3HFOA

Crystal structure of an hfq protein from synechocystis sp.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
DSGLPSVRQVQLLIKDQTPVEIKLLTGDSLFGTIRWQDTDGLGLVDDSERSTIVRLAAIAYITPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ssr3341 protein
publication title Cyanobacteria contain a structural homologue of the Hfq protein with altered RNA-binding properties.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Rna binding protein
total genus 15
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hfoA00
4PJOD 3PGGA 3BW1A 3JCMW 3JCMX 4MMLA 5GAOq 4HT9A 4QVCA 4PJOC 5GAMe 4M75D 5GMKi 4NL3A 4F7UA 1KQ1A 2ZGWA 4V2SA 3RKWA 1N9SA 4M77F 4M77C 3RKXA 3M4GA 5GAMf 5GMKj 3VU3C 2YLCA 1LOJA 5LJ5d 4XTVA 3HFNA 4EMKB 4JLIA 4M7AF 4M7AC 4C8QF 1HXDA 2RM4A 3SWNC 2VXEA 4RCBA 5GAMg 3JB9H 3V7CA 2I2LA 4M78D 4Y91A 4M78C 3L2ZA 4N0AA 2RD1A 3QUIA 5LJ5j 4HA8A 5GMKl 1U1TA 2RA2A 3V7RA 3JCMe 3JB9F 5LJ3d 4M7DE 2DZCA 4EMGA 5GAN3 5GAOp 4EMKA 5GAN2 1N9RA 3INZA 4MMKA 1BIBA 2DZ9A 4PJOB 4PJOE 4QVDA 4A54A 1JRIA 4C92C 4C92F 5CAIA 5GAOm 4M7DG 4M75B 3JCMg 4M75E 5LJ3j 3EFSA 3RESA 1U1SA 4NOYA 4M77D 3JB9J 3L1AA 4XTWA 5GANj 4M7DA 3BFMA 2K57A 1JBMA 1HK9A 4PJOG 3JCMc 4F7UF 5I21A 4C8QD 1I8FA 4XTUA 4C8QC 2EWNA 3JB9I 4M7AD 4M75G 3JCMh 3SWNB 4DQ2A 1LJOA 5GMKh 4PJOA 2E64A 4OP0A 3HFOA 2E1HA 4M78B 4M75A 1X01A 3BDUA 4M78E 4X9CA 2EAYA 3JB9D 2Y90A 1I4K1 4NL2A 2DXUA 5GMKe 2FB7A 2E10A 1WPYA 4N0AC 1MGQA 5GAOr 2DTHA 4JUVA 3JCMf 3FJPA 2DTIA 5GAMd 3RKYA 3V7SA 5LJ5h 4M78G 2DVEA 5GMKm 4J5YA 5GAN4 4C92D 2EJFA 2FYKA 3JCMV 1WQWA 4HT8A 4EMHA 1WNLA 4X9DA 2EJ9A 4J6WA 4M78A 1TH7A 5LJ5e 5GANg 3QO3A 3RUXA 4M77B 3JCMP 4M77E 2EJGA 2QTXA 4XTZA 5GAMj 1D3BB 2RB6A 4F7UB 3QHSA 4M7AB 2E41A 5LJ3h 4C8QB 4XTYA 1B34B 4C8QE 5LJ5f 4M7AE 1I5LA 4M7DD 4M7DF 4M7DC 3BY7A 5GANh 3GIBA 4M77G 3JCMd 4PNOA 5LJ5g 1Y96B 2CGHA 4XU1A 4XU3A 5LJ3e 4XQ3A 4M7AG 3RIRA 2YHTA 4C8QG 5GAOn 3JCMQ 4XTXA 5DY9A 4PJOF 5GAN8 4M77A 5GANe 3V8LA 3HSBA 4J6YA 1D3BA 4M75F 4M75C 5LJ3f 4XU2A 4XU0A 4M7AA 3FB9A 4C8QA 1B34A 4RCCA 3SWNA 5GANf 3EFRA 1YCYA 3FIFA 3JB9G 4WF2A 4A53A 2DKGA 5LJ3g 4C92B 2DEQA 4C92E 4EMKC 3RERA 5GAN7 1Y96A 3V8KA 4JRKA 1LNXA 2HNIA 2DTOA 4J6XA 3JCMb 2E65A 2DJZA 3V8JA 4F7UE 5GAN6 1KQ2A 2YLBA 4M78F 4C92G 5GAN5 1H641 2VC8A 1I81A 5GAOl 2JN0A 4JRIA 4M7DB 5GAMh 1M5Q1 1M8VA 2VXFA 1WQ7A 3SB2A 1BIAA 4C92A 3AHUA 3JCMJ 3QSUA 5GANd 4F7UG 2DXTA
chains in the Genus database with same CATH superfamily
3BW1A 5GAOq 4RTZA 3QYGB 3ZL7C 3RKWA 1TWBA 4AFUC 3M4GA 2LP5A 1BCMA 2YLCA 2LTOA 4C8QF 4FIBA 1JEGA 2RM4A 2VB6A 5GAMg 1AWOA 2LCSA 2QDLA 1S1NA 3ZBDA 5HK0A 1H92A 4FT2A 1WHKA 5LJ5j 1XQHA 2L2PA 3CPWA 3G71Q 3MEVA 2C0TA 1N9RA 3TREA 5J3BA 3EAEA 1Q7YR 2YXYA 3JAME 2V26A 1PRMC 3S6WA 2FRWA 2KT1A 3QDFA 2OTLQ 1I8FA 2HBPA 4QW2A 3PIPA 2RHXA 4XK8E 2DX1A 2PTKA 3M5AA 2ED1A 1V1CA 1LCKA 1UUEA 3E9FA 4QKUA 2DK3A 1WHGA 1WI7A 5FROA 4C0GA 5GAOr 1Z9QA 4II1A 1ZBXA 1UECA 2KEAA 1KHIA 4C92D 2OJ2A 4J6WA 2CREA 3NTHA 3QO3A 4R55A 3HRUA 1WHHA 2DIGA 1G3YA 1ZSZB 2DLPA 3CPFA 1TOVA 4DOVA 3NTIA 2HKQB 1Q86C 2FPDA 2JTMA 1MHNA 2DL4A 3SFMA 2EPDA 1QKXA 3CCJT 3C95A 5GAOn 2VVKA 3CQTA 5IHNA 5GAN8 3HHTB 3M9QA 1YJ9Q 4C92B 4YTLA 2R5MA 3QJ6A 1NZ9A 1FWZA 1LNXA 3QXEB 5IH2A 3P8HA 4E7JA 3VS0A 2LC4A 3V8JA 3OMCA 1KQ2A 2D9TA 1VQLA 3OYMA 1NG2A 2A36A 4JRIA 3SB2A 2X4WA 3OQ5A 4XAXB 4PJOD 2FPEA 2V1QA 4E7HA 2ZGWA 2FZGB 2J7IA 4JLIA 1QVGS 4ATOA 4RTUA 1HJDA 2BIVA 1M3CA 2RHZA 4ZGDB 4ORZA 1UHCA 5GMKl 3V7RA 4J9FA 3RR6A 3T9NA 3I56T 3OYLA 3GP8A 4JZ4A 2KROA 1BIBA 1CKAA 1M2OA 4PJOB 1YN8A 4N4HA 3PMIA 4DBQA 2K57A 2MK5A 2ATCB 5CCAA 3OYNA 4E7LA 1VYTA 2LCCA 4M78E 4MZMA 1J3TA 1BYMA 4BACA 5GMKe 2MCNA 1K9MC 2RHUA 2FZKB 4LUEA 3JCMf 1MNEA 1OOTA 5LJ5h 1Y07A 3I5SA 2V1RA 2JZ2A 2EJFA 2FYKA 2BZXA 4DA4A 3C94A 1JJ2A 2VV5A 4DEYA 2EQUA 2MWOA 4KH0B 1VQ5Q 1H3ZA 1IHVA 4M77E 1NLOC 5GAMj 4DBFA 5L8RE 1NYFA 1VQ4Q 2V8JA 1VQNA 2YUQA 4KUDK 1QCNA 4A4FA 2PVGB 3JCMQ 5DY9A 2FEIA 4BI8B 2O4XA 2X51A 1WJSA 1D1BA 3M53A 1NJIU 1KQSA 4EMKC 1ARKA 4RMOA 2HCKA 2LNVA 1TG0A 1VQLQ 2DTOA 1PSFA 3QZ9B 1RAEB 4BE1A 3VS2A 4BE0A 1WIEA 2K3YA 1I81A 3MCAB 4PL6A 2FG0A 2GNCA 2DJQA 2OTLT 1TSFA 2Y4XA 1GCQC 2X3WD 5GMKi 2RF0A 4FYXB 1K8AR 2PVOB 1WHJA 4FYWB 3J7AF 1E6HA 3CPWS 3OW2A 3HP9A 2ROTA 4N4GA 4BY6C 1X43A 1YP5A 2QDYB 3L2RA 3CCUA 2CKKA 1I0CA 1PG5B 2DZ9A 2CP2A 4C92F 2QA4Q 4OGCA 1P92A 3F70A 1JBMA 4F7UF 3EGXA 2L3PA 1B7TA 1GL5A 3HKSA 5CKFA 4FCYA 1QWFA 5FU6B 1X01A 4KT0E 1PD0A 2QEXA 2JOYA 4OB3B 2DYBA 5J39A 1EIFA 5I22A 3JCMV 8AT1B 2CSIA 1W2BP 2J6KA 4OF1A 3S3NA 1PCXA 3TVTA 2XKOC 2P0KA 3OS1A 5KYXA 1VQNQ 3DB3A 4M7AE 1KC8R 4O6JA 4M7DF 1GCQA 3JCMd 4FYYB 1R77A 2L3SA 4PJOF 1X75C 3OYEA 3OSSC 2V8IA 4CRIA 2RQVA 3SHWA 3RERA 2MI6A 1QCOA 4PJMA 1T0HA 2DIQA 3CCVT 5M9OA 4BD3A 2BE7D 4J6XA 3KUFA 1O75A 1QLYA 4AG2C 5GAMh 2VXFA 4RG2A 2RQUA 4FSXA 3NGPA 3EGDA 2QQRA 2CH4A 5FU7C 1N9SA 3MEWA 4XTVA 3SD4A 3U23A 1B07A 2PQWA 1PNJA 3C12A 3CCUQ 4M78C 2RD1A 4KGXB 2KSSA 1R0BG 2ZPFB 1VQ5T 4C0DB 2DBMA 2EW3A 4C5EA 4PJNA 2YRCA 3TEEA 4MMKA 1VQMA 3X25B 5CAIA 1JRIA 1VQ4T 4QT7A 1ABQA 4ELYC 2OTJA 3L1AA 5KYYB 5GANj 1Q86U 2QEXQ 2B86A 3R6OA 1OV3A 4GLKA 2DMOA 4HVWA 1VQLT 2YSQA 4C5GA 3QBYA 3FEOA 1JJ2S 3CMAA 1GFDA 4C0ZA 3ZEHA 3FJPA 3VRYA 4JJDA 3RDVA 3M0SA 1WNLA 2RJCA 2F2XA 2AKLA 3M0PA 2ZPGB 2M1HA 5LJ5f 1WA7A 2HDAA 3GIBA 4O5VA 5HCKA 2CGHA 1IHWA 2FO0A 3CCSA 4XTXA 3RMQA 4J6YA 2KYMA 3P8DA 1UTIA 4XU2A 3L2VA 2WSEE 4WTOB 1YJNA 2KK4A 3OA6A 1AHJB 1ZA2B 3M55A 4J7FA 2DJZA 1UGRB 5KH6A 4IKFA 2K5FA 2QA4T 1IB8A 3S3OA 2ESWA 2HZYA 1QVFP 4WCIA 1YHQA 1Q82C 5C6SA 4AFSC 1GBRA 4M75D 3JSCA 3FC3A 3RKXA 1LOJA 2RO0A 1SSHA 3MHXA 1NBEB 4KBMB 3JB9H 3J81E 2ZAEA 3A8LB 2RK1A 1OQKA 4FSSA 1SHFA 4LN2A 4JS5A 4HA8A 1VQMQ 4ANJA 1BI0A 1M90R 2DZCA 4EMGA 3PT9A 1ZHIA 4LDUA 3R6NA 1SHGA 1X2QA 1VQNT 2E6NA 3OY9A 2OTJQ 3PVLA 1M27C 2LNHB 2JT4A 2CP3A 4M75B 6AT1B 5IT9E 2L3QA 2OI3A 4BDZA 2DL8A 2HKNA 1YBYA 4ZGEB 3VS6A 1PKSA 2K3XA 1WJRA 1FYNA 2EYZA 3G4SA 1OYXA 2FZCB 3CMAQ 1RACB 1M30A 5IHKA 2BUDA 2DXUA 4LD6A 2KNBB 1OULA 3CCQT 2M02A 1W2BA 1VQ8A 2C0OA 4E7ZA 1M1KU 1IO6A 2DVEA 3CBPA 2FHDA 1O9SA 2V8KA 3RUXA 4IUTA 1KC8C 2RB6A 2B8AA 2EVRA 2F2WA 3EG2A 7AT1B 3CCSQ 2KDSA 5GANh 1YI2A 1YIJQ 1LPLA 2YUOA 4BDYA 4LDYA 1W6XA 1YJNQ 4PKCC 3CCUT 3EGUA 3EG3A 1B34A 2P4TA 3EFOA 2JJ9A 1X2KA 1RUWA 1Q95G 1K0XA 4PLLA 1Y96A 2QASA 1KD1U 3WXMB 5DLOA 5DLQE 5A0DA 1YHQQ 3CCRA 3VS7A 4FW2A 1K9AA 5CVIA 2E5QA 1TTHB 1ZSGA 4LXCA 3CC7T 4V2SA 1FXXA 1XOVA 2HQEA 1K73U 5GAMf 5GMKj 1RADB 2O01E 2KRNA 3UF4A 1NE8A 2CP5A 9ATCB 1QMCA 3QDRB 1WFWA 4AFZC 1D1CA 2COWA 1U1TA 5D6WA 3JCMe 3LYIA 1WDXA 4J9HA 5LJ3d 4RTYA 2COZA 4HCBA 5KE3A 2K5LA 2XDDA 2EQKA 4QVDA 2GQVA 2MMPA 4X34A 2E3HA 3A98A 1M1KR 3GNFB 4KULA 3G4SQ 1IRXA 2CZ1B 4J9CA 2YRVA 2CP0A 2ZPEB 1VQ8Q 2KY9A 4OMOA 5CIUA 