3HFOA

Crystal structure of an hfq protein from synechocystis sp.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
DSGLPSVRQVQLLIKDQTPVEIKLLTGDSLFGTIRWQDTDGLGLVDDSERSTIVRLAAIAYITPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cyanobacteria contain a structural homologue of the Hfq protein with altered RNA-binding properties.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Rna binding protein
molecule keywords Ssr3341 protein
total genus 15
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hfoA00
2EAYA 5GAMh 4M78D 4PNOA 4C8QC 4C92E 4M7AC 3JB9J 3RERA 4C8QA 3FIFA 1I8FA 4J6WA 4M78E 4M75C 4EMKA 4F7UE 3JCMP 4M77B 1M8VA 3HFNA 4EMHA 3SWNC 2HNIA 4M75E 5GAN6 5GANg 1WNLA 3JCMf 3V7RA 1U1SA 5GAMf 5LJ5g 3BW1A 4MMLA 4XU1A 4M75F 3VU3C 4M7DG 1N9SA 2EWNA 3JB9D 3FB9A 3EFRA 2EJFA 4M75B 4C92B 3JB9H 4RCBA 5GAN4 5GANd 5LJ3e 4N0AA 3PGGA 4M75D 2Y90A 4XTZA 4C92G 3RESA 4F7UF 3SB2A 4X9CA 4XU2A 4PJOA 2DJZA 5GMKh 5I21A 4M77D 4OP0A 4XTYA 4NL3A 4JRIA 3JCMc 3SWNA 3INZA 1D3BB 4MMKA 3JCMh 5LJ5h 4C8QD 3RKWA 4XTVA 2QTXA 4PJOE 4M77F 4M7DE 2FYKA 3JCMe 3RIRA 2VC8A 4J6YA 4XTWA 4M7AD 3V7SA 4C92C 4C8QE 4XU3A 3V8KA 3BFMA 5GAOr 4PJOB 1YCYA 1WQ7A 2RB6A 3L1AA 3RKXA 5CAIA 5GAN7 4HT8A 4Y91A 2DXUA 4M7AF 3SWNB 5GANj 3GIBA 4C92A 1B34A 4X9DA 1BIBA 1HXDA 5LJ3h 2DTHA 4M75A 1JBMA 5GAN3 2EJGA 4M7DF 4M78A 1WPYA 2YHTA 3EFSA 2CGHA 3JB9F 2ZGWA 3JCMV 1U1TA 2DEQA 3QO3A 4WF2A 5GMKi 4F7UA 4M7DD 4M7AG 5LJ5e 3QHSA 5GMKm 2YLCA 3JB9G 4M7AE 2JN0A 1X01A 1D3BA 2DKGA 2RD1A 5GANf 1JRIA 3V7CA 4J5YA 4NOYA 2E10A 2YLBA 4A54A 5GAMe 2K57A 4NL2A 4M77E 4A53A 4N0AC 5LJ3g 2I2LA 1TH7A 4M78B 5GAN8 3JB9I 5GAOp 1LOJA 4JRKA 5GAMj 3RKYA 4C8QF 2EJ9A 3V8LA 4DQ2A 4V2SA 2E64A 3HFOA 4M78G 4C92D 2DXTA 2DVEA 4M77G 1Y96A 4J6XA 1B34B 2E1HA 4PJOG 4EMKC 3JCMW 5GMKl 4RCCA 4XTUA 2RM4A 1LJOA 5GAN2 4M7AB 4C92F 5GMKj 5GAMg 4JUVA 1BIAA 4HA8A 4M7DA 1LNXA 1I5LA 4M78F 4F7UB 5GANe 3BDUA 4HT9A 5LJ3f 3QUIA 4EMGA 1M5Q1 4M7DC 4JLIA 3BY7A 4XU0A 5GAOm 3QSUA 5LJ5d 3JCMb 1N9RA 5LJ5j 5GMKe 5GAOq 4M77A 5GAN5 4EMKB 4M75G 3HSBA 1KQ1A 5GAOl 2RA2A 1KQ2A 2E41A 5LJ3d 5DY9A 3AHUA 4XQ3A 3V8JA 4QVCA 4C8QG 3M4GA 2E65A 4PJOC 1Y96B 2DTOA 1MGQA 4M77C 4QVDA 5GAOn 4F7UG 1I81A 4M78C 2DZCA 2VXEA 2FB7A 3JCMg 4XTXA 4C8QB 1H641 3L2ZA 5LJ5f 4M7AA 3JCMJ 2DTIA 1I4K1 4PJOF 5GANh 3FJPA 5LJ3j 4M7DB 3RUXA 1WQWA 1HK9A 3JCMQ 5GAMd 2VXFA 2DZ9A 3JCMd 4PJOD 3JCMX
chains in the Genus database with same CATH superfamily
3I55T 2CUDA 1ZA2B 5IN1A 2CP5A 3JCMP 1K8AC 1IB8A 4XAXB 1QVFP 1OPKA 5LJ5g 1WZOA 2RQWA 4MDWA 3RNJA 4HCCA 1JJ2S 4FYXB 4C0DC 2DL3A 2EYXA 3M0TA 2YUQA 4L6V5 3MEAA 1NBEB 1M90C 2CUBA 3OQ5A 1SHFA 4E7ZA 1D0XA 2CP2A 1VA7A 4BACA 1Q81C 4C8QE 2E3IA 2EYZA 3BFMA 4KH1B 5CAIA 1RI9A 1ZHIA 4ZGJB 1VQOQ 4C5GA 2LQNA 1M1KR 2F1LA 4A63B 4WF2A 4FIBA 1WXBA 1VQ7A 1UE9A 3IQLA 4J8OA 1NJIC 1GRIA 2AZVA 2ZAEA 3J80E 3CCQQ 1ARKA 3TEEA 1YITQ 2D8JA 2K4YA 4ZGDB 2YWWA 5M9OA 3CXCA 2X35A 3CPWA 5LJ3f 3QYGB 3RR6A 1NLPC 2R5AA 2QG9B 2L5QA 1S72A 2XICA 4C5EA 2FPDA 2COWA 1KQSA 5LJ5d 1MHNA 3S6WA 4M75G 1KQ1A 2K9GA 2QTVA 5LJ3d 3AHUA 1JB0E 3PVQA 2XD0A 1VQ7T 3GLXA 5FLXE 1KD1R 2VXEA 4M7AA 3L2ZA 5LJ5f 2DYBA 2IIMA 2C06A 1K8AR 2DZ9A 3JCMd 2BIVA 2M02A 4RTUA 1I1JA 3FIFA 4J6WA 2V1QA 1EX4A 2RF0A 4EIKA 4LD9K 4DBHA 1BYMA 1TG0A 4MMLA 2EKOA 1N8RR 4M7DG 3FB9A 3QG1A 1YJWA 2BUDA 1K0XA 4ELYC 5CKEA 1DJ7B 1SG5A 5KYWA 3EHRA 3QYHB 1Q82U 1K9MC 4A4EA 3OBWA 2EW3A 4PK4A 1PD0A 4BI4A 2QQBA 4A4GA 2OAWA 4Y92A 1R8OB 2YRDA 1KD1C 1LVKA 2DVJA 2DXUA 2CSIA 4MDXA 3G4SQ 2H3JA 3JV3A 3CCET 3PE0A 1VYTA 2YUNA 4BE2A 2M0OA 2ENMA 2K6DA 1X01A 2E5QA 3M55A 5GAMe 2K57A 6AT1B 1K1ZA 5LJ3g 2GNCA 1QP2A 2RPNA 2G6FX 3SHWA 1MMGA 3OYDA 1Z9ZA 3V8LA 2CS7A 4MZMA 1GBRA 4FT4A 5GMKl 3G7ZA 2HQEA 2L2PA 3NTHA 1LNXA 2RHUA 5ECAA 3WVEB 4C0GA 2KRSA 4JPBW 3VYHB 3FRNA 5CKBA 2RHZA 1OOTA 3QSUA 2F5KA 2VGMA 3REBB 2RA2A 2PQWA 3OMGA 1QWEA 3EFOB 3EGDB 2PVOB 1B7TA 1M3BA 4RUGA 2R58A 1SPKA 1K9MR 4J9EA 4BE1A 1Q81R 4M7DB 1M3CA 1WFWA 1WQWA 4FYYB 3NMZC 1VQOT 1N8RC 4C8QC 2E6NA 2NUZA 3M54A 3CC7Q 2JVVA 4JRQA 3JCMf 4KH0B 2E5KA 4E47A 3JB9D 3TQ7P 5HKCA 1R0CB 1YI2T 3C95A 2Y90A 2VB6A 2XK0A 4XTYA 3GOXA 2Z0WA 1VQNQ 2COYA 2DFUA 3OYJA 3SWNA 1KQSS 4L5GA 2QK0A 3BE3A 3RKWA 1VQ4Q 4DBRA 2EBPA 3H41A 2XDDA 4M77F 4X1VA 3ZBDA 3L42A 5GAOr 4PJOB 2V26A 2GBQA 2RN8A 1B34A 2RQVA 3A8OB 1IGQA 4M75A 2FL7A 4E2FB 3OYGA 4BE0A 1QVGP 3CCST 1QVFA 1BCOA 1ZUUA 3O5ZA 1D1CA 2X3WD 3D7SB 5I2SA 3G6EA 4M7AG 5IHNA 4LUEA 2K5IA 2JMCA 2DM1A 2EGCA 1YIJA 4CRIA 3V7CA 2E10A 4JDSA 4PFOA 4A53A 1PNJA 2CYZB 1Y71A 2LP5A 2EJ9A 3M0SA 3C12A 2E1HA 3QWYA 5IHIA 5A0GA 1FMWA 4FM4B 1W6XA 4J9CA 4M7DA 3TSWA 4F7UB 2C0OA 1NPRA 3RBBB 5FWBA 4OMPA 2KEAA 1VUBA 1YIJQ 3H8ZA 3U23A 1CSKA 2ZCFB 3A8GB 2DIGA 2PNIA 3PNWC 4EPCA 2LCCA 1HSQA 2X3XD 3CC2Q 1B07A 9ATCB 3JCMJ 2CP3A 2VASA 1PRMC 3OYFA 4RTTA 1JJ2P 2RQTA 2VXFA 1FYNA 1WXUA 1OU9A 4OMOA 1VQ4A 4FT2A 4M78D 5KCOA 2C0TA 4EMKA 5GANg 1WNLA 1PM3A 2EJFA 3JB9H 4BY6B 4QT7A 5A0DA 4F14A 4M75D 1F1BB 1LPLA 2YDLA 4C92G 1YJNQ 1FMVA 1OX9A 4CC2A 5IAYA 2FPEA 4JRIA 2DLPA 3EGDA 3VJPA 2LNHB 2PUKB 5CKFA 3CCMT 1K73U 5DM7R 1ZSZB 1OYXA 4FSXA 4Y28E 1NEBA 3PFSA 4LN2A 2P84A 3MHXA 3SWNB 5AT1B 4X9DA 1UHFA 4OGCA 2CZ0B 1RAGB 2VV5A 2O4XA 2OAUA 2C0IA 1PSFA 3NPFA 3OYMA 4M7DF 2K79A 3EFSA 2F2VA 3QO3A 3ZL7C 3LWIA 1KD1U 2R5MA 3DB4A 3E9FA 1SRLA 1G3TA 1M2OA 4ZNXA 1YN8A 2J05A 2JN0A 3Q1JA 5FRMA 1ACMB 2RMOA 5EC7A 1M1GA 1KG1A 4A54A 3META 2LNVA 1QLYA 3GF5A 2VWFA 2I2LA 2RJEA 2RH2A 2DL7A 1PKTA 3OYKA 4X34A 3HFOA 2P4TA 4BB7A 1C6VX 1M2VB 1X6OA 1KC8R 3LLRA 2X9HA 3UT1A 1NEGA 2HBWA 4Z8AA 3FJ5A 2LCLA 3CCSQ 4VUBA 3MJXA 1W4SA 1IHVA 1AT1B 1WA7A 2GFUA 3V8JA 4C8QG 3QXEB 1YJWQ 4RTZA 1MV3A 1I81A 4M78C 3H9NA 2LJ3A 3L2VA 3RUXA 1WLPB 2JXBA 2OTJA 2EIFA 1FMKA 2H3EB 5CVIA 3G6ET 4M78E 4EMHA 3LW5E 5GAMf 2DO3A 3BW1A 3KBGA 3G4SA 4M75B 4B6MA 2MPXC 4A4HA 4XTZA 3CD6Q 4O6JA 4O5VA 3E2UA 3E9GA 3V7SA 3KUFA 3REAB 2P0QA 1WHLA 3CMEA 2RO0A 3MKDA 3CD6T 2BZYA 2LQKA 1D1AA 4GLKA 1TS9A 3EGUA 4M78A 4CC3A 3LH0A 2L3PA 2JM9A 2OTLT 2ZGWA 4OMLA 4M7DD 5CQYA 5GMKm 2QQRA 1AWOA 3VRYA 1TSFA 3CBOA 1K73C 2ESWA 4KUIA 5D6YA 1M90U 3A5ZB 4QKUA 4KRTA 2E64A 1UJYA 2LT1A 4IUQA 1E6HA 3HTRA 3S3NA 3CBMA 4J9BA 4JUVA 1A0NB 1MMDA 3CC7T 3QDFA 4AFQC 5FW9A 1M1FA 1UECA 1VIFA 1K8AU 4QVZA 4M7DC 1M90R 2AZSA 2CT4A 5GAOl 1KQ2A 2DX1A 2E41A 5KYXB 2KK4A 2JW4A 1OX8A 5KE3A 1V76A 2DTOA 1TWBA 1O75A 5EG2A 1SHGA 2ZPGB 3H6ZA 1WHKA 5LJ3j 2FZCB 4BD3A 5GAMd 1IGUA 3JCMX 2M51A 2XU8A 3MEVA 3UWNA 1QKWA 4M7AC 2K7AA 1PD1A 5KE2A 2ZPIB 3SD4A 3BDLA 2DNUA 3FLGA 3QKJA 2LTOA 3CCLT 4OVAA 1M8MA 1K9MU 1VQ6A 2QGFB 3I35A 1BI2A 5GAN4 3KFVA 1PHTA 3OY9A 4XU2A 2RJFA 1VIEA 3WXMB 4HCBA 3CCSA 4PJMA 5KYUA 3INZA 5LJ5h 4IUTA 4XTVA 2CZ6B 2M1HA 3G71A 2FYKA 1KHCA 2HDAA 3MEUA 2PVDB 1TUCA 2VC8A 5I22A 