3HFOA

Crystal structure of an hfq protein from synechocystis sp.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
b'DSGLPSVRQVQLLIKDQTPVEIKLLTGDSLFGTIRWQDTDGLGLVDDSERSTIVRLAAIAYITPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cyanobacteria contain a structural homologue of the Hfq protein with altered RNA-binding properties.
pubmed doi rcsb
molecule keywords Ssr3341 protein
source organism Synechocystis sp. pcc 6803
molecule tags Rna binding protein
total genus 15
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3hfoA00
4EMKB 4M77A 4M7DA 4C92E 2DXUA 5LJ5f 1JBMA 5GAOr 4M7DB 2YHTA 3RUXA 4M78C 3RKYA 4DQ2A 5GAOn 5GANj 5I21A 2RM4A 4PNOA 5GMKe 2YLCA 3V7RA 2CGHA 4C8QF 4F7UF 1Y96A 2VXFA 3V7CA 3JCMW 2JN0A 2RA2A 4J6WA 1YCYA 2DZCA 2Y90A 4J5YA 4M78G 3V8JA 4M78E 5LJ3h 3JCMQ 3FJPA 3GIBA 5GAMf 2QTXA 4JLIA 3RIRA 1I4K1 5GMKi 4XU1A 4X9DA 5GAOp 3JCMP 3BFMA 4XU0A 5GANe 4HA8A 3RERA 5GANf 3QHSA 1M8VA 4RCCA 5GMKh 5LJ3d 4C8QC 4PJOE 1HXDA 4WF2A 1B34A 4EMKC 3RKWA 1B34B 3HFNA 5GAOl 4XU3A 4EMGA 4M7DC 5LJ3f 2DKGA 4MMKA 3SB2A 3AHUA 1LOJA 1WPYA 4M75D 5GAMh 4M75A 4XTVA 1KQ1A 4M75B 4F7UG 3HSBA 2FB7A 5GMKm 2DXTA 5GAN2 4M77G 4M7DG 3V7SA 3SWNA 5GANh 1H641 4M77E 4M7DE 3SWNB 3RESA 5GAN6 4XTUA 3JCMe 5GAOm 5GAMd 3QO3A 4M75F 2RB6A 3EFRA 1LJOA 4C92D 3JCMb 1WQ7A 1MGQA 4C92A 3BY7A 3PGGA 3V8KA 2DTOA 4C92B 5GANd 1N9SA 1U1SA 4J6YA 4HT9A 4M7AD 1WNLA 3JCMg 4QVDA 3JCMJ 3INZA 4M7AA 4M7AB 5GAN8 2E1HA 5GAN7 4JUVA 3L1AA 5GAN3 5GANg 3FB9A 3RKXA 2VXEA 1TH7A 1BIAA 1M5Q1 4C92F 2EJFA 5CAIA 3L2ZA 4NL3A 4M75C 2DTIA 2EJ9A 5GAN5 4M7AF 5LJ5g 3JB9H 3JB9I 3BW1A 4XQ3A 2FYKA 2HNIA 4C8QG 4M7DD 1WQWA 3EFSA 3SWNC 4F7UE 4C8QE 1N9RA 2E41A 5LJ5j 2I2LA 3VU3C 4PJOD 4M75G 3JB9D 1LNXA 4PJOA 4M75E 4PJOB 3JCMf 2DVEA 4C92C 2YLBA 4JRKA 3BDUA 4NOYA 1U1TA 2EWNA 5GAMg 4M7AC 1BIBA 1I81A 3FIFA 3QUIA 1X01A 3JCMV 4M77D 4NL2A 4PJOF 5GAMj 4C92G 4V2SA 2DTHA 2K57A 5LJ5e 4JRIA 3JB9F 4MMLA 4M77B 4OP0A 4N0AA 4XU2A 4QVCA 4EMKA 4M7AG 4M78D 3M4GA 4X9CA 3QSUA 3JCMh 4M7AE 5LJ3g 2DZ9A 2EAYA 4M78A 4XTXA 4M78B 2E65A 5GAOq 4Y91A 3JCMc 3JCMX 4J6XA 2E10A 1Y96B 4XTZA 4EMHA 4M77F 1D3BA 4A53A 4A54A 2VC8A 5LJ3j 1D3BB 3JB9J 1I5LA 4M7DF 1I8FA 2ZGWA 4PJOC 5GAMe 4XTWA 3JCMd 1HK9A 5LJ5h 4M78F 4XTYA 4HT8A 2DEQA 5DY9A 3HFOA 5GMKj 5GMKl 2E64A 2EJGA 3V8LA 4PJOG 4RCBA 3JB9G 1KQ2A 4C8QD 5GAN4 4M77C 4F7UA 1JRIA 2DJZA 2RD1A 4C8QA 4F7UB 4C8QB 5LJ3e 5LJ5d 4N0AC
chains in the Genus database with same CATH superfamily
3FLGA 3CCLA 4C92E 4KH1B 2RJEA 4M78C 4MDXA 2HSPA 2NUPA 2H8HA 1PM3A 3CCET 3P8HA 4JPBW 1WXTA 1SKUB 2FPEA 4DEYA 1LVKA 1UEBA 2CDTA 2XKOC 2GCXA 2XIDA 2XG8D 3CC2A 3GIBA 3LWHA 1UGRB 2L3RA 3BFMA 5DLOA 2CSIA 4HA8A 2YUOA 3M5AA 2DETA 1VUBA 1QW1A 4FSSA 1YJ9Q 1LCKA 2BIVA 2K4YA 1WFWA 2FB7A 1PC0A 1D1BA 1S1NA 3RESA 2YDLA 2HL5C 1NLPC 5CKFA 2RQVA 3G4ST 3CC4A 3OYAA 4F04B 4RTWA 2VXEA 2O88A 1WGSA 1Q82U 2K3YA 4QQDA 5CQYA 2QEXT 1Q95G 1Z9ZA 5KE3A 3OW2A 1VQNT 2DIQA 1WQWA 1SSFA 4IUUA 2GNCA 1IRXA 1UJ0A 2RI3A 2A3LA 5D6WA 1NBEB 2EYWA 5GJVB 2MCNA 1D0YA 1ZUYA 3H41A 4AG1C 3CCMQ 3HP9A 3OYBA 1KK7A 3KXTA 4IURA 4CC7A 4II1A 4JRIA 2LQKA 2QGGA 4JRPA 1V29B 2EQUA 2K2MA 2EAYA 4FW1A 2OTLA 5GAOq 4EMHA 2QTVA 1QCOA 5GAMe 2R5AA 1HK9A 3MJXA 2DEQA 4OMFB 2JJ9A 2V1QA 1VQ7Q 1OU8A 3H0HA 3JB9G 1KQ2A 1GCQA 2RMOA 4F7UA 5CVIA 5GANg 4ZNXA 2IIMA 1MV0B 4JJNK 4B6MA 4LD9K 2YHTA 4BE0A 2KR3A 1VQ9A 4JJDA 4QVZA 2KSSA 4JLIA 4OVAA 3R6NA 5KE2A 1KHIA 2HQXA 1YJ9T 2CH4W 2FZCB 1ABOA 1UGPB 4M75D 3G71Q 1K73C 5GAMh 4M75A 1QVFA 3HSBA 2XU8A 4OMQA 4FIBA 5GAN2 2RHIA 2MWPA 3EG2A 2EW3A 3UWNA 1AEYA 4BY6C 3V8KA 2P0KA 3ER0A 4FM4B 2BZXA 4J83A 1S72Q 3CCRA 3OW2P 1SRMA 2EYXA 1ZA2B 5FWCA 1KC8R 3MEUA 2O9SA 2QASA 4AFSC 1YJWA 2PVGB 2HNIA 1PKTA 3EFSA 1RI0A 2RJDA 2HBPA 3J7AF 1WHHA 2LNHB 5KYYB 4C5EA 3L2VA 1UECA 2X35A 1RAHB 5I22A 4NS5A 2WACA 3EGXB 3PE0A 2JNGA 1X01A 2O01E 3QYHB 3PIOA 3ZFJA 2DTHA 5KYWA 2QQRA 2BZ8A 2HCKA 3H0IA 4GBQA 2ESWA 3OQ5A 4M7AE 3X26B 3JB9J 4A53A 1GBRA 3M55A 1WHJA 1QWEA 3UF4A 1KHCA 2FO0A 4LDXA 3S3MA 3FEOA 3CCVT 3EG9B 1KJWA 3CC7Q 3FB9A 2RQRA 3CXCA 4RTYA 4EMKB 2K5LA 4RTTA 2LJ1A 2QI2A 2DL4A 3I55Q 4C8QF 3UT1A 3ZEHA 2MOXA 1PNJA 5LJ3h 1BCOA 2ZPGB 1AT1B 2EKHA 3OMCA 3GLXA 1QVFP 4C5HA 3G71T 3HL8A 2LQNA 2WSCE 1M3CA 2KEAA 1F1BB 1VQLQ 2O9VA 1JQQA 3PIPA 2CZ1B 3OS2A 4M7DE 1OOTA 2CKKA 2J7IA 4QW2A 3I5RA 1S72T 3RDVA 5IT9E 1D1CA 1SHFA 3VRYA 2EQKA 3RKXA 3X25B 2HKQB 5LL6S 2RNAA 4C92F 2GFUA 4LNPA 3I56Q 1HSQA 1GBQA 4XQ3A 1MMNA 1PSFA 3HHTB 3CXCS 1BKBA 3QBYA 1KC8U 2A0FB 3UPUA 2DL7A 3FDRA 1UGSB 4GY5A 1VQMQ 2O4XB 3M0SA 2DVJA 4PJJA 5D6YA 3CCJA 1UTIA 3JCMc 4J6XA 1SSHA 2LP5A 1TOVA 3JV3A 5KYXA 2XI9A 2PVDB 1R77A 1UGQB 4Z88A 3VS6A 4M78F 2KI7A 5LJ5h 2CZ0B 3CXCP 3CC7T 1YWOA 2AK5A 3V8LA 1H92A 1X6BA 2LX9A 4RTUA 1VQPA 4FL6A 4O5VA 1M90C 1ACMB 3PVQA 2DXUA 1C0MA 5CKBA 3RUXA 5GMKe 3MCAB 3JCMW 1U8RA 4LE9A 2RF0A 3KFVA 1T3LA 3JCMQ 2QQSA 5C0MA 2RQTA 2JT4A 4BI3A 2LVMA 1GCQC 1KD1C 3C12A 1RACB 2MIOA 4EMGA 1VQLT 3M9QA 3SB2A 1M27C 4MZTA 1ZBJA 3O8VA 1RLPC 2ATCB 1JJ2S 4N4IA 2KMTA 9ATCB 1XTDA 2C0IA 2DXBA 1VQOA 2DF6A 2DRMA 3L2RA 2JTFA 3JCMJ 2KROA 5GAN7 3OYGA 3I56T 2VWFA 4A4GA 3OYFA 4OGCA 3HRSA 4M75C 1YNZA 2OJ2A 3JB9H 4D6WA 4F7UE 4FT4A 2CT4A 3OYIA 2PNIA 3TU4K 3VS0A 1ZX6A 2DA9A 1U1TA 4QQ6A 2LRQA 1VQMT 1WIEA 4XAXB 1TS9A 2P84A 1QKXA 5GAMj 3EG0A 2RHYA 1WHLA 1HJDA 4HKEA 2COYA 2L3QA 3CPWA 3CCUQ 3JRZA 1K76A 2FRYA 3DB3A 4OF1A 1OZ2A 2FPFA 1IREB 2E64A 2L8DA 1QVPA 1N6AA 2ED0A 1MMDA 2YRVA 2DYBA 3M0TA 1QP2A 2RHUA 2D9TA 2E5KA 1W2BA 2XDBA 3QJ6A 1BI3A 1QCNA 3V7CA 2P4TA 2DBMA 2DZCA 3FC3A 3V8JA 3CMEQ 1RAIB 3G6EA 2RHXA 1FMKA 3JAME 2RI5A 2DX1A 1WYXA 5GANf 2QXFA 4BD3A 5CIUA 2VASA 2HBWA 5FWBA 5LJ3f 2G6FX 1NEGA 2FRWA 3OYLA 2L3PA 1I07A 2CP3A 2RK2A 4M77G 5C6SA 3SWNA 1H641 1OYXA 3CCEQ 5EC7A 2P4RA 1C1AA 5GAMd 3NGPA 4CRIA 3CEYA 1VIFA 2ZZDA 4M7AD 4J6YA 1J3TA 1DJ7B 4M7AA 3INZA 2KNBB 3CPWS 4E47A 2DTIA 1TUCA 1U3OA 2KVQG 3M57A 3OA6A 1X75C 