2Y90A 1WPYA 1MGQA 3DLMA 4PFPA 1WQWA 4JZ3A 2J6FA 2MWPA 1W4SA 1SG5A 1YI2Q 3VYHB 1X6BA 3CD6A 2E5KA 4MDXA 1OI1A 4VUBA 1I5LA 3BY7A 4IUVA 1KD1R 4R0KA 3A8OB 1Q81U 4Y92A 5KYWA 3CC2A 2IG0A 2E4HA 1BI3A 4AG1C 4C8QG 4M75F 4B9WA 2SEMA 1HD3A 3C4SA 4OMLA 4C8QA 1VQMT 1JB0E 2DKGA 2DM1A 2HNIA 4OB1B 2OTJT 3M57A 2EIFA 2YLBA 4J9EA 3CCRQ 1QVFA 2YWWA 2LQKA 3URGA 4OVAA 3VS5A 3EH2A 1MV3A 1V76A 1FMVA 3H0FA 1VQKA 3LLRA 1WXUA 4ZTFA 3REBB 2EGEA 4P5NA 2KQWA 1U8RA 2JMAA 4EMKB 1ZX6A 1JXOA 2OAUA 1C6VX 3SDZA 3NFCA 4X1VA 1UG1A 2ED0A 3C0CA 1AZGB 3EG9A 1RI0A 2RA2A 5KYXB 2DXCA 2DILA 2YT6A 4F17A 3M4YA 4J7IA 1WHMA 2DBKA 2QQ9A 2ROLA 3GNGA 3CCST 1YIJT 3HPWA 1I07A 1WGSA 2NUTA 3RESA 4CC4B 2LJ1A 3CCMA 1YJNT 1WZOA 2LT4A 1RLPC 1LJOA 5GMKh 2NUPB 1W2BS 2E64A 4BY6B 5KYUB 2EGCA 1FMKA 3VJPA 2O2OA 3GLXA 3OYIA 1G3SA 1KK7A 2DTIA 1MMGA 1YHQT 4J5YA 2W10A 3E19A 4L59A 3L2WA 4DOWA 3CD6Q 4RUGA 1TUDA 4AMCA 1MMNA 2AKKA 3OBWA 3CXCP 3CC2Q 2JS2A 2A0FB 1M1GA 3VYGA 1I5OB 4E7SA 1D3BA 4JRQA 2MAMA 5GANf 3FIFA 2ZZDA 4A53A 1X6OA 5GAN7 2BE9B 2FRYA 1X6GA 2IIMA 4E6RA 4ZNXA 2QK0A 3VS4A 1VQKQ 2DA9A 4E47A 3G4ST 5IAYA 3PFSA 2PU9B 3PNWC 4HT9A 2DD4A 1KQ1A 1VQ8T 2G6FX 3G71T 1HXDA 3RBBB 1QVPA 1PRLC 4LDWA 4J9GA 4M78D 1N8RC 2HMAA 1X27A 2PNIA 4RG8A 3M59A 1MUZA 2AK5A 1VQ9A 5CR2A 5GAN2 1PM3A 3H0HA 2RJFA 1X69A 1UJ0A 4A54A 1UGSB 4C92C 3CCMQ 3JCMg 4D8KA 2DVJA 3P8BB 4M77D 4TVRA 4JDSA 2Y4YA 5HY6A 4D8DA 1KHCA 4M78B 1ZUKA 4PLIA 3JB9D 2JXBA 1Y0MA 1Q7YC 3G6EA 2DETA 5CQXA 3CCRT 3DLLA 2HSEB 3I35A 3N5BB 4ME7A 2RK2A 3EHRA 4M77B 3VS1A 1OU9A 1T3LA 1YITA 3KXTA 4IIMA 2E41A 1AD5A 2GCXA 4FL6A 2XIDA 4M7DC 2F2VA 3L2UA 4GY5A 1YJ9T 3Q1JA 1Y57A 2GQIA 5LJ3e 2P4RA 2VGMA 2ZPIB 1TUGB 3D7SB 1ZSZA 1M1FA 4F14A 5HK3A 4EDUA 1QVFS 4Z8AA 4MZTA 1NJIR 1NLPC 1UHFA 5J26A 1Z9ZA 1M2VB 4C92G 2R5AA 2DFUA 4LE9A 2XG8D 5D6YA 4C92A 3PIOA 5GANd 4F7UG 2DPPB 4GBQA 3PMTA 4OGEA 4NL3A 1OZ2A 4F7UA 1BU1A 5D7UA 3VU3C 1OU8A 3M0UA 1IGQA 4HVUA 2JM8A 1MMDA 2DYIA 1QW1A 1VIFA 1U3OA 1PWTA 1VQ9Q 4ZGJB 1C1AA 4CC3A 3X28B 3A8HB 3CD6T 1RL2A 2CZ6B 3QKJA 4BE2A 3EG1A 4M7DG 3CCEA 3UA6A 4XTWA 1SKUB 4M7DA 1RI9A 2ZPBB 4PJOG 3JCMc 4Y28E 5I21A 4M7AD 5EG2A 4A4GA 2L5QA 1BI1A 4PJOA 4OP0A 4Z89A 3LW5E 1PKTA 1UFFA 3G6EQ 1D0XA 1AWXA 1SF9A 2D0NA 2GTJA 2JW4A 5IXFA 2KBTA 2XMFA 3RKYA 2HAXA 2M0OA 3NMZC 2GTOA 2QGGA 2JTEA 3LWHA 1VQKT 3EHQA 4HT8A 1YITQ 3MP8A 2EJ9A 3X20B 4PFZA 2QQBA 4ZN3A 1K1ZA 3M56A 4M7AB 4HCZA 4C8QE 1XJWB 1RLQC 2IVWA 5GJWB 1N6AA 4LDXA 1I1JA 4RTXA 2FL7A 3GBQA 3RIRA 2YHTA 1T3SA 2YUNA 2EKOA 2EFIA 5IHIA 2RHIA 1M8MA 4WF2A 4A4HA 5HKCA 3PTAA 2RQWA 3TQ7P 1U06A 4JRKA 2HEQA 1R8OB 5IXBA 2HL3A 4M78F 3O5ZA 3CCMT 1XTDA 1VIEA 2KMTA 3QZ5B 2RQRA 2DXTA 3CPWP 2JVVA 1CSKA 2ZCFB 4M77F 3QWXX 1AVZC 3SWNC 2VXEA 3PE0A 2DD5A 3QUIA 1NYGA 3JB9F 1OEBA 2AHJB 2AT1B 2KVQG 1WXBA 1VA7A 3KBGA 3CCEQ 1K8AC 4M4ZA 5GAOm 2H8HA 4C0FA 2K79A 4IURA 5AYFA 2LMJA 3META 1SRLA 2JMCA 1ZQ1A 4Q5WA 2GGRA 1GXIE 3CC4A 4FU6A 5C0MA 3M0TA 2QI2A 3E9GA 3QJYA 2EAYA 3OYBA 1JU5C 2QYZA 1I4K1 2MPXC 1Q86R 4KGZB 2DE0X 1K9MU 4ELZC 4N0AC 2DTHA 2QQSA 1RAFB 3X24B 3JCMP 2K9GA 4JJCA 2F1LA 3ULRB 1B3QA 5CKEA 1QP3A 2DL3A 2RI3A 5I11A 1VQOA 4OB2B 2KYBA 2XICA 3AT1B 4R56A 1VQ9T 2COYA 4KH1B 3SWNA 1NJIC 1RAAB 5LJ3g 2MYSA 2D1XA 1EFNA 2XD0A 1BI2A 1PSEA 1N8RU 4DBRA 3M0RA 3REAB 2H3EB 3JCMW 3JCMX 5FLXE 2E70A 3RNJA 4LNPA 1D09B 2O31A 5LJ5d 3VUZA 2O9SA 4M7AF 2RPNA 2HSPA 1YWPA 1VQPA 1UDLA 4Y91A 4N0AA 2JNGA 4HVVA 1IREB 1Q7YU 1GBQA 2LVMA 2DXBA 2LZ6B 2X4JA 3EG0A 4HKEA 1K9MR 2QEXT 1IZ6A 3UATA 1U1SA 2K5IA 2K4YA 3BFMA 3CC4Q 3QYHB 1HK9A 3WVEB 4C8QC 2EWNA 2BTTA 2RN8A 4DQ2A 2LX7A 2E1HA 1BB9A 4F04B 3MP1A 1VQ6A 4FM4B 4FYVB 3JRZA 1FX7A 1SRMA 2FB7A 4KUIA 3QG1A 1ZA1B 1AT1B 1W1FA 2C0IA 1AZEA 3RMSA 5GMKm 4IUPA 1WXTA 2BKDN 2O9VA 3I5RA 2O4XB 1KQSP 2XI9A 2E12A 1VQOQ 4CC7A 1VUBA 2HL5C 2KXDA 4PNOA 2CT4A 1H8KA 4XQ3A 1ZBJA 2MF2A 3HSBA 4IUQA 4M75C 2CUDA 2DAQA 1NPPA 1V29B 2PZ1A 1NM7A 3NHNA 4C92E 5I2MA 5CKDA 2J06A 1PD1A 4QQ6A 3CCET 2P0QA 2P84A 1G83A 4F7UE 2WSFE 4JLGA 4KGVB 3OW2P 1WX6A 3JCMJ 3OBYA 2F69A 1M3AA 1ABOA 3OMGA 4F16A 5FW9A 1ZUUA 4EPCA 4NS5A 3CCVA 2KAFA 2A37A 3CCLA 2JTFA 1VQPQ 3VKIA 4DBHA 4ESRA 3HRSA 1KG1A 2RJEA 3L42A 1QWEA 1K73R 1ACMB 2I2LA 4B9XA 1G5VA 4J9BA 2OAWA 2HQHA 2KRSA 4M7DE 2LT1A 4IIOA 3A8MB 5GAOp 3EGXB 3UDCA 1N27A 2EYWA 2KT8A 2HD0A 4PJOE 1SSFA 2EQIA 2J05A 5LJ3j 3H9NA 2YUPA 3CMAT 4NOYA 2X4XA 4CC2A 3TCJA 2LJ3A 4MZPA 1MV0B 4M75G 2EYYA 1VQ5A 2G3RA 5GJVB 3X26B 1VQ6Q 4GLMA 2RI2A 1M90C 2VYTA 2JS0A 2M9UA 4M75A 4AT1B 5KCOA 5L23A 1VQ4A 2E10A 2GFAA 2RHYA 5GAMd 1KSWA 1E7OA 1VYVA 4X9DA 1GCPA 3OYKA 2QTXA 1BKBA 4F7UB 8ATCB 4XTYA 4KRTA 2XDPA 2QGFB 3H6ZA 3M58A 1UGQB 4ZN1A 3LWIA 4M7DD 3HRTA 2DEUA 3ASKA 3CMEA 1D0YA 2M51A 1IXDA 1Q81R 1GFCA 5A2QE 1K76A 3FB9A 2CZ7B 4PK4A 3OYHA 1NEGA 1VOMA 3VS3A 2X3XD 1UGVA 2NLUA 2DO3A 1RAIB 4RTWA 3GF5A 2E65A 3EGDB 2CS7A 4Z88A 2VGNA 2VWFA 2XHCA 4J83A 2VC8A 1YCSB 3OYJA 4M7DB 3LH0A 1PC0A 2CP6A 3CC4T 1WQ7A 1ZUYA 1K0SA 3CCVQ 1Q82U 1K8AU 2FVUA 4D6WA 3CCLQ 1YJWA 2X9HA 3ZFJA 2LX9A 2YRDA 1JO8A 2QA4A 4RCBA 1BCOA 2QAZA 3UA7A 1WHLA 3L2ZA 2R57A 3H8ZA 2DL7A 3OYYA 2RI5A 2CH4W 1RABB 2RMOA 1VQOT 3SEMA 2RH2A 1E6GA 3MJXA 1CKBA 4OMQA 3OYDA 2HBWA 2CZ0B 1ZSZC 2ZPHB 4DEXA 5KCHA 1RAHB 1LVKA 3MO8A 3UT1A 1AEYA 2EGAA 1C0MA 5CK9A 3G7ZA 4MDWA 2MIOA 3H41A 3BDUA 1TXQA 1TS9A 4NL2A 1YI2T 3L2QA 4EIKA 4JUVA 1M1KC 2JUFA 2XDBA 4PFOA 2L89A 5FRMA 1JXMA 5FU7B 5LJ5e 5GANg 1KC8U 2EJGA 5LJ3h 5IN1A 3LH5A 2KRMA 3CMEQ 3CCQA 1S72A 1MMAA 3FRNA 5FWBA 1VQPT 3M0QA 1G3TA 4XU3A 4BUGA 3OS0A 1M9SA 4RKUE 1Q82R 1OZ3A 3EFRA 1YCYA 5CO7A 2JM9A 2W0ZA 3UWNA 2NWMA 3I55A 3NPFA 1KD1C 1SEMA 3VUBA 2A28A 1N5ZA 4OB0B 1G8XA 1W70A 2RNAA 3OS2A 1M5Q1 1M8VA 1YJWQ 3QSUA 2NUZA 1UJYA 2D6FA 1RAGB 4J9DA 4PJOC 2ECZA 1VQ6T 1VYUA 1TUCA 2AZSA 2M0YA 2CUBA 2M16A 1K73C 1KIKA 1QCFA 4RTTA 5CKBA 1D1AA 2BZ8A 2K2VA 3V7CA 1VQ7A 3VRZA 1AWJA 2MOXA 1K4US 3CC7A 2I0NA 3WVDB 1DJ7B 2EKHA 2XU8A 3BE3A 3MEAA 3MEUA 3O8VA 4EMKA 4JRPA 1QVGP 4L5GA 4N4IA 5CQYA 1Y7XA 2L3RA 2KR3A 2X4YA 3EFSA 1D0ZA 4E7KA 4PJLA 4UC4A 4BI3A 2CSQA 4FW1A 2LQ8A 5D6XA 2H3JA 2K3BA 3GPLA 3SWNB 1OX8A 5FWCA 2OX7A 4ZTJA 2YDLA 2QTVA 4J8OA 4CI0C 4J9IA 1F1BB 2EBPA 4AFQC 2A3LA 3CBOA 3V7SA 1MNDA 3CC2T 1UEBA 2Z0WA 5GAN4 2CYZB 1TU0B 2NUPA 2DF6A 2D0QB 2J6OA 5KYUA 1QKWA 3OS5A 4XTZA 3CCQQ 1S72Q 3CCLT 3ME9A 1B34B 3EFOB 1YFNA 5A0LA 1Q81C 1EZZB 1Y96B 2WSCE 2LRQA 2KI7A 2GF7A 2D8HA 3LX7A 4HXJA 5DM7R 2CT3A 2L0AA 4XU0A 3I55Q 4RCCA 5KYNA 3KFVA 3IQLA 4LD9K 3CXCA 3V8KA 2KGTA 2PVDB 3JCMb 2K7AA 4A63B 5ECAA 1G2BA 4PJJA 3J80E 1AWWA 4JJNK 2GFUA 4HCCA 2QXFA 4JS4A 3GOXA 2R58A 5AT1B 3AHUA 2VKNA 3PVQA 4BB7A 4OMFB 3OYAA 3UPUA 4MMLA 1OPLA 2AZVA 5GAMe 3CBMA 2EYQA 2PUOB 3FJ5A 3MKDA 4C5IA 4M77C 3TU4K 1VQ7Q 1AOJA 1T0JA 3OSVA 3NTKA 1M90U 3QPHA 5KE2A 5FU6C 3CCJA 