4M7AD 2YUOA 5CIUA 1YJWT 1YJ9T 2QGGA 2RB6A 1I07A 1IXDA 1UGSB 3CCEQ 2A37A 1BIBA 1TXQA 2MF2A 1YJNT 2CGHA 1M9SA 4AFSC 1T3SA 1QW1A 3ZFJA 2KXDA 4C0DB 2KGTA 3P8DA 3OW2P 1Y0MA 4M78B 2O9SA 3QJ6A 4C8QF 4PFZA 4FCYA 2P0KA 1JU5C 3HRUA 2JS2A 3ASKA 2HSEB 4HA8A 2VVKA 1YWPA 4GLMA 3UPUA 1VQ7Q 4C5HA 2D0QB 1N9RA 4R0KA 5GMKe 2ZPHB 4F17A 4IKFA 3HSBA 2KVQG 1PRLC 2JM8A 4XQ3A 2K3XA 1IRXA 2EQKA 2LZ6B 2A0FB 4JZ4A 3JCMQ 1OV3A 3G71T 2D9TA 4LDYA 4IUVA 2K3BA 2CH4W 1OEBA 1I8FA 1K76A 2KRMA 4DEYA 1X6GA 1NYGA 4XU1A 2RK1A 1RACB 2X4JA 3VS4A 2COZA 1RAIB 1WJRA 1VQMT 4AG1C 2E4HA 1SEMA 4IIOA 3EGXB 4KGZB 1QQJA 4X9CA 3P8BB 2OTJQ 4NL3A 3A8HB 3S3OA 4KUDK 2QTXA 3JSCA 4GY5A 3NTIA 4AG2C 3VS6A 1RUWA 3OBYA 2KI7A 4A4FA 3L1AA 3CC4T 4Y91A 4M7AF 1UGPB 2DTHA 1U5SA 2KSSA 2JMAA 3EHQA 1YP5A 4E7LA 1ZBJA 8AT1B 2GTOA 2KNBB 3I5RA 1M30A 4OF1A 4QW2A 2FVUA 2LC4A 2E12A 4GBQA 1M2VA 4C92D 1X75C 5KYUB 3N5BB 2O2OA 3FEOA 3CCQT 2LJ0A 2XI9A 3X28B 3F70A 4QQGA 2KYBA 2WACA 4D8KA 2QEXT 2A08A 3MO8A 5I11A 2CZ1B 1BB9A 2KT8A 1VQNA 4FL6A 3HKSA 1D0YA 2KQWA 4RMOA 3EAEA 2JS0A 5GAOm 3L2QA 5GAOq 3PIOA 1QCFA 2CT3A 3NHNA 5IXFA 1QVGS 1QVGA 2VUBA 3CCRA 4D6WA 3CMAQ 1MGQA 5GAOn 1WYXA 1JXOA 2LDMA 1H92A 3M0QA 2LQ8A 3ER0A 1RAFB 2DTIA 3QDRB 4OMFB 2HAXA 1UTIA 2QDYB 5D6XA 1YI2Q 2QEXA 2QQ9A 2XDPA 1Y7XA 3HFNA 4ESRA 1QWFA 2HNIA 1GFDA 1M4ZA 2P4RA 5A0LA 1QVPA 1YITA 3OYYA 2GF7A 2RI2A 2Y4YA 3EFRA 2EVRA 1AVZC 2QI2A 4RG8A 1MNDA 4OP0A 4MMKA 4PJOE 1G3YA 2DL5A 3OMCA 1WHHA 2V8IA 2CREA 1G3WA 4PL6A 1UGVA 2DMOA 3LWHA 2KAFA 4RTVA 4LDUA 4DBQA 4RG2A 3AT1B 2QXFA 2KBTA 2YHTA 5KYWB 4DBFA 2J6OA 1OI1A 4WTOB 2RJDA 2YLCA 1VYVA 2DKGA 2FPFA 5GANf 1Q81U 4J5YA 3C4SA 4R56A 1K0SA 2A3LA 5GAN8 2VGNA 3JB9I 4PJJA 5GAOp 1WHJA 3CCJT 2KMTA 1C0MA 2RQRA 3I5SA 3M56A 4M77G 2EKHA 2MWOA 5HK0A 1WJSA 4C92F 5GMKj 2V1RA 3PIPA 1UB4A 4M78F 3SFMA 5GANe 2PUOB 2KR3A 5IH2A 3VRZA 3LH5A 1WX6A 2BE9B 4JLIA 1YITT 4HVVA 5LL6S 1Q86R 4R55A 3CC4Q 1BCMA 1EFNA 2E65A 2ECZA 2NYSA 4LDVA 2GQVA 3JRZA 3DB3A 1I4K1 3EH1A 2SEMA 2RI3A 1VQLQ 2NWMA 3OYHA 2L8DA 5GJVB 2B86A 1GCPA 1UGQB 1ZUYA 4E7HA 1PSEA 3EG0A 2MYSA 3JB9J 2CP7A 1ZSGA 3CCRT 4IUUA 4KGVB 3CXCP 4RTYA 3C94A 4JJBA 3C0CA 2DE0X 3GPLA 1NE8A 1VQNT 4WCIA 3PGGA 3RESA 1J3TA 1RLQC 3X26B 2QAZA 1RABB 3NGPA 1Y57A 2DBKA 2IVWA 3FDRA 2DL8A 5C6SA 1WQ7A 4PKCC 4HCZA 4C92A 1HXDA 2L3RA 2LJ1A 5GAN3 3E1SA 2OTLQ 2ZPBB 2GFAA 4NS5A 1TUDA 3EH2A 1E6GA 4RTWA 5DLOA 2RD1A 1LCKA 2YUPA 4UC4A 2NUTA 4NL2A 3CC4A 1TH7A 2QQAA 4AT1B 1VQ8Q 3CXCS 2BE7D 1VOMA 3KXTA 3QPHA 5KYYA 1Y96A 2XG8D 5J3BA 1KIKA 4XTUA 3DLLA 5HY6A 2LMJA 3CCLA 1ZSZA 3I56A 5FU7C 1SSHA 1BIAA 2VYTA 3I56T 2R57A 1WHMA 4HT9A 2X4YA 4DOVA 3OYBA 2JZ2A 4OB3B 2DD5A 3HP9A 4IURA 1KHIA 2MCNA 3A8LB 2MK5A 2F69A 2ABLA 1YHQT 2DZCA 1QCOA 1ZA1B 2KROA 5FROA 3FJPA 2HKQB 3VV0A 1HK9A 2PTKA 3EG1A 3VS5A 2KDSA 3LYIA 2EQMA 3CCJQ 1SSFA 4DOWA 1VQ5A 3A8MB 2JT4A 1VQ8A 2QQSA 4F7UE 1M8VA 4XK8E 3SWNC 3L2UA 1W2BA 5IHKA 4C92B 2W10A 3M4YA 1EZZB 4N0AA 2RNAA 2CZ7B 2MI6A 1UDLA 2HD0A 1Q7YC 1P92A 3UF4A 3CC2T 1NG2A 1BI0A 1AWJA 2GCXA 2IPOB 1SKUB 4PFPA 5GANj 1JEGA 2QYZA 4MZPA 3QZ5B 1UHCA 2D1XA 2D8HA 5IT9E 4E7KA 4MZTA 3QIIA 1V1CA 2KT1A 4QQDA 3LX7A 2QA4A 5CO7A 2MWPA 3OYNA 1X6BA 3JB9G 3PVLA 1YJ9A 3M58A 3MP6A 4N4HA 2Y4XA 1ABQA 1K4US 3OW2S 4EMKC 1ZSZC 3JCMW 4ELZC 1TOVA 4M7AB 1YNZA 4RKUE 5CK9A 4K11A 2FO0A 1K73R 2AKLA 3NFCA 2JOYA 2DBMA 2E6ZA 1N5ZA 3CCJA 4BY6C 3BY7A 1GXIE 3CCUT 3OS5A 1VQ9Q 1NPPA 2ROLA 1OU8A 2HBPA 2JJ9A 2O01E 3M4GA 3CCEA 5I2MA 1TTHB 4PJOF 2LQWA 2ATCB 1BI3A 2DAQA 3MPUB 1JQQA 2EQUA 2HZYA 4E7SA 5J26A 2FZGB 2DETA 5GAMh 1KJWA 2AIRB 1BK2A 5FU7B 1G8XA 4M75C 4M75E 3I55A 1ZUKA 4DEXA 4P5NA 2DRMA 3I56Q 3UATA 3EG9B 2FRYA 1JO8A 5KYXA 1YWOA 2DL4A 4C8QD 3OYIA 2KY9A 2AHJB 3CPWS 3GNGA 2YRVA 2DILA 2M16A 4OB2B 3CMAA 4CC7A 1HJDA 3HHTB 2RJCA 1KQSP 3RDVA 1JBMA 2O9VA 2EFIA 2DD4A 3JCMV 1U1TA 2DEQA 4CI0C 1ZLMA 2DF6A 2B8AA 1BBZA 1OZ2A 4NOYA 1RLPC 3QWXX 4M77E 3T9NA 3CMET 1MNEA 1O9SA 3RKYA 5GJWB 2RHXA 4J9DA 4ORZA 4V2SA 2GGRA 2DVEA 4J7FA 2CH4A 2L89A 3EFOA 3G1JA 1VYUA 4RCCA 5GAN2 1YBYA 4ME7A 1OZ3A 1VQKT 3SEMA 1UUEA 1W1FA 3EG3A 1M1KC 4JJDA 1VQKQ 4LNPA 1RAEB 2AKKA 2DERA 4LE9A 1ABOA 5CKDA 5LJ5j 2GQIA 5CR2A 1IZ6A 1GCQA 2BZXA 2JUFA 5DY9A 1Y96B 1Y07A 4M77C 3JCMg 1RAHB 3EG9A 4OMQA 1FXXA 3CCVT 1YCSB 2OTJT 1ZBXA 4PLIA 1XTDA 4PLLA 4PJOD 3VS0A 2EAYA 4PNOA 5C0MA 4C8QA 4B9WA 3MCAB 2HL3A 8ATCB 1H8KA 1NZ9A 1N9SA 2OX7A 4LDWA 3M57A 3PT9A 3S3MA 1QCNA 1K9AA 4ZN3A 5CKHA 2J06A 2O31A 1T0JA 1U3OA 4J7IA 1D1BA 3G6EQ 1TUGB 4FYVB 3GNFB 1M27C 4II1A 2RI5A 5FU6B 3CPWP 4XU3A 3V8KA 5A2QE 1I5OB 2D0NA 4JJCA 2EYYA 4HT8A 1MUZA 4CC4B 1U8RA 2YT6A 3ZEHA 1FWZA 1WI7A 1WPYA 3OSSC 1AZGB 1AZEA 1RL2A 3QHSA 2QA4Q 3H0FA 5FRNA 2RQUA 4RTXA 2OJ2A 1N6AA 5L8RE 4OMNA 2MAMA 1S1NA 1IO6A 4M78G 1N27A 1M1KU 2O88A 1T0HA 1VQ6Q 2LT4A 4PJOG 3GP8A 4Z89A 3QJYA 1NM7A 4M4ZA 4FW1A 2NUPA 1PWTA 3TSZA 4FU6A 2K5LA 2MIOA 2HCKA 3JCMb 4J9GA 4EMKB 2FHDA 2MOXA 1HD3A 4QVDA 1VQ4T 4N4GA 4XTXA 1WGSA 2HL5C 1G2BA 3CQTA 1YJNA 1X2QA 1Q82R 4E6RA 3O8VA 3RERA 3OS0A 5HK3A 1QVFS 1X69A 1C1AA 3LGLA 3EG2A 5GAN6 2FG0A 1OULA 3VU3C 2EWNA 2LRQA 3M0PA 4Z02A 5LJ3e 3VKIA 4QQ6A 2EQIA 4F7UF 4BDYA 3P8HA 3OYCA 2SRCA 1VQPA 1RADB 1D3BB 2F2XA 4ZN1A 4M7DE 2EQJA 3JCMe 3RIRA 4XTWA 4C92C 2M9UA 1B3QA 2LCSA 5CCAA 3SDZA 1Q82C 1Z9QA 3FC3A 3VYGA 1YIJT 2EJGA 2XDBA 2F2WA 4F16A 2NUPB 3OB9A 2A28A 3RMSA 2XIDA 5LJ5e 1JRIA 2YLBA 1XJWB 5IXBA 2EPDA 4KBMB 4TVRA 2YRCA 4DQ2A 4JRPA 4BUGA 2RM4A 3TVTA 2K2MA 3TU4K 3UA6A 3VUBA 1QP3A 3CCUA 2ZPEB 2EYWA 3CCVA 2I0NA 3BDUA 2XHCA 3H0IA 2DRKA 3QUIA 4C5IA 1YI2A 2A36A 1M5Q1 5HCKA 4HVUA 3CPFA 4XU0A 1BKBA 4M77A 2NLUA 5GAN5 2HEQA 3E19A 2IG0A 3J7AF 4OMMA 1V29B 2DXBA 3X20B 4HKEA 1X27A 2KYMA 1WDXA 1VQOA 2BZ8A 3QBYA 4J83A 2V8KA 1KC8U 2OTLA 3X25B 2RHIA 5L23A 3M0RA 2V8JA 3X24B 1VQKA 3NTKA 1WXTA 2K2VA 2P0PA 5J39A 1AWXA 1BU1A 2L3SA 4C0FA 1U1SA 1TU0B 1PG5B 2JNGA 2EGAA 3HRSA 3OS1A 3SB2A 4PJOA 3M9QA 3M0UA 5GMKh 3G4ST 2QASA 4IIMA 4ZTJA 3R6NA 3ULRB 4N4IA 1UEBA 4E7JA 3TCJA 1E7OA 2J6KA 5CQXA 2BTTA 4E7IA 3DLMA 1FX7A 1KK7A 3CCMQ 1YCYA 1NLOC 2L0AA 1R77A 1YFNA 1VQ8T 4L59A 1VQ5T 3JB9F 3CCVQ 1UFFA 3MP1A 4M7AE 4KGXB 1D0ZA 4N0AC 4A4KA 1JJ2A 1VQ5Q 2KRNA 3HL8A 1VQLT 1VQMQ 2M0YA 1R0BG 1WIEA 4J6XA 1B34B 4AFUC 1HYOA 4OB0B 3TREA 3VUZA 1T3LA 2HMAA 1VQLA 1VQPQ 2QA4T 2K3YA 2EGEA 3LGFA 1MV0B 1KFZA 1IREB 2G3RA 4YTLA 1H3HA 2LX9A 2DIQA 1CKAA 3CMEQ 2DJQA 1MMNA 1VQMA 1I0CA 2WSEE 2ED1A 4F7UG 2NUTB 3DKMA 4C8QB 4BI3A 3M53A 1X2KA 4FW2A 3VS7A 4ATOA 2LX7A 4F04B 5KH6A 5D6WA 4JS4A 5KCHA 1OQKA 2J6FA 4C92E 1S72Q 1EIFA 1XOVA 2E70A 3OSVA 1SF9A 2YSQA 1PCXA 1UGRB 3L2RA 2BKDN 2F5TX 3CCMA 3OW2A 4PJNA 3VS1A 4ANJA 1Q95G 3CCRQ 1W2BS 1S72T 3H0HA 4HCKA 2HQXA 2DYIA 2DJZA 4M77D 1Q86U 4JJNK 1M3AA 2AK5A 4LD6A 4HVWA 4Z88A 2KE9A 1GBQA 1VQ9A 2FEIA 2DEUA 