3HPWA 1K8AC 2QAZA 1QMCA 2KT1A 4PJOD 2DE0X 3CCLQ 3N5BB 4PJOA 7AT1B 2EFIA 1VIEA 2MAMA 2JS0A 1H8KA 3QUIA 1UGVA 2K3XA 1Q81C 2D8JA 5FU6C 1VYTA 1SRLA 3CPWP 5KYNA 3QSUA 1R0CB 3CCUT 4GLKA 1I1JA 4Y91A 1WHMA 4OB0B 4M7DF 5IXBA 2CZ7B 4PFPA 3EG1A 1D09B 4C0GA 4CI0C 3QZ9B 1B07A 2E3HA 2ZPEB 4RTVA 3S6WA 1I0CA 4Y28E 1NYFA 2MK5A 5GAN5 1JRIA 3I35A 1K73R 4M7DD 4C8QB 3JSCA 4M7DA 5LJ5f 3RKYA 2KBTA 3CC4Q 1VQ5Q 3ZL7C 3V7RA 3CMET 5CKEA 2VXFA 1QP3A 2KYBA 1KG1A 3MEAA 5KH6A 1VQ4A 4LUDA 2JMCA 2QA4Q 4C0FA 2EYYA 5CKDA 1IB8A 4WTOB 1CSKA 1JXOA 4R0KA 5J26A 4IUTA 5LJ3d 1B34A 3A1PA 2COWA 2DKGA 4MMKA 1HD3A 2DERA 1FX7A 4PJMA 4DEXA 4E7HA 4QT7A 2ZCFB 3CCQQ 1E7OA 4Q5WA 1FMWA 2F2WA 4IIOA 3EFOA 4C0ZA 4C92B 4TVRA 2KYMA 2OI3A 3H0FA 1ZHIA 1WZOA 2AT1B 3FRNA 1YITQ 2B86A 1VYUA 1Q7YC 4Z02A 3CCLT 4OMLA 2QGFB 2EGAA 1T0HA 2BE9B 2L3SA 3MKDA 3NMZC 2XMFA 5GAMg 3QKJA 2A28A 3RBBB 2QEXA 1X6GA 4M77D 4NL2A 2EKOA 1VQNA 4J9IA 1VQ9Q 2DNUA 4OP0A 4EDUA 1EZZB 4M78B 1UHFA 1UDLA 3QYGB 1VQ8Q 1YHQA 2XDDA 5CCAA 1M2VA 4HT8A 3HFOA 5KYUA 4LDWA 5GMKj 2EJGA 2CREA 1YJNA 1ZBXA 2JM9A 1PWTA 5LJ5d 2LQWA 3CC4T 1VQ5T 3GOXA 1G3YA 1GFCA 1AZGB 4DQ2A 2X4YA 2RM4A 1RAGB 4QKUA 3REBB 2RHZA 5CO7A 4F7UF 5CK9A 3CCRQ 2QA4T 1V76A 8AT1B 1K73U 2QTXA 1NM7A 2SRCA 3PTAA 5GMKi 2E5QA 1YJWQ 3PMTA 4XU0A 2CSQA 3X28B 1HXDA 2DIGA 3CCVQ 1D1AA 2PUOB 4J9GA 3SFMA 2OX7A 3C0CA 1D0XA 3CCQT 5A2QE 2HEQA 2RQWA 1N8RC 3LLRA 4BB7A 4RG2A 4BDZA 2LT4A 2MWOA 5IXFA 4OB3B 4AMCA 2OTLT 4M75F 4A4FA 2OTJA 4PLLA 4E7KA 1Q82C 1JXMA 1YP5A 3PMIA 1EIFA 3JCMg 2VGNA 2C0OA 2X9HA 2HZYA 1YITT 2JS2A 2JZ2A 1M5Q1 1JO8A 2X51A 3M58A 1Q86C 2KY9A 2FYKA 4AG2C 3SWNC 4EIKA 2E70A 2ZPIB 3QDFA 1T0JA 2R5MA 2ECZA 4QQGA 1NPRA 3M0QA 1XOVA 3E9GA 2DVEA 1PRMC 2FZGB 4E6RA 3CBMA 1M90R 4M7AC 1VQ9T 4ORZA 3E9FA 1SG5A 3UATA 4C92G 2J6OA 1VQKA 2M0YA 2QYZA 2NLUA 4N0AA 3VUZA 2X4JA 3M4GA 1VQ8T 2HSEB 3OS5A 5IAYA 5HK0A 3CCMA 3PNWC 1D3BB 1MV3A 4PJOC 1YBYA 3UA6A 2BE7D 4BI8B 1KD1R 1I5OB 3HRTA 3M4YA 4KULA 3OYMA 1OPKA 5DLQE 2RK1A 3OBWA 2KT8A 5LJ3e 4BE1A 4JS5A 5KCOA 4E7ZA 2F2XA 1QVGA 3CCRT 2PU9B 4PJLA 1MNDA 1N5ZA 1R0BG 1VQ7A 4C0DC 1BI1A 4BACA 1RABB 2FG0A 4M78G 4R56A 1YJWT 4Y92A 4FYWB 4JRQA 4XU1A 2DD4A 4BY6B 1K0SA 3RERA 2EBPA 4C5IA 1OZ3A 2WSFE 2H3JA 4PJOE 4J9DA 3RKWA 4HVUA 4M7DC 2LDMA 2L89A 3OB9A 3OYKA 2HQHA 5GANh 2M9UA 2XD0A 3SDZA 1M30A 1ZSZA 1A0NB 5FW9A 3G71A 2IG0A 3MP1A 1VQ6A 1OI1A 1N9SA 3CCJQ 2LJ3A 4RMOA 2VVKA 2CUDA 3S3OA 3L2ZA 1U06A 3M54A 1WLPB 2IVWA 3NTIA 3URGA 1SPKA 1VQPQ 4LD6A 2YWWA 4VUBA 2XHCA 2CP0A 1JU5C 3P8DA 2QDLA 3L2WA 3JB9D 1M9SA 4BE2A 3ZBDA 2YRDA 3VS3A 1BBZA 4KT0E 3M59A 2JW4A 1QVGS 2JOYA 2EWNA 3S3NA 4DBQA 5A0GA 2YXYA 4HVVA 4DBHA 2ENMA 2ED1A 1H3ZA 2K57A 5LJ5e 1MHNA 3GNFB 3MP8A 2ABLA 3LW5E 1M90U 1BCMA 3CCSA 3QWXX 2VC8A 4JJCA 1M8MA 1I8FA 1AZEA 2DAQA 2LZ6B 4CC4B 3VS4A 2CS7A 1QVGP 1JJ2A 2ROTA 4M77C 2DJZA 1KIKA 2YUNA 3LYIA 2QQBA 1IGUA 4PL6A 2ROLA 1AVZC 2V8IA 2LMJA 2NUPB 1KD1U 2GQIA 2M0OA 4HCZA 1NLOC 1XJWB 1RLQC 3NTHA 2HD0A 3WVEB 3CMAA 1H3HA 3MEWA 1AHJB 3C94A 2RN8A 3I55A 1EFNA 2NYSA 1WXUA 3THKA 2RI2A 4RG8A 1X43A 1AOJA 3DB4A 1K8AR 4XTVA 1G8XA 1KQ1A 1PD1A 3CPFA 1B3QA 4M77E 3OMGA 1N27A 3EGDA 1NJIC 3CCJT 5L8RE 2H3EB 1FXXA 1VA7A 1X27A 1MGQA 2LCCA 5I11A 2LCSA 1Q81R 2NUTA 3SHWA 4QVDA 5FU7C 4K11A 3GPLA 3U23A 4D8KA 1WI7A 4F14A 2DL8A 2YUQA 1IO6A 1VQPT 5CKHA 2V26A 2E41A 1VYVA 2LJ0A 3I56A 4L6V5 2W10A 3RR6A 4J9FA 1XNIA 4ELZC 1VOMA 4IKFA 4A63B 4FYXB 1O75A 2DL3A 2HL3A 2EQMA 2V8JA 1X2QA 3F70A 2E65A 5FLXE 3TCJA 1CKAA 5FROA 3LGFA 3CD6Q 1VQMA 2JUFA 1JJ2P 1UG1A 2M51A 4OMPA 1PHTA 1VQOT 4IUQA 4F7UB 4N0AC 4IUVA 2LCLA 3A8MB 3TQ7P 3NPFA 2Z0WA 1OULA 3MPUB 2RA2A 4J6WA 2DO3A 2K2VA 4PJNA 1I4K1 1IZ6A 1SHGA 1TXQA 1G2BA 5A0LA 3ASKA 2P0PA 3LH0A 1BK2A 1QLYA 3DKMA 2PTKA 1Q7YR 3QZ5B 3EHRA 4M75B 4PLIA 1PKSA 4FW2A 1YIJA 2DPPB 1AWJA 1QKWA 3HTRA 1RI9A 4KGZB 3EFRA 2I0NA 1WQ7A 1ARKA 2DTOA 4HT9A 1K8AU 1NE8A 1BI0A 3OSVA 2DEUA 5DM7R 3QIIA 4XK8E 4HCCA 3OYHA 1G5VA 4M7AF 4J7IA 1Y7XA 1P92A 1Q81U 3TEEA 2CYZB 3EH2A 1UFFA 1ZSZC 2D6FA 1LNXA 5KYYA 3RMQA 1MNEA 3JCMf 3TSZA 2Y4XA 1SEMA 2CUBA 3EGXA 4JZ4A 2AIRB 3PT9A 4L5GA 2K5FA 2C06A 4PJOF 2KRSA 5HKCA 5KYWB 3LH5A 1K4US 1KQSS 1U5SA 3OYEA 2CP6A 3CD6T 4XTZA 1K9AA 5LJ3j 4A54A 2BKDN 4HVWA 1I5LA 4MZMA 3X24B 2LNVA 5FRNA 4XTYA 1OX8A 4X1VA 4AT1B 1K9MC 3ME9A 4RTZA 4JS4A 4RCBA 4RTXA 3PVLA 2BZYA 2LX7A 1PRLC 4EMKA 4LN2A 1TG0A 3CC2Q 1FWZA 1JBMA 2P0QA 1N8RR 5A0DA 4AFQC 3SD4A 4OGEA 4RKUE 3UDCA 4J5YA 2ZPFB 1Q82R 1PSEA 3GBQA 5FRMA 3JCMP 3ULRB 1QQJA 1CKBA 1YI2A 5D7UA 3J81E 3M53A 3CMEA 1MUZA 3OYYA 1Q86R 1NEBA 4N4GA 3BDLA 2XK0A 2RPNA 4F7UG 1TUGB 2E3IA 1K0XA 3META 5GAOm 3H6ZA 5J3BA 2AZSA 2RB6A 3JCMb 1LJOA 1Q7YU 1WHKA 3QG1A 1TU0B 5I2MA 5GANd 1U1SA 2EQJA 4GLMA 1X2KA 2CP7A 2QDYB 3L1AA 3OBYA 3CCEA 1M3BA 3QPHA 5FU6B 5IHKA 2LT1A 3EG3A 1W70A 2K79A 1YJNQ 1K1ZA 2ZPHB 1O9SA 1UJYA 3BE3A 3PFSA 5LJ5j 1AWXA 4M75G 1M1KC 5EG2A 5I2SA 3DLLA 2VKNA 2XDPA 4JRKA 3BDUA 2A36A 1G83A 3L2UA 1BIBA 2OTLQ 2FL7A 2OAWA 1M4ZA 2O4XA 3A8GB 4A4HA 1R8OB 4JDSA 2KDSA 2A37A 4OMOA 2FVUA 1MMAA 2L5QA 2IPOB 4M77F 3G4SA 1OV3A 4E7LA 5KYXB 2QQAA 1WHGA 1RAFB 2F69A 3E19A 1OX9A 4KGXB 5GMKl 4BI4A 1MMGA 3CC2T 2QQ9A 2RD1A 4AFUC 4M77A 2OTJQ 3LWIA 4LXCA 4HCBA 1ZQ1A 4FT2A 3LGLA 4KGVB 2CGHA 3VYHB 1Y96A 3J80E 2X4WA 3OYCA 3EGDB 4PFZA 4M78E 3L2QA 4JZ3A 2EQIA 3VS2A 1VQ5A 1N8RU 2GF7A 1M1GA 2NUTB 1M8VA 4B9XA 4RCCA 2KQWA 2CP2A 4J9EA 5GAOl 2PZ1A 4J8OA 2QA4A 3A8LB 2DXTA 1GL5A 3A98A 1VQKQ 4JJBA 3QO3A 1UHCA 2A08A 1YHQT 1Q86U 3BY7A 3KUFA 4PK4A 3OS0A 3CCQA 3DLMA 1C6VX 1JB0E 2EGCA 2FPDA 2MMPA 4MZPA 1TH7A 4KUIA 2HMAA 1YJNT 2HKNA 2HQEA 2KRNA 2K5IA 3BW1A 3D7SB 4C8QG 4L59A 2GFAA 4LDUA 2I2LA 3QDRB 1GCPA 3GF5A 2JM8A 1YITA 1YJ9A 1KFZA 1RAAB 8ATCB 5L23A 3H8ZA 2W0ZA 1X69A 3JCMV 5J39A 2D0QB 1GFDA 4F17A 4J9CA 4X9CA 1TWBA 2EVRA 3IQLA 5LJ3g 1GXIE 4XTXA 1FMVA 1YWPA 4ZGEB 2WSEE 5HK3A 3CQTA 4DOVA 3WVDB 1IXDA 3VS7A 3OW2S 3O5ZA 2DK3A 1OEBA 1VQ8A 2HAXA 2OTJT 1G3SA 