;  5GAN d;  1DJ7 B;  4C92 G;  3SDZ A;  3VV0 A;  5DLQ E;  2A7Y A;  1UGP B;  3UWN A;  5GAO l;  1YJ9 T;  4M7D B;  1VQ7 T;  3RMQ A;  3MP1 A;  2LQ8 A;  2QQB A;  4M75 F;  2RO0 A;  5FU6 C;  3SWN A;  3I56 T;  3GPL A;  1K73 U;  4BI8 B;  2K3X A;  4M7A F;  2VC8 A;  4RG2 A;  2B8A A;  2EAY A;  1YCY A;  2X4J A;  1WJQ A;  2XU8 A;  3EAE A;  4M78 A;  4OB2 B;  2R57 A;  2KVQ G;  4II1 A;  5J3B A;  4QVC A;  3G4S A;  3UPU A;  4E7L A;  4KUI A;  4PL6 A;  4RCC A;  3L1A A;  3A5Z B;  1LNX A;  3CBP A;  3OYH A;  3EFR A;  3DLL A;  1K9M C;  4N4G A;  5CQY A;  4OB0 B;  3CC7 T;  2E6Z A;  3QYH B;  3JCM b;  4R55 A;  1FX7 A;  2PQW A;  3TRE A;  3L2W A;  4C92 F;  5GAO n;  1VQN T;  3PNW C;  2HBP A;  2P0K A;  4VUB A;  1OZ2 A;  4BDY A;  1MHN A;  3JB9 G;  4A4G A;  3EFS A;  3BW1 A;  4P5N A;  2DTI A;  4PJO G;  4BE0 A;  3CXC S;  4OMF B;  2L89 A;  1BIB A;  2CZ1 B;  3WVE B;  3CD6 T;  4IUQ A;  3JB9 F;  4C8Q G;  4XTZ A;  3CME A;  2E41 A;  2CKK A;  4M77 B;  2Y90 A;  3MEW A;  1WQ7 A;  2L5Q A;  2RH2 A;  4GY5 A;  5LJ5 h;  1BI2 A;  4BY6 B;  3ZBD A;  3O8V A;  3RKX A;  3CCM A;  3FIF A;  2DZC A;  2RJE A;  2YRV A;  5GAN 2;  5GAN 5;  2E64 A;  1WJS A;  5M9O A;  3PTA A;  2JUF A;  3CCV T;  4NL3 A;  3CMA A;  1XTD A;  3OMG A;  2FHD A;  2RA2 A;  1NZ9 A;  3TCJ A;  1M90 U;  5GAO q;  2CZ6 B;  1W2B A;  1M5Q 1;  5GAM g;  4M78 B;  1VQK T;  3BDL A;  2RHI A;  4PJO F;  2V8I A;  2DO3 A;  5CCA A;  3CCQ A;  1EIF A;  1O75 A;  1VQL A;  4OF1 A;  3CCS A;  3KBG A;  4HCC A;  3HHT B;  4C8Q F;  4N0A A;  1VQP T;  4L59 A;  2KQW A;  5D6Y A;  4M7D G;  2V8J A;  5C6S A;  4RG8 A;  2PVG B;  4IUT A;  5CKE A;  4Q5W A;  3JSC A;  4Y91 A;  4KUL A;  2OTJ T;  5GAN 7;  4XU0 A;  3URG A;  1QVF A;  2RHX A;  2RJC A;  4QW2 A;  3QSU A;  4Z02 A;  2IVW A;  4C5E A;  1VQ8 T;  3HRT A;  3INZ A;  3JCM J;  5L8R E;  4FU6 A;  4F7U E;  3PFS A;  2XDD A;  5DY9 A;  5LJ3 h;  1M4Z A;  1G3W A;  4M7D F;  4XTX A;  1X01 A;  5LJ5 f;  5GAN 4;  2K5L A;  2O4X B;  5IAY A;  3OS5 A;  5LJ5 d;  4XU1 A;  2GFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...