2CSQA 3CBPA 1NJIR 4JLGA 3RKXA 1KSWA 5KYYB 3PTAA 4BDZA 5D7UA 3GIBA 3CC2A 1RI0A 1G5VA 2AT1B 2X4WA 2L3QA 4J9HA 4AMCA 4ZGEB 4KT0E 3A1PA 3MEWA 4J9FA 3HPWA 4Q5WA 1AEYA 1D3BA 1W2BP 1YHQQ 2MMPA 2LVMA 1NJIU 1H3ZA 1N8RU 1QMCA 4JRKA 1ZX6A 1Q7YU 2RK2A 2CP0A 4J9IA 1LJOA 2O4XB 1UG1A 2PVGB 1I5LA 2X4XA 2CDTA 2DK3A 4EMGA 1UJ0A 1WHGA 3RMQA 1YHQA 3G71Q 4ZTFA 2PZ1A 2ZZDA 1YJ9Q 4BI8B 3OYEA 2WSFE 1SRMA 1BI1A 4QVCA 4PJOC 2VKNA 4KULA 3OS2A 2FB7A 4AFZC 1GL5A 1H641 1VQ6T 5GANh 3M5AA 3OYAA 3MP8A 2EYQA 4JZ3A 2ROTA 3UDCA 1MMAA 1XQHA 2ED0A 2JTFA 3OYLA 2W0ZA 4LXCA 1VQPT 5DLQE 4B9XA 3URGA 4M77B 3V7RA 3L2WA 1ZQ1A 4OB1B 5FWCA 4M75F 2HQHA 1AHJB 3PMIA 2PU9B 3CCLQ 4RCBA 4FSSA 1KC8C 5GANd 2CP6A 1QKXA 2GTJA 3JAME 2JTMA 2CKKA 2OI3A 1OPLA 2WSCE 5I21A 1GCQC 2ZPFB 3JCMc 1PC0A 3JCMh 1WJQA 2QEXQ 4HXJA 3ME9A 1AWWA 4J6YA 3CC7A 2D6FA 1Q86C 5AYFA 4C0ZA 5GAN7 3R6OA 2HSPA 3VS3A 1NYFA 5LJ3h 2H8HA 3CCUQ 1VQ9T 2FRWA 5GMKi 4F7UA 2XKOC 2E3HA 1W70A 3GBQA 1X43A 3OA6A 3J81E 1LOJA 5GAMj 4OGEA 1PKSA 3EGXA 1GFCA 4JS5A 2JTEA 3WVDB 2DXTA 2X51A 2FZKB 4PJLA 4IUPA 5KYNA 5FU6C 1JXMA 5GAMg 3CD6A 4FYWB 3QZ9B 3I9QA 1XNIA 3A98A 3CMAT 2DA9A 1AD5A 2YXYA 1G83A 2A7YA 1IHWA 1AOJA 1Q7YR 3UA7A 3PMTA 4EDUA 2DXCA 3I55Q 3CCQA 2RHYA 3THKA 2HKNA 1CKBA 3VS2A 4DA4A 1G3SA 3CEYA 2QDLA 2XMFA 1U06A 2DPPB 7AT1B 4LUDA 3HRTA 4D8DA 1RAAB 2K5FA 1D09B 4LDXA 3M59A 2J7IA 2KXCA
chains in the Genus database with same CATH topology
3I55T 1PSEA 3O8VA 3JB9J 3RERA 3OS0A 3CCRT 5IN1A 4IUUA 4M78E 5HK3A 3JCMP 1K8AC 1QVFS 4XAXB 4EMHA 3LGLA 5GAN6 3C94A 3LW5E 5GAMf 5LJ5g 3GPLA 2DO3A 3BW1A 1NE8A 3KBGA 3VU3C 2EWNA 3G4SA 2LRQA 4M75B 4MDWA 4Z02A 4HCCA 4A4HA 5LJ3e 1VQNT 3VKIA 3PGGA 4QQ6A 4XTZA 3RESA 4F7UF 1JJ2S 4BDYA 4C0DC 3P8HA 4O6JA 3OYCA 3X26B 1VQPA 4O5VA 1D3BB 4L6V5 3MEAA 1M90C 4ZN1A 3OQ5A 4M7DE 2EQJA 2IVWA 3RIRA 3JCMe 4XTWA 4BACA 3E9GA 1Q81C 3FDRA 2M9UA 3V7SA 4C92C 4C8QE 3BFMA 5CCAA 3KUFA 5C6SA 3SDZA 2P0QA 1WQ7A 5CAIA 3CMEA 4PKCC 2RO0A 1Q82C 3FC3A 3CD6T 1ZHIA 4ZGJB 4HCZA 3VYGA 2LQKA 4C92A 1HXDA 2L3RA 5GAN3 4GLKA 3E1SA 1YIJT 2ZPBB 4C5GA 2EJGA 2GFAA 4NS5A 2XDBA 4M78A 3LH0A 2OTLT 2ZGWA 3OB9A 4WF2A 4FIBA 3RMSA 2XIDA 4M7DD 5CQYA 1VQ7A 5LJ5e 4J8OA 5GMKm 5DLOA 2QQRA 2RD1A 1JRIA 1NJIC 4UC4A 3CBOA 2YLBA 1K73C 4NL2A 4KUIA 3CC4A 1TH7A 2QQAA 5D6YA 3J80E 4KBMB 3CXCS 4TVRA 1M90U 3A5ZB 3TEEA 4DQ2A 3KXTA 2E64A 3QPHA 2K4YA 4ZGDB 4BUGA 4JRPA 1Y96A 2LT1A 4IUQA 2XG8D 5J3BA 4XTUA 3DLLA 5M9OA 2RM4A 5HY6A 3CXCA 3S3NA 3CBMA 3CCLA 3I56A 5FU7C 4JUVA 3TU4K 3VUBA 3CCUA 1BIAA 1QP3A 2VYTA 2X35A 3I56T 2ZPEB 2R57A 3CPWA 3CCVA 3CC7T 3BDUA 2X4YA 2XHCA 3QYGB 5LJ3f 4HT9A 3QUIA 2R5AA 4C5IA 1M1FA 1VIFA 4DOVA 1YI2A 2L5QA 1K8AU 1M5Q1 4QVZA 3OYBA 2XICA 4C5EA 1S72A 4M7DC 3CPFA 2JZ2A 4OB3B 1KQSA 2DD5A 4XU0A 1BKBA 5LJ5d 1MHNA 3HP9A 3S6WA 4M77A 2NLUA 5GAN5 4M75G 4IURA 1KQ1A 1KHIA 3E19A 2IG0A 2E41A 3A8LB 5LJ3d 5GAOl 2KK4A 1JB0E 1KQ2A 1V29B 3AHUA 3J7AF 2XD0A 2F69A 2DXBA 3X20B 4HKEA 1VQ7T 5KE3A 2DTOA 1YHQT 1O75A 3GLXA 5FLXE 1VQOA 2DZCA 2VXEA 3QBYA 4J83A 5EG2A 2V8KA 2ZPGB 3H6ZA 3L2ZA 5LJ5f 1KC8U 2OTLA 5FROA 3X25B 3FJPA 5LJ3j 2RHIA 3VV0A 2C06A 1HK9A 2V8JA 4BD3A 5GAMd 3X24B 2DZ9A 1VQKA 3JCMd 2BIVA 3NTKA 2KDSA 2XU8A 3JCMX 3MEVA 3LYIA 4M7AC 5KE2A 2EQMA 2ZPIB 3SD4A 1SSFA 2K2VA 3BDLA 4DOWA 3FIFA 3A8MB 3FLGA 4J6WA 1VQ5A 2QQSA 4F7UE 1VQ8A 1M8VA 3QKJA 2LTOA 4XK8E 2P0PA 5J39A 3SWNC 3CCLT 4OVAA 4LD9K 3L2UA 4C0FA 1U1SA 1K9MU 1BYMA 4MMLA 1VQ6A 3G6ET 1W2BA 2EKOA 4M7DG 3FB9A 3QG1A 2JNGA 1BI2A 4C92B 3HRSA 1YJWA 5GAN4 3M4YA 4N0AA 3OS1A 2BUDA 3OY9A 4ELYC 5CKEA 3SB2A 1DJ7B 4XU2A 2CZ7B 2MI6A 3QYHB 2RJFA 4PJOA 1Q82U 1VIEA 3M9QA 5GMKh 1K9MC 3G4ST 3WXMB 4A4EA 2HD0A 3CCSA 4HCBA 3OBWA 1Q7YC 3INZA 1P92A 4BI4A 5LJ5h 4ZTJA 4IUTA 4XTVA 3CC2T 2QQBA 2CZ6B 1UEBA 2M1HA 4N4IA 4A4GA 2FYKA 1KHCA 3G71A 3MEUA 2PVDB 2VC8A 3TCJA 4E7JA 5CQXA 4M7AD 5CIUA 4E7IA 1BI0A 1R8OB 3DLMA 1FX7A 1YJWT 2GCXA 1YJ9T 1YCYA 2RB6A 1KD1C 1UGSB 2DXUA 5GANj 4MDXA 1BIBA 4MZPA 2H3JA 3CCET 2MF2A 1YJNT 3QZ5B 1VQ8T 4L59A 1VQ5T 2CGHA 3JB9F 1M9SA 5IT9E 1QW1A 3ZFJA 4BE2A 2M0OA 3MP1A 4E7KA 4MZTA 4C0DB 3QIIA 4QQDA 3LX7A 1X01A 2E5QA 3P8DA 2QA4A 4M7AE 4M7AA 5CO7A 2MWPA 3OYNA 3M55A 5GAMe 2K57A 5LJ3g 4N0AC 1QP2A 3JB9G 4M78B 4A4KA 1JJ2A 1YJ9A 3QJ6A 3OYDA 4C8QF 3HL8A 3M58A 3V8LA 2CS7A 3MP6A 1VQLT 4N4HA 2Y4XA 2P0KA 4MZMA 4J6XA 3OW2S 1B34B 3HRUA 4FT4A 4EMKC 3JCMW 5GMKl 3G7ZA 4ELZC 3ASKA 4M7AB 2HQEA 4OB0B 3TREA 3VUZA 4HA8A 4RKUE 5CK9A 1VQLA 3NTHA 1LNXA 2RHUA 2QA4T 2K3YA 3NFCA 3WVEB 2JOYA 4C0GA 3UPUA 2E6ZA 4C5HA 3LGFA 3VYHB 3FRNA 5CKBA 2RHZA 2D0QB 3CCJA 4BY6C 3BY7A 1GXIE 3CCUT 1IREB 2G3RA 3OS5A 3QSUA 1N9RA 5GMKe 4YTLA 2ZPHB 2LX9A 2DIQA 1NPPA 4IKFA 3HSBA 2KVQG 2F5KA 2VGMA 2RA2A 2HBPA 4XQ3A 2K3XA 1VQMA 2O01E 2PQWA 3OMGA 3M4GA 2EQKA 3CCEA 2PVOB 2WSEE 4F7UG 3DKMA 5I2MA 4C8QB 4BI3A 2R58A 3M53A 4PJOF 4BE1A 4M7DB 1WQWA 1BI3A 2DAQA 2EQUA 3JCMQ 4ATOA 3G71T 5J26A 4LDYA 4IUVA 5D6WA 5KH6A 1VQOT 4JS4A 5GAMh 5KCHA 4C8QC 4C92E 2E6NA 1N8RC 3M54A 1EIFA 5FU7B 1XOVA 2JVVA 2E70A 1I8FA 4M75C 3OSVA 4JRQA 3L2RA 1UGRB 2BKDN 2F5TX 4M75E 3CCMA 3OW2A 3JCMf 3I55A 4E47A 4XU1A 4P5NA 2RK1A 1W2BS 3JB9D 5HKCA 1S72T 2X4JA 1YI2T 3C95A 1WJRA 1VQMT 2Y90A 2HQXA 4X9CA 2XK0A 3P8BB 2DJZA 4M77D 3A8HB 4XTYA 4NL3A 3GOXA 3S3OA 1Q86U 3OYJA 4JJNK 3SWNA 1KQSS 4L5GA 4LD6A 4C8QD 3OYIA 3RKWA 4KUDK 2QTXA 3JSCA 2XDDA 2KY9A 4M77F 4GY5A 1VQ9A 3NTIA 3ZBDA 3L42A 2AHJB 3CPWS 5GAOr 3CBPA 3OBYA 4PJOB 3GNGA 4JLGA 3L1AA 3RKXA 2YRVA 2M16A 4A4FA 4OB2B 3CC4T 3PTAA 4Y91A 3CMAA 4BDZA 4M7AF 1UGPB 3GIBA 1B34A 3CC2A 1RI0A 2RJCA 3A8OB 2DTHA 3HHTB 1JBMA 2FL7A 4M75A 3OYGA 4BE0A 1G5VA 2X4WA 2KSSA 3CCST 2EFIA 2DD4A 4ZGEB 1QVFA 3JCMV 4KT0E 1U1TA 2DEQA 4CI0C 3MEWA 4E7LA 3HPWA 5I2SA 2B8AA 3G6EA 4M7AG 1OZ2A 2K5IA 4Q5WA 1D3BA 1YIJA 4CRIA 3V7CA 4NOYA 2E10A 2MMPA 4JDSA 2LVMA 4A53A 4M77E 4OF1A 4QW2A 2FVUA 3T9NA 3CMET 1N8RU 2LC4A 1NJIU 1H3ZA 2E12A 2CYZB 4JRKA 1O9SA 3RKYA 1Y71A 1Q7YU 2RHXA 2EJ9A 4V2SA 3C12A 4C92D 1X75C 2DVEA 2RK2A 4J7FA 2L89A 2E1HA 3N5BB 3FEOA 4RCCA 3CCQT 1LJOA 5GAN2 2O4XB 2XI9A 1YBYA 4ME7A 5A0GA 1OZ3A 4FM4B 3F70A 3X28B 4QQGA 2PVGB 1VQKT 2WACA 4M7DA 1I5LA 1M1KC 2QEXT 4F7UB 1NPRA 2X4XA 2DK3A 3MO8A 2CZ1B 1VQNA 4EMGA 1VUBA 4FL6A 3HKSA 2KQWA 3RMQA 4RMOA 1YHQA 4ZTFA 3EAEA 3H8ZA 5CKDA 5GAOm 2ZCFB 3A8GB 5LJ5j 5GAOq 2ZZDA 3PIOA 3L2QA 2DIGA 5CR2A 1IZ6A 4BI8B 3PNWC 4EPCA 3OYEA 1QVGS 1QVGA 2WSFE 2JUFA 5DY9A 2VUBA 1BI1A 3CCRA 2LCCA 4QVCA 4D6WA 4PJOC 1Y96B 1Y07A 1MGQA 4M77C 2LDMA 5GAOn 4KULA 3OS2A 2LQ8A 2FB7A 3ER0A 3JCMg 1H641 1VQ6T 3JCMJ 2DTIA 5GANh 3M5AA 3OYAA 1FXXA 3MP8A 3QDRB 3CCVT 4OMFB 2EYQA 3OYFA 2OTJT 2HAXA 1ZBXA 4PLIA 1XTDA 2QDYB 2VXFA 5D6XA 3UDCA 4PLLA 4PJOD 1VQ4A 1XQHA 4FT2A 2EAYA 2JTFA 4M78D 4PNOA 2QEXA 3OYLA 2QQ9A 5C0MA 5KCOA 4C8QA 1VQPT 5DLQE 4B9XA 3URGA 