5GAN4 1SF9A 2C0TA 1M2OA 4YTLA 1D0ZA 2FHDA 4EPCA 1VQ6Q 2VUBA 1NJIR 2JN0A 1PCXA 2DRKA 2F1LA 2LQ8A 4B9WA 2NWMA 4DA4A 2JTMA 3P8BB 4A4KA 5GANe 2YRCA 4FCYA 2Y4YA 3HRUA 2DLPA 1M1FA 4X34A 4EMKC 4R55A 2K6DA 3HFNA 4XU3A 4RUGA 3OYDA 1WPYA 3C95A 1VQKT 3T9NA 3REAB 3SWNB 3CCVA 2R57A 2J6FA 3JCMe 2DFUA 3OYJA 2OAUA 3CCMT 4ME7A 1E6GA 1PG5B 1WJRA 3CCSQ 1WNLA 4M7AB 1WJSA 5GAN3 2G3RA 2GBQA 4ZTJA 5LJ5g 3A5ZB 2KRMA 1WDXA 2GTOA 3L42A 2E6ZA 4PJOB 1AD5A 1VQ7T 2CH4A 2YLBA 1QVFS 2VB6A 4HXJA 4E7JA 2F5TX 4FYYB 1AWWA 3JB9F 2A7YA 3CMAQ 2V1RA 1W1FA 3JCMh 2DZ9A 3MP6A 1RL2A 2DMOA 2CZ6B 2MF2A 4OMMA 1NPPA 1S72A 4C0DB 1HYOA 2KK4A 2QG9B 4ELYC 2DL5A 4Z8AA 4C8QD 2JXBA 4C8QA 1WJQA 1VQ6T 1Z9QA 4M7DB 1ZUUA 2K7AA 3VKIA 3QWYA 2QK0A 3M0PA 1NYGA 2YLCA 4DOWA 5AT1B 3RIRA 2DM1A 2R58A 3E2UA 3M0RA 5IN1A 1NJIU 3TREA 1B34B 2LC4A 2EGEA 2GGRA 2KXDA 1RAEB 1VQOQ 3OSSC 3Q1JA 1W6XA 2K9GA 4HCKA 3V7SA 3CC7A 2DD5A 3LX7A 3CBOA 4J9HA 2EPDA 4C92D 3CCST 3EFOB 3TSWA 4CC3A 2M16A 4C92A 3PGGA 2PQWA 1UB4A 5GAN8 5IH2A 1T3SA 1E6HA 2CP5A 3MO8A 2VYTA 4KUDK 5CR2A 4CC2A 1TSFA 2E4HA 2YT6A 2B8AA 2EYQA 2COZA 2EJ9A 1IGQA 3AT1B 3X20B 3H9NA 1B7TA 1K9MR 1ZSGA 5M9OA 3E1SA 1G3TA 1YFNA 2O2OA 1YCSB 3RNJA 3C4SA 5CQXA 1OQKA 1VQLA 2NUZA 3FIFA 3CMAT 4N4HA 1Y07A 2F5KA 4V2SA 5HY6A 4P5NA 3MHXA 4ZN1A 2CT3A 4MMLA 4M77B 5ECAA 2JMAA 4M7AG 3I55T 4M78D 4WCIA 4PFOA 4M78A 1KC8C 2E10A 1Y96B 2ZGWA 4XTWA 2RJFA 1BU1A 4Z89A 1M2VB 3VYGA 1RUWA 2J06A 5KYUB 2E6NA 1YIJQ 4PJOG 2PVOB 4A4EA 1WXBA 2KGTA 1Y57A 3EHQA 3G6EQ 4MDWA 3UA7A 1QWFA 2BUDA 4LDVA 4BDYA 3FJ5A 1YCYA 2M1HA 2Y90A 3GNGA 1YN8A 3FJPA 1UE9A 2HDAA 5GAMf 4D8DA 2VGMA 2EYZA 4E7SA 3QJYA 4ANJA 2J05A 5IHNA 5GMKh 5FU7B 3EH1A 1Y0MA 3VS5A 4OMNA 3AHUA 1LOJA 3NTKA 1RADB 2FEIA 4KBMB 2DYIA 1M1KR 4M7DG 4ZTFA 1ZLMA 5GJWB 2DJQA 4DBFA 4J7FA 2ZAEA 1IHWA 1KQSA 2RQUA 2E1HA 4BUGA 4JUVA 2X3XD 2J6KA 1BIAA 4E2FB 3NHNA 4NL3A 2D8HA 3R6OA 2X3WD 1UUEA 3VS1A 4C5GA 3JB9I 1NZ9A 1ABQA 1NG2A 3VU3C 4IIMA 4JLGA 5IHIA 4M75E 1V1CA 2O31A 4OB2B 4NOYA 4DBRA 1I81A 1TUDA 4ESRA 2L2PA 2MPXC 1K9MU 4KH0B 1BYMA 3QXEB 3SEMA 3JCMX 1YI2Q 1D3BA 3MEVA 2MI6A 2VV5A 2L0AA 4UC4A 1YIJT 4AFZC 5DY9A 4OB1B 2KXCA 1LPLA 3A8OB 2KAFA 3VV0A 4FU6A 3HKSA 2AKLA 1W4SA 3G7ZA 3CD6A 4M4ZA 3OS1A 2GTJA 3G6ET 4ATOA 5GAOr 1VQ4Q 1KSWA 2PUKB 4FSXA 1IHVA 5GAOn 5GANj 2RH2A 3M0UA 5I21A 4PNOA 2EIFA 2K3BA 2FZKB 4IUPA 3M56A 3RMSA 4X9DA 5GAOp 3EG9A 3QHSA 2DILA 3CCUA 2JTEA 4C8QC 4WF2A 3CBPA 3KBGA 3EAEA 4PKCC 1ZUKA 4O6JA 3NFCA 5D6XA 2D1XA 1EX4A 3OY9A 3EGUA 5GMKm 2XICA 5GAN6 1KQSP 4XTUA 3OYNA 2X4XA 1ZSZB 2SEMA 3G1JA 2D0NA 2ZPBB 1W2BS 4ZGDB 4J9BA 3I5SA 2JVVA 3G4SQ 1ZA1B 1M1KU 2RO0A 2V8KA 4ZGJB 2DXCA 5CAIA 2EJFA 2MYSA 1WX6A 1XQHA 2AZVA 2AHJB 1M3AA 2GQVA 2F2VA 5AYFA 2BTTA 3A8HB 4C8QE 2QEXQ 1N9RA 4FYVB 1X6OA 1BI2A 3VJPA 1VQNQ 4ZN3A 3VRZA 1PD0A 3GP8A 2LTOA 4C92C 1QCFA 2E12A 5HCKA 5KCHA 1W2BP 1YHQQ 1Y71A 2YUPA 4XU2A 4QVCA 1TTHB 4E7IA 1YI2T 2KE9A 2M02A 4F16A 1BB9A 3VUBA 1OPLA 1FYNA 3WXMB 2RJCA 3TVTA 1JEGA 3JCMd 1AWOA 2YSQA 1WA7A 1OU9A 3I9QA 4LDYA 4LUEA 1GRIA 4KRTA 1G3WA 2AKKA 1VQ4T 2DBKA 6AT1B
chains in the Genus database with same CATH topology
3FLGA 2RHUA 2D9TA 3LYIA 4YTLA 4C92E 3CCLA 2QQBA 2FHDA 2RJEA 4PL6A 4M78C 4EPCA 4MDXA 1W2BA 2V8IA 2XDBA 3CCET 3QJ6A 3P8HA 1KD1U 2VUBA 1BI3A 2M0OA 4HCZA 3V7CA 2JN0A 2P4TA 1UEBA 2DZCA 2LQ8A 2XKOC 2GCXA 2XIDA 2XG8D 3NTHA 2HD0A 3V8JA 2JTMA 3WVEB 4B9WA 3CMAA 3MEWA 3CC2A 3GIBA 3G6EA 2RHXA 3LWHA 1AHJB 3JAME 2RI5A 1UGRB 2L3RA 3BFMA 3C94A 3P8BB 4A4KA 4HA8A 5GANe 5DLOA 3M5AA 5GANf 3I55A 2Y4YA 1VUBA 3HRUA 2QXFA 4BD3A 1M1FA 4X34A 5CIUA 4EMKC 1QW1A 4R55A 3HFNA 4XU3A 2RI2A 4RG8A 5LJ3f 3OYDA 1WPYA 3DB4A 3OYLA 2BIVA 2K4YA 3C95A 4XTVA 1KQ1A 1VQKT 2FB7A 3CPFA 1VQNA 3T9NA 2RK2A 4M77G 5C6SA 3SWNA 1H641 4M77E 3OMGA 3RESA 3SWNB 1OYXA 1N27A 3CCVA 2R57A 3JCMe 5GAMd 1NJIC 3OYJA 2OAUA 5L8RE 4CRIA 1FXXA 3CEYA 4ME7A 5CKFA 3CCJT 3CCMT 1MGQA 1VIFA 3G4ST 2LCCA 2ZZDA 3CC4A 4M7AD 4J6YA 1WJRA 3OYAA 1DJ7B 1WNLA 4QVDA 5FU7C 3INZA 3GPLA 4M7AA 4M7AB 3CPWS 1WJSA 5GAN3 2VXEA 2G3RA 4ZTJA 4E47A 1WGSA 1Q82U 2K3YA 1VQPT 4QQDA 5CQYA 2DTIA 2QEXT 5KE3A 5CKHA 5LJ5g 3A5ZB 3OW2A 2KVQG 1VQNT 2DIQA 3M57A 3OA6A 1X75C 1WQWA 3HPWA 1SSFA 1K8AC 4IUUA 2E41A 2RI3A 4PJOD 3L42A 4PJOA 3N5BB 2E6ZA 2A3LA 4PJOB 1VQ7T 2EFIA 4L6V5 3I56A 1VIEA 5D6WA 2MAMA 2YLBA 1QVFS 1XNIA 4ELZC 4IKFA 3QUIA 2K3XA 3HP9A 2F5TX 3OYBA 4E7JA 1Q81C 3KXTA 4IURA 5FU6C 3JB9F 2A7YA 1O75A 4II1A 4JRIA 2LQKA 4JRPA 2EQMA 2V8JA 3QSUA 1V29B 2EQUA 3JCMh 3CCUT 3F70A 4GLKA 2DZ9A 2EAYA 3MP6A 1RL2A 2E65A 5FLXE 5GAOq 2OTLA 2CZ6B 2MF2A 4Y91A 3TCJA 4EMHA 1NPPA 4OB0B 4M7DF 1S72A 4C0DB 5FROA 3LGFA 2C06A 1VQMA 2CZ7B 5GAMe 2R5AA 1HK9A 2JUFA 2DEQA 2KK4A 4C0GA 4CI0C 3QZ9B 4OMFB 4ELYC 2ZPEB 3JB9G 3S6WA 4C8QD 4Y28E 1VQOT 1KQ2A 5GAN5 4F7UA 1JRIA 1WJQA 4IUQA 5CVIA 4C8QA 4C8QB 4F7UB 5GANg 4N0AC 1VQ6T 4IUVA 2LCLA 3JSCA 4M7DA 5LJ5f 3A8MB 4LD9K 4JJNK 4M7DB 2YHTA 3RKYA 3VKIA 4BE0A 2YLCA 3V7RA 3CMET 5CKEA 2VXFA 1QP3A 2RA2A 4J6WA 1VQ9A 1KG1A 4QVZA 2DO3A 4DOWA 3MEAA 5KH6A 2K2VA 1VQ4A 2KSSA 4JLIA 4C0FA 4OVAA 1I4K1 3RIRA 5CKDA 5KE2A 2R58A 1IZ6A 1KHIA 5A0LA 2HQXA 5IN1A 5J26A 1YJ9T 3ASKA 2P0PA 3LH0A 4IUTA 5LJ3d 3TREA 1NJIU 1B34A 1B34B 2LC4A 3DKMA 2DKGA 4MMKA 1UGPB 3QZ5B 4M75D 1K73C 1FX7A 5GAMh 4E7HA 4M75A 1QVFA 3OSSC 4M75B 4PLIA 3HSBA 2XU8A 3Q1JA 2ZCFB 4FIBA 5GAN2 2RHIA 1YIJA 2MWPA 2DPPB 3V7SA 4Q5WA 3CC7A 2DD5A 3LX7A 3CBOA 3UWNA 4C92D 3EFRA 3CCST 4C0ZA 1WQ7A 4BY6C 4C92A 2M16A 3PGGA 3V8KA 2DTOA 2P0KA 4C92B 1K8AU 1NE8A 3ER0A 1BI0A 2PQWA 4FM4B 4J83A 4HT9A 1UB4A 4TVRA 5GAN8 3OSVA 3MO8A 3CCRA 2VYTA 1ZHIA 4KUDK 5DM7R 3QIIA 5CR2A 4XK8E 3FRNA 3MEUA 4HCCA 3OYHA 5HY6A 2B8AA 2EYQA 1G5VA 2EJ9A 4M7AF 4J7IA 1Y7XA 1YJWA 2PVGB 1Q7YC 1P92A 1Q81U 2HNIA 4Z02A 3TEEA 4M7DD 3EFSA 1RI0A 3CCLT 2RJDA 2CYZB 3X20B 2HBPA 3J7AF 2D6FA 1LNXA 3RMQA 3JCMf 3E1SA 4C5EA 5M9OA 1G3TA 3L2VA 2Y4XA 3C4SA 2X35A 5GAMg 3QKJA 4NS5A 5CQXA 2WACA 1VQLA 2QEXA 