3CC7Q 3TSWA 4QQDA 1UGPB 2RQTA 3OYFA 2VASA 2L8DA 1Y71A 4B6MA 3CMET 4K11A 1WYXA 4M75E 2A7YA 3JB9J 4C8QD 4XTUA 2DL5A 4FT4A 2A08A 1BK2A 1M3BA 1ZLMA 3BDLA 1U5SA 3HFOA 3ER0A 3E1SA 4X9CA 1YIJA 1KQSS 1R0CB 1FMWA 3TSZA 4M78G 1UB4A 3OYGA 3H0IA 3I9QA 5KYWB 4E2FB 1YJWT 4JPBW 4M78A 2EYXA 1TH7A 2LJ0A 2K6DA 3HL8A 1WLPB 2DRMA 3FDRA 4C8QB 1PHTA 2PUKB 1JQQA 3I56A 4M77G 2F5TX 5LJ5g 1XNIA 1IGUA 2KE9A 4XU1A 4M77A 3V8LA 3HTRA 5LJ3f 3QIIA 3OW2S 2DERA 5I2SA 3JB9G 1QP2A 1OX9A 2BZYA 1QQJA 2DEQA 4LUDA 3OYCA 5A0GA 1NEBA 3OB9A 2CP7A 5EC7A 2JN0A 3CEYA 4C0DC 2NYSA 1BIAA 3A1PA 4A4KA 1BBZA 2GBQA 2P0PA 3PGGA 4QVCA 2EQMA 2KXCA 1M4ZA 2CDTA 3EG9B 1M2VA 3MP6A 4QVZA 1HYOA 4C5HA 2SRCA 3HFNA 3MPUB 4M7AC 2K2MA 3CCJQ 2XK0A 2NUTB 3QWYA 4IUUA 2LQNA 1QVGA 2LCLA 2LDMA 1KFZA 4Z02A 3LGFA 1S72T 5GAN3 2X35A 2EQJA 1OPKA 3INZA 2QQAA 3EH1A 2AIRB 3M54A 3G71A 1GRIA 1HSQA 1YWOA 4RTVA 2DNUA 3G6ET 4OMMA 3JB9I 1A0NB 2E6ZA 3G1JA 2QG9B 3JCMh 3I55T 1SPKA 5CKHA 2OTLA 2E3IA 2ENMA 3JV3A 2HQXA 1YITT 4E7IA 3A5ZB 4HCKA 2IPOB 2LQWA 3DB4A 4EMHA 3LGLA 1D3BB 3I56Q 3QHSA 2F5KA 1JJ2P 5FRNA 1WJQA 4LDVA 2RJDA 5LL6S 3FLGA 4M7AG 2D8JA 2O88A 2VUBA 1VQ7T 4A4EA 5KYYA 2DRKA 5GANe 2WACA 3CXCS 2FPFA 4OMNA 4M7AA 1UE9A 4L6V5 1KJWA 4QQGA 3VV0A 1EX4A 3DKMA 1YNZA 4OMPA 1G3WA 1YJ9A 5GAN6 4JJBA 3THKA 5GAN5 1H3HA 1H641 5GAOl 3S3MA 1NPRA 4BI4A 1N8RR 2C06A 3A8GB 2ABLA 3E2UA
chains in the Genus database with same CATH topology
5C6SA 3BW1A 2FVUA 5GAOq 4D6WA 1YJWA 3QYGB 4M75D 3PMTA 4OGEA 3ZFJA 1OZ2A 4NL3A 4F7UA 3JSCA 2LX9A 3RKWA 3FC3A 3RKXA 3M4GA 3VU3C 2YLCA 1LOJA 2RO0A 2LTOA 4C8QF 4FIBA 2QA4A 2RM4A 3MHXA 4RCBA 1QW1A 4KBMB 5GAMg 3JB9H 3J81E 3A8LB 3ZBDA 1VIFA 5HK0A 2RK1A 3L2ZA 4FT2A 4ZGJB 5LJ5j 4HA8A 4JS5A 3X28B 1XQHA 2R57A 3A8HB 3CD6T 3CPWA 1BI0A 3H8ZA 1RL2A 2DZCA 4EMGA 3PT9A 2CZ6B 3MEVA 3OYYA 3QKJA 1ZHIA 2RI5A 1N9RA 4LDUA 4BE2A 3TREA 1VQNT 5J3BA 2E6NA 3OY9A 1VQOT 3EAEA 3JAME 4M7DG 2RH2A 4M75B 3CCEA 3S6WA 5IT9E 4BDZA 4XTWA 3OYDA 4M7DA 2CZ0B 1YBYA 2ZPBB 4PJOG 4Y28E 3JCMc 5I21A 1I8FA 2HBPA 2ZPHB 4QW2A 5EG2A 4A4GA 4ZGEB 5KCHA 2L5QA 2K3XA 3MO8A 3PIPA 2RHXA 4XK8E 3UT1A 1BI1A 1WJRA 3M5AA 3G4SA 4PJOA 4OP0A 5CK9A 1OYXA 3G7ZA 4MDWA 3LW5E 3E9FA 3BDUA 2BUDA 4NL2A 2DXUA 2DK3A 4LD6A 5FROA 4C0GA 3CCQT 5GAOr 3L2QA 1YI2T 1W2BA 1VQ8A 4II1A 4JUVA 1M1KU 3RKYA 2HAXA 1M1KC 1ZBXA 2DVEA 2M0OA 1KHIA 3CBPA 4C92D 3LWHA 1VQKT 4HT8A 2JUFA 2FHDA 2XDBA 3MP8A 2L89A 2EJ9A 1O9SA 2V8KA 3NTHA 4J6WA 5FU7B 3QO3A 4IUTA 3HRUA 3RUXA 3X20B 5LJ5e 5GANg 2DIGA 2EJGA 4R55A 1G3YA 2QQBA 4ZN3A 2RB6A 3CPFA 2B8AA 3M56A 4M7AB 5LJ3h 4HCZA 5IN1A 4C8QE 4DOVA 4JRPA 3NTIA 2KDSA 5GANh 2IVWA 3CCQA 1YI2A 1S72A 1Q86C 2JTMA 3FRNA 1N6AA 1MHNA 4BDYA 1VQPT 4LDXA 3SFMA 1G3TA 4XU3A 2FL7A 4LDYA 3RIRA 2YHTA 3C95A 5GAOn 3CCJT 5GAN8 4BUGA 4PKCC 3CCUT 3HHTB 2EKOA 3OS0A 1M9SA 4RKUE 1B34A 1OZ3A 2P4TA 2EFIA 3M9QA 2RHIA 1YCYA 3EFRA 4WF2A 5CO7A 4A4HA 3UWNA 4C92B 5HKCA 4YTLA 3PTAA 4PLLA 3I55A 1Y96A 2R5MA 3QJ6A 1NZ9A 1FWZA 1LNXA 3QXEB 4JRKA 3P8HA 4E7JA 1R8OB 3WXMB 1KD1U 1KD1C 2LC4A 5DLOA 3V8JA 3OMCA 1KQ2A 4M78F 5DLQE 2D9TA 3CCMT 3VUBA 1VQLA 5A0DA 4OB0B 3OYMA 4JRIA 1XTDA 1VIEA 3OS2A 1M5Q1 2KMTA 1M8VA 3SB2A 3CCRA 3QSUA 3QZ5B 2D6FA 2X4WA 3OQ5A 2DXTA 4XAXB 4PJOD 4PJOC 1VQ6T 5CVIA 2JVVA 2E5QA 4E7HA 3CC7T 2ZCFB 2ZGWA 1FXXA 4V2SA 1XOVA 2HQEA 4M77F 1K73U 5GAMf 1K73C 2M16A 5GMKj 5CKBA 4JLIA 1QVGS 2O01E 3SWNC 1NE8A 2VXEA 2K2VA 4ATOA 3V7CA 2DD5A 2BIVA 1VQ7A 4ZGDB 2RHZA 3QDRB 3QUIA 5D6WA 5GMKl 1U1TA 3V7RA 3JCMe 3LYIA 2AHJB 3JB9F 5LJ3d 2KVQG 4HCBA 3T9NA 3CC7A 3I56T 4EMKA 3WVDB 1DJ7B 3OYLA 2XU8A 3MEAA 2K5LA 3KBGA 3MEUA 3O8VA 5KE3A 2EQKA 2XDDA 1BIBA 3GP8A 1K8AC 4L5GA 4N4IA 4PJOB 5CQYA 4QVDA 2GQVA 2MMPA 5GAOm 1Y7XA 2L3RA 4X34A 4C0FA 2X4YA 3EFSA 4N4HA 4IURA 5AYFA 4E7KA 3META 3GNFB 4KULA 4UC4A 3PMIA 4BI3A 1ZQ1A 2K57A 2LQ8A 4Q5WA 1GXIE 5D6XA 2H3JA 2CZ1B 3GPLA 3SWNB 5CCAA 2YRVA 3CC4A 4FU6A 3OYNA 4ZTJA 4E7LA 5C0MA 2QI2A 2ZPEB 3E9GA 2LCCA 3QJYA 4J8OA 4M78E 2KY9A 4MZMA 2EAYA 5CIUA 4CI0C 3OYBA 2Y90A 1BYMA 1I4K1 4BACA 5GMKe 1K9MU 4ELZC 1WPYA 2A3LA 1MGQA 2RHUA 4N0AC 2DTHA 3CBOA 3JCMf 1K9MC 3V7SA 2QQSA 5LJ5h 1Y07A 3CC2T 1UEBA 5GAN4 2CYZB 3DLMA 2JZ2A 2EJFA 2FYKA 3X24B 4DA4A 1WQWA 3C94A 1JJ2A 2D0QB 2VV5A 2EQUA 2MWOA 3JCMP 1H3ZA 2MWPA 3OS5A 4M77E 1W4SA 4XTZA 5GAMj 3CCLT 3VYHB 3ME9A 1B34B 3CD6A 4MDXA 1OI1A 4VUBA 5L8RE 5CKEA 1I5LA 5A0LA 3BY7A 4IUVA 1QP3A 3A8OB 1Q81U 2V8JA 1Q81C 1VQNA 2RI3A 1Y96B 4KUDK 3CC2A 1VQOA 2WSCE 2LRQA 4OB2B 2IG0A 4A4FA 1BI3A 2GF7A 2PVGB 2XICA 5DY9A 4C8QG 3JCMQ 3LX7A 4BI8B 5DM7R 2O4XA 4M75F 4B9WA 4XU0A 4R56A 3C4SA 4C8QA 1WJSA 1VQ9T 4RCCA 3SWNA 1VQMT 3M53A 1NJIU 1JB0E 1NJIC 2DKGA 1KQSA 5LJ3g 4LD9K 4EMKC 4RMOA 3CXCA 5FRMA 2LNVA 3V8KA 2PVDB 2HNIA 2DTOA 1PSFA 3QZ9B 3JCMb 4OB1B 2XD0A 1BI2A 2OTJT 3M57A 2EIFA 1PSEA 4BE1A 1N8RU 2YLBA 1QVFA 3J80E 4BE0A 2K3YA 1I81A 4JJNK 3MCAB 2LQKA 3URGA 4OVAA 2GFUA 4HCCA 2QXFA 4JS4A 4PL6A 3GOXA 2R58A 3AHUA 2OTLT 4BB7A 4OMFB 2Y4XA 3OYAA 3UPUA 1VQKA 3JCMW 3JCMX 4MMLA 5FLXE 2E70A 3LLRA 5GAMe 5GMKi 4ZTFA 3CBMA 2EYQA 2PUOB 2PVOB 4P5NA 2KQWA 4C5IA 1U8RA 4M77C 5LJ5d 3VUZA 4EMKB 4M7AF 3TU4K 2OAUA 3SDZA 3NFCA 3J7AF 3CPWS 3OW2A 3OSVA 1VQPA 3HP9A 3NTKA 1M90U 4N4GA 3QPHA 4BY6C 5KE2A 5FU6C 4Y91A 3CCJA 4N0AA 2JNGA 2QDYB 3L2RA 1RI0A 4QQDA 2RA2A 1IREB 1UGPB 3OYFA 3CCUA 1Q7YU 2DXCA 2CKKA 2LVMA 2DXBA 2L8DA 1Y71A 3M4YA 4J7IA 2X4JA 3CMET 2DZ9A 2QQ9A 3GNGA 4HKEA 3CCST 1YIJT 3HPWA 4C92F 2QEXT 1WGSA 1IZ6A 4M75E 2A7YA 4OGCA 1U1SA 2K5IA 3RESA 3JB9J 1P92A 2K4YA 3BFMA 3F70A 3QYHB 1JBMA 1HK9A 4F7UF 3CCMA 1YJNT 4C8QD 4XTUA 3WVEB 2EWNA 4C8QC 4FT4A 4DQ2A 2LT4A 1LJOA 5GMKh 3BDLA 1W2BS 2E64A 3HKSA 5CKFA 4BY6B 3HFOA 3ER0A 2E1HA 5FU6B 3E1SA 4X9CA 1X01A 3MP1A 4KT0E 3VJPA 1VQ6A 4FM4B 3GLXA 3JRZA 1YIJA 1KQSS 1FX7A 3OYIA 2QEXA 2JOYA 4OB3B 2FB7A 1G3SA 4KUIA 3QG1A 5J39A 2DTIA 1EIFA 4M78G 1UB4A 1YHQT 3RMSA 4J5YA 5GMKm 3E19A 4L59A 3OYGA 3L2WA 3JCMV 4DOWA 4IUPA 1YJWT 2BKDN 3S3NA 4OF1A 4M78A 1TH7A 2XKOC 2P0KA 3OS1A 2O4XB 3HL8A 3FDRA 4M7AE 2XI9A 3DB3A 2E12A 3OBWA 4C8QB 4O6JA 4M7DF 2PUKB 1VUBA 3I56A 4M77G 4M7DD 3JCMd 2F5TX 4PNOA 5LJ5g 1XNIA 1M1GA 4XU1A 3VYGA 4XQ3A 2MF2A 1X75C 4PJOF 3OSSC 4M77A 2V8IA 3V8LA 4IUQA 4CRIA 3OYEA 3HSBA 1D3BA 4M75C 5LJ3f 4JRQA 2DAQA 1NPPA 2MAMA 3QIIA 3OW2S 1V29B 5GANf 5I2SA 3FIFA 3JB9G 2ZZDA 4A53A 1X6OA 1QP2A 3RERA 2DEQA 2MI6A 4C92E 5I2MA 5GAN7 5CKDA 3OYCA 2DIQA 3CCVT 5A0GA 4BD3A 4QQ6A 5M9OA 1KC8U 1K8AU 2P0QA 3CCET 4J6XA 3OB9A 3KUFA 1O75A 4F7UE 2WSFE 4JLGA 2JN0A 3CEYA 4C0DC 5GAMh 2VXFA 4RG2A 4E47A 1BIAA 4A4KA 3G4ST 3JCMJ 5IAYA 3OBYA 3PFSA 2F69A 4FSXA 3PGGA 2P0PA 2PU9B 3OMGA 3PNWC 4HT9A 4QVCA 2DD4A 2QQRA 2EQMA 4EPCA 4NS5A 3CCVA 1M4ZA 1KQ1A 5FU7C 3MP6A 1N9SA 2KAFA 3MEWA 4QVZA 1VQ8T 3CCLA 4C5HA 2JTFA 4XTVA 3SD4A 3G71T 3HFNA 3VKIA 