2XDPA 4EMKA 1Y7XA 4M77B 3HFNA 4B9WA 5GANg 2HNIA 1M4ZA 3MCAB 1WNLA 5A0LA 1QVPA 3V7RA 3L2WA 1YITA 1ZQ1A 3OYYA 4OB1B 4M75F 2GF7A 1NZ9A 1N9SA 2RI2A 2Y4YA 1AHJB 3EFRA 2EJFA 2PU9B 3PMIA 4LDWA 4RCBA 4BY6B 3JB9H 1KC8C 5GANd 3M57A 3JAME 3PT9A 5A0DA 3S3MA 2JTMA 4M75D 2QI2A 4C92G 4ZN3A 4RG8A 2CKKA 5CKHA 2WSCE 4J7IA 5IAYA 5I21A 4OP0A 2ZPFB 4JRIA 3JCMc 3VJPA 2PUKB 4MMKA 5CKFA 3JCMh 3GNFB 1WJQA 4II1A 3CCMT 4PJOE 1G3YA 3OMCA 5DM7R 1K73U 3ME9A 1OYXA 2RI5A 2V8IA 4J6YA 5FU6B 3CC7A 2D6FA 4FSXA 4XU3A 4Y28E 3V8KA 5A2QE 1Q86C 1G3WA 5AYFA 4C0ZA 4PL6A 3PFSA 5GAN7 3R6OA 4HT8A 3MHXA 3LWHA 2KAFA 3SWNB 4LDUA 4X9DA 4RG2A 5LJ3h 4OGCA 1U8RA 2CZ0B 2QXFA 3ZEHA 2VV5A 1FWZA 2O4XA 2OAUA 3OYMA 1PSFA 4M7DF 1WPYA 1VQ9T 2YHTA 3OSSC 3EFSA 3QO3A 5GMKi 3LWIA 1KD1U 2R5MA 4F7UA 3DB4A 3E9FA 1G3TA 1OI1A 1RL2A 3QHSA 2RJDA 2YLCA 2JN0A 2DKGA 1Q81U 5GANf 3Q1JA 4J5YA 5FRMA 3C4SA 4R56A 1M1GA 1KG1A 2XKOC 3META 2LNVA 4A54A 5FRNA 2A3LA 5GAN8 3GF5A 3OA6A 2I2LA 2RJEA 2VGNA 1N6AA 5L8RE 1LOJA 5GAMj 4OGEA 5GAOp 2MAMA 2RH2A 3JB9I 3J81E 4JS5A 3CCJT 3OYKA 2KMTA 4X34A 3HFOA 4M78G 3WVDB 2DXTA 2P4TA 1N27A 3M56A 4M77G 5CVIA 1M1KU 2LT4A 2MWOA 4IUPA 4PJOG 3QJYA 5HK0A 3GP8A 5FU6C 1WJSA 4C92F 5GMKj 5GAMg 3CD6A 4BB7A 3PIPA 1UB4A 1X6OA 3QZ9B 4FU6A 4M78F 2K5LA 3SFMA 3LLRA 3UT1A 5GANe 4E7HA 1XNIA 2PUOB 3CMAT 2LCLA 2A7YA 4JLIA 4VUBA 1W4SA 3PMTA 3JCMb 1YITT 5LL6S 4R55A 4EDUA 4EMKB 2DXCA 3CCQA 2GFUA 2FHDA 2RHYA 3V8JA 4C8QG 2E65A 3QXEB 4QVDA 4DA4A 1I81A 4LDVA 4M78C 1VQ4T 1G3SA 2GQVA 3CEYA 3DB3A 3JRZA 4N4GA 4XTXA 1WGSA 1I4K1 2DPPB 3HRTA 3L2VA 1YJNA 3RUXA 2RI3A 3OYHA 2OTJA 2L8DA 2K5FA 2EIFA 1UGQB 4LDXA 3M59A 2D9TA 3UWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAY A;  5GAM h;  4M78 D;  4PNO A;  4C8Q C;  4C92 E;  4M7A C;  3JB9 J;  3RER A;  4C8Q A;  3FIF A;  1I8F A;  4J6W A;  4M78 E;  4M75 C;  4EMK A;  4F7U E;  3JCM P;  4M77 B;  1M8V A;  3HFN A;  4EMH A;  3SWN C;  2HNI A;  4M75 E;  5GAN 6;  5GAN g;  1WNL A;  3JCM f;  3V7R A;  1U1S A;  5GAM f;  5LJ5 g;  3BW1 A;  4MML A;  4XU1 A;  4M75 F;  3VU3 C;  4M7D G;  1N9S A;  2EWN A;  3JB9 D;  3FB9 A;  3EFR A;  2EJF A;  4M75 B;  4C92 B;  3JB9 H;  4RCB A;  5GAN 4;  5GAN d;  5LJ3 e;  4N0A A;  3PGG A;  4M75 D;  2Y90 A;  4XTZ A;  4C92 G;  3RES A;  4F7U F;  3SB2 A;  4X9C A;  4XU2 A;  4PJO A;  2DJZ A;  5GMK h;  5I21 A;  4M77 D;  4OP0 A;  4XTY A;  4NL3 A;  4JRI A;  3JCM c;  3SWN A;  3INZ A;  1D3B B;  4MMK A;  3JCM h;  5LJ5 h;  4C8Q D;  3RKW A;  4XTV A;  2QTX A;  4PJO E;  4M77 F;  4M7D E;  2FYK A;  3JCM e;  3RIR A;  2VC8 A;  4J6Y A;  4XTW A;  4M7A D;  3V7S A;  4C92 C;  4C8Q E;  4XU3 A;  3V8K A;  3BFM A;  5GAO r;  4PJO B;  1YCY A;  1WQ7 A;  2RB6 A;  3L1A A;  3RKX A;  5CAI A;  5GAN 7;  4HT8 A;  4Y91 A;  2DXU A;  4M7A F;  3SWN B;  5GAN j;  3GIB A;  4C92 A;  1B34 A;  4X9D A;  1BIB A;  1HXD A;  5LJ3 h;  2DTH A;  4M75 A;  1JBM A;  5GAN 3;  2EJG A;  4M7D F;  4M78 A;  1WPY A;  2YHT A;  3EFS A;  2CGH A;  3JB9 F;  2ZGW A;  3JCM V;  1U1T A;  2DEQ A;  3QO3 A;  4WF2 A;  5GMK i;  4F7U A;  4M7D D;  4M7A G;  5LJ5 e;  3QHS A;  5GMK m;  2YLC A;  3JB9 G;  4M7A E;  2JN0 A;  1X01 A;  1D3B A;  2DKG A;  2RD1 A;  5GAN f;  1JRI A;  3V7C A;  4J5Y A;  4NOY A;  2E10 A;  2YLB A;  4A54 A;  5GAM e;  2K57 A;  4NL2 A;  4M77 E;  4A53 A;  4N0A C;  5LJ3 g;  2I2L A;  1TH7 A;  4M78 B;  5GAN 8;  3JB9 I;  5GAO p;  1LOJ A;  4JRK A;  5GAM j;  3RKY A;  4C8Q F;  2EJ9 A;  3V8L A;  4DQ2 A;  4V2S A;  2E64 A;  3HFO A;  4M78 G;  4C92 D;  2DXT A;  2DVE A;  4M77 G;  1Y96 A;  4J6X A;  1B34 B;  2E1H A;  4PJO G;  4EMK C;  3JCM W;  5GMK l;  4RCC A;  4XTU A;  2RM4 A;  1LJO A;  5GAN 2;  4M7A B;  4C92 F;  5GMK j;  5GAM g;  4JUV A;  1BIA A;  4HA8 A;  4M7D A;  1LNX A;  1I5L A;  4M78 F;  4F7U B;  5GAN e;  3BDU A;  4HT9 A;  5LJ3 f;  3QUI A;  4EMG A;  1M5Q 1;  4M7D C;  4JLI A;  3BY7 A;  4XU0 A;  5GAO m;  3QSU A;  5LJ5 d;  3JCM b;  1N9R A;  5LJ5 j;  5GMK e;  5GAO q;  4M77 A;  5GAN 5;  4EMK B;  4M75 G;  3HSB A;  1KQ1 A;  5GAO l;  2RA2 A;  1KQ2 A;  2E41 A;  5LJ3 d;  5DY9 A;  3AHU A;  4XQ3 A;  3V8J A;  4QVC A;  4C8Q G;  3M4G A;  2E65 A;  4PJO C;  1Y96 B;  2DTO A;  1MGQ A;  4M77 C;  4QVD A;  5GAO n;  4F7U G;  1I81 A;  4M78 C;  2DZC A;  2VXE A;  2FB7 A;  3JCM g;  4XTX A;  4C8Q B;  1H64 1;  3L2Z A;  5LJ5 f;  4M7A A;  3JCM J;  2DTI A;  1I4K 1;  4PJO F;  5GAN h;  3FJP A;  5LJ3 j;  4M7D B;  3RUX A;  1WQW A;  1HK9 A;  3JCM Q;  5GAM d;  2VXF A;  2DZ9 A;  3JCM d;  4PJO D;  3JCM X; 
#chains in the Genus database with same CATH topology
 3I55 T;  2CUD A;  1ZA2 B;  5IN1 A;  2CP5 A;  3JCM P;  1K8A C;  1IB8 A;  4XAX B;  1QVF P;  1OPK A;  5LJ5 g;  1WZO A;  2RQW A;  4MDW A;  3RNJ A;  4HCC A;  1JJ2 S;  4FYX B;  4C0D C;  2DL3 A;  2EYX A;  3M0T A;  2YUQ A;  4L6V 5;  3MEA A;  1NBE B;  1M90 C;  2CUB A;  3OQ5 A;  1SHF A;  4E7Z A;  1D0X A;  2CP2 A;  1VA7 A;  4BAC A;  1Q81 C;  4C8Q E;  2E3I A;  2EYZ A;  3BFM A;  4KH1 B;  5CAI A;  1RI9 A;  1ZHI A;  4ZGJ B;  1VQO Q;  4C5G A;  2LQN A;  1M1K R;  2F1L A;  4A63 B;  4WF2 A;  4FIB A;  1WXB A;  1VQ7 A;  1UE9 A;  3IQL A;  4J8O A;  1NJI C;  1GRI A;  2AZV A;  2ZAE A;  3J80 E;  3CCQ Q;  1ARK A;  3TEE A;  1YIT Q;  2D8J A;  2K4Y A;  4ZGD B;  2YWW A;  5M9O A;  3CXC A;  2X35 A;  3CPW A;  5LJ3 f;  3QYG B;  3RR6 A;  1NLP C;  2R5A A;  2QG9 B;  2L5Q A;  1S72 A;  2XIC A;  4C5E A;  2FPD A;  2COW A;  1KQS A;  5LJ5 d;  1MHN A;  3S6W A;  4M75 G;  1KQ1 A;  2K9G A;  2QTV A;  5LJ3 d;  3AHU A;  1JB0 E;  3PVQ A;  2XD0 A;  1VQ7 T;  3GLX A;  5FLX E;  1KD1 R;  2VXE A;  4M7A A;  3L2Z A;  5LJ5 f;  2DYB A;  2IIM A;  2C06 A;  1K8A R;  2DZ9 A;  3JCM d;  2BIV A;  2M02 A;  4RTU A;  1I1J A;  3FIF A;  4J6W A;  2V1Q A;  1EX4 A;  2RF0 A;  4EIK A;  4LD9 K;  4DBH A;  1BYM A;  1TG0 A;  4MML A;  2EKO A;  1N8R R;  4M7D G;  3FB9 A;  3QG1 A;  1YJW A;  2BUD A;  1K0X A;  4ELY C;  5CKE A;  1DJ7 B;  1SG5 A;  5KYW A;  3EHR A;  3QYH B;  1Q82 U;  1K9M C;  4A4E A;  3OBW A;  2EW3 A;  4PK4 A;  1PD0 A;  4BI4 A;  2QQB A;  4A4G A;  2OAW A;  4Y92 A;  1R8O B;  2YRD A;  1KD1 C;  1LVK A;  2DVJ A;  2DXU A;  2CSI A;  4MDX A;  3G4S Q;  2H3J A;  3JV3 A;  3CCE T;  3PE0 A;  1VYT A;  2YUN A;  4BE2 A;  2M0O A;  2ENM A;  2K6D A;  1X01 A;  2E5Q A;  3M55 A;  5GAM e;  2K57 A;  6AT1 B;  1K1Z A;  5LJ3 g;  2GNC A;  1QP2 A;  2RPN A;  2G6F X;  3SHW A;  1MMG A;  3OYD A;  1Z9Z A;  3V8L A;  2CS7 A;  4MZM A;  1GBR A;  4FT4 A;  5GMK l;  3G7Z A;  2HQE A;  2L2P A;  3NTH A;  1LNX A;  2RHU A;  5ECA A;  3WVE B;  4C0G A;  2KRS A;  4JPB W;  3VYH B;  3FRN A;  5CKB A;  2RHZ A;  1OOT A;  3QSU A;  2F5K A;  2VGM A;  3REB B;  2RA2 A;  2PQW A;  3OMG A;  1QWE A;  3EFO B;  3EGD B;  2PVO B;  1B7T A;  1M3B A;  4RUG A;  2R58 A;  1SPK A;  