3FIFA 3CMAT 4N4HA 3PT9A 2JNGA 1X01A 1Y07A 2F5KA 2K5FA 2O01E 2EKOA 3MHXA 3QYHB 4L5GA 4M77D 4NL2A 2DTHA 4P5NA 3ZFJA 4ZN1A 2QQRA 5HKCA 4MMLA 4M77B 4OP0A 4M7AG 3I55T 4M78D 3OQ5A 4EDUA 4M7AE 3X26B 1KQSS 4M78A 3OYEA 4M78B 1KC8C 3CD6T 3QYGB 1YHQA 2E10A 1Y96B 4XTZA 3JB9J 5LJ3j 4A53A 4A54A 2BKDN 1I5LA 4MZMA 3X24B 2ZGWA 3M55A 2XDDA 4XTWA 2RJFA 5CCAA 2LNVA 5FRNA 4XTYA 3VYGA 4HT8A 4LDXA 1KHCA 3HFOA 5GMKj 3FEOA 4LDWA 3CCVT 3ME9A 2E6NA 2EJGA 3S3MA 1K9MC 4PJOG 4JS4A 1YJNA 1ZBXA 4RCBA 2PVOB 4A4EA 5LJ5d 3FB9A 3CC4T 3CXCA 4EMKA 4DA4A 3GOXA 1VQ5T 4V2SA 4EMKB 1G3YA 1FWZA 2K5LA 1JBMA 2P0QA 5A0DA 4DQ2A 4MDWA 3SD4A 2X4YA 2QI2A 2RM4A 4OGEA 4RKUE 3UDCA 2BUDA 2RHZA 5CO7A 4F7UF 4LDVA 4C8QF 5CK9A 3UT1A 4BDYA 2QA4T 3ZEHA 1YCYA 2M1HA 4J5YA 2Y90A 3GNGA 2ZPFB 1K73U 1PSEA 5LJ3h 2ZPGB 3FJPA 5GAMf 2QTXA 3PTAA 5GMKi 2E5QA 2VGMA 5FRMA 3PMTA 3JCMP 3QJYA 4XU0A 3OMCA 3GLXA 1YI2A 5GMKh 5FU7B 3X28B 3J81E 3M53A 1HXDA 2DIGA 4C5HA 3HL8A 3G71T 2PUOB 3SFMA 3CMEA 3OYYA 3AHUA 2WSCE 1LOJA 3NTKA 3CCQT 4N4GA 3BDLA 2XK0A 5A2QE 4F7UG 4KBMB 1N8RC 3LLRA 4BB7A 4M7DG 4RG2A 2CZ1B 3PIPA 3OS2A 4BDZA 2LT4A 2MWOA 4ZTFA 4M7DE 3META 4OB3B 5GAOm 3H6ZA 2CKKA 5J3BA 2OTLT 4M75F 2RB6A 4J7FA 1LJOA 4QW2A 4A4FA 3JCMb 1Q7YU 2OTJA 3QG1A 4PLLA 4E7KA 1Q82C 1S72T 5I2MA 5GANd 1KQSA 1U1SA 3PMIA 1EIFA 2EQJA 3JCMg 2VGNA 5IT9E 2EQKA 2QDYB 2E1HA 4BUGA 4JUVA 3L1AA 3OBYA 1YITT 3CCEA 3RKXA 3X25B 5LL6S 1BIAA 2JZ2A 3QPHA 1M5Q1 5FU6B 4C92F 2GFUA 4NL3A 3R6OA 3M58A 2LT1A 4C5GA 3JB9I 4XQ3A 1NZ9A 1Q86C 2KY9A 2FYKA 1PSFA 3SWNC 3HHTB 2ZPHB 1O9SA 2E70A 2ZPIB 5LJ5j 3PFSA 3VU3C 2R5MA 4M75G 4JLGA 1M1KC 3CXCS 4QQGA 1BKBA 4M75E 1NPRA 5EG2A 5I2SA 3DLLA 3QBYA 1XOVA 3E9GA 2DVEA 3PIOA 1KC8U 2XDPA 4JRKA 3BDUA 4NOYA 4OB2B 3UPUA 3CBMA 3L2UA 4M7AC 1VQ9T 1BIBA 1I81A 2FL7A 3E9FA 3FDRA 3FC3A 1M4ZA 1UGSB 4GY5A 4C92G 1VQKA 2O4XA 3A8GB 2NLUA 2O4XB 4N0AA 4A4HA 1K9MU 3VUZA 1R8OB 2X4JA 3M4GA 1VQ8T 3OS5A 4JDSA 2KDSA 5IAYA 5D6YA 3QXEB 1BYMA 5HK0A 3CCJA 2FVUA 3JCMX 3JCMc 3CCMA 4J6XA 2L5QA 3PNWC 4M77F 1D3BA 3MEVA 3G4SA 1D3BB 4E7LA 2VV5A 1YBYA 2MI6A 2PVDB 2XI9A 4PJOC 1UGQB 2QQAA 5LJ5h 4M78F 2F69A 3E19A 4UC4A 4PJOF 1YIJT 5DY9A 2CZ0B 4BI8B 5GMKl 4OB1B 4BI4A 3CC7T 3V8LA 3HRTA 2LX9A 3A8OB 2KAFA 3M4YA 4KULA 3VV0A 3OYMA 4FU6A 1VQPA 4FL6A 2RK1A 3HKSA 4O5VA 5DLQE 1W4SA 2QQ9A 3G7ZA 1M90C 3CC2T 3CD6A 2RD1A 3OBWA 5LJ3e 3OS1A 3G6ET 4BE1A 4ATOA 4M77A 4JS5A 5KCOA 2DXUA 3LWIA 4HCBA 5GAOr 1ZQ1A 2PUKB 4FSXA 4FT2A 5CKBA 3RUXA 5GAOn 1QVGA 5GANj 3CCRT 2RH2A 2PU9B 3LGLA 5I21A 4PNOA 5GMKe 2EIFA 1VQ7A 3MCAB 2CGHA 3VYHB 1BI1A 1Y96A 2X4WA 4C0DC 3J80E 4BACA 3JCMW 3OYCA 4IUPA 1U8RA 4M78G 4R56A 1YJWT 4M78E 3JCMQ 3L2QA 2QQSA 3M56A 4JRQA 1VQ5A 4XU1A 3RMSA 4X9DA 5C0MA 1N8RU 2DD4A 2GF7A 4BI3A 1M1GA 4BY6B 5GAOp 3RERA 2LVMA 4C5IA 1OZ3A 3QHSA 1M8VA 4B9XA 4RCCA 2WSFE 3CCUA 1KD1C 2H3JA 3C12A 4C8QC 4PJOE 4WF2A 3CBPA 2KQWA 3RKWA 3KBGA 3EAEA 4PKCC 4EMGA 5GAOl 2LDMA 4M7DC 2L89A 1VQLT 3M9QA 4O6JA 4J8OA 3SB2A 2QA4A 3NFCA 3OB9A 4MZTA 5D6XA 3OY9A 3O8VA 5GMKm 3A8LB 3OYKA 2DXTA 1JJ2S 5GANh 2XICA 4N4IA 2KMTA 2M9UA 5GAN6 2XD0A 4XTUA 3SDZA 1XTDA 3OYNA 2X4XA 3QO3A 2DXBA 1YHQT 3G71A 2IG0A 2ZPBB 1VQOA 1W2BS 1Q86U 3MP1A 3BY7A 3KUFA 4ZGDB 1OI1A 3OS0A 1VQ6A 1N9SA 3L2RA 2JTFA 3CCQA 3JCMJ 3DLMA 2JVVA 1M1KU 2MMPA 1JB0E 4MZPA 5GAN7 3OYGA 2RO0A 4RMOA 2V8KA 4ZGJB 2DXCA 3I56T 1TH7A 4KUIA 4A4GA 3OYFA 3S3OA 5CAIA 2EJFA 4OGCA 1YJNT 3HRSA 2HQEA 1XQHA 3L2ZA 4M75C 2AHJB 3M54A 2GQVA 2IVWA 3NTIA 3URGA 3JB9H 2K5IA 3BW1A 5AYFA 4C8QG 4L59A 4LD6A 3A8HB 2GFAA 2XHCA 4VUBA 4C8QE 1N9RA 3P8DA 4LDUA 4D6WA 4F7UE 2I2LA 1X6OA 1BI2A 3QDRB 3VJPA 4FT4A 3L2WA 3JB9D 3GF5A 4ZN3A 1M9SA 3OYIA 4BE2A 3ZBDA 3GP8A 2LTOA 1YITA 1YJ9A 4KT0E 3M59A 3TU4K 4C92C 1QVGS 2JOYA 1U1TA 4QQ6A 2EWNA 2LRQA 3S3NA 2E12A 5A0GA 5KCHA 1VQMT 3H8ZA 4XAXB 3JCMV 5J39A 5GAMj 2D0QB 1H3ZA 1Y71A 2K57A 2RHYA 5LJ5e 4HKEA 1MHNA 4XU2A 3GNFB 3MP8A 4QVCA 4E7IA 4X9CA 1YI2T 1GXIE 5LJ3g 4XTXA 3LW5E 1M90U 4ZGEB 2WSEE 3VUBA 3CCSA 5HK3A 3CPWA 3JRZA 4DOVA 3WVDB 2VC8A 3WXMB 2RJCA 1I8FA 2DAQA 3JCMd 4LDYA 3DB3A 2CS7A 4OF1A 3OW2S 1OZ2A 2DK3A 1IREB 2E64A 1VQ8A 2HAXA 1G3WA 2L8DA 1QVPA 2OTJT 1G3SA 5GAN4 1JJ2A 1N6AA 1VQ4T 4M77C 2DJZA 2YRVA 1QP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMK B;  4M77 A;  4M7D A;  4C92 E;  2DXU A;  5LJ5 f;  1JBM A;  5GAO r;  4M7D B;  2YHT A;  3RUX A;  4M78 C;  3RKY A;  4DQ2 A;  5GAO n;  5GAN j;  5I21 A;  2RM4 A;  4PNO A;  5GMK e;  2YLC A;  3V7R A;  2CGH A;  4C8Q F;  4F7U F;  1Y96 A;  2VXF A;  3V7C A;  3JCM W;  2JN0 A;  2RA2 A;  4J6W A;  1YCY A;  2DZC A;  2Y90 A;  4J5Y A;  4M78 G;  3V8J A;  4M78 E;  5LJ3 h;  3JCM Q;  3FJP A;  3GIB A;  5GAM f;  2QTX A;  4JLI A;  3RIR A;  1I4K 1;  5GMK i;  4XU1 A;  4X9D A;  5GAO p;  3JCM P;  3BFM A;  4XU0 A;  5GAN e;  4HA8 A;  3RER A;  5GAN f;  3QHS A;  1M8V A;  4RCC A;  5GMK h;  5LJ3 d;  4C8Q C;  4PJO E;  1HXD A;  4WF2 A;  1B34 A;  4EMK C;  3RKW A;  1B34 B;  3HFN A;  5GAO l;  4XU3 A;  4EMG A;  4M7D C;  5LJ3 f;  2DKG A;  4MMK A;  3SB2 A;  3AHU A;  1LOJ A;  1WPY A;  4M75 D;  5GAM h;  4M75 A;  4XTV A;  1KQ1 A;  4M75 B;  4F7U G;  3HSB A;  2FB7 A;  5GMK m;  2DXT A;  5GAN 2;  4M77 G;  4M7D G;  3V7S A;  3SWN A;  5GAN h;  1H64 1;  4M77 E;  4M7D E;  3SWN B;  3RES A;  5GAN 6;  4XTU A;  3JCM e;  5GAO m;  5GAM d;  3QO3 A;  4M75 F;  2RB6 A;  3EFR A;  1LJO A;  4C92 D;  3JCM b;  1WQ7 A;  1MGQ A;  4C92 A;  3BY7 A;  3PGG A;  3V8K A;  2DTO A;  4C92 B;  5GAN d;  1N9S A;  1U1S A;  4J6Y A;  4HT9 A;  4M7A D;  1WNL A;  3JCM g;  4QVD A;  3JCM J;  3INZ A;  4M7A A;  4M7A B;  5GAN 8;  2E1H A;  5GAN 7;  4JUV A;  3L1A A;  5GAN 3;  5GAN g;  3FB9 A;  3RKX A;  2VXE A;  1TH7 A;  1BIA A;  1M5Q 1;  4C92 F;  2EJF A;  5CAI A;  3L2Z A;  4NL3 A;  4M75 C;  2DTI A;  2EJ9 A;  5GAN 5;  4M7A F;  5LJ5 g;  3JB9 H;  3JB9 I;  3BW1 A;  4XQ3 A;  2FYK A;  2HNI A;  4C8Q G;  4M7D D;  1WQW A;  3EFS A;  3SWN C;  4F7U E;  4C8Q