4M7AC 1HXDA 3HRSA 1KG1A 1QVPA 2PQWA 2RJEA 3L42A 2XK0A 4LDWA 1KC8C 3C12A 2I2LA 4M78D 4B9XA 1N8RC 4M78C 1G5VA 4IUUA 2RD1A 2KSSA 1QVGA 2LCLA 2LDMA 2ZPFB 4RG8A 4Z02A 3M59A 2LT1A 4C0DB 1VQ5T 3LGFA 4M7DE 3A8MB 4C5EA 1S72T 5GAN3 5GAOp 1VQ9A 5CR2A 2X35A 2EQJA 3TEEA 3INZA 4MMKA 3UDCA 2QQAA 5GAN2 2RJFA 1VQMA 1N27A 3M54A 2HD0A 3X25B 3G71A 4PJOE 4A54A 1JRIA 1UGSB 1SSFA 4C92C 5CAIA 1VQ4T 3JCMg 5LJ3j 3CMAT 4ELYC 4NOYA 3P8BB 4M77D 3G6ET 2X4XA 2OTJA 3L1AA 4TVRA 5GANj 3TCJA 4MZPA 3JB9I 2E6ZA 4JDSA 4M75G 2Y4YA 3JCMh 5HY6A 1VQ5A 2G3RA 3X26B 5CKHA 3I55T 2RI2A 1Q86U 2OTLA 3R6OA 1M90C 2VYTA 4GLKA 1KHCA 2HQXA 2M9UA 4M78B 4M75A 1YITT 4PLIA 4E7IA 3JB9D 1VQLT 5KCOA 4C5GA 3QBYA 1VQ4A 3A5ZB 3FEOA 1Q7YC 2E10A 1JJ2S 3CMAA 4C0ZA 3ZEHA 2GFAA 3G6EA 3FJPA 2RHYA 5CQXA 5GAMd 3CCRT 3DLLA 3DB4A 3N5BB 4ME7A 4M7AD 4EMHA 1WNLA 4X9DA 2RK2A 3OYKA 2RJCA 4M77B 3LGLA 2QTXA 1D3BB 1BKBA 1YITA 4F7UB 2ZPGB 3QHSA 2M1HA 2E41A 5LJ5f 3KXTA 2F5KA 4XTYA 5FRNA 2GCXA 2XDPA 3M58A 3H6ZA 2XIDA 1UGQB 4FL6A 4ZN1A 1WJQA 3LWIA 4M7DC 3HRTA 3GIBA 3L2UA 4O5VA 4GY5A 4LDVA 2RJDA 5LL6S 1YJ9T 3ASKA 3Q1JA 2CGHA 3FLGA 5LJ3e 3CMEA 4M7AG 3CCSA 2VGMA 2VUBA 2ZPIB 1VQ7T 4A4EA 4XTXA 3RMQA 5GANe 4J6YA 2WACA 3CXCS 3P8DA 5A2QE 4XU2A 1M1FA 4M7AA 3FB9A 5HK3A 3L2VA 4EDUA 2WSEE 4L6V5 1YJNA 2CZ7B 2KK4A 4QQGA 3VV0A 1QVFS 3OYHA 3OA6A 3DKMA 1AHJB 1G3WA 2NLUA 2DO3A 4MZTA 3GF5A 2E65A 3M55A 4J7FA 1YJ9A 2DJZA 2CS7A 1UGRB 2VGNA 5J26A 5GAN6 2XHCA 4C92G 5KH6A 5GAN5 1H641 2K5FA 4J83A 4IKFA 2VC8A 2QA4T 3OYJA 2R5AA 5GAOl 3S3OA 4M7DB 3LH0A 3S3MA 1NPRA 2XG8D 4BI4A 5D6YA 3CC4T 2C06A 1WQ7A 3A8GB 4C92A 3PIOA 5GANd 4F7UG 1YHQA 1Q82U 2DPPB 1Q82C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO D;  3PGG A;  3BW1 A;  3JCM W;  3JCM X;  4MML A;  5GAO q;  4HT9 A;  4QVC A;  4PJO C;  5GAM e;  4M75 D;  5GMK i;  4NL3 A;  4F7U A;  1KQ1 A;  2ZGW A;  4V2S A;  3RKW A;  1N9S A;  4M77 F;  4M77 C;  3RKX A;  3M4G A;  5GAM f;  5GMK j;  3VU3 C;  2YLC A;  1LOJ A;  5LJ5 d;  4XTV A;  3HFN A;  4EMK B;  4JLI A;  4M7A F;  4M7A C;  4C8Q F;  1HXD A;  2RM4 A;  3SWN C;  2VXE A;  4RCB A;  5GAM g;  3JB9 H;  3V7C A;  2I2L A;  4M78 D;  4Y91 A;  4M78 C;  3L2Z A;  4N0A A;  2RD1 A;  3QUI A;  5LJ5 j;  4HA8 A;  5GMK l;  1U1T A;  2RA2 A;  3V7R A;  3JCM e;  3JB9 F;  5LJ3 d;  4M7D E;  2DZC A;  4EMG A;  5GAN 3;  5GAO p;  4EMK A;  5GAN 2;  1N9R A;  3INZ A;  4MMK A;  1BIB A;  2DZ9 A;  4PJO B;  4PJO E;  4QVD A;  4A54 A;  1JRI A;  4C92 C;  4C92 F;  5CAI A;  5GAO m;  4M7D G;  4M75 B;  3JCM g;  4M75 E;  5LJ3 j;  3EFS A;  3RES A;  1U1S A;  4NOY A;  4M77 D;  3JB9 J;  3L1A A;  4XTW A;  5GAN j;  4M7D A;  3BFM A;  2K57 A;  1JBM A;  1HK9 A;  4PJO G;  3JCM c;  4F7U F;  5I21 A;  4C8Q D;  1I8F A;  4XTU A;  4C8Q C;  2EWN A;  3JB9 I;  4M7A D;  4M75 G;  3JCM h;  3SWN B;  4DQ2 A;  1LJO A;  5GMK h;  4PJO A;  2E64 A;  4OP0 A;  3HFO A;  2E1H A;  4M78 B;  4M75 A;  1X01 A;  3BDU A;  4M78 E;  4X9C A;  2EAY A;  3JB9 D;  2Y90 A;  1I4K 1;  4NL2 A;  2DXU A;  5GMK e;  2FB7 A;  2E10 A;  1WPY A;  4N0A C;  1MGQ A;  5GAO r;  2DTH A;  4JUV A;  3JCM f;  3FJP A;  2DTI A;  5GAM d;  3RKY A;  3V7S A;  5LJ5 h;  4M78 G;  2DVE A;  5GMK m;  4J5Y A;  5GAN 4;  4C92 D;  2EJF A;  2FYK A;  3JCM V;  1WQW A;  4HT8 A;  4EMH A;  1WNL A;  4X9D A;  2EJ9 A;  4J6W A;  4M78 A;  1TH7 A;  5LJ5 e;  5GAN g;  3QO3 A;  3RUX A;  4M77 B;  3JCM P;  4M77 E;  2EJG A;  2QTX A;  4XTZ A;  5GAM j;  1D3B B;  2RB6 A;  4F7U B;  3QHS A;  4M7A B;  2E41 A;  5LJ3 h;  4C8Q B;  4XTY A;  1B34 B;  4C8Q E;  5LJ5 f;  4M7A E;  1I5L A;  4M7D D;  4M7D F;  4M7D C;  3BY7 A;  5GAN h;  3GIB A;  4M77 G;  3JCM d;  4PNO A;  5LJ5 g;  1Y96 B;  2CGH A;  4XU1 A;  4XU3 A;  5LJ3 e;  4XQ3 A;  4M7A G;  3RIR A;  2YHT A;  4C8Q G;  5GAO n;  3JCM Q;  4XTX A;  5DY9 A;  4PJO F;  5GAN 8;  4M77 A;  5GAN e;  3V8L A;  3HSB A;  4J6Y A;  1D3B A;  4M75 F;  4M75 C;  5LJ3 f;  4XU2 A;  4XU0 A;  4M7A A;  3FB9 A;  4C8Q A;  1B34 A;  4RCC A;  3SWN A;  5GAN f;  3EFR A;  1YCY A;  3FIF A;  3JB9 G;  4WF2 A;  4A53 A;  2DKG A;  5LJ3 g;  4C92 B;  2DEQ A;  4C92 E;  4EMK C;  3RER A;  5GAN 7;  1Y96 A;  3V8K A;  4JRK A;  1LNX A;  2HNI A;  2DTO A;  4J6X A;  3JCM b;  2E65 A;  2DJZ A;  3V8J A;  4F7U E;  5GAN 6;  1KQ2 A;  2YLB A;  4M78 F;  4C92 G;  5GAN 5;  1H64 1;  2VC8 A;  1I81 A;  5GAO l;  2JN0 A;  4JRI A;  4M7D B;  5GAM h;  1M5Q 1;  1M8V A;  2VXF A;  1WQ7 A;  3SB2 A;  1BIA A;  4C92 A;  3AHU A;  3JCM J;  3QSU A;  5GAN d;  4F7U G;  2DXT A; 
#chains in the Genus database with same CATH topology
 3BW1 A;  5GAO q;  4RTZ A;  3QYG B;  3ZL7 C;  3RKW A;  1TWB A;  4AFU C;  3M4G A;  2LP5 A;  1BCM A;  2YLC A;  2LTO A;  4C8Q F;  4FIB A;  1JEG A;  2RM4 A;  2VB6 A;  5GAM g;  1AWO A;  2LCS A;  2QDL A;  1S1N A;  3ZBD A;  5HK0 A;  1H92 A;  4FT2 A;  1WHK A;  5LJ5 j;  1XQH A;  2L2P A;  3CPW A;  3G71 Q;  3MEV A;  2C0T A;  1N9R A;  3TRE A;  5J3B A;  3EAE A;  1Q7Y R;  2YXY A;  3JAM E;  2V26 A;  1PRM C;  3S6W A;  2FRW A;  2KT1 A;  3QDF A;  2OTL Q;  1I8F A;  2HBP A;  4QW2 A;  3PIP A;  2RHX A;  4XK8 E;  2DX1 A;  2PTK A;  3M5A A;  2ED1 A;  1V1C A;  1LCK A;  1UUE A;  3E9F A;  4QKU A;  2DK3 A;  1WHG A;  1WI7 A;  5FRO A;  4C0G A;  5GAO r;  1Z9Q A;  4II1 A;  1ZBX A;  1UEC A;  2KEA A;  1KHI A;  4C92 D;  2OJ2 A;  4J6W A;  2CRE A;  3NTH A;  3QO3 A;  4R55 A;  3HRU A;  1WHH A;  2DIG A;  1G3Y A;  1ZSZ B;  2DLP A;  3CPF A;  1TOV A;  4DOV A;  3NTI A;  2HKQ B;  1Q86 C;  2FPD A;  2JTM A;  1MHN A;  2DL4 A;  3SFM A;  2EPD A;  1QKX A;  3CCJ T;  3C95 A;  5GAO n;  2VVK A;  3CQT A;  5IHN A;  5GAN 8;  3HHT B;  3M9Q A;  1YJ9 Q;  4C92 B;  4YTL A;  2R5M A;  3QJ6 A;  1NZ9 A;  1FWZ A;  1LNX A;  3QXE B;  5IH2 A;  3P8H A;  4E7J A;  3VS0 A;  2LC4 A;  3V8J A;  3OMC A;  1KQ2 A;  2D9T A;  1VQL A;  3OYM A;  1NG2 A;  2A36 A;  4JRI A;  3SB2 A;  2X4W A;  3OQ5 A;  4XAX B;  4PJO D;  2FPE A;  2V1Q A;  4E7H A;  2ZGW A;  2FZG B;  2J7I A;  4JLI A;  1QVG S;  4ATO A;  4RTU A;  1HJD A;  2BIV A;  1M3C A;  2RHZ A;  4ZGD B;  4ORZ A;  1UHC A;  5GMK l;  3V7R A;  4J9F A;  3RR6 A;  3T9N A;  3I56 T;  3OYL A;  3GP8 A;  4JZ4 A;  2KRO A;  1BIB A;  1CKA A;  1M2O A;  4PJO B;  1YN8 A;  4N4H A;  3PMI A;  4DBQ A;  2K57 A;  2MK5 A;  2ATC B;  5CCA A;  3OYN A;  4E7L A;  1VYT A;  2LCC A;  4M78 E;  4MZM A;  1J3T A;  1BYM A;  4BAC A;  5GMK e;  2MCN A;  1K9M C;  2RHU A;  2FZK B;  4LUE A;  3JCM f;  1MNE A;  1OOT A;  5LJ5 h;  1Y07 A;  3I5S A;  2V1R A;  2JZ2 A;  2EJF A;  2FYK A;  2BZX A;  4DA4 A;  3C94 A;  1JJ2 A;  2VV5 A;  4DEY A;  2EQU A;  2MWO A;  4KH0 B;  1VQ5 Q;  1H3Z A;  1IHV A;  4M77 E;  1NLO C;  5GAM j;  4DBF A;  5L8R E;  1NYF A;  1VQ4 Q;  2V8J A;  1VQN A;  2YUQ A;  4KUD K;  1QCN A;  4A4F A;  2PVG B;  3JCM Q;  