1K9M R;  4J9E A;  4BE1 A;  1Q81 R;  4M7D B;  1M3C A;  1WFW A;  1WQW A;  4FYY B;  3NMZ C;  1VQO T;  1N8R C;  4C8Q C;  2E6N A;  2NUZ A;  3M54 A;  3CC7 Q;  2JVV A;  4JRQ A;  3JCM f;  4KH0 B;  2E5K A;  4E47 A;  3JB9 D;  3TQ7 P;  5HKC A;  1R0C B;  1YI2 T;  3C95 A;  2Y90 A;  2VB6 A;  2XK0 A;  4XTY A;  3GOX A;  2Z0W A;  1VQN Q;  2COY A;  2DFU A;  3OYJ A;  3SWN A;  1KQS S;  4L5G A;  2QK0 A;  3BE3 A;  3RKW A;  1VQ4 Q;  4DBR A;  2EBP A;  3H41 A;  2XDD A;  4M77 F;  4X1V A;  3ZBD A;  3L42 A;  5GAO r;  4PJO B;  2V26 A;  2GBQ A;  2RN8 A;  1B34 A;  2RQV A;  3A8O B;  1IGQ A;  4M75 A;  2FL7 A;  4E2F B;  3OYG A;  4BE0 A;  1QVG P;  3CCS T;  1QVF A;  1BCO A;  1ZUU A;  3O5Z A;  1D1C A;  2X3W D;  3D7S B;  5I2S A;  3G6E A;  4M7A G;  5IHN A;  4LUE A;  2K5I A;  2JMC A;  2DM1 A;  2EGC A;  1YIJ A;  4CRI A;  3V7C A;  2E10 A;  4JDS A;  4PFO A;  4A53 A;  1PNJ A;  2CYZ B;  1Y71 A;  2LP5 A;  2EJ9 A;  3M0S A;  3C12 A;  2E1H A;  3QWY A;  5IHI A;  5A0G A;  1FMW A;  4FM4 B;  1W6X A;  4J9C A;  4M7D A;  3TSW A;  4F7U B;  2C0O A;  1NPR A;  3RBB B;  5FWB A;  4OMP A;  2KEA A;  1VUB A;  1YIJ Q;  3H8Z A;  3U23 A;  1CSK A;  2ZCF B;  3A8G B;  2DIG A;  2PNI A;  3PNW C;  4EPC A;  2LCC A;  1HSQ A;  2X3X D;  3CC2 Q;  1B07 A;  9ATC B;  3JCM J;  2CP3 A;  2VAS A;  1PRM C;  3OYF A;  4RTT A;  1JJ2 P;  2RQT A;  2VXF A;  1FYN A;  1WXU A;  1OU9 A;  4OMO A;  1VQ4 A;  4FT2 A;  4M78 D;  5KCO A;  2C0T A;  4EMK A;  5GAN g;  1WNL A;  1PM3 A;  2EJF A;  3JB9 H;  4BY6 B;  4QT7 A;  5A0D A;  4F14 A;  4M75 D;  1F1B B;  1LPL A;  2YDL A;  4C92 G;  1YJN Q;  1FMV A;  1OX9 A;  4CC2 A;  5IAY A;  2FPE A;  4JRI A;  2DLP A;  3EGD A;  3VJP A;  2LNH B;  2PUK B;  5CKF A;  3CCM T;  1K73 U;  5DM7 R;  1ZSZ B;  1OYX A;  4FSX A;  4Y28 E;  1NEB A;  3PFS A;  4LN2 A;  2P84 A;  3MHX A;  3SWN B;  5AT1 B;  4X9D A;  1UHF A;  4OGC A;  2CZ0 B;  1RAG B;  2VV5 A;  2O4X A;  2OAU A;  2C0I A;  1PSF A;  3NPF A;  3OYM A;  4M7D F;  2K79 A;  3EFS A;  2F2V A;  3QO3 A;  3ZL7 C;  3LWI A;  1KD1 U;  2R5M A;  3DB4 A;  3E9F A;  1SRL A;  1G3T A;  1M2O A;  4ZNX A;  1YN8 A;  2J05 A;  2JN0 A;  3Q1J A;  5FRM A;  1ACM B;  2RMO A;  5EC7 A;  1M1G A;  1KG1 A;  4A54 A;  3MET A;  2LNV A;  1QLY A;  3GF5 A;  2VWF A;  2I2L A;  2RJE A;  2RH2 A;  2DL7 A;  1PKT A;  3OYK A;  4X34 A;  3HFO A;  2P4T A;  4BB7 A;  1C6V X;  1M2V B;  1X6O A;  1KC8 R;  3LLR A;  2X9H A;  3UT1 A;  1NEG A;  2HBW A;  4Z8A A;  3FJ5 A;  2LCL A;  3CCS Q;  4VUB A;  3MJX A;  1W4S A;  1IHV A;  1AT1 B;  1WA7 A;  2GFU A;  3V8J A;  4C8Q G;  3QXE B;  1YJW Q;  4RTZ A;  1MV3 A;  1I81 A;  4M78 C;  3H9N A;  2LJ3 A;  3L2V A;  3RUX A;  1WLP B;  2JXB A;  2OTJ A;  2EIF A;  1FMK A;  2H3E B;  5CVI A;  3G6E T;  4M78 E;  4EMH A;  3LW5 E;  5GAM f;  2DO3 A;  3BW1 A;  3KBG A;  3G4S A;  4M75 B;  4B6M A;  2MPX C;  4A4H A;  4XTZ A;  3CD6 Q;  4O6J A;  4O5V A;  3E2U A;  3E9G A;  3V7S A;  3KUF A;  3REA B;  2P0Q A;  1WHL A;  3CME A;  2RO0 A;  3MKD A;  3CD6 T;  2BZY A;  2LQK A;  1D1A A;  4GLK A;  1TS9 A;  3EGU A;  4M78 A;  4CC3 A;  3LH0 A;  2L3P A;  2JM9 A;  2OTL T;  2ZGW A;  4OML A;  4M7D D;  5CQY A;  5GMK m;  2QQR A;  1AWO A;  3VRY A;  1TSF A;  3CBO A;  1K73 C;  2ESW A;  4KUI A;  5D6Y A;  1M90 U;  3A5Z B;  4QKU A;  4KRT A;  2E64 A;  1UJY A;  2LT1 A;  4IUQ A;  1E6H A;  3HTR A;  3S3N A;  3CBM A;  4J9B A;  4JUV A;  1A0N B;  1MMD A;  3CC7 T;  3QDF A;  4AFQ C;  5FW9 A;  1M1F A;  1UEC A;  1VIF A;  1K8A U;  4QVZ A;  4M7D C;  1M90 R;  2AZS A;  2CT4 A;  5GAO l;  1KQ2 A;  2DX1 A;  2E41 A;  5KYX B;  2KK4 A;  2JW4 A;  1OX8 A;  5KE3 A;  1V76 A;  2DTO A;  1TWB A;  1O75 A;  5EG2 A;  1SHG A;  2ZPG B;  3H6Z A;  1WHK A;  5LJ3 j;  2FZC B;  4BD3 A;  5GAM d;  1IGU A;  3JCM X;  2M51 A;  2XU8 A;  3MEV A;  3UWN A;  1QKW A;  4M7A C;  2K7A A;  1PD1 A;  5KE2 A;  2ZPI B;  3SD4 A;  3BDL A;  2DNU A;  3FLG A;  3QKJ A;  2LTO A;  3CCL T;  4OVA A;  1M8M A;  1K9M U;  1VQ6 A;  2QGF B;  3I35 A;  1BI2 A;  5GAN 4;  3KFV A;  1PHT A;  3OY9 A;  4XU2 A;  2RJF A;  1VIE A;  3WXM B;  4HCB A;  3CCS A;  4PJM A;  5KYU A;  3INZ A;  5LJ5 h;  4IUT A;  4XTV A;  2CZ6 B;  2M1H A;  3G71 A;  2FYK A;  1KHC A;  2HDA A;  3MEU A;  2PVD B;  1TUC A;  2VC8 A;  5I22 A;  4M7A D;  2YUO A;  5CIU A;  1YJW T;  1YJ9 T;  2QGG A;  2RB6 A;  1I07 A;  1IXD A;  1UGS B;  3CCE Q;  2A37 A;  1BIB A;  1TXQ A;  2MF2 A;  1YJN T;  2CGH A;  1M9S A;  4AFS C;  1T3S A;  1QW1 A;  3ZFJ A;  2KXD A;  4C0D B;  2KGT A;  3P8D A;  3OW2 P;  1Y0M A;  4M78 B;  2O9S A;  3QJ6 A;  4C8Q F;  4PFZ A;  4FCY A;  2P0K A;  1JU5 C;  3HRU A;  2JS2 A;  3ASK A;  2HSE B;  4HA8 A;  2VVK A;  1YWP A;  4GLM A;  3UPU A;  1VQ7 Q;  4C5H A;  2D0Q B;  1N9R A;  4R0K A;  5GMK e;  2ZPH B;  4F17 A;  4IKF A;  3HSB A;  2KVQ G;  1PRL C;  2JM8 A;  4XQ3 A;  2K3X A;  1IRX A;  2EQK A;  2LZ6 B;  2A0F B;  4JZ4 A;  3JCM Q;  1OV3 A;  3G71 T;  2D9T A;  4LDY A;  4IUV A;  2K3B A;  2CH4 W;  1OEB A;  1I8F A;  1K76 A;  2KRM A;  4DEY A;  1X6G A;  1NYG A;  4XU1 A;  2RK1 A;  1RAC B;  2X4J A;  3VS4 A;  2COZ A;  1RAI B;  1WJR A;  1VQM T;  4AG1 C;  2E4H A;  1SEM A;  4IIO A;  3EGX B;  4KGZ B;  1QQJ A;  4X9C A;  3P8B B;  2OTJ Q;  4NL3 A;  3A8H B;  3S3O A;  4KUD K;  2QTX A;  3JSC A;  4GY5 A;  3NTI A;  4AG2 C;  3VS6 A;  1RUW A;  3OBY A;  2KI7 A;  4A4F A;  3L1A A;  3CC4 T;  4Y91 A;  4M7A F;  1UGP B;  2DTH A;  1U5S A;  2KSS A;  2JMA A;  3EHQ A;  1YP5 A;  4E7L A;  1ZBJ A;  8AT1 B;  2GTO A;  2KNB B;  3I5R A;  1M30 A;  4OF1 A;  4QW2 A;  2FVU A;  2LC4 A;  2E12 A;  4GBQ A;  1M2V A;  4C92 D;  1X75 C;  5KYU B;  3N5B B;  2O2O A;  3FEO A;  3CCQ T;  2LJ0 A;  2XI9 A;  3X28 B;  3F70 A;  4QQG A;  2KYB A;  2WAC A;  4D8K A;  2QEX T;  2A08 A;  3MO8 A;  5I11 A;  2CZ1 B;  1BB9 A;  2KT8 A;  1VQN A;  4FL6 A;  3HKS A;  1D0Y A;  2KQW A;  4RMO A;  3EAE A;  2JS0 A;  5GAO m;  3L2Q A;  5GAO q;  3PIO A;  1QCF A;  2CT3 A;  3NHN A;  5IXF A;  1QVG S;  1QVG A;  2VUB A;  3CCR A;  4D6W A;  3CMA Q;  1MGQ A;  5GAO n;  1WYX A;  1JXO A;  2LDM A;  1H92 A;  3M0Q A;  2LQ8 A;  3ER0 A;  1RAF B;  2DTI A;  3QDR B;  4OMF B;  2HAX A;  1UTI A;  2QDY B;  5D6X A;  1YI2 Q;  2QEX A;  2QQ9 A;  2XDP A;  1Y7X A;  3HFN A;  4ESR A;  1QWF A;  2HNI A;  1GFD A;  1M4Z A;  2P4R A;  5A0L A;  1QVP A;  1YIT A;  3OYY A;  2GF7 A;  2RI2 A;  2Y4Y A;  3EFR A;  2EVR A;  1AVZ C;  2QI2 A;  4RG8 A;  1MND A;  4OP0 A;  4MMK A;  4PJO E;  1G3Y A;  2DL5 A;  3OMC A;  1WHH A;  2V8I A;  2CRE A;  1G3W A;  4PL6 A;  1UGV A;  2DMO A;  3LWH A;  2KAF A;  4RTV A;  4LDU A;  4DBQ A;  4RG2 A;  3AT1 B;  2QXF A;  2KBT A;  2YHT A;  5KYW B;  4DBF A;  2J6O A;  1OI1 A;  4WTO B;  2RJD A;  2YLC A;  1VYV A;  2DKG A;  2FPF A;  5GAN f;  1Q81 U;  4J5Y A;  3C4S A;  4R56 A;  1K0S A;  2A3L