E;  1N9R A;  2E41 A;  5LJ5 j;  2I2L A;  3VU3 C;  4PJO D;  4M75 G;  3JB9 D;  1LNX A;  4PJO A;  4M75 E;  4PJO B;  3JCM f;  2DVE A;  4C92 C;  2YLB A;  4JRK A;  3BDU A;  4NOY A;  1U1T A;  2EWN A;  5GAM g;  4M7A C;  1BIB A;  1I81 A;  3FIF A;  3QUI A;  1X01 A;  3JCM V;  4M77 D;  4NL2 A;  4PJO F;  5GAM j;  4C92 G;  4V2S A;  2DTH A;  2K57 A;  5LJ5 e;  4JRI A;  3JB9 F;  4MML A;  4M77 B;  4OP0 A;  4N0A A;  4XU2 A;  4QVC A;  4EMK A;  4M7A G;  4M78 D;  3M4G A;  4X9C A;  3QSU A;  3JCM h;  4M7A E;  5LJ3 g;  2DZ9 A;  2EAY A;  4M78 A;  4XTX A;  4M78 B;  2E65 A;  5GAO q;  4Y91 A;  3JCM c;  3JCM X;  4J6X A;  2E10 A;  1Y96 B;  4XTZ A;  4EMH A;  4M77 F;  1D3B A;  4A53 A;  4A54 A;  2VC8 A;  5LJ3 j;  1D3B B;  3JB9 J;  1I5L A;  4M7D F;  1I8F A;  2ZGW A;  4PJO C;  5GAM e;  4XTW A;  3JCM d;  1HK9 A;  5LJ5 h;  4M78 F;  4XTY A;  4HT8 A;  2DEQ A;  5DY9 A;  3HFO A;  5GMK j;  5GMK l;  2E64 A;  2EJG A;  3V8L A;  4PJO G;  4RCB A;  3JB9 G;  1KQ2 A;  4C8Q D;  5GAN 4;  4M77 C;  4F7U A;  1JRI A;  2DJZ A;  2RD1 A;  4C8Q A;  4F7U B;  4C8Q B;  5LJ3 e;  5LJ5 d;  4N0A C; 
#chains in the Genus database with same CATH topology
 3FLG A;  3CCL A;  4C92 E;  4KH1 B;  2RJE A;  4M78 C;  4MDX A;  2HSP A;  2NUP A;  2H8H A;  1PM3 A;  3CCE T;  3P8H A;  4JPB W;  1WXT A;  1SKU B;  2FPE A;  4DEY A;  1LVK A;  1UEB A;  2CDT A;  2XKO C;  2GCX A;  2XID A;  2XG8 D;  3CC2 A;  3GIB A;  3LWH A;  1UGR B;  2L3R A;  3BFM A;  5DLO A;  2CSI A;  4HA8 A;  2YUO A;  3M5A A;  2DET A;  1VUB A;  1QW1 A;  4FSS A;  1YJ9 Q;  1LCK A;  2BIV A;  2K4Y A;  1WFW A;  2FB7 A;  1PC0 A;  1D1B A;  1S1N A;  3RES A;  2YDL A;  2HL5 C;  1NLP C;  5CKF A;  2RQV A;  3G4S T;  3CC4 A;  3OYA A;  4F04 B;  4RTW A;  2VXE A;  2O88 A;  1WGS A;  1Q82 U;  2K3Y A;  4QQD A;  5CQY A;  2QEX T;  1Q95 G;  1Z9Z A;  5KE3 A;  3OW2 A;  1VQN T;  2DIQ A;  1WQW A;  1SSF A;  4IUU A;  2GNC A;  1IRX A;  1UJ0 A;  2RI3 A;  2A3L A;  5D6W A;  1NBE B;  2EYW A;  5GJV B;  2MCN A;  1D0Y A;  1ZUY A;  3H41 A;  4AG1 C;  3CCM Q;  3HP9 A;  3OYB A;  1KK7 A;  3KXT A;  4IUR A;  4CC7 A;  4II1 A;  4JRI A;  2LQK A;  2QGG A;  4JRP A;  1V29 B;  2EQU A;  2K2M A;  2EAY A;  4FW1 A;  2OTL A;  5GAO q;  4EMH A;  2QTV A;  1QCO A;  5GAM e;  2R5A A;  1HK9 A;  3MJX A;  2DEQ A;  4OMF B;  2JJ9 A;  2V1Q A;  1VQ7 Q;  1OU8 A;  3H0H A;  3JB9 G;  1KQ2 A;  1GCQ A;  2RMO A;  4F7U A;  5CVI A;  5GAN g;  4ZNX A;  2IIM A;  1MV0 B;  4JJN K;  4B6M A;  4LD9 K;  2YHT A;  4BE0 A;  2KR3 A;  1VQ9 A;  4JJD A;  4QVZ A;  2KSS A;  4JLI A;  4OVA A;  3R6N A;  5KE2 A;  1KHI A;  2HQX A;  1YJ9 T;  2CH4 W;  2FZC B;  1ABO A;  1UGP B;  4M75 D;  3G71 Q;  1K73 C;  5GAM h;  4M75 A;  1QVF A;  3HSB A;  2XU8 A;  4OMQ A;  4FIB A;  5GAN 2;  2RHI A;  2MWP A;  3EG2 A;  2EW3 A;  3UWN A;  1AEY A;  4BY6 C;  3V8K A;  2P0K A;  3ER0 A;  4FM4 B;  2BZX A;  4J83 A;  1S72 Q;  3CCR A;  3OW2 P;  1SRM A;  2EYX A;  1ZA2 B;  5FWC A;  1KC8 R;  3MEU A;  2O9S A;  2QAS A;  4AFS C;  1YJW A;  2PVG B;  2HNI A;  1PKT A;  3EFS A;  1RI0 A;  2RJD A;  2HBP A;  3J7A F;  1WHH A;  2LNH B;  5KYY B;  4C5E A;  3L2V A;  1UEC A;  2X35 A;  1RAH B;  5I22 A;  4NS5 A;  2WAC A;  3EGX B;  3PE0 A;  2JNG A;  1X01 A;  2O01 E;  3QYH B;  3PIO A;  3ZFJ A;  2DTH A;  5KYW A;  2QQR A;  2BZ8 A;  2HCK A;  3H0I A;  4GBQ A;  2ESW A;  3OQ5 A;  4M7A E;  3X26 B;  3JB9 J;  4A53 A;  1GBR A;  3M55 A;  1WHJ A;  1QWE A;  3UF4 A;  1KHC A;  2FO0 A;  4LDX A;  3S3M A;  3FEO A;  3CCV T;  3EG9 B;  1KJW A;  3CC7 Q;  3FB9 A;  2RQR A;  3CXC A;  4RTY A;  4EMK B;  2K5L A;  4RTT A;  2LJ1 A;  2QI2 A;  2DL4 A;  3I55 Q;  4C8Q F;  3UT1 A;  3ZEH A;  2MOX A;  1PNJ A;  5LJ3 h;  1BCO A;  2ZPG B;  1AT1 B;  2EKH A;  3OMC A;  3GLX A;  1QVF P;  4C5H A;  3G71 T;  3HL8 A;  2LQN A;  2WSC E;  1M3C A;  2KEA A;  1F1B B;  1VQL Q;  2O9V A;  1JQQ A;  3PIP A;  2CZ1 B;  3OS2 A;  4M7D E;  1OOT A;  2CKK A;  2J7I A;  4QW2 A;  3I5R A;  1S72 T;  3RDV A;  5IT9 E;  1D1C A;  1SHF A;  3VRY A;  2EQK A;  3RKX A;  3X25 B;  2HKQ B;  5LL6 S;  2RNA A;  4C92 F;  2GFU A;  4LNP A;  3I56 Q;  1HSQ A;  1GBQ A;  4XQ3 A;  1MMN A;  1PSF A;  3HHT B;  3CXC S;  1BKB A;  3QBY A;  1KC8 U;  2A0F B;  3UPU A;  2DL7 A;  3FDR A;  1UGS B;  4GY5 A;  1VQM Q;  2O4X B;  3M0S A;  2DVJ A;  4PJJ A;  5D6Y A;  3CCJ A;  1UTI A;  3JCM c;  4J6X A;  1SSH A;  2LP5 A;  1TOV A;  3JV3 A;  5KYX A;  2XI9 A;  2PVD B;  1R77 A;  1UGQ B;  4Z88 A;  3VS6 A;  4M78 F;  2KI7 A;  5LJ5 h;  2CZ0 B;  3CXC P;  3CC7 T;  1YWO A;  2AK5 A;  3V8L A;  1H92 A;  1X6B A;  2LX9 A;  4RTU A;  1VQP A;  4FL6 A;  4O5V A;  1M90 C;  1ACM B;  3PVQ A;  2DXU A;  1C0M A;  5CKB A;  3RUX A;  5GMK e;  3MCA B;  3JCM W;  1U8R A;  4LE9 A;  2RF0 A;  3KFV A;  1T3L A;  3JCM Q;  2QQS A;  5C0M A;  2RQT A;  2JT4 A;  4BI3 A;  2LVM A;  1GCQ C;  1KD1 C;  3C12 A;  1RAC B;  2MIO A;  4EMG A;  1VQL T;  3M9Q A;  3SB2 A;  1M27 C;  4MZT A;  1ZBJ A;  3O8V A;  1RLP C;  2ATC B;  1JJ2 S;  4N4I A;  2KMT A;  9ATC B;  1XTD A;  2C0I A;  2DXB A;  1VQO A;  2DF6 A;  2DRM A;  3L2R A;  2JTF A;  3JCM J;  2KRO A;  5GAN 7;  3OYG A;  3I56 T;  2VWF A;  4A4G A;  3OYF A;  4OGC A;  3HRS A;  4M75 C;  1YNZ A;  2OJ2 A;  3JB9 H;  4D6W A;  4F7U E;  4FT4 A;  2CT4 A;  3OYI A;  2PNI A;  3TU4 K;  3VS0 A;  1ZX6 A;  2DA9 A;  1U1T A;  4QQ6 A;  2LRQ A;  1VQM T;  1WIE A;  4XAX B;  1TS9 A;  2P84 A;  1QKX A;  5GAM j;  3EG0 A;  2RHY A;  1WHL A;  1HJD A;  4HKE A;  2COY A;  2L3Q A;  3CPW A;  3CCU Q;  3JRZ A;  1K76 A;  2FRY A;  3DB3 A;  4OF1 A;  1OZ2 A;  2FPF A;  1IRE B;  2E64 A;  2L8D A;  1QVP A;  1N6A A;  2ED0 A;  1MMD A;  2YRV A;  2DYB A;  3M0T A;  1QP2 A;  2RHU A;  2D9T A;  2E5K A;  1W2B A;  2XDB A;  3QJ6 A;  1BI3 A;  1QCN A;  3V7C A;  2P4T A;  2DBM A;  2DZC A;  3FC3 A;  3V8J A;  3CME Q;  1RAI B;  3G6E A;  2RHX A;  1FMK A;  3JAM E;  2RI5 A;  2DX1 A;  1WYX A;  5GAN f;  2QXF A;  4BD3 A;  5CIU A;  2VAS A;  2HBW