5DY9 A;  2FEI A;  4BI8 B;  2O4X A;  2X51 A;  1WJS A;  1D1B A;  3M53 A;  1NJI U;  1KQS A;  4EMK C;  1ARK A;  4RMO A;  2HCK A;  2LNV A;  1TG0 A;  1VQL Q;  2DTO A;  1PSF A;  3QZ9 B;  1RAE B;  4BE1 A;  3VS2 A;  4BE0 A;  1WIE A;  2K3Y A;  1I81 A;  3MCA B;  4PL6 A;  2FG0 A;  2GNC A;  2DJQ A;  2OTL T;  1TSF A;  2Y4X A;  1GCQ C;  2X3W D;  5GMK i;  2RF0 A;  4FYX B;  1K8A R;  2PVO B;  1WHJ A;  4FYW B;  3J7A F;  1E6H A;  3CPW S;  3OW2 A;  3HP9 A;  2ROT A;  4N4G A;  4BY6 C;  1X43 A;  1YP5 A;  2QDY B;  3L2R A;  3CCU A;  2CKK A;  1I0C A;  1PG5 B;  2DZ9 A;  2CP2 A;  4C92 F;  2QA4 Q;  4OGC A;  1P92 A;  3F70 A;  1JBM A;  4F7U F;  3EGX A;  2L3P A;  1B7T A;  1GL5 A;  3HKS A;  5CKF A;  4FCY A;  1QWF A;  5FU6 B;  1X01 A;  4KT0 E;  1PD0 A;  2QEX A;  2JOY A;  4OB3 B;  2DYB A;  5J39 A;  1EIF A;  5I22 A;  3JCM V;  8AT1 B;  2CSI A;  1W2B P;  2J6K A;  4OF1 A;  3S3N A;  1PCX A;  3TVT A;  2XKO C;  2P0K A;  3OS1 A;  5KYX A;  1VQN Q;  3DB3 A;  4M7A E;  1KC8 R;  4O6J A;  4M7D F;  1GCQ A;  3JCM d;  4FYY B;  1R77 A;  2L3S A;  4PJO F;  1X75 C;  3OYE A;  3OSS C;  2V8I A;  4CRI A;  2RQV A;  3SHW A;  3RER A;  2MI6 A;  1QCO A;  4PJM A;  1T0H A;  2DIQ A;  3CCV T;  5M9O A;  4BD3 A;  2BE7 D;  4J6X A;  3KUF A;  1O75 A;  1QLY A;  4AG2 C;  5GAM h;  2VXF A;  4RG2 A;  2RQU A;  4FSX A;  3NGP A;  3EGD A;  2QQR A;  2CH4 A;  5FU7 C;  1N9S A;  3MEW A;  4XTV A;  3SD4 A;  3U23 A;  1B07 A;  2PQW A;  1PNJ A;  3C12 A;  3CCU Q;  4M78 C;  2RD1 A;  4KGX B;  2KSS A;  1R0B G;  2ZPF B;  1VQ5 T;  4C0D B;  2DBM A;  2EW3 A;  4C5E A;  4PJN A;  2YRC A;  3TEE A;  4MMK A;  1VQM A;  3X25 B;  5CAI A;  1JRI A;  1VQ4 T;  4QT7 A;  1ABQ A;  4ELY C;  2OTJ A;  3L1A A;  5KYY B;  5GAN j;  1Q86 U;  2QEX Q;  2B86 A;  3R6O A;  1OV3 A;  4GLK A;  2DMO A;  4HVW A;  1VQL T;  2YSQ A;  4C5G A;  3QBY A;  3FEO A;  1JJ2 S;  3CMA A;  1GFD A;  4C0Z A;  3ZEH A;  3FJP A;  3VRY A;  4JJD A;  3RDV A;  3M0S A;  1WNL A;  2RJC A;  2F2X A;  2AKL A;  3M0P A;  2ZPG B;  2M1H A;  5LJ5 f;  1WA7 A;  2HDA A;  3GIB A;  4O5V A;  5HCK A;  2CGH A;  1IHW A;  2FO0 A;  3CCS A;  4XTX A;  3RMQ A;  4J6Y A;  2KYM A;  3P8D A;  1UTI A;  4XU2 A;  3L2V A;  2WSE E;  4WTO B;  1YJN A;  2KK4 A;  3OA6 A;  1AHJ B;  1ZA2 B;  3M55 A;  4J7F A;  2DJZ A;  1UGR B;  5KH6 A;  4IKF A;  2K5F A;  2QA4 T;  1IB8 A;  3S3O A;  2ESW A;  2HZY A;  1QVF P;  4WCI A;  1YHQ A;  1Q82 C;  5C6S A;  4AFS C;  1GBR A;  4M75 D;  3JSC A;  3FC3 A;  3RKX A;  1LOJ A;  2RO0 A;  1SSH A;  3MHX A;  1NBE B;  4KBM B;  3JB9 H;  3J81 E;  2ZAE A;  3A8L B;  2RK1 A;  1OQK A;  4FSS A;  1SHF A;  4LN2 A;  4JS5 A;  4HA8 A;  1VQM Q;  4ANJ A;  1BI0 A;  1M90 R;  2DZC A;  4EMG A;  3PT9 A;  1ZHI A;  4LDU A;  3R6N A;  1SHG A;  1X2Q A;  1VQN T;  2E6N A;  3OY9 A;  2OTJ Q;  3PVL A;  1M27 C;  2LNH B;  2JT4 A;  2CP3 A;  4M75 B;  6AT1 B;  5IT9 E;  2L3Q A;  2OI3 A;  4BDZ A;  2DL8 A;  2HKN A;  1YBY A;  4ZGE B;  3VS6 A;  1PKS A;  2K3X A;  1WJR A;  1FYN A;  2EYZ A;  3G4S A;  1OYX A;  2FZC B;  3CMA Q;  1RAC B;  1M30 A;  5IHK A;  2BUD A;  2DXU A;  4LD6 A;  2KNB B;  1OUL A;  3CCQ T;  2M02 A;  1W2B A;  1VQ8 A;  2C0O A;  4E7Z A;  1M1K U;  1IO6 A;  2DVE A;  3CBP A;  2FHD A;  1O9S A;  2V8K A;  3RUX A;  4IUT A;  1KC8 C;  2RB6 A;  2B8A A;  2EVR A;  2F2W A;  3EG2 A;  7AT1 B;  3CCS Q;  2KDS A;  5GAN h;  1YI2 A;  1YIJ Q;  1LPL A;  2YUO A;  4BDY A;  4LDY A;  1W6X A;  1YJN Q;  4PKC C;  3CCU T;  3EGU A;  3EG3 A;  1B34 A;  2P4T A;  3EFO A;  2JJ9 A;  1X2K A;  1RUW A;  1Q95 G;  1K0X A;  4PLL A;  1Y96 A;  2QAS A;  1KD1 U;  3WXM B;  5DLO A;  5DLQ E;  5A0D A;  1YHQ Q;  3CCR A;  3VS7 A;  4FW2 A;  1K9A A;  5CVI A;  2E5Q A;  1TTH B;  1ZSG A;  4LXC A;  3CC7 T;  4V2S A;  1FXX A;  1XOV A;  2HQE A;  1K73 U;  5GAM f;  5GMK j;  1RAD B;  2O01 E;  2KRN A;  3UF4 A;  1NE8 A;  2CP5 A;  9ATC B;  1QMC A;  3QDR B;  1WFW A;  4AFZ C;  1D1C A;  2COW A;  1U1T A;  5D6W A;  3JCM e;  3LYI A;  1WDX A;  4J9H A;  5LJ3 d;  4RTY A;  2COZ A;  4HCB A;  5KE3 A;  2K5L A;  2XDD A;  2EQK A;  4QVD A;  2GQV A;  2MMP A;  4X34 A;  2E3H A;  3A98 A;  1M1K R;  3GNF B;  4KUL A;  3G4S Q;  1IRX A;  2CZ1 B;  4J9C A;  2YRV A;  2CP0 A;  2ZPE B;  1VQ8 Q;  2KY9 A;  4OMO A;  5CIU A;  2Y90 A;  1WPY A;  1MGQ A;  3DLM A;  4PFP A;  1WQW A;  4JZ3 A;  2J6F A;  2MWP A;  1W4S A;  1SG5 A;  1YI2 Q;  3VYH B;  1X6B A;  3CD6 A;  2E5K A;  4MDX A;  1OI1 A;  4VUB A;  1I5L A;  3BY7 A;  4IUV A;  1KD1 R;  4R0K A;  3A8O B;  1Q81 U;  4Y92 A;  5KYW A;  3CC2 A;  2IG0 A;  2E4H A;  1BI3 A;  4AG1 C;  4C8Q G;  4M75 F;  4B9W A;  2SEM A;  1HD3 A;  3C4S A;  4OML A;  4C8Q A;  1VQM T;  1JB0 E;  2DKG A;  2DM1 A;  2HNI A;  4OB1 B;  2OTJ T;  3M57 A;  2EIF A;  2YLB A;  4J9E A;  3CCR Q;  1QVF A;  2YWW A;  2LQK A;  3URG A;  4OVA A;  3VS5 A;  3EH2 A;  1MV3 A;  1V76 A;  1FMV A;  3H0F A;  1VQK A;  3LLR A;  1WXU A;  4ZTF A;  3REB B;  2EGE A;  4P5N A;  2KQW A;  1U8R A;  2JMA A;  4EMK B;  1ZX6 A;  1JXO A;  2OAU A;  1C6V X;  3SDZ A;  3NFC A;  4X1V A;  1UG1 A;  2ED0 A;  3C0C A;  1AZG B;  3EG9 A;  1RI0 A;  2RA2 A;  5KYX B;  2DXC A;  2DIL A;  2YT6 A;  4F17 A;  3M4Y A;  4J7I A;  1WHM A;  2DBK A;  2QQ9 A;  2ROL A;  3GNG A;  3CCS T;  1YIJ T;  3HPW A;  1I07 A;  1WGS A;  2NUT A;  3RES A;  4CC4 B;  2LJ1 A;  3CCM A;  1YJN T;  1WZO A;  2LT4 A;  1RLP C;  1LJO A;  5GMK h;  2NUP B;  1W2B S;  2E64 A;  4BY6 B;  5KYU B;  2EGC A;  1FMK A;  3VJP A;  2O2O A;  3GLX A;  3OYI A;  1G3S A;  1KK7 A;  2DTI A;  1MMG A;  1YHQ T;  4J5Y A;  2W10 A;  3E19 A;  4L59 A;  3L2W A;  4DOW A;  3CD6 Q;  4RUG A;  1TUD A;  4AMC A;  1MMN A;  2AKK A;  3OBW A;  3CXC P;  3CC2 Q;  2JS2 A;  2A0F B;  1M1G A;  3VYG A;  1I5O B;  4E7S A;  1D3B A;  4JRQ A;  2MAM A;  5GAN f;  3FIF A;  2ZZD A;  4A53 A;  1X6O A;  5GAN 7;  2BE9 B;  2FRY A;  1X6G A;  2IIM A;  4E6R A;  4ZNX A;  2QK0 A;  3VS4 A;  1VQK Q;  2DA9 A;  4E47 A;  3G4S T;  5IAY A;  3PFS A;  2PU9 B;  3PNW C;  4HT9 A;  2DD4 A;  1KQ1 A;  1VQ8 T;  2G6F X;  3G71 T;  1HXD A;  3RBB B;  1QVP A;  1PRL C;  4LDW A;  4J9G A;  4M78 D;  1N8R C;  2HMA A;  1X27 A;  2PNI A;  4RG8 A;  3M59 A;  1MUZ A;  2AK5 A;  1VQ9 A;  5CR2 A;  5GAN 2;  1PM3 A;  3H0H A;  2RJF A;  1X69 A;  1UJ0 A;  4A54 A;  1UGS B;  4C92 C;  3CCM Q;  3JCM g;  4D8K A;  2DVJ A;  3P8B B;  4M77 D;  4TVR A;  4JDS A;  2Y4Y A;  5HY6 A;  4D8D A;  1KHC A;  4M78 B;  1ZUK A;  4PLI A;  3JB9 D;  2JXB A;  1Y0M A;  1Q7Y C;  3G6E A;  2DET A;  5CQX A;  3CCR T;  3DLL A;  2HSE B;  3I35 A;  3N5B B;  4ME7 A;  2RK2 A;  3EHR A;  4M77 B;  3VS1 A;  1OU9 A;  1T3L A;  1YIT A;  3KXT A;  4IIM A;  2E41 A;  1AD5 A;  2GCX A;  4FL6 A;  2XID A;  4M7D C;  2F2V A;  3L2U A;  4GY5 A;  1YJ9 T;  3Q1J A;  1Y57 A;  2GQI A;  5LJ3 e;  2P4R A;  2VGM A;  