A;  5GAN 8;  2VGN A;  3JB9 I;  4PJJ A;  5GAO p;  1WHJ A;  3CCJ T;  2KMT A;  1C0M A;  2RQR A;  3I5S A;  3M56 A;  4M77 G;  2EKH A;  2MWO A;  5HK0 A;  1WJS A;  4C92 F;  5GMK j;  2V1R A;  3PIP A;  1UB4 A;  4M78 F;  3SFM A;  5GAN e;  2PUO B;  2KR3 A;  5IH2 A;  3VRZ A;  3LH5 A;  1WX6 A;  2BE9 B;  4JLI A;  1YIT T;  4HVV A;  5LL6 S;  1Q86 R;  4R55 A;  3CC4 Q;  1BCM A;  1EFN A;  2E65 A;  2ECZ A;  2NYS A;  4LDV A;  2GQV A;  3JRZ A;  3DB3 A;  1I4K 1;  3EH1 A;  2SEM A;  2RI3 A;  1VQL Q;  2NWM A;  3OYH A;  2L8D A;  5GJV B;  2B86 A;  1GCP A;  1UGQ B;  1ZUY A;  4E7H A;  1PSE A;  3EG0 A;  2MYS A;  3JB9 J;  2CP7 A;  1ZSG A;  3CCR T;  4IUU A;  4KGV B;  3CXC P;  4RTY A;  3C94 A;  4JJB A;  3C0C A;  2DE0 X;  3GPL A;  1NE8 A;  1VQN T;  4WCI A;  3PGG A;  3RES A;  1J3T A;  1RLQ C;  3X26 B;  2QAZ A;  1RAB B;  3NGP A;  1Y57 A;  2DBK A;  2IVW A;  3FDR A;  2DL8 A;  5C6S A;  1WQ7 A;  4PKC C;  4HCZ A;  4C92 A;  1HXD A;  2L3R A;  2LJ1 A;  5GAN 3;  3E1S A;  2OTL Q;  2ZPB B;  2GFA A;  4NS5 A;  1TUD A;  3EH2 A;  1E6G A;  4RTW A;  5DLO A;  2RD1 A;  1LCK A;  2YUP A;  4UC4 A;  2NUT A;  4NL2 A;  3CC4 A;  1TH7 A;  2QQA A;  4AT1 B;  1VQ8 Q;  3CXC S;  2BE7 D;  1VOM A;  3KXT A;  3QPH A;  5KYY A;  1Y96 A;  2XG8 D;  5J3B A;  1KIK A;  4XTU A;  3DLL A;  5HY6 A;  2LMJ A;  3CCL A;  1ZSZ A;  3I56 A;  5FU7 C;  1SSH A;  1BIA A;  2VYT A;  3I56 T;  2R57 A;  1WHM A;  4HT9 A;  2X4Y A;  4DOV A;  3OYB A;  2JZ2 A;  4OB3 B;  2DD5 A;  3HP9 A;  4IUR A;  1KHI A;  2MCN A;  3A8L B;  2MK5 A;  2F69 A;  2ABL A;  1YHQ T;  2DZC A;  1QCO A;  1ZA1 B;  2KRO A;  5FRO A;  3FJP A;  2HKQ B;  3VV0 A;  1HK9 A;  2PTK A;  3EG1 A;  3VS5 A;  2KDS A;  3LYI A;  2EQM A;  3CCJ Q;  1SSF A;  4DOW A;  1VQ5 A;  3A8M B;  2JT4 A;  1VQ8 A;  2QQS A;  4F7U E;  1M8V A;  4XK8 E;  3SWN C;  3L2U A;  1W2B A;  5IHK A;  4C92 B;  2W10 A;  3M4Y A;  1EZZ B;  4N0A A;  2RNA A;  2CZ7 B;  2MI6 A;  1UDL A;  2HD0 A;  1Q7Y C;  1P92 A;  3UF4 A;  3CC2 T;  1NG2 A;  1BI0 A;  1AWJ A;  2GCX A;  2IPO B;  1SKU B;  4PFP A;  5GAN j;  1JEG A;  2QYZ A;  4MZP A;  3QZ5 B;  1UHC A;  2D1X A;  2D8H A;  5IT9 E;  4E7K A;  4MZT A;  3QII A;  1V1C A;  2KT1 A;  4QQD A;  3LX7 A;  2QA4 A;  5CO7 A;  2MWP A;  3OYN A;  1X6B A;  3JB9 G;  3PVL A;  1YJ9 A;  3M58 A;  3MP6 A;  4N4H A;  2Y4X A;  1ABQ A;  1K4U S;  3OW2 S;  4EMK C;  1ZSZ C;  3JCM W;  4ELZ C;  1TOV A;  4M7A B;  1YNZ A;  4RKU E;  5CK9 A;  4K11 A;  2FO0 A;  1K73 R;  2AKL A;  3NFC A;  2JOY A;  2DBM A;  2E6Z A;  1N5Z A;  3CCJ A;  4BY6 C;  3BY7 A;  1GXI E;  3CCU T;  3OS5 A;  1VQ9 Q;  1NPP A;  2ROL A;  1OU8 A;  2HBP A;  2JJ9 A;  2O01 E;  3M4G A;  3CCE A;  5I2M A;  1TTH B;  4PJO F;  2LQW A;  2ATC B;  1BI3 A;  2DAQ A;  3MPU B;  1JQQ A;  2EQU A;  2HZY A;  4E7S A;  5J26 A;  2FZG B;  2DET A;  5GAM h;  1KJW A;  2AIR B;  1BK2 A;  5FU7 B;  1G8X A;  4M75 C;  4M75 E;  3I55 A;  1ZUK A;  4DEX A;  4P5N A;  2DRM A;  3I56 Q;  3UAT A;  3EG9 B;  2FRY A;  1JO8 A;  5KYX A;  1YWO A;  2DL4 A;  4C8Q D;  3OYI A;  2KY9 A;  2AHJ B;  3CPW S;  3GNG A;  2YRV A;  2DIL A;  2M16 A;  4OB2 B;  3CMA A;  4CC7 A;  1HJD A;  3HHT B;  2RJC A;  1KQS P;  3RDV A;  1JBM A;  2O9V A;  2EFI A;  2DD4 A;  3JCM V;  1U1T A;  2DEQ A;  4CI0 C;  1ZLM A;  2DF6 A;  2B8A A;  1BBZ A;  1OZ2 A;  4NOY A;  1RLP C;  3QWX X;  4M77 E;  3T9N A;  3CME T;  1MNE A;  1O9S A;  3RKY A;  5GJW B;  2RHX A;  4J9D A;  4ORZ A;  4V2S A;  2GGR A;  2DVE A;  4J7F A;  2CH4 A;  2L89 A;  3EFO A;  3G1J A;  1VYU A;  4RCC A;  5GAN 2;  1YBY A;  4ME7 A;  1OZ3 A;  1VQK T;  3SEM A;  1UUE A;  1W1F A;  3EG3 A;  1M1K C;  4JJD A;  1VQK Q;  4LNP A;  1RAE B;  2AKK A;  2DER A;  4LE9 A;  1ABO A;  5CKD A;  5LJ5 j;  2GQI A;  5CR2 A;  1IZ6 A;  1GCQ A;  2BZX A;  2JUF A;  5DY9 A;  1Y96 B;  1Y07 A;  4M77 C;  3JCM g;  1RAH B;  3EG9 A;  4OMQ A;  1FXX A;  3CCV T;  1YCS B;  2OTJ T;  1ZBX A;  4PLI A;  1XTD A;  4PLL A;  4PJO D;  3VS0 A;  2EAY A;  4PNO A;  5C0M A;  4C8Q A;  4B9W A;  3MCA B;  2HL3 A;  8ATC B;  1H8K A;  1NZ9 A;  1N9S A;  2OX7 A;  4LDW A;  3M57 A;  3PT9 A;  3S3M A;  1QCN A;  1K9A A;  4ZN3 A;  5CKH A;  2J06 A;  2O31 A;  1T0J A;  1U3O A;  4J7I A;  1D1B A;  3G6E Q;  1TUG B;  4FYV B;  3GNF B;  1M27 C;  4II1 A;  2RI5 A;  5FU6 B;  3CPW P;  4XU3 A;  3V8K A;  5A2Q E;  1I5O B;  2D0N A;  4JJC A;  2EYY A;  4HT8 A;  1MUZ A;  4CC4 B;  1U8R A;  2YT6 A;  3ZEH A;  1FWZ A;  1WI7 A;  1WPY A;  3OSS C;  1AZG B;  1AZE A;  1RL2 A;  3QHS A;  2QA4 Q;  3H0F A;  5FRN A;  2RQU A;  4RTX A;  2OJ2 A;  1N6A A;  5L8R E;  4OMN A;  2MAM A;  1S1N A;  1IO6 A;  4M78 G;  1N27 A;  1M1K U;  2O88 A;  1T0H A;  1VQ6 Q;  2LT4 A;  4PJO G;  3GP8 A;  4Z89 A;  3QJY A;  1NM7 A;  4M4Z A;  4FW1 A;  2NUP A;  1PWT A;  3TSZ A;  4FU6 A;  2K5L A;  2MIO A;  2HCK A;  3JCM b;  4J9G A;  4EMK B;  2FHD A;  2MOX A;  1HD3 A;  4QVD A;  1VQ4 T;  4N4G A;  4XTX A;  1WGS A;  2HL5 C;  1G2B A;  3CQT A;  1YJN A;  1X2Q A;  1Q82 R;  4E6R A;  3O8V A;  3RER A;  3OS0 A;  5HK3 A;  1QVF S;  1X69 A;  1C1A A;  3LGL A;  3EG2 A;  5GAN 6;  2FG0 A;  1OUL A;  3VU3 C;  2EWN A;  2LRQ A;  3M0P A;  4Z02 A;  5LJ3 e;  3VKI A;  4QQ6 A;  2EQI A;  4F7U F;  4BDY A;  3P8H A;  3OYC A;  2SRC A;  1VQP A;  1RAD B;  1D3B B;  2F2X A;  4ZN1 A;  4M7D E;  2EQJ A;  3JCM e;  3RIR A;  4XTW A;  4C92 C;  2M9U A;  1B3Q A;  2LCS A;  5CCA A;  3SDZ A;  1Q82 C;  1Z9Q A;  3FC3 A;  3VYG A;  1YIJ T;  2EJG A;  2XDB A;  2F2W A;  4F16 A;  2NUP B;  3OB9 A;  2A28 A;  3RMS A;  2XID A;  5LJ5 e;  1JRI A;  2YLB A;  1XJW B;  5IXB A;  2EPD A;  4KBM B;  4TVR A;  2YRC A;  4DQ2 A;  4JRP A;  4BUG A;  2RM4 A;  3TVT A;  2K2M A;  3TU4 K;  3UA6 A;  3VUB A;  1QP3 A;  3CCU A;  2ZPE B;  2EYW A;  3CCV A;  2I0N A;  3BDU A;  2XHC A;  3H0I A;  2DRK A;  3QUI A;  4C5I A;  1YI2 A;  2A36 A;  1M5Q 1;  5HCK A;  4HVU A;  3CPF A;  4XU0 A;  1BKB A;  4M77 A;  2NLU A;  5GAN 5;  2HEQ A;  3E19 A;  2IG0 A;  3J7A F;  4OMM A;  1V29 B;  2DXB A;  3X20 B;  4HKE A;  1X27 A;  2KYM A;  1WDX A;  1VQO A;  2BZ8 A;  3QBY A;  4J83 A;  2V8K A;  1KC8 U;  2OTL A;  3X25 B;  2RHI A;  5L23 A;  3M0R A;  2V8J A;  3X24 B;  1VQK A;  3NTK A;  1WXT A;  2K2V A;  2P0P A;  5J39 A;  1AWX A;  1BU1 A;  2L3S A;  4C0F A;  1U1S A;  1TU0 B;  1PG5 B;  2JNG A;  2EGA A;  3HRS A;  3OS1 A;  3SB2 A;  4PJO A;  3M9Q A;  3M0U A;  5GMK h;  3G4S T;  2QAS A;  4IIM A;  4ZTJ A;  3R6N A;  3ULR B;  4N4I A;  1UEB A;  4E7J A;  3TCJ A;  1E7O A;  2J6K A;  5CQX A;  2BTT A;  4E7I A;  3DLM A;  1FX7 A;  1KK7 A;  3CCM Q;  1YCY A;  1NLO C;  2L0A A;  1R77 A;  1YFN A;  1VQ8 T;  4L59 A;  1VQ5 T;  3JB9 F;  3CCV Q;  1UFF A;  3MP1 A;  4M7A E;  4KGX B;  1D0Z A;  4N0A C;  4A4K A;  1JJ2 A;  1VQ5 Q;  2KRN A;  3HL8 A;  1VQL T;  1VQM Q;  2M0Y A;  1R0B G;  1WIE