A;  5FWB A;  5LJ3 f;  2G6F X;  1NEG A;  2FRW A;  3OYL A;  2L3P A;  1I07 A;  2CP3 A;  2RK2 A;  4M77 G;  5C6S A;  3SWN A;  1H64 1;  1OYX A;  3CCE Q;  5EC7 A;  2P4R A;  1C1A A;  5GAM d;  3NGP A;  4CRI A;  3CEY A;  1VIF A;  2ZZD A;  4M7A D;  4J6Y A;  1J3T A;  1DJ7 B;  4M7A A;  3INZ A;  2KNB B;  3CPW S;  4E47 A;  2DTI A;  1TUC A;  1U3O A;  2KVQ G;  3M57 A;  3OA6 A;  1X75 C;  3HPW A;  1K8A C;  2QAZ A;  1QMC A;  2KT1 A;  4PJO D;  2DE0 X;  3CCL Q;  3N5B B;  4PJO A;  7AT1 B;  2EFI A;  1VIE A;  2MAM A;  2JS0 A;  1H8K A;  3QUI A;  1UGV A;  2K3X A;  1Q81 C;  2D8J A;  5FU6 C;  1VYT A;  1SRL A;  3CPW P;  5KYN A;  3QSU A;  1R0C B;  3CCU T;  4GLK A;  1I1J A;  4Y91 A;  1WHM A;  4OB0 B;  4M7D F;  5IXB A;  2CZ7 B;  4PFP A;  3EG1 A;  1D09 B;  4C0G A;  4CI0 C;  3QZ9 B;  1B07 A;  2E3H A;  2ZPE B;  4RTV A;  3S6W A;  1I0C A;  4Y28 E;  1NYF A;  2MK5 A;  5GAN 5;  1JRI A;  3I35 A;  1K73 R;  4M7D D;  4C8Q B;  3JSC A;  4M7D A;  5LJ5 f;  3RKY A;  2KBT A;  3CC4 Q;  1VQ5 Q;  3ZL7 C;  3V7R A;  3CME T;  5CKE A;  2VXF A;  1QP3 A;  2KYB A;  1KG1 A;  3MEA A;  5KH6 A;  1VQ4 A;  4LUD A;  2JMC A;  2QA4 Q;  4C0F A;  2EYY A;  5CKD A;  1IB8 A;  4WTO B;  1CSK A;  1JXO A;  4R0K A;  5J26 A;  4IUT A;  5LJ3 d;  1B34 A;  3A1P A;  2COW A;  2DKG A;  4MMK A;  1HD3 A;  2DER A;  1FX7 A;  4PJM A;  4DEX A;  4E7H A;  4QT7 A;  2ZCF B;  3CCQ Q;  1E7O A;  4Q5W A;  1FMW A;  2F2W A;  4IIO A;  3EFO A;  4C0Z A;  4C92 B;  4TVR A;  2KYM A;  2OI3 A;  3H0F A;  1ZHI A;  1WZO A;  2AT1 B;  3FRN A;  1YIT Q;  2B86 A;  1VYU A;  1Q7Y C;  4Z02 A;  3CCL T;  4OML A;  2QGF B;  2EGA A;  1T0H A;  2BE9 B;  2L3S A;  3MKD A;  3NMZ C;  2XMF A;  5GAM g;  3QKJ A;  2A28 A;  3RBB B;  2QEX A;  1X6G A;  4M77 D;  4NL2 A;  2EKO A;  1VQN A;  4J9I A;  1VQ9 Q;  2DNU A;  4OP0 A;  4EDU A;  1EZZ B;  4M78 B;  1UHF A;  1UDL A;  3QYG B;  1VQ8 Q;  1YHQ A;  2XDD A;  5CCA A;  1M2V A;  4HT8 A;  3HFO A;  5KYU A;  4LDW A;  5GMK j;  2EJG A;  2CRE A;  1YJN A;  1ZBX A;  2JM9 A;  1PWT A;  5LJ5 d;  2LQW A;  3CC4 T;  1VQ5 T;  3GOX A;  1G3Y A;  1GFC A;  1AZG B;  4DQ2 A;  2X4Y A;  2RM4 A;  1RAG B;  4QKU A;  3REB B;  2RHZ A;  5CO7 A;  4F7U F;  5CK9 A;  3CCR Q;  2QA4 T;  1V76 A;  8AT1 B;  1K73 U;  2QTX A;  1NM7 A;  2SRC A;  3PTA A;  5GMK i;  2E5Q A;  1YJW Q;  3PMT A;  4XU0 A;  2CSQ A;  3X28 B;  1HXD A;  2DIG A;  3CCV Q;  1D1A A;  2PUO B;  4J9G A;  3SFM A;  2OX7 A;  3C0C A;  1D0X A;  3CCQ T;  5A2Q E;  2HEQ A;  2RQW A;  1N8R C;  3LLR A;  4BB7 A;  4RG2 A;  4BDZ A;  2LT4 A;  2MWO A;  5IXF A;  4OB3 B;  4AMC A;  2OTL T;  4M75 F;  4A4F A;  2OTJ A;  4PLL A;  4E7K A;  1Q82 C;  1JXM A;  1YP5 A;  3PMI A;  1EIF A;  3JCM g;  2VGN A;  2C0O A;  2X9H A;  2HZY A;  1YIT T;  2JS2 A;  2JZ2 A;  1M5Q 1;  1JO8 A;  2X51 A;  3M58 A;  1Q86 C;  2KY9 A;  2FYK A;  4AG2 C;  3SWN C;  4EIK A;  2E70 A;  2ZPI B;  3QDF A;  1T0J A;  2R5M A;  2ECZ A;  4QQG A;  1NPR A;  3M0Q A;  1XOV A;  3E9G A;  2DVE A;  1PRM C;  2FZG B;  4E6R A;  3CBM A;  1M90 R;  4M7A C;  1VQ9 T;  4ORZ A;  3E9F A;  1SG5 A;  3UAT A;  4C92 G;  2J6O A;  1VQK A;  2M0Y A;  2QYZ A;  2NLU A;  4N0A A;  3VUZ A;  2X4J A;  3M4G A;  1VQ8 T;  2HSE B;  3OS5 A;  5IAY A;  5HK0 A;  3CCM A;  3PNW C;  1D3B B;  1MV3 A;  4PJO C;  1YBY A;  3UA6 A;  2BE7 D;  4BI8 B;  1KD1 R;  1I5O B;  3HRT A;  3M4Y A;  4KUL A;  3OYM A;  1OPK A;  5DLQ E;  2RK1 A;  3OBW A;  2KT8 A;  5LJ3 e;  4BE1 A;  4JS5 A;  5KCO A;  4E7Z A;  2F2X A;  1QVG A;  3CCR T;  2PU9 B;  4PJL A;  1MND A;  1N5Z A;  1R0B G;  1VQ7 A;  4C0D C;  1BI1 A;  4BAC A;  1RAB B;  2FG0 A;  4M78 G;  4R56 A;  1YJW T;  4Y92 A;  4FYW B;  4JRQ A;  4XU1 A;  2DD4 A;  4BY6 B;  1K0S A;  3RER A;  2EBP A;  4C5I A;  1OZ3 A;  2WSF E;  2H3J A;  4PJO E;  4J9D A;  3RKW A;  4HVU A;  4M7D C;  2LDM A;  2L89 A;  3OB9 A;  3OYK A;  2HQH A;  5GAN h;  2M9U A;  2XD0 A;  3SDZ A;  1M30 A;  1ZSZ A;  1A0N B;  5FW9 A;  3G71 A;  2IG0 A;  3MP1 A;  1VQ6 A;  1OI1 A;  1N9S A;  3CCJ Q;  2LJ3 A;  4RMO A;  2VVK A;  2CUD A;  3S3O A;  3L2Z A;  1U06 A;  3M54 A;  1WLP B;  2IVW A;  3NTI A;  3URG A;  1SPK A;  1VQP Q;  4LD6 A;  2YWW A;  4VUB A;  2XHC A;  2CP0 A;  1JU5 C;  3P8D A;  2QDL A;  3L2W A;  3JB9 D;  1M9S A;  4BE2 A;  3ZBD A;  2YRD A;  3VS3 A;  1BBZ A;  4KT0 E;  3M59 A;  2JW4 A;  1QVG S;  2JOY A;  2EWN A;  3S3N A;  4DBQ A;  5A0G A;  2YXY A;  4HVV A;  4DBH A;  2ENM A;  2ED1 A;  1H3Z A;  2K57 A;  5LJ5 e;  1MHN A;  3GNF B;  3MP8 A;  2ABL A;  3LW5 E;  1M90 U;  1BCM A;  3CCS A;  3QWX X;  2VC8 A;  4JJC A;  1M8M A;  1I8F A;  1AZE A;  2DAQ A;  2LZ6 B;  4CC4 B;  3VS4 A;  2CS7 A;  1QVG P;  1JJ2 A;  2ROT A;  4M77 C;  2DJZ A;  1KIK A;  2YUN A;  3LYI A;  2QQB A;  1IGU A;  4PL6 A;  2ROL A;  1AVZ C;  2V8I A;  2LMJ A;  2NUP B;  1KD1 U;  2GQI A;  2M0O A;  4HCZ A;  1NLO C;  1XJW B;  1RLQ C;  3NTH A;  2HD0 A;  3WVE B;  3CMA A;  1H3H A;  3MEW A;  1AHJ B;  3C94 A;  2RN8 A;  3I55 A;  1EFN A;  2NYS A;  1WXU A;  3THK A;  2RI2 A;  4RG8 A;  1X43 A;  1AOJ A;  3DB4 A;  1K8A R;  4XTV A;  1G8X A;  1KQ1 A;  1PD1 A;  3CPF A;  1B3Q A;  4M77 E;  3OMG A;  1N27 A;  3EGD A;  1NJI C;  3CCJ T;  5L8R E;  2H3E B;  1FXX A;  1VA7 A;  1X27 A;  1MGQ A;  2LCC A;  5I11 A;  2LCS A;  1Q81 R;  2NUT A;  3SHW A;  4QVD A;  5FU7 C;  4K11 A;  3GPL A;  3U23 A;  4D8K A;  1WI7 A;  4F14 A;  2DL8 A;  2YUQ A;  1IO6 A;  1VQP T;  5CKH A;  2V26 A;  2E41 A;  1VYV A;  2LJ0 A;  3I56 A;  4L6V 5;  2W10 A;  3RR6 A;  4J9F A;  1XNI A;  4ELZ C;  1VOM A;  4IKF A;  4A63 B;  4FYX B;  1O75 A;  2DL3 A;  2HL3 A;  2EQM A;  2V8J A;  1X2Q A;  3F70 A;  2E65 A;  5FLX E;  3TCJ A;  1CKA A;  5FRO A;  3LGF A;  3CD6 Q;  1VQM A;  2JUF A;  1JJ2 P;  1UG1 A;  2M51 A;  4OMP A;  1PHT A;  1VQO T;  4IUQ A;  4F7U B;  4N0A C;  4IUV A;  2LCL A;  3A8M B;  3TQ7 P;  3NPF A;  2Z0W A;  1OUL A;  3MPU B;  2RA2 A;  4J6W A;  2DO3 A;  2K2V A;  4PJN A;  1I4K 1;  1IZ6 A;  1SHG A;  1TXQ A;  