2ZPI B;  1TUG B;  3D7S B;  1ZSZ A;  1M1F A;  4F14 A;  5HK3 A;  4EDU A;  1QVF S;  4Z8A A;  4MZT A;  1NJI R;  1NLP C;  1UHF A;  5J26 A;  1Z9Z A;  1M2V B;  4C92 G;  2R5A A;  2DFU A;  4LE9 A;  2XG8 D;  5D6Y A;  4C92 A;  3PIO A;  5GAN d;  4F7U G;  2DPP B;  4GBQ A;  3PMT A;  4OGE A;  4NL3 A;  1OZ2 A;  4F7U A;  1BU1 A;  5D7U A;  3VU3 C;  1OU8 A;  3M0U A;  1IGQ A;  4HVU A;  2JM8 A;  1MMD A;  2DYI A;  1QW1 A;  1VIF A;  1U3O A;  1PWT A;  1VQ9 Q;  4ZGJ B;  1C1A A;  4CC3 A;  3X28 B;  3A8H B;  3CD6 T;  1RL2 A;  2CZ6 B;  3QKJ A;  4BE2 A;  3EG1 A;  4M7D G;  3CCE A;  3UA6 A;  4XTW A;  1SKU B;  4M7D A;  1RI9 A;  2ZPB B;  4PJO G;  3JCM c;  4Y28 E;  5I21 A;  4M7A D;  5EG2 A;  4A4G A;  2L5Q A;  1BI1 A;  4PJO A;  4OP0 A;  4Z89 A;  3LW5 E;  1PKT A;  1UFF A;  3G6E Q;  1D0X A;  1AWX A;  1SF9 A;  2D0N A;  2GTJ A;  2JW4 A;  5IXF A;  2KBT A;  2XMF A;  3RKY A;  2HAX A;  2M0O A;  3NMZ C;  2GTO A;  2QGG A;  2JTE A;  3LWH A;  1VQK T;  3EHQ A;  4HT8 A;  1YIT Q;  3MP8 A;  2EJ9 A;  3X20 B;  4PFZ A;  2QQB A;  4ZN3 A;  1K1Z A;  3M56 A;  4M7A B;  4HCZ A;  4C8Q E;  1XJW B;  1RLQ C;  2IVW A;  5GJW B;  1N6A A;  4LDX A;  1I1J A;  4RTX A;  2FL7 A;  3GBQ A;  3RIR A;  2YHT A;  1T3S A;  2YUN A;  2EKO A;  2EFI A;  5IHI A;  2RHI A;  1M8M A;  4WF2 A;  4A4H A;  5HKC A;  3PTA A;  2RQW A;  3TQ7 P;  1U06 A;  4JRK A;  2HEQ A;  1R8O B;  5IXB A;  2HL3 A;  4M78 F;  3O5Z A;  3CCM T;  1XTD A;  1VIE A;  2KMT A;  3QZ5 B;  2RQR A;  2DXT A;  3CPW P;  2JVV A;  1CSK A;  2ZCF B;  4M77 F;  3QWX X;  1AVZ C;  3SWN C;  2VXE A;  3PE0 A;  2DD5 A;  3QUI A;  1NYG A;  3JB9 F;  1OEB A;  2AHJ B;  2AT1 B;  2KVQ G;  1WXB A;  1VA7 A;  3KBG A;  3CCE Q;  1K8A C;  4M4Z A;  5GAO m;  2H8H A;  4C0F A;  2K79 A;  4IUR A;  5AYF A;  2LMJ A;  3MET A;  1SRL A;  2JMC A;  1ZQ1 A;  4Q5W A;  2GGR A;  1GXI E;  3CC4 A;  4FU6 A;  5C0M A;  3M0T A;  2QI2 A;  3E9G A;  3QJY A;  2EAY A;  3OYB A;  1JU5 C;  2QYZ A;  1I4K 1;  2MPX C;  1Q86 R;  4KGZ B;  2DE0 X;  1K9M U;  4ELZ C;  4N0A C;  2DTH A;  2QQS A;  1RAF B;  3X24 B;  3JCM P;  2K9G A;  4JJC A;  2F1L A;  3ULR B;  1B3Q A;  5CKE A;  1QP3 A;  2DL3 A;  2RI3 A;  5I11 A;  1VQO A;  4OB2 B;  2KYB A;  2XIC A;  3AT1 B;  4R56 A;  1VQ9 T;  2COY A;  4KH1 B;  3SWN A;  1NJI C;  1RAA B;  5LJ3 g;  2MYS A;  2D1X A;  1EFN A;  2XD0 A;  1BI2 A;  1PSE A;  1N8R U;  4DBR A;  3M0R A;  3REA B;  2H3E B;  3JCM W;  3JCM X;  5FLX E;  2E70 A;  3RNJ A;  4LNP A;  1D09 B;  2O31 A;  5LJ5 d;  3VUZ A;  2O9S A;  4M7A F;  2RPN A;  2HSP A;  1YWP A;  1VQP A;  1UDL A;  4Y91 A;  4N0A A;  2JNG A;  4HVV A;  1IRE B;  1Q7Y U;  1GBQ A;  2LVM A;  2DXB A;  2LZ6 B;  2X4J A;  3EG0 A;  4HKE A;  1K9M R;  2QEX T;  1IZ6 A;  3UAT A;  1U1S A;  2K5I A;  2K4Y A;  3BFM A;  3CC4 Q;  3QYH B;  1HK9 A;  3WVE B;  4C8Q C;  2EWN A;  2BTT A;  2RN8 A;  4DQ2 A;  2LX7 A;  2E1H A;  1BB9 A;  4F04 B;  3MP1 A;  1VQ6 A;  4FM4 B;  4FYV B;  3JRZ A;  1FX7 A;  1SRM A;  2FB7 A;  4KUI A;  3QG1 A;  1ZA1 B;  1AT1 B;  1W1F A;  2C0I A;  1AZE A;  3RMS A;  5GMK m;  4IUP A;  1WXT A;  2BKD N;  2O9V A;  3I5R A;  2O4X B;  1KQS P;  2XI9 A;  2E12 A;  1VQO Q;  4CC7 A;  1VUB A;  2HL5 C;  2KXD A;  4PNO A;  2CT4 A;  1H8K A;  4XQ3 A;  1ZBJ A;  2MF2 A;  3HSB A;  4IUQ A;  4M75 C;  2CUD A;  2DAQ A;  1NPP A;  1V29 B;  2PZ1 A;  1NM7 A;  3NHN A;  4C92 E;  5I2M A;  5CKD A;  2J06 A;  1PD1 A;  4QQ6 A;  3CCE T;  2P0Q A;  2P84 A;  1G83 A;  4F7U E;  2WSF E;  4JLG A;  4KGV B;  3OW2 P;  1WX6 A;  3JCM J;  3OBY A;  2F69 A;  1M3A A;  1ABO A;  3OMG A;  4F16 A;  5FW9 A;  1ZUU A;  4EPC A;  4NS5 A;  3CCV A;  2KAF A;  2A37 A;  3CCL A;  2JTF A;  1VQP Q;  3VKI A;  4DBH A;  4ESR A;  3HRS A;  1KG1 A;  2RJE A;  3L42 A;  1QWE A;  1K73 R;  1ACM B;  2I2L A;  4B9X A;  1G5V A;  4J9B A;  2OAW A;  2HQH A;  2KRS A;  4M7D E;  2LT1 A;  4IIO A;  3A8M B;  5GAO p;  3EGX B;  3UDC A;  1N27 A;  2EYW A;  2KT8 A;  2HD0 A;  4PJO E;  1SSF A;  2EQI A;  2J05 A;  5LJ3 j;  3H9N A;  2YUP A;  3CMA T;  4NOY A;  2X4X A;  4CC2 A;  3TCJ A;  2LJ3 A;  4MZP A;  1MV0 B;  4M75 G;  2EYY A;  1VQ5 A;  2G3R A;  5GJV B;  3X26 B;  1VQ6 Q;  4GLM A;  2RI2 A;  1M90 C;  2VYT A;  2JS0 A;  2M9U A;  4M75 A;  4AT1 B;  5KCO A;  5L23 A;  1VQ4 A;  2E10 A;  2GFA A;  2RHY A;  5GAM d;  1KSW A;  1E7O A;  1VYV A;  4X9D A;  1GCP A;  3OYK A;  2QTX A;  1BKB A;  4F7U B;  8ATC B;  4XTY A;  4KRT A;  2XDP A;  2QGF B;  3H6Z A;  3M58 A;  1UGQ B;  4ZN1 A;  3LWI A;  4M7D D;  3HRT A;  2DEU A;  3ASK A;  3CME A;  1D0Y A;  2M51 A;  1IXD A;  1Q81 R;  1GFC A;  5A2Q E;  1K76 A;  3FB9 A;  2CZ7 B;  4PK4 A;  3OYH A;  1NEG A;  1VOM A;  3VS3 A;  2X3X D;  1UGV A;  2NLU A;  2DO3 A;  1RAI B;  4RTW A;  3GF5 A;  2E65 A;  3EGD B;  2CS7 A;  4Z88 A;  2VGN A;  2VWF A;  2XHC A;  4J83 A;  2VC8 A;  1YCS B;  3OYJ A;  4M7D B;  3LH0 A;  1PC0 A;  2CP6 A;  3CC4 T;  1WQ7 A;  1ZUY A;  1K0S A;  3CCV Q;  1Q82 U;  1K8A U;  2FVU A;  4D6W A;  3CCL Q;  1YJW A;  2X9H A;  3ZFJ A;  2LX9 A;  2YRD A;  1JO8 A;  2QA4 A;  4RCB A;  1BCO A;  2QAZ A;  3UA7 A;  1WHL A;  3L2Z A;  2R57 A;  3H8Z A;  2DL7 A;  3OYY A;  2RI5 A;  2CH4 W;  1RAB B;  2RMO A;  1VQO T;  3SEM A;  2RH2 A;  1E6G A;  3MJX A;  1CKB A;  4OMQ A;  3OYD A;  2HBW A;  2CZ0 B;  1ZSZ C;  2ZPH B;  4DEX A;  5KCH A;  1RAH B;  1LVK A;  3MO8 A;  3UT1 A;  1AEY A;  2EGA A;  1C0M A;  5CK9 A;  3G7Z A;  4MDW A;  2MIO A;  3H41 A;  3BDU A;  1TXQ A;  1TS9 A;  4NL2 A;  1YI2 T;  3L2Q A;  4EIK A;  4JUV A;  1M1K C;  2JUF A;  2XDB A;  4PFO A;  2L89 A;  5FRM A;  1JXM A;  5FU7 B;  5LJ5 e;  5GAN g;  1KC8 U;  2EJG A;  5LJ3 h;  5IN1 A;  3LH5 A;  2KRM A;  3CME Q;  3CCQ A;  1S72 A;  1MMA A;  3FRN A;  5FWB A;  1VQP T;  3M0Q A;  1G3T A;  4XU3 A;  4BUG A;  3OS0 A;  1M9S A;  4RKU E;  1Q82 R;  1OZ3 A;  3EFR A;  1YCY A;  5CO7 A;  2JM9 A;  2W0Z A;  3UWN A;  2NWM A;  3I55 A;  3NPF A;  1KD1 C;  1SEM A;  3VUB A;  2A28 A;  1N5Z A;  4OB0 B;  1G8X A;  1W70 A;  2RNA A;  3OS2 A;  1M5Q 1;  1M8V A;  1YJW Q;  3QSU A;  2NUZ A;  1UJY A;  2D6F A;  1RAG B;  4J9D A;  4PJO C;  2ECZ A;  1VQ6 T;  1VYU A;  1TUC A;  2AZS A;  2M0Y A;  2CUB A;  2M16 A;  1K73 C;  1KIK A;  1QCF A;  4RTT A;  5CKB A;  1D1A A;  2BZ8 A;  2K2V A;  3V7C A;  1VQ7 A;  3VRZ A;  1AWJ A;  2MOX A;  1K4U S;  3CC7 A;  2I0N A;  3WVD B;  1DJ7 B;  2EKH A;  2XU8 A;  3BE3 A;  3MEA A;  3MEU A;  3O8V A;  4EMK A;  4JRP A;  1QVG P;  4L5G A;  4N4I A;  5CQY A;  1Y7X A;  2L3R A;  2KR3 A;  2X4Y A;  3EFS A;  1D0Z A;  4E7K A;  4PJL A;  4UC4 A;  4BI3 A;  2CSQ A;  4FW1 A;  2LQ8 A;  5D6X A;  2H3J A;  2K3B A;  3GPL A;  3SWN B;  1OX8 A;  5FWC A;  2OX7 A;  4ZTJ A;  2YDL A;  2QTV A;  4J8O A;  4CI0 C;  4J9I A;  1F1B B;  2EBP A;  4AFQ C;  2A3L A;  3CBO A;  3V7S A;  1MND A;  3CC2 T;  1UEB