A;  4J6X A;  1B34 B;  4AFU C;  1HYO A;  4OB0 B;  3TRE A;  3VUZ A;  1T3L A;  2HMA A;  1VQL A;  1VQP Q;  2QA4 T;  2K3Y A;  2EGE A;  3LGF A;  1MV0 B;  1KFZ A;  1IRE B;  2G3R A;  4YTL A;  1H3H A;  2LX9 A;  2DIQ A;  1CKA A;  3CME Q;  2DJQ A;  1MMN A;  1VQM A;  1I0C A;  2WSE E;  2ED1 A;  4F7U G;  2NUT B;  3DKM A;  4C8Q B;  4BI3 A;  3M53 A;  1X2K A;  4FW2 A;  3VS7 A;  4ATO A;  2LX7 A;  4F04 B;  5KH6 A;  5D6W A;  4JS4 A;  5KCH A;  1OQK A;  2J6F A;  4C92 E;  1S72 Q;  1EIF A;  1XOV A;  2E70 A;  3OSV A;  1SF9 A;  2YSQ A;  1PCX A;  1UGR B;  3L2R A;  2BKD N;  2F5T X;  3CCM A;  3OW2 A;  4PJN A;  3VS1 A;  4ANJ A;  1Q95 G;  3CCR Q;  1W2B S;  1S72 T;  3H0H A;  4HCK A;  2HQX A;  2DYI A;  2DJZ A;  4M77 D;  1Q86 U;  4JJN K;  1M3A A;  2AK5 A;  4LD6 A;  4HVW A;  4Z88 A;  2KE9 A;  1GBQ A;  1VQ9 A;  2FEI A;  2DEU A;  2CSQ A;  3CBP A;  1NJI R;  4JLG A;  3RKX A;  1KSW A;  5KYY B;  3PTA A;  4BDZ A;  5D7U A;  3GIB A;  3CC2 A;  1RI0 A;  1G5V A;  2AT1 B;  2X4W A;  2L3Q A;  4J9H A;  4AMC A;  4ZGE B;  4KT0 E;  3A1P A;  3MEW A;  4J9F A;  3HPW A;  4Q5W A;  1AEY A;  1D3B A;  1W2B P;  1YHQ Q;  2MMP A;  2LVM A;  1NJI U;  1H3Z A;  1N8R U;  1QMC A;  4JRK A;  1ZX6 A;  1Q7Y U;  2RK2 A;  2CP0 A;  4J9I A;  1LJO A;  2O4X B;  1UG1 A;  2PVG B;  1I5L A;  2X4X A;  2CDT A;  2DK3 A;  4EMG A;  1UJ0 A;  1WHG A;  3RMQ A;  1YHQ A;  3G71 Q;  4ZTF A;  2PZ1 A;  2ZZD A;  1YJ9 Q;  4BI8 B;  3OYE A;  2WSF E;  1SRM A;  1BI1 A;  4QVC A;  4PJO C;  2VKN A;  4KUL A;  3OS2 A;  2FB7 A;  4AFZ C;  1GL5 A;  1H64 1;  1VQ6 T;  5GAN h;  3M5A A;  3OYA A;  3MP8 A;  2EYQ A;  4JZ3 A;  2ROT A;  3UDC A;  1MMA A;  1XQH A;  2ED0 A;  2JTF A;  3OYL A;  2W0Z A;  4LXC A;  1VQP T;  5DLQ E;  4B9X A;  3URG A;  4M77 B;  3V7R A;  3L2W A;  1ZQ1 A;  4OB1 B;  5FWC A;  4M75 F;  2HQH A;  1AHJ B;  3PMI A;  2PU9 B;  3CCL Q;  4RCB A;  4FSS A;  1KC8 C;  5GAN d;  2CP6 A;  1QKX A;  2GTJ A;  3JAM E;  2JTM A;  2CKK A;  2OI3 A;  1OPL A;  2WSC E;  5I21 A;  1GCQ C;  2ZPF B;  3JCM c;  1PC0 A;  3JCM h;  1WJQ A;  2QEX Q;  4HXJ A;  3ME9 A;  1AWW A;  4J6Y A;  3CC7 A;  2D6F A;  1Q86 C;  5AYF A;  4C0Z A;  5GAN 7;  3R6O A;  2HSP A;  3VS3 A;  1NYF A;  5LJ3 h;  2H8H A;  3CCU Q;  1VQ9 T;  2FRW A;  5GMK i;  4F7U A;  2XKO C;  2E3H A;  1W70 A;  3GBQ A;  1X43 A;  3OA6 A;  3J81 E;  1LOJ A;  5GAM j;  4OGE A;  1PKS A;  3EGX A;  1GFC A;  4JS5 A;  2JTE A;  3WVD B;  2DXT A;  2X51 A;  2FZK B;  4PJL A;  4IUP A;  5KYN A;  5FU6 C;  1JXM A;  5GAM g;  3CD6 A;  4FYW B;  3QZ9 B;  3I9Q A;  1XNI A;  3A98 A;  3CMA T;  2DA9 A;  1AD5 A;  2YXY A;  1G83 A;  2A7Y A;  1IHW A;  1AOJ A;  1Q7Y R;  3UA7 A;  3PMT A;  4EDU A;  2DXC A;  3I55 Q;  3CCQ A;  2RHY A;  3THK A;  2HKN A;  1CKB A;  3VS2 A;  4DA4 A;  1G3S A;  3CEY A;  2QDL A;  2XMF A;  1U06 A;  2DPP B;  7AT1 B;  4LUD A;  3HRT A;  4D8D A;  1RAA B;  2K5F A;  1D09 B;  4LDX A;  3M59 A;  2J7I A;  2KXC A; 
#chains in the Genus database with same CATH homology
 3I55 T;  1PSE A;  3O8V A;  3JB9 J;  3RER A;  3OS0 A;  3CCR T;  5IN1 A;  4IUU A;  4M78 E;  5HK3 A;  3JCM P;  1K8A C;  1QVF S;  4XAX B;  4EMH A;  3LGL A;  5GAN 6;  3C94 A;  3LW5 E;  5GAM f;  5LJ5 g;  3GPL A;  2DO3 A;  3BW1 A;  1NE8 A;  3KBG A;  3VU3 C;  2EWN A;  3G4S A;  2LRQ A;  4M75 B;  4MDW A;  4Z02 A;  4HCC A;  4A4H A;  5LJ3 e;  1VQN T;  3VKI A;  3PGG A;  4QQ6 A;  4XTZ A;  3RES A;  4F7U F;  1JJ2 S;  4BDY A;  4C0D C;  3P8H A;  4O6J A;  3OYC A;  3X26 B;  1VQP A;  4O5V A;  1D3B B;  4L6V 5;  3MEA A;  1M90 C;  4ZN1 A;  3OQ5 A;  4M7D E;  2EQJ A;  2IVW A;  3RIR A;  3JCM e;  4XTW A;  4BAC A;  3E9G A;  1Q81 C;  3FDR A;  2M9U A;  3V7S A;  4C92 C;  4C8Q E;  3BFM A;  5CCA A;  3KUF A;  5C6S A;  3SDZ A;  2P0Q A;  1WQ7 A;  5CAI A;  3CME A;  4PKC C;  2RO0 A;  1Q82 C;  3FC3 A;  3CD6 T;  1ZHI A;  4ZGJ B;  4HCZ A;  3VYG A;  2LQK A;  4C92 A;  1HXD A;  2L3R A;  5GAN 3;  4GLK A;  3E1S A;  1YIJ T;  2ZPB B;  4C5G A;  2EJG A;  2GFA A;  4NS5 A;  2XDB A;  4M78 A;  3LH0 A;  2OTL T;  2ZGW A;  3OB9 A;  4WF2 A;  4FIB A;  3RMS A;  2XID A;  4M7D D;  5CQY A;  1VQ7 A;  5LJ5 e;  4J8O A;  5GMK m;  5DLO A;  2QQR A;  2RD1 A;  1JRI A;  1NJI C;  4UC4 A;  3CBO A;  2YLB A;  1K73 C;  4NL2 A;  4KUI A;  3CC4 A;  1TH7 A;  2QQA A;  5D6Y A;  3J80 E;  4KBM B;  3CXC S;  4TVR A;  1M90 U;  3A5Z B;  3TEE A;  4DQ2 A;  3KXT A;  2E64 A;  3QPH A;  2K4Y A;  4ZGD B;  4BUG A;  4JRP A;  1Y96 A;  2LT1 A;  4IUQ A;  2XG8 D;  5J3B A;  4XTU A;  3DLL A;  5M9O A;  2RM4 A;  5HY6 A;  3CXC A;  3S3N A;  3CBM A;  3CCL A;  3I56 A;  5FU7 C;  4JUV A;  3TU4 K;  3VUB A;  3CCU A;  1BIA A;  1QP3 A;  2VYT A;  2X35 A;  3I56 T;  2ZPE B;  2R57 A;  3CPW A;  3CCV A;  3CC7 T;  3BDU A;  2X4Y A;  2XHC A;  3QYG B;  5LJ3 f;  4HT9 A;  3QUI A;  2R5A A;  4C5I A;  1M1F A;  1VIF A;  4DOV A;  1YI2 A;  2L5Q A;  1K8A U;  1M5Q 1;  4QVZ A;  3OYB A;  2XIC A;  4C5E A;  1S72 A;  4M7D C;  3CPF A;  2JZ2 A;  4OB3 B;  1KQS A;  2DD5 A;  4XU0 A;  1BKB A;  5LJ5 d;  1MHN A;  3HP9 A;  3S6W A;  4M77 A;  2NLU A;  5GAN 5;  4M75 G;  4IUR A;  1KQ1 A;  1KHI A;  3E19 A;  2IG0 A;  2E41 A;  3A8L B;  5LJ3 d;  5GAO l;  2KK4 A;  1JB0 E;  1KQ2 A;  1V29 B;  3AHU A;  3J7A F;  2XD0 A;  2F69 A;  2DXB A;  3X20 B;  4HKE A;  1VQ7 T;  5KE3 A;  2DTO A;  1YHQ T;  1O75 A;  3GLX A;  5FLX E;  1VQO A;  2DZC A;  2VXE A;  3QBY A;  4J83 A;  5EG2 A;  2V8K A;  2ZPG B;  3H6Z A;  3L2Z A;  5LJ5 f;  1KC8 U;  2OTL A;  5FRO A;  3X25 B;  3FJP A;  5LJ3 j;  2RHI A;  3VV0 A;  2C06 A;  1HK9 A;  2V8J A;  4BD3 A;  5GAM d;  3X24 B;  2DZ9 A;  1VQK A;  3JCM d;  2BIV A;  3NTK A;  2KDS A;  2XU8 A;  3JCM X;  3MEV A;  3LYI A;  4M7A C;  5KE2 A;  2EQM A;  2ZPI B;  3SD4 A;  1SSF A;  2K2V A;  3BDL A;  4DOW A;  3FIF A;  3A8M B;  3FLG A;  4J6W A;  1VQ5 A;  2QQS A;  4F7U E;  1VQ8 A;  1M8V A;  3QKJ A;  2LTO A;  4XK8 E;  2P0P A;  5J39 A;  3SWN C;  3CCL T;  4OVA A;  4LD9 K;  3L2U A;  4C0F A;  1U1S A;  1K9M U;  1BYM A;  4MML A;  1VQ6 A;  3G6E T;  1W2B A;  2EKO A;  4M7D G;  3FB9 A;  3QG1 A;  2JNG A;  1BI2 A;  4C92 B;  3HRS A;  1YJW A;  5GAN 4;  3M4Y A;  4N0A A;  3OS1 A;  2BUD A;  3OY9 A;  4ELY C;  5CKE A;  3SB2 A;  1DJ7 B;  4XU2 A;  2CZ7 B;  2MI6 A;  3QYH B;  2RJF A;  4PJO A;  1Q82 U;  1VIE A;  3M9Q A;  5GMK h;  1K9M C;  3G4S T;  3WXM B;  4A4E A;  2HD0 A;  3CCS A;  4HCB A;  3OBW A;  1Q7Y C;  3INZ A;  1P92 A;  4BI4 A;  5LJ5 h;  4ZTJ A;  4IUT A;  4XTV A;  3CC2 T;  2QQB A;  2CZ6 B;  1UEB A;  2M1H A;  4N4I A;  4A4G A;  2FYK A;  1KHC A;  3G71 A;  3MEU A;  2PVD B;  2VC8 A;  3TCJ A;  4E7J A;  5CQX A;  4M7A D;  5CIU A;  4E7I A;  1BI0 A;  1R8O B;  3DLM A;  1FX7 A;  1YJW T;  2GCX A;  1YJ9 T;  1YCY A;  2RB6 A;  1KD1 C;  1UGS B;  2DXU A;  5GAN j;  4MDX A;  1BIB A;  4MZP A;  