1G2B A;  5A0L A;  3ASK A;  2P0P A;  3LH0 A;  1BK2 A;  1QLY A;  3DKM A;  2PTK A;  1Q7Y R;  3QZ5 B;  3EHR A;  4M75 B;  4PLI A;  1PKS A;  4FW2 A;  1YIJ A;  2DPP B;  1AWJ A;  1QKW A;  3HTR A;  1RI9 A;  4KGZ B;  3EFR A;  2I0N A;  1WQ7 A;  1ARK A;  2DTO A;  4HT9 A;  1K8A U;  1NE8 A;  1BI0 A;  3OSV A;  2DEU A;  5DM7 R;  3QII A;  4XK8 E;  4HCC A;  3OYH A;  1G5V A;  4M7A F;  4J7I A;  1Y7X A;  1P92 A;  1Q81 U;  3TEE A;  2CYZ B;  3EH2 A;  1UFF A;  1ZSZ C;  2D6F A;  1LNX A;  5KYY A;  3RMQ A;  1MNE A;  3JCM f;  3TSZ A;  2Y4X A;  1SEM A;  2CUB A;  3EGX A;  4JZ4 A;  2AIR B;  3PT9 A;  4L5G A;  2K5F A;  2C06 A;  4PJO F;  2KRS A;  5HKC A;  5KYW B;  3LH5 A;  1K4U S;  1KQS S;  1U5S A;  3OYE A;  2CP6 A;  3CD6 T;  4XTZ A;  1K9A A;  5LJ3 j;  4A54 A;  2BKD N;  4HVW A;  1I5L A;  4MZM A;  3X24 B;  2LNV A;  5FRN A;  4XTY A;  1OX8 A;  4X1V A;  4AT1 B;  1K9M C;  3ME9 A;  4RTZ A;  4JS4 A;  4RCB A;  4RTX A;  3PVL A;  2BZY A;  2LX7 A;  1PRL C;  4EMK A;  4LN2 A;  1TG0 A;  3CC2 Q;  1FWZ A;  1JBM A;  2P0Q A;  1N8R R;  5A0D A;  4AFQ C;  3SD4 A;  4OGE A;  4RKU E;  3UDC A;  4J5Y A;  2ZPF B;  1Q82 R;  1PSE A;  3GBQ A;  5FRM A;  3JCM P;  3ULR B;  1QQJ A;  1CKB A;  1YI2 A;  5D7U A;  3J81 E;  3M53 A;  3CME A;  1MUZ A;  3OYY A;  1Q86 R;  1NEB A;  4N4G A;  3BDL A;  2XK0 A;  2RPN A;  4F7U G;  1TUG B;  2E3I A;  1K0X A;  3MET A;  5GAO m;  3H6Z A;  5J3B A;  2AZS A;  2RB6 A;  3JCM b;  1LJO A;  1Q7Y U;  1WHK A;  3QG1 A;  1TU0 B;  5I2M A;  5GAN d;  1U1S A;  2EQJ A;  4GLM A;  1X2K A;  2CP7 A;  2QDY B;  3L1A A;  3OBY A;  3CCE A;  1M3B A;  3QPH A;  5FU6 B;  5IHK A;  2LT1 A;  3EG3 A;  1W70 A;  2K79 A;  1YJN Q;  1K1Z A;  2ZPH B;  1O9S A;  1UJY A;  3BE3 A;  3PFS A;  5LJ5 j;  1AWX A;  4M75 G;  1M1K C;  5EG2 A;  5I2S A;  3DLL A;  2VKN A;  2XDP A;  4JRK A;  3BDU A;  2A36 A;  1G83 A;  3L2U A;  1BIB A;  2OTL Q;  2FL7 A;  2OAW A;  1M4Z A;  2O4X A;  3A8G B;  4A4H A;  1R8O B;  4JDS A;  2KDS A;  2A37 A;  4OMO A;  2FVU A;  1MMA A;  2L5Q A;  2IPO B;  4M77 F;  3G4S A;  1OV3 A;  4E7L A;  5KYX B;  2QQA A;  1WHG A;  1RAF B;  2F69 A;  3E19 A;  1OX9 A;  4KGX B;  5GMK l;  4BI4 A;  1MMG A;  3CC2 T;  2QQ9 A;  2RD1 A;  4AFU C;  4M77 A;  2OTJ Q;  3LWI A;  4LXC A;  4HCB A;  1ZQ1 A;  4FT2 A;  3LGL A;  4KGV B;  2CGH A;  3VYH B;  1Y96 A;  3J80 E;  2X4W A;  3OYC A;  3EGD B;  4PFZ A;  4M78 E;  3L2Q A;  4JZ3 A;  2EQI A;  3VS2 A;  1VQ5 A;  1N8R U;  2GF7 A;  1M1G A;  2NUT B;  1M8V A;  4B9X A;  4RCC A;  2KQW A;  2CP2 A;  4J9E A;  5GAO l;  2PZ1 A;  4J8O A;  2QA4 A;  3A8L B;  2DXT A;  1GL5 A;  3A98 A;  1VQK Q;  4JJB A;  3QO3 A;  1UHC A;  2A08 A;  1YHQ T;  1Q86 U;  3BY7 A;  3KUF A;  4PK4 A;  3OS0 A;  3CCQ A;  3DLM A;  1C6V X;  1JB0 E;  2EGC A;  2FPD A;  2MMP A;  4MZP A;  1TH7 A;  4KUI A;  2HMA A;  1YJN T;  2HKN A;  2HQE A;  2KRN A;  2K5I A;  3BW1 A;  3D7S B;  4C8Q G;  4L59 A;  2GFA A;  4LDU A;  2I2L A;  3QDR B;  1GCP A;  3GF5 A;  2JM8 A;  1YIT A;  1YJ9 A;  1KFZ A;  1RAA B;  8ATC B;  5L23 A;  3H8Z A;  2W0Z A;  1X69 A;  3JCM V;  5J39 A;  2D0Q B;  1GFD A;  4F17 A;  4J9C A;  4X9C A;  1TWB A;  2EVR A;  3IQL A;  5LJ3 g;  1GXI E;  4XTX A;  1FMV A;  1YWP A;  4ZGE B;  2WSE E;  5HK3 A;  3CQT A;  4DOV A;  3WVD B;  1IXD A;  3VS7 A;  3OW2 S;  3O5Z A;  2DK3 A;  1OEB A;  1VQ8 A;  2HAX A;  2OTJ T;  1G3S A;  5GAN 4;  1SF9 A;  2C0T A;  1M2O A;  4YTL A;  1D0Z A;  2FHD A;  4EPC A;  1VQ6 Q;  2VUB A;  1NJI R;  2JN0 A;  1PCX A;  2DRK A;  2F1L A;  2LQ8 A;  4B9W A;  2NWM A;  4DA4 A;  2JTM A;  3P8B B;  4A4K A;  5GAN e;  2YRC A;  4FCY A;  2Y4Y A;  3HRU A;  2DLP A;  1M1F A;  4X34 A;  4EMK C;  4R55 A;  2K6D A;  3HFN A;  4XU3 A;  4RUG A;  3OYD A;  1WPY A;  3C95 A;  1VQK T;  3T9N A;  3REA B;  3SWN B;  3CCV A;  2R57 A;  2J6F A;  3JCM e;  2DFU A;  3OYJ A;  2OAU A;  3CCM T;  4ME7 A;  1E6G A;  1PG5 B;  1WJR A;  3CCS Q;  1WNL A;  4M7A B;  1WJS A;  5GAN 3;  2G3R A;  2GBQ A;  4ZTJ A;  5LJ5 g;  3A5Z B;  2KRM A;  1WDX A;  2GTO A;  3L42 A;  2E6Z A;  4PJO B;  1AD5 A;  1VQ7 T;  2CH4 A;  2YLB A;  1QVF S;  2VB6 A;  4HXJ A;  4E7J A;  2F5T X;  4FYY B;  1AWW A;  3JB9 F;  2A7Y A;  3CMA Q;  2V1R A;  1W1F A;  3JCM h;  2DZ9 A;  3MP6 A;  1RL2 A;  2DMO A;  2CZ6 B;  2MF2 A;  4OMM A;  1NPP A;  1S72 A;  4C0D B;  1HYO A;  2KK4 A;  2QG9 B;  4ELY C;  2DL5 A;  4Z8A A;  4C8Q D;  2JXB A;  4C8Q A;  1WJQ A;  1VQ6 T;  1Z9Q A;  4M7D B;  1ZUU A;  2K7A A;  3VKI A;  3QWY A;  2QK0 A;  3M0P A;  1NYG A;  2YLC A;  4DOW A;  5AT1 B;  3RIR A;  2DM1 A;  2R58 A;  3E2U A;  3M0R A;  5IN1 A;  1NJI U;  3TRE A;  1B34 B;  2LC4 A;  2EGE A;  2GGR A;  2KXD A;  1RAE B;  1VQO Q;  3OSS C;  3Q1J A;  1W6X A;  2K9G A;  4HCK A;  3V7S A;  3CC7 A;  2DD5 A;  3LX7 A;  3CBO A;  4J9H A;  2EPD A;  4C92 D;  3CCS T;  3EFO B;  3TSW A;  4CC3 A;  2M16 A;  4C92 A;  3PGG A;  2PQW A;  1UB4 A;  5GAN 8;  5IH2 A;  1T3S A;  1E6H A;  2CP5 A;  3MO8 A;  2VYT A;  4KUD K;  5CR2 A;  4CC2 A;  1TSF A;  2E4H A;  2YT6 A;  2B8A A;  2EYQ A;  2COZ A;  2EJ9 A;  1IGQ A;  3AT1 B;  3X20 B;  3H9N A;  1B7T A;  1K9M R;  1ZSG A;  5M9O A;  3E1S A;  1G3T A;  1YFN A;  2O2O A;  1YCS B;  3RNJ A;  3C4S A;  5CQX A;  1OQK A;  1VQL A;  2NUZ A;  3FIF A;  3CMA T;  4N4H A;  1Y07 A;  2F5K A;  4V2S A;  5HY6 A;  4P5N A;  3MHX A;  4ZN1 A;  2CT3 A;  4MML A;  4M77 B;  5ECA A;  2JMA A;  4M7A G;  3I55 T;  4M78 D;  4WCI A;  4PFO A;  4M78 A;  1KC8 C;  2E10 A;  1Y96 B;  2ZGW A;  4XTW A;  2RJF A;  1BU1 A;  4Z89 A;  1M2V B;  3VYG A;  1RUW A;  2J06 A;  5KYU B;  2E6N A;  1YIJ Q;  4PJO G;  2PVO B;  4A4E A;  1WXB A;  2KGT A;  1Y57 A;  3EHQ A;  3G6E Q;  4MDW A;  3UA7 A;  1QWF A;  2BUD A;  4LDV A;  4BDY A;  3FJ5 A;  1YCY A;  2M1H A;  2Y90 A;  3GNG A;  1YN8 A;  3FJP A;  1UE9 A;  2HDA A;  5GAM f;  4D8D A;  2VGM A;  2EYZ A;  4E7S A;  3QJY A;  4ANJ A;  2J05 A;  5IHN A;  5GMK h;  5FU7 B;  3EH1 A;  1Y0M A;  3VS5 A;  4OMN A;  3AHU A;  