A;  2Z0W A;  5GAN 4;  2CYZ B;  1TU0 B;  2NUP A;  2DF6 A;  2D0Q B;  2J6O A;  5KYU A;  1QKW A;  3OS5 A;  4XTZ A;  3CCQ Q;  1S72 Q;  3CCL T;  3ME9 A;  1B34 B;  3EFO B;  1YFN A;  5A0L A;  1Q81 C;  1EZZ B;  1Y96 B;  2WSC E;  2LRQ A;  2KI7 A;  2GF7 A;  2D8H A;  3LX7 A;  4HXJ A;  5DM7 R;  2CT3 A;  2L0A A;  4XU0 A;  3I55 Q;  4RCC A;  5KYN A;  3KFV A;  3IQL A;  4LD9 K;  3CXC A;  3V8K A;  2KGT A;  2PVD B;  3JCM b;  2K7A A;  4A63 B;  5ECA A;  1G2B A;  4PJJ A;  3J80 E;  1AWW A;  4JJN K;  2GFU A;  4HCC A;  2QXF A;  4JS4 A;  3GOX A;  2R58 A;  5AT1 B;  3AHU A;  2VKN A;  3PVQ A;  4BB7 A;  4OMF B;  3OYA A;  3UPU A;  4MML A;  1OPL A;  2AZV A;  5GAM e;  3CBM A;  2EYQ A;  2PUO B;  3FJ5 A;  3MKD A;  4C5I A;  4M77 C;  3TU4 K;  1VQ7 Q;  1AOJ A;  1T0J A;  3OSV A;  3NTK A;  1M90 U;  3QPH A;  5KE2 A;  5FU6 C;  3CCJ A;  3CC7 Q;  3TSW A;  4QQD A;  1UGP B;  2RQT A;  3OYF A;  2VAS A;  2L8D A;  1Y71 A;  4B6M A;  3CME T;  4K11 A;  1WYX A;  4M75 E;  2A7Y A;  3JB9 J;  4C8Q D;  4XTU A;  2DL5 A;  4FT4 A;  2A08 A;  1BK2 A;  1M3B A;  1ZLM A;  3BDL A;  1U5S A;  3HFO A;  3ER0 A;  3E1S A;  4X9C A;  1YIJ A;  1KQS S;  1R0C B;  1FMW A;  3TSZ A;  4M78 G;  1UB4 A;  3OYG A;  3H0I A;  3I9Q A;  5KYW B;  4E2F B;  1YJW T;  4JPB W;  4M78 A;  2EYX A;  1TH7 A;  2LJ0 A;  2K6D A;  3HL8 A;  1WLP B;  2DRM A;  3FDR A;  4C8Q B;  1PHT A;  2PUK B;  1JQQ A;  3I56 A;  4M77 G;  2F5T X;  5LJ5 g;  1XNI A;  1IGU A;  2KE9 A;  4XU1 A;  4M77 A;  3V8L A;  3HTR A;  5LJ3 f;  3QII A;  3OW2 S;  2DER A;  5I2S A;  3JB9 G;  1QP2 A;  1OX9 A;  2BZY A;  1QQJ A;  2DEQ A;  4LUD A;  3OYC A;  5A0G A;  1NEB A;  3OB9 A;  2CP7 A;  5EC7 A;  2JN0 A;  3CEY A;  4C0D C;  2NYS A;  1BIA A;  3A1P A;  4A4K A;  1BBZ A;  2GBQ A;  2P0P A;  3PGG A;  4QVC A;  2EQM A;  2KXC A;  1M4Z A;  2CDT A;  3EG9 B;  1M2V A;  3MP6 A;  4QVZ A;  1HYO A;  4C5H A;  2SRC A;  3HFN A;  3MPU B;  4M7A C;  2K2M A;  3CCJ Q;  2XK0 A;  2NUT B;  3QWY A;  4IUU A;  2LQN A;  1QVG A;  2LCL A;  2LDM A;  1KFZ A;  4Z02 A;  3LGF A;  1S72 T;  5GAN 3;  2X35 A;  2EQJ A;  1OPK A;  3INZ A;  2QQA A;  3EH1 A;  2AIR B;  3M54 A;  3G71 A;  1GRI A;  1HSQ A;  1YWO A;  4RTV A;  2DNU A;  3G6E T;  4OMM A;  3JB9 I;  1A0N B;  2E6Z A;  3G1J A;  2QG9 B;  3JCM h;  3I55 T;  1SPK A;  5CKH A;  2OTL A;  2E3I A;  2ENM A;  3JV3 A;  2HQX A;  1YIT T;  4E7I A;  3A5Z B;  4HCK A;  2IPO B;  2LQW A;  3DB4 A;  4EMH A;  3LGL A;  1D3B B;  3I56 Q;  3QHS A;  2F5K A;  1JJ2 P;  5FRN A;  1WJQ A;  4LDV A;  2RJD A;  5LL6 S;  3FLG A;  4M7A G;  2D8J A;  2O88 A;  2VUB A;  1VQ7 T;  4A4E A;  5KYY A;  2DRK A;  5GAN e;  2WAC A;  3CXC S;  2FPF A;  4OMN A;  4M7A A;  1UE9 A;  4L6V 5;  1KJW A;  4QQG A;  3VV0 A;  1EX4 A;  3DKM A;  1YNZ A;  4OMP A;  1G3W A;  1YJ9 A;  5GAN 6;  4JJB A;  3THK A;  5GAN 5;  1H3H A;  1H64 1;  5GAO l;  3S3M A;  1NPR A;  4BI4 A;  1N8R R;  2C06 A;  3A8G B;  2ABL A;  3E2U A; 
#chains in the Genus database with same CATH homology
 5C6S A;  3BW1 A;  2FVU A;  5GAO q;  4D6W A;  1YJW A;  3QYG B;  4M75 D;  3PMT A;  4OGE A;  3ZFJ A;  1OZ2 A;  4NL3 A;  4F7U A;  3JSC A;  2LX9 A;  3RKW A;  3FC3 A;  3RKX A;  3M4G A;  3VU3 C;  2YLC A;  1LOJ A;  2RO0 A;  2LTO A;  4C8Q F;  4FIB A;  2QA4 A;  2RM4 A;  3MHX A;  4RCB A;  1QW1 A;  4KBM B;  5GAM g;  3JB9 H;  3J81 E;  3A8L B;  3ZBD A;  1VIF A;  5HK0 A;  2RK1 A;  3L2Z A;  4FT2 A;  4ZGJ B;  5LJ5 j;  4HA8 A;  4JS5 A;  3X28 B;  1XQH A;  2R57 A;  3A8H B;  3CD6 T;  3CPW A;  1BI0 A;  3H8Z A;  1RL2 A;  2DZC A;  4EMG A;  3PT9 A;  2CZ6 B;  3MEV A;  3OYY A;  3QKJ A;  1ZHI A;  2RI5 A;  1N9R A;  4LDU A;  4BE2 A;  3TRE A;  1VQN T;  5J3B A;  2E6N A;  3OY9 A;  1VQO T;  3EAE A;  3JAM E;  4M7D G;  2RH2 A;  4M75 B;  3CCE A;  3S6W A;  5IT9 E;  4BDZ A;  4XTW A;  3OYD A;  4M7D A;  2CZ0 B;  1YBY A;  2ZPB B;  4PJO G;  4Y28 E;  3JCM c;  5I21 A;  1I8F A;  2HBP A;  2ZPH B;  4QW2 A;  5EG2 A;  4A4G A;  4ZGE B;  5KCH A;  2L5Q A;  2K3X A;  3MO8 A;  3PIP A;  2RHX A;  4XK8 E;  3UT1 A;  1BI1 A;  1WJR A;  3M5A A;  3G4S A;  4PJO A;  4OP0 A;  5CK9 A;  1OYX A;  3G7Z A;  4MDW A;  3LW5 E;  3E9F A;  3BDU A;  2BUD A;  4NL2 A;  2DXU A;  2DK3 A;  4LD6 A;  5FRO A;  4C0G A;  3CCQ T;  5GAO r;  3L2Q A;  1YI2 T;  1W2B A;  1VQ8 A;  4II1 A;  4JUV A;  1M1K U;  3RKY A;  2HAX A;  1M1K C;  1ZBX A;  2DVE A;  2M0O A;  1KHI A;  3CBP A;  4C92 D;  3LWH A;  1VQK T;  4HT8 A;  2JUF A;  2FHD A;  2XDB A;  3MP8 A;  2L89 A;  2EJ9 A;  1O9S A;  2V8K A;  3NTH A;  4J6W A;  5FU7 B;  3QO3 A;  4IUT A;  3HRU A;  3RUX A;  3X20 B;  5LJ5 e;  5GAN g;  2DIG A;  2EJG A;  4R55 A;  1G3Y A;  2QQB A;  4ZN3 A;  2RB6 A;  3CPF A;  2B8A A;  3M56 A;  4M7A B;  5LJ3 h;  4HCZ A;  5IN1 A;  4C8Q E;  4DOV A;  4JRP A;  3NTI A;  2KDS A;  5GAN h;  2IVW A;  3CCQ A;  1YI2 A;  1S72 A;  1Q86 C;  2JTM A;  3FRN A;  1N6A A;  1MHN A;  4BDY A;  1VQP T;  4LDX A;  3SFM A;  1G3T A;  4XU3 A;  2FL7 A;  4LDY A;  3RIR A;  2YHT A;  3C95 A;  5GAO n;  3CCJ T;  5GAN 8;  4BUG A;  4PKC C;  3CCU T;  3HHT B;  2EKO A;  3OS0 A;  1M9S A;  4RKU E;  1B34 A;  1OZ3 A;  2P4T A;  2EFI A;  3M9Q A;  2RHI A;  1YCY A;  3EFR A;  4WF2 A;  5CO7 A;  4A4H A;  3UWN A;  4C92 B;  5HKC A;  4YTL A;  3PTA A;  4PLL A;  3I55 A;  1Y96 A;  2R5M A;  3QJ6 A;  1NZ9 A;  1FWZ A;  1LNX A;  3QXE B;  4JRK A;  3P8H A;  4E7J A;  1R8O B;  3WXM B;  1KD1 U;  1KD1 C;  2LC4 A;  5DLO A;  3V8J A;  3OMC A;  1KQ2 A;  4M78 F;  5DLQ E;  2D9T A;  3CCM T;  3VUB A;  1VQL A;  5A0D A;  4OB0 B;  3OYM A;  4JRI A;  1XTD A;  1VIE A;  3OS2 A;  1M5Q 1;  2KMT A;  1M8V A;  3SB2 A;  3CCR A;  3QSU A;  3QZ5 B;  2D6F A;  2X4W A;  3OQ5 A;  2DXT A;  4XAX B;  4PJO D;  4PJO C;  1VQ6 T;  5CVI A;  2JVV A;  2E5Q A;  4E7H A;  3CC7 T;  2ZCF B;  2ZGW A;  1FXX A;  4V2S A;  1XOV A;  2HQE A;  4M77 F;  1K73 U;  5GAM f;  1K73 C;  2M16 A;  5GMK j;  5CKB A;  4JLI A;  1QVG S;  2O01 E;  3SWN C;  1NE8 A;  2VXE A;  2K2V A;  4ATO A;  3V7C A;  2DD5 A;  2BIV A;  1VQ7 A;  4ZGD B;  2RHZ A;  3QDR B;  3QUI A;  5D6W A;  5GMK l;  1U1T A;  3V7R A;  3JCM e;  3LYI A;  2AHJ B;  3JB9 F;  5LJ3 d;  2KVQ G;  4HCB A;  3T9N A;  3CC7 A;  3I56 T;  4EMK A;  3WVD B;  1DJ7 B;  3OYL A;  2XU8 A;  3MEA A;  2K5L A;  3KBG A;  3MEU A;  3O8V A;  5KE3 A;  2EQK A;  2XDD A;  1BIB A;  3GP8 A;  1K8A C;  4L5G A;  4N4I A;  4PJO B;  5CQY A;  4QVD A;  2GQV A;  2MMP A;  5GAO m;  1Y7X A;  2L3R A;  4X34 A;  4C0F A;  2X4Y A;  3EFS A;  4N4H A;  4IUR A;  5AYF A;  4E7K A;  3MET A;  3GNF B;  4KUL A;  4UC4 A;  3PMI A;  4BI3 A;  1ZQ1 A;  2K57 A;  2LQ8 A;  4Q5W A;  1GXI E;  5D6X A;  2H3J A;  2CZ1 B;  3GPL A;  3SWN B;  5CCA A;  2YRV A;  3CC4 A;  4FU6 A;  3OYN A;  4ZTJ A;  4E7L A;  5C0M A;  2QI2 A;  2ZPE B;  3E9G A;  2LCC A;  3QJY A;  4J8O A;  