2H3J A;  3CCE T;  2MF2 A;  1YJN T;  3QZ5 B;  1VQ8 T;  4L59 A;  1VQ5 T;  2CGH A;  3JB9 F;  1M9S A;  5IT9 E;  1QW1 A;  3ZFJ A;  4BE2 A;  2M0O A;  3MP1 A;  4E7K A;  4MZT A;  4C0D B;  3QII A;  4QQD A;  3LX7 A;  1X01 A;  2E5Q A;  3P8D A;  2QA4 A;  4M7A E;  4M7A A;  5CO7 A;  2MWP A;  3OYN A;  3M55 A;  5GAM e;  2K57 A;  5LJ3 g;  4N0A C;  1QP2 A;  3JB9 G;  4M78 B;  4A4K A;  1JJ2 A;  1YJ9 A;  3QJ6 A;  3OYD A;  4C8Q F;  3HL8 A;  3M58 A;  3V8L A;  2CS7 A;  3MP6 A;  1VQL T;  4N4H A;  2Y4X A;  2P0K A;  4MZM A;  4J6X A;  3OW2 S;  1B34 B;  3HRU A;  4FT4 A;  4EMK C;  3JCM W;  5GMK l;  3G7Z A;  4ELZ C;  3ASK A;  4M7A B;  2HQE A;  4OB0 B;  3TRE A;  3VUZ A;  4HA8 A;  4RKU E;  5CK9 A;  1VQL A;  3NTH A;  1LNX A;  2RHU A;  2QA4 T;  2K3Y A;  3NFC A;  3WVE B;  2JOY A;  4C0G A;  3UPU A;  2E6Z A;  4C5H A;  3LGF A;  3VYH B;  3FRN A;  5CKB A;  2RHZ A;  2D0Q B;  3CCJ A;  4BY6 C;  3BY7 A;  1GXI E;  3CCU T;  1IRE B;  2G3R A;  3OS5 A;  3QSU A;  1N9R A;  5GMK e;  4YTL A;  2ZPH B;  2LX9 A;  2DIQ A;  1NPP A;  4IKF A;  3HSB A;  2KVQ G;  2F5K A;  2VGM A;  2RA2 A;  2HBP A;  4XQ3 A;  2K3X A;  1VQM A;  2O01 E;  2PQW A;  3OMG A;  3M4G A;  2EQK A;  3CCE A;  2PVO B;  2WSE E;  4F7U G;  3DKM A;  5I2M A;  4C8Q B;  4BI3 A;  2R58 A;  3M53 A;  4PJO F;  4BE1 A;  4M7D B;  1WQW A;  1BI3 A;  2DAQ A;  2EQU A;  3JCM Q;  4ATO A;  3G71 T;  5J26 A;  4LDY A;  4IUV A;  5D6W A;  5KH6 A;  1VQO T;  4JS4 A;  5GAM h;  5KCH A;  4C8Q C;  4C92 E;  2E6N A;  1N8R C;  3M54 A;  1EIF A;  5FU7 B;  1XOV A;  2JVV A;  2E70 A;  1I8F A;  4M75 C;  3OSV A;  4JRQ A;  3L2R A;  1UGR B;  2BKD N;  2F5T X;  4M75 E;  3CCM A;  3OW2 A;  3JCM f;  3I55 A;  4E47 A;  4XU1 A;  4P5N A;  2RK1 A;  1W2B S;  3JB9 D;  5HKC A;  1S72 T;  2X4J A;  1YI2 T;  3C95 A;  1WJR A;  1VQM T;  2Y90 A;  2HQX A;  4X9C A;  2XK0 A;  3P8B B;  2DJZ A;  4M77 D;  3A8H B;  4XTY A;  4NL3 A;  3GOX A;  3S3O A;  1Q86 U;  3OYJ A;  4JJN K;  3SWN A;  1KQS S;  4L5G A;  4LD6 A;  4C8Q D;  3OYI A;  3RKW A;  4KUD K;  2QTX A;  3JSC A;  2XDD A;  2KY9 A;  4M77 F;  4GY5 A;  1VQ9 A;  3NTI A;  3ZBD A;  3L42 A;  2AHJ B;  3CPW S;  5GAO r;  3CBP A;  3OBY A;  4PJO B;  3GNG A;  4JLG A;  3L1A A;  3RKX A;  2YRV A;  2M16 A;  4A4F A;  4OB2 B;  3CC4 T;  3PTA A;  4Y91 A;  3CMA A;  4BDZ A;  4M7A F;  1UGP B;  3GIB A;  1B34 A;  3CC2 A;  1RI0 A;  2RJC A;  3A8O B;  2DTH A;  3HHT B;  1JBM A;  2FL7 A;  4M75 A;  3OYG A;  4BE0 A;  1G5V A;  2X4W A;  2KSS A;  3CCS T;  2EFI A;  2DD4 A;  4ZGE B;  1QVF A;  3JCM V;  4KT0 E;  1U1T A;  2DEQ A;  4CI0 C;  3MEW A;  4E7L A;  3HPW A;  5I2S A;  2B8A A;  3G6E A;  4M7A G;  1OZ2 A;  2K5I A;  4Q5W A;  1D3B A;  1YIJ A;  4CRI A;  3V7C A;  4NOY A;  2E10 A;  2MMP A;  4JDS A;  2LVM A;  4A53 A;  4M77 E;  4OF1 A;  4QW2 A;  2FVU A;  3T9N A;  3CME T;  1N8R U;  2LC4 A;  1NJI U;  1H3Z A;  2E12 A;  2CYZ B;  4JRK A;  1O9S A;  3RKY A;  1Y71 A;  1Q7Y U;  2RHX A;  2EJ9 A;  4V2S A;  3C12 A;  4C92 D;  1X75 C;  2DVE A;  2RK2 A;  4J7F A;  2L89 A;  2E1H A;  3N5B B;  3FEO A;  4RCC A;  3CCQ T;  1LJO A;  5GAN 2;  2O4X B;  2XI9 A;  1YBY A;  4ME7 A;  5A0G A;  1OZ3 A;  4FM4 B;  3F70 A;  3X28 B;  4QQG A;  2PVG B;  1VQK T;  2WAC A;  4M7D A;  1I5L A;  1M1K C;  2QEX T;  4F7U B;  1NPR A;  2X4X A;  2DK3 A;  3MO8 A;  2CZ1 B;  1VQN A;  4EMG A;  1VUB A;  4FL6 A;  3HKS A;  2KQW A;  3RMQ A;  4RMO A;  1YHQ A;  4ZTF A;  3EAE A;  3H8Z A;  5CKD A;  5GAO m;  2ZCF B;  3A8G B;  5LJ5 j;  5GAO q;  2ZZD A;  3PIO A;  3L2Q A;  2DIG A;  5CR2 A;  1IZ6 A;  4BI8 B;  3PNW C;  4EPC A;  3OYE A;  1QVG S;  1QVG A;  2WSF E;  2JUF A;  5DY9 A;  2VUB A;  1BI1 A;  3CCR A;  2LCC A;  4QVC A;  4D6W A;  4PJO C;  1Y96 B;  1Y07 A;  1MGQ A;  4M77 C;  2LDM A;  5GAO n;  4KUL A;  3OS2 A;  2LQ8 A;  2FB7 A;  3ER0 A;  3JCM g;  1H64 1;  1VQ6 T;  3JCM J;  2DTI A;  5GAN h;  3M5A A;  3OYA A;  1FXX A;  3MP8 A;  3QDR B;  3CCV T;  4OMF B;  2EYQ A;  3OYF A;  2OTJ T;  2HAX A;  1ZBX A;  4PLI A;  1XTD A;  2QDY B;  2VXF A;  5D6X A;  3UDC A;  4PLL A;  4PJO D;  1VQ4 A;  1XQH A;  4FT2 A;  2EAY A;  2JTF A;  4M78 D;  4PNO A;  2QEX A;  3OYL A;  2QQ9 A;  5C0M A;  5KCO A;  4C8Q A;  1VQP T;  5DLQ E;  4B9X A;  3URG A;  2XDP A;  4EMK A;  1Y7X A;  4M77 B;  3HFN A;  4B9W A;  5GAN g;  2HNI A;  1M4Z A;  3MCA B;  1WNL A;  5A0L A;  1QVP A;  3V7R A;  3L2W A;  1YIT A;  1ZQ1 A;  3OYY A;  4OB1 B;  4M75 F;  2GF7 A;  1NZ9 A;  1N9S A;  2RI2 A;  2Y4Y A;  1AHJ B;  3EFR A;  2EJF A;  2PU9 B;  3PMI A;  4LDW A;  4RCB A;  4BY6 B;  3JB9 H;  1KC8 C;  5GAN d;  3M57 A;  3JAM E;  3PT9 A;  5A0D A;  3S3M A;  2JTM A;  4M75 D;  2QI2 A;  4C92 G;  4ZN3 A;  4RG8 A;  2CKK A;  5CKH A;  2WSC E;  4J7I A;  5IAY A;  5I21 A;  4OP0 A;  2ZPF B;  4JRI A;  3JCM c;  3VJP A;  2PUK B;  4MMK A;  5CKF A;  3JCM h;  3GNF B;  1WJQ A;  4II1 A;  3CCM T;  4PJO E;  1G3Y A;  3OMC A;  5DM7 R;  1K73 U;  3ME9 A;  1OYX A;  2RI5 A;  2V8I A;  4J6Y A;  5FU6 B;  3CC7 A;  2D6F A;  4FSX A;  4XU3 A;  4Y28 E;  3V8K A;  5A2Q E;  1Q86 C;  1G3W A;  5AYF A;  4C0Z A;  4PL6 A;  3PFS A;  5GAN 7;  3R6O A;  4HT8 A;  3MHX A;  3LWH A;  2KAF A;  3SWN B;  4LDU A;  4X9D A;  4RG2 A;  5LJ3 h;  4OGC A;  1U8R A;  2CZ0 B;  2QXF A;  3ZEH A;  2VV5 A;  1FWZ A;  2O4X A;  2OAU A;  3OYM A;  1PSF A;  4M7D F;  1WPY A;  1VQ9 T;  2YHT A;  3OSS C;  3EFS A;  3QO3 A;  5GMK i;  3LWI A;  1KD1 U;  2R5M A;  4F7U A;  3DB4 A;  3E9F A;  1G3T A;  1OI1 A;  1RL2 A;  3QHS A;  2RJD A;  2YLC A;  2JN0 A;  2DKG A;  1Q81 U;  5GAN f;  3Q1J A;  4J5Y A;  5FRM A;  3C4S A;  4R56 A;  1M1G A;  1KG1 A;  2XKO C;  3MET A;  2LNV A;  4A54 A;  5FRN A;  2A3L A;  5GAN 8;  3GF5 A;  3OA6 A;  2I2L A;  2RJE A;  2VGN A;  1N6A A;  5L8R E;  1LOJ A;  5GAM j;  4OGE A;  5GAO p;  2MAM A;  2RH2 A;  3JB9 I;  3J81 E;  4JS5 A;  3CCJ T;  3OYK A;  2KMT A;  4X34 A;  3HFO A;  4M78 G;  3WVD B;  2DXT A;  2P4T A;  1N27 A;  3M56 A;  4M77 G;  5CVI A;  1M1K U;  2LT4 A;  2MWO A;  4IUP A;  4PJO G;  3QJY A;  5HK0 A;  3GP8 A;  5FU6 C;  1WJS A;  4C92 F;  5GMK j;  5GAM g;  3CD6 A;  4BB7 A;  3PIP A;  1UB4 A;  1X6O A;  3QZ9 B;  4FU6 A;  4M78 F;  2K5L A;  3SFM A;  3LLR A;  3UT1 A;  5GAN e;  4E7H A;  1XNI A;  2PUO B;  3CMA T;  2LCL A;  2A7Y A;  4JLI A;  4VUB A;  1W4S A;  3PMT A;  3JCM b;  1YIT T;  5LL6 S;  4R55 A;  4EDU A;  4EMK B;  2DXC A;  3CCQ A;  2GFU A;  2FHD A;  2RHY A;  3V8J A;  4C8Q G;  2E65 A;  3QXE B;  4QVD A;  4DA4 A;  1I81 A;  4LDV A;  4M78 C;  1VQ4 T;  1G3S A;  2GQV A;  3CEY A;  3DB3 A;  3JRZ A;  4N4G A;  4XTX A;  1WGS A;  1I4K 1;  2DPP B;  3HRT A;  3L2V A;  1YJN A;  3RUX A;  2RI3 A;  3OYH A;  2OTJ A;  2L8D A;  2K5F A;  2EIF A;  1UGQ B;  4LDX A;  3M59 A;  2D9T A;  3UWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...