4M78 E;  2KY9 A;  4MZM A;  2EAY A;  5CIU A;  4CI0 C;  3OYB A;  2Y90 A;  1BYM A;  1I4K 1;  4BAC A;  5GMK e;  1K9M U;  4ELZ C;  1WPY A;  2A3L A;  1MGQ A;  2RHU A;  4N0A C;  2DTH A;  3CBO A;  3JCM f;  1K9M C;  3V7S A;  2QQS A;  5LJ5 h;  1Y07 A;  3CC2 T;  1UEB A;  5GAN 4;  2CYZ B;  3DLM A;  2JZ2 A;  2EJF A;  2FYK A;  3X24 B;  4DA4 A;  1WQW A;  3C94 A;  1JJ2 A;  2D0Q B;  2VV5 A;  2EQU A;  2MWO A;  3JCM P;  1H3Z A;  2MWP A;  3OS5 A;  4M77 E;  1W4S A;  4XTZ A;  5GAM j;  3CCL T;  3VYH B;  3ME9 A;  1B34 B;  3CD6 A;  4MDX A;  1OI1 A;  4VUB A;  5L8R E;  5CKE A;  1I5L A;  5A0L A;  3BY7 A;  4IUV A;  1QP3 A;  3A8O B;  1Q81 U;  2V8J A;  1Q81 C;  1VQN A;  2RI3 A;  1Y96 B;  4KUD K;  3CC2 A;  1VQO A;  2WSC E;  2LRQ A;  4OB2 B;  2IG0 A;  4A4F A;  1BI3 A;  2GF7 A;  2PVG B;  2XIC A;  5DY9 A;  4C8Q G;  3JCM Q;  3LX7 A;  4BI8 B;  5DM7 R;  2O4X A;  4M75 F;  4B9W A;  4XU0 A;  4R56 A;  3C4S A;  4C8Q A;  1WJS A;  1VQ9 T;  4RCC A;  3SWN A;  1VQM T;  3M53 A;  1NJI U;  1JB0 E;  1NJI C;  2DKG A;  1KQS A;  5LJ3 g;  4LD9 K;  4EMK C;  4RMO A;  3CXC A;  5FRM A;  2LNV A;  3V8K A;  2PVD B;  2HNI A;  2DTO A;  1PSF A;  3QZ9 B;  3JCM b;  4OB1 B;  2XD0 A;  1BI2 A;  2OTJ T;  3M57 A;  2EIF A;  1PSE A;  4BE1 A;  1N8R U;  2YLB A;  1QVF A;  3J80 E;  4BE0 A;  2K3Y A;  1I81 A;  4JJN K;  3MCA B;  2LQK A;  3URG A;  4OVA A;  2GFU A;  4HCC A;  2QXF A;  4JS4 A;  4PL6 A;  3GOX A;  2R58 A;  3AHU A;  2OTL T;  4BB7 A;  4OMF B;  2Y4X A;  3OYA A;  3UPU A;  1VQK A;  3JCM W;  3JCM X;  4MML A;  5FLX E;  2E70 A;  3LLR A;  5GAM e;  5GMK i;  4ZTF A;  3CBM A;  2EYQ A;  2PUO B;  2PVO B;  4P5N A;  2KQW A;  4C5I A;  1U8R A;  4M77 C;  5LJ5 d;  3VUZ A;  4EMK B;  4M7A F;  3TU4 K;  2OAU A;  3SDZ A;  3NFC A;  3J7A F;  3CPW S;  3OW2 A;  3OSV A;  1VQP A;  3HP9 A;  3NTK A;  1M90 U;  4N4G A;  3QPH A;  4BY6 C;  5KE2 A;  5FU6 C;  4Y91 A;  3CCJ A;  4N0A A;  2JNG A;  2QDY B;  3L2R A;  1RI0 A;  4QQD A;  2RA2 A;  1IRE B;  1UGP B;  3OYF A;  3CCU A;  1Q7Y U;  2DXC A;  2CKK A;  2LVM A;  2DXB A;  2L8D A;  1Y71 A;  3M4Y A;  4J7I A;  2X4J A;  3CME T;  2DZ9 A;  2QQ9 A;  3GNG A;  4HKE A;  3CCS T;  1YIJ T;  3HPW A;  4C92 F;  2QEX T;  1WGS A;  1IZ6 A;  4M75 E;  2A7Y A;  4OGC A;  1U1S A;  2K5I A;  3RES A;  3JB9 J;  1P92 A;  2K4Y A;  3BFM A;  3F70 A;  3QYH B;  1JBM A;  1HK9 A;  4F7U F;  3CCM A;  1YJN T;  4C8Q D;  4XTU A;  3WVE B;  2EWN A;  4C8Q C;  4FT4 A;  4DQ2 A;  2LT4 A;  1LJO A;  5GMK h;  3BDL A;  1W2B S;  2E64 A;  3HKS A;  5CKF A;  4BY6 B;  3HFO A;  3ER0 A;  2E1H A;  5FU6 B;  3E1S A;  4X9C A;  1X01 A;  3MP1 A;  4KT0 E;  3VJP A;  1VQ6 A;  4FM4 B;  3GLX A;  3JRZ A;  1YIJ A;  1KQS S;  1FX7 A;  3OYI A;  2QEX A;  2JOY A;  4OB3 B;  2FB7 A;  1G3S A;  4KUI A;  3QG1 A;  5J39 A;  2DTI A;  1EIF A;  4M78 G;  1UB4 A;  1YHQ T;  3RMS A;  4J5Y A;  5GMK m;  3E19 A;  4L59 A;  3OYG A;  3L2W A;  3JCM V;  4DOW A;  4IUP A;  1YJW T;  2BKD N;  3S3N A;  4OF1 A;  4M78 A;  1TH7 A;  2XKO C;  2P0K A;  3OS1 A;  2O4X B;  3HL8 A;  3FDR A;  4M7A E;  2XI9 A;  3DB3 A;  2E12 A;  3OBW A;  4C8Q B;  4O6J A;  4M7D F;  2PUK B;  1VUB A;  3I56 A;  4M77 G;  4M7D D;  3JCM d;  2F5T X;  4PNO A;  5LJ5 g;  1XNI A;  1M1G A;  4XU1 A;  3VYG A;  4XQ3 A;  2MF2 A;  1X75 C;  4PJO F;  3OSS C;  4M77 A;  2V8I A;  3V8L A;  4IUQ A;  4CRI A;  3OYE A;  3HSB A;  1D3B A;  4M75 C;  5LJ3 f;  4JRQ A;  2DAQ A;  1NPP A;  2MAM A;  3QII A;  3OW2 S;  1V29 B;  5GAN f;  5I2S A;  3FIF A;  3JB9 G;  2ZZD A;  4A53 A;  1X6O A;  1QP2 A;  3RER A;  2DEQ A;  2MI6 A;  4C92 E;  5I2M A;  5GAN 7;  5CKD A;  3OYC A;  2DIQ A;  3CCV T;  5A0G A;  4BD3 A;  4QQ6 A;  5M9O A;  1KC8 U;  1K8A U;  2P0Q A;  3CCE T;  4J6X A;  3OB9 A;  3KUF A;  1O75 A;  4F7U E;  2WSF E;  4JLG A;  2JN0 A;  3CEY A;  4C0D C;  5GAM h;  2VXF A;  4RG2 A;  4E47 A;  1BIA A;  4A4K A;  3G4S T;  3JCM J;  5IAY A;  3OBY A;  3PFS A;  2F69 A;  4FSX A;  3PGG A;  2P0P A;  2PU9 B;  3OMG A;  3PNW C;  4HT9 A;  4QVC A;  2DD4 A;  2QQR A;  2EQM A;  4EPC A;  4NS5 A;  3CCV A;  1M4Z A;  1KQ1 A;  5FU7 C;  3MP6 A;  1N9S A;  2KAF A;  3MEW A;  4QVZ A;  1VQ8 T;  3CCL A;  4C5H A;  2JTF A;  4XTV A;  3SD4 A;  3G71 T;  3HFN A;  3VKI A;  4M7A C;  1HXD A;  3HRS A;  1KG1 A;  1QVP A;  2PQW A;  2RJE A;  3L42 A;  2XK0 A;  4LDW A;  1KC8 C;  3C12 A;  2I2L A;  4M78 D;  4B9X A;  1N8R C;  4M78 C;  1G5V A;  4IUU A;  2RD1 A;  2KSS A;  1QVG A;  2LCL A;  2LDM A;  2ZPF B;  4RG8 A;  4Z02 A;  3M59 A;  2LT1 A;  4C0D B;  1VQ5 T;  3LGF A;  4M7D E;  3A8M B;  4C5E A;  1S72 T;  5GAN 3;  5GAO p;  1VQ9 A;  5CR2 A;  2X35 A;  2EQJ A;  3TEE A;  3INZ A;  4MMK A;  3UDC A;  2QQA A;  5GAN 2;  2RJF A;  1VQM A;  1N27 A;  3M54 A;  2HD0 A;  3X25 B;  3G71 A;  4PJO E;  4A54 A;  1JRI A;  1UGS B;  1SSF A;  4C92 C;  5CAI A;  1VQ4 T;  3JCM g;  5LJ3 j;  3CMA T;  4ELY C;  4NOY A;  3P8B B;  4M77 D;  3G6E T;  2X4X A;  2OTJ A;  3L1A A;  4TVR A;  5GAN j;  3TCJ A;  4MZP A;  3JB9 I;  2E6Z A;  4JDS A;  4M75 G;  2Y4Y A;  3JCM h;  5HY6 A;  1VQ5 A;  2G3R A;  3X26 B;  5CKH A;  3I55 T;  2RI2 A;  1Q86 U;  2OTL A;  3R6O A;  1M90 C;  2VYT A;  4GLK A;  1KHC A;  2HQX A;  2M9U A;  4M78 B;  4M75 A;  1YIT T;  4PLI A;  4E7I A;  3JB9 D;  1VQL T;  5KCO A;  4C5G A;  3QBY A;  1VQ4 A;  3A5Z B;  3FEO A;  1Q7Y C;  2E10 A;  1JJ2 S;  3CMA A;  4C0Z A;  3ZEH A;  2GFA A;  3G6E A;  3FJP A;  2RHY A;  5CQX A;  5GAM d;  3CCR T;  3DLL A;  3DB4 A;  3N5B B;  4ME7 A;  4M7A D;  4EMH A;  1WNL A;  4X9D A;  2RK2 A;  3OYK A;  2RJC A;  4M77 B;  3LGL A;  2QTX A;  1D3B B;  1BKB A;  1YIT A;  4F7U B;  2ZPG B;  3QHS A;  2M1H A;  2E41 A;  5LJ5 f;  3KXT A;  2F5K A;  4XTY A;  5FRN A;  2GCX A;  2XDP A;  3M58 A;  3H6Z A;  2XID A;  1UGQ B;  4FL6 A;  4ZN1 A;  1WJQ A;  3LWI A;  4M7D C;  3HRT A;  3GIB A;  3L2U A;  4O5V A;  4GY5 A;  4LDV A;  2RJD A;  5LL6 S;  1YJ9 T;  3ASK A;  3Q1J A;  2CGH A;  3FLG A;  5LJ3 e;  3CME A;  4M7A G;  3CCS A;  2VGM A;  2VUB A;  2ZPI B;  1VQ7 T;  4A4E A;  4XTX A;  3RMQ A;  5GAN e;  4J6Y A;  2WAC A;  3CXC S;  3P8D A;  5A2Q E;  4XU2 A;  1M1F A;  4M7A A;  3FB9 A;  5HK3 A;  3L2V A;  4EDU A;  2WSE E;  4L6V 5;  1YJN A;  2CZ7 B;  2KK4 A;  4QQG A;  3VV0 A;  1QVF S;  3OYH A;  3OA6 A;  3DKM A;  1AHJ B;  1G3W A;  2NLU A;  2DO3 A;  4MZT A;  3GF5 A;  2E65 A;  3M55 A;  4J7F A;  1YJ9 A;  2DJZ A;  2CS7 A;  1UGR B;  2VGN A;  5J26 A;  5GAN 6;  2XHC A;  4C92 G;  5KH6 A;  5GAN 5;  1H64 1;  2K5F A;  4J83 A;  4IKF A;  2VC8 A;  2QA4 T;  3OYJ A;  2R5A A;  5GAO l;  3S3O A;  4M7D B;  3LH0 A;  3S3M A;  1NPR A;  2XG8 D;  4BI4 A;  5D6Y A;  3CC4 T;  2C06 A;  1WQ7 A;  3A8G B;  4C92 A;  3PIO A;  5GAN d;  4F7U G;  1YHQ A;  1Q82 U;  2DPP B;  1Q82 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...