1LOJ A;  3NTK A;  1RAD B;  2FEI A;  4KBM B;  2DYI A;  1M1K R;  4M7D G;  4ZTF A;  1ZLM A;  5GJW B;  2DJQ A;  4DBF A;  4J7F A;  2ZAE A;  1IHW A;  1KQS A;  2RQU A;  2E1H A;  4BUG A;  4JUV A;  2X3X D;  2J6K A;  1BIA A;  4E2F B;  3NHN A;  4NL3 A;  2D8H A;  3R6O A;  2X3W D;  1UUE A;  3VS1 A;  4C5G A;  3JB9 I;  1NZ9 A;  1ABQ A;  1NG2 A;  3VU3 C;  4IIM A;  4JLG A;  5IHI A;  4M75 E;  1V1C A;  2O31 A;  4OB2 B;  4NOY A;  4DBR A;  1I81 A;  1TUD A;  4ESR A;  2L2P A;  2MPX C;  1K9M U;  4KH0 B;  1BYM A;  3QXE B;  3SEM A;  3JCM X;  1YI2 Q;  1D3B A;  3MEV A;  2MI6 A;  2VV5 A;  2L0A A;  4UC4 A;  1YIJ T;  4AFZ C;  5DY9 A;  4OB1 B;  2KXC A;  1LPL A;  3A8O B;  2KAF A;  3VV0 A;  4FU6 A;  3HKS A;  2AKL A;  1W4S A;  3G7Z A;  3CD6 A;  4M4Z A;  3OS1 A;  2GTJ A;  3G6E T;  4ATO A;  5GAO r;  1VQ4 Q;  1KSW A;  2PUK B;  4FSX A;  1IHV A;  5GAO n;  5GAN j;  2RH2 A;  3M0U A;  5I21 A;  4PNO A;  2EIF A;  2K3B A;  2FZK B;  4IUP A;  3M56 A;  3RMS A;  4X9D A;  5GAO p;  3EG9 A;  3QHS A;  2DIL A;  3CCU A;  2JTE A;  4C8Q C;  4WF2 A;  3CBP A;  3KBG A;  3EAE A;  4PKC C;  1ZUK A;  4O6J A;  3NFC A;  5D6X A;  2D1X A;  1EX4 A;  3OY9 A;  3EGU A;  5GMK m;  2XIC A;  5GAN 6;  1KQS P;  4XTU A;  3OYN A;  2X4X A;  1ZSZ B;  2SEM A;  3G1J A;  2D0N A;  2ZPB B;  1W2B S;  4ZGD B;  4J9B A;  3I5S A;  2JVV A;  3G4S Q;  1ZA1 B;  1M1K U;  2RO0 A;  2V8K A;  4ZGJ B;  2DXC A;  5CAI A;  2EJF A;  2MYS A;  1WX6 A;  1XQH A;  2AZV A;  2AHJ B;  1M3A A;  2GQV A;  2F2V A;  5AYF A;  2BTT A;  3A8H B;  4C8Q E;  2QEX Q;  1N9R A;  4FYV B;  1X6O A;  1BI2 A;  3VJP A;  1VQN Q;  4ZN3 A;  3VRZ A;  1PD0 A;  3GP8 A;  2LTO A;  4C92 C;  1QCF A;  2E12 A;  5HCK A;  5KCH A;  1W2B P;  1YHQ Q;  1Y71 A;  2YUP A;  4XU2 A;  4QVC A;  1TTH B;  4E7I A;  1YI2 T;  2KE9 A;  2M02 A;  4F16 A;  1BB9 A;  3VUB A;  1OPL A;  1FYN A;  3WXM B;  2RJC A;  3TVT A;  1JEG A;  3JCM d;  1AWO A;  2YSQ A;  1WA7 A;  1OU9 A;  3I9Q A;  4LDY A;  4LUE A;  1GRI A;  4KRT A;  1G3W A;  2AKK A;  1VQ4 T;  2DBK A;  6AT1 B; 
#chains in the Genus database with same CATH homology
 3FLG A;  2RHU A;  2D9T A;  3LYI A;  4YTL A;  4C92 E;  3CCL A;  2QQB A;  2FHD A;  2RJE A;  4PL6 A;  4M78 C;  4EPC A;  4MDX A;  1W2B A;  2V8I A;  2XDB A;  3CCE T;  3QJ6 A;  3P8H A;  1KD1 U;  2VUB A;  1BI3 A;  2M0O A;  4HCZ A;  3V7C A;  2JN0 A;  2P4T A;  1UEB A;  2DZC A;  2LQ8 A;  2XKO C;  2GCX A;  2XID A;  2XG8 D;  3NTH A;  2HD0 A;  3V8J A;  2JTM A;  3WVE B;  4B9W A;  3CMA A;  3MEW A;  3CC2 A;  3GIB A;  3G6E A;  2RHX A;  3LWH A;  1AHJ B;  3JAM E;  2RI5 A;  1UGR B;  2L3R A;  3BFM A;  3C94 A;  3P8B B;  4A4K A;  4HA8 A;  5GAN e;  5DLO A;  3M5A A;  5GAN f;  3I55 A;  2Y4Y A;  1VUB A;  3HRU A;  2QXF A;  4BD3 A;  1M1F A;  4X34 A;  5CIU A;  4EMK C;  1QW1 A;  4R55 A;  3HFN A;  4XU3 A;  2RI2 A;  4RG8 A;  5LJ3 f;  3OYD A;  1WPY A;  3DB4 A;  3OYL A;  2BIV A;  2K4Y A;  3C95 A;  4XTV A;  1KQ1 A;  1VQK T;  2FB7 A;  3CPF A;  1VQN A;  3T9N A;  2RK2 A;  4M77 G;  5C6S A;  3SWN A;  1H64 1;  4M77 E;  3OMG A;  3RES A;  3SWN B;  1OYX A;  1N27 A;  3CCV A;  2R57 A;  3JCM e;  5GAM d;  1NJI C;  3OYJ A;  2OAU A;  5L8R E;  4CRI A;  1FXX A;  3CEY A;  4ME7 A;  5CKF A;  3CCJ T;  3CCM T;  1MGQ A;  1VIF A;  3G4S T;  2LCC A;  2ZZD A;  3CC4 A;  4M7A D;  4J6Y A;  1WJR A;  3OYA A;  1DJ7 B;  1WNL A;  4QVD A;  5FU7 C;  3INZ A;  3GPL A;  4M7A A;  4M7A B;  3CPW S;  1WJS A;  5GAN 3;  2VXE A;  2G3R A;  4ZTJ A;  4E47 A;  1WGS A;  1Q82 U;  2K3Y A;  1VQP T;  4QQD A;  5CQY A;  2DTI A;  2QEX T;  5KE3 A;  5CKH A;  5LJ5 g;  3A5Z B;  3OW2 A;  2KVQ G;  1VQN T;  2DIQ A;  3M57 A;  3OA6 A;  1X75 C;  1WQW A;  3HPW A;  1SSF A;  1K8A C;  4IUU A;  2E41 A;  2RI3 A;  4PJO D;  3L42 A;  4PJO A;  3N5B B;  2E6Z A;  2A3L A;  4PJO B;  1VQ7 T;  2EFI A;  4L6V 5;  3I56 A;  1VIE A;  5D6W A;  2MAM A;  2YLB A;  1QVF S;  1XNI A;  4ELZ C;  4IKF A;  3QUI A;  2K3X A;  3HP9 A;  2F5T X;  3OYB A;  4E7J A;  1Q81 C;  3KXT A;  4IUR A;  5FU6 C;  3JB9 F;  2A7Y A;  1O75 A;  4II1 A;  4JRI A;  2LQK A;  4JRP A;  2EQM A;  2V8J A;  3QSU A;  1V29 B;  2EQU A;  3JCM h;  3CCU T;  3F70 A;  4GLK A;  2DZ9 A;  2EAY A;  3MP6 A;  1RL2 A;  2E65 A;  5FLX E;  5GAO q;  2OTL A;  2CZ6 B;  2MF2 A;  4Y91 A;  3TCJ A;  4EMH A;  1NPP A;  4OB0 B;  4M7D F;  1S72 A;  4C0D B;  5FRO A;  3LGF A;  2C06 A;  1VQM A;  2CZ7 B;  5GAM e;  2R5A A;  1HK9 A;  2JUF A;  2DEQ A;  2KK4 A;  4C0G A;  4CI0 C;  3QZ9 B;  4OMF B;  4ELY C;  2ZPE B;  3JB9 G;  3S6W A;  4C8Q D;  4Y28 E;  1VQO T;  1KQ2 A;  5GAN 5;  4F7U A;  1JRI A;  1WJQ A;  4IUQ A;  5CVI A;  4C8Q A;  4C8Q B;  4F7U B;  5GAN g;  4N0A C;  1VQ6 T;  4IUV A;  2LCL A;  3JSC A;  4M7D A;  5LJ5 f;  3A8M B;  4LD9 K;  4JJN K;  4M7D B;  2YHT A;  3RKY A;  3VKI A;  4BE0 A;  2YLC A;  3V7R A;  3CME T;  5CKE A;  2VXF A;  1QP3 A;  2RA2 A;  4J6W A;  1VQ9 A;  1KG1 A;  4QVZ A;  2DO3 A;  4DOW A;  3MEA A;  5KH6 A;  2K2V A;  1VQ4 A;  2KSS A;  4JLI A;  4C0F A;  4OVA A;  1I4K 1;  3RIR A;  5CKD A;  5KE2 A;  2R58 A;  1IZ6 A;  1KHI A;  5A0L A;  2HQX A;  5IN1 A;  5J26 A;  1YJ9 T;  3ASK A;  2P0P A;  3LH0 A;  4IUT A;  5LJ3 d;  3TRE A;  1NJI U;  1B34 A;  1B34 B;  2LC4 A;  3DKM A;  2DKG A;  4MMK A;  1UGP B;  3QZ5 B;  4M75 D;  1K73 C;  1FX7 A;  5GAM h;  4E7H A;  4M75 A;  1QVF A;  3OSS C;  4M75 B;  4PLI A;  3HSB A;  2XU8 A;  3Q1J A;  2ZCF B;  4FIB A;  5GAN 2;  2RHI A;  1YIJ A;  2MWP A;  2DPP B;  3V7S A;  4Q5W A;  3CC7 A;  2DD5 A;  3LX7 A;  3CBO A;  3UWN A;  4C92 D;  3EFR A;  3CCS T;  4C0Z A;  1WQ7 A;  4BY6 C;  4C92 A;  2M16 A;  3PGG A;  3V8K A;  2DTO A;  2P0K A;  4C92 B;  1K8A U;  1NE8 A;  3ER0 A;  1BI0 A;  2PQW A;  4FM4 B;  4J83 A;  4HT9 A;  1UB4 A;  4TVR A;  5GAN 8;  3OSV A;  3MO8 A;  3CCR A;  2VYT A;  1ZHI A;  4KUD K;  5DM7 R;  3QII A;  5CR2 A;  4XK8 E;  3FRN A;  3MEU A;  4HCC A;  3OYH A;  5HY6 A;  2B8A A;  2EYQ A;  1G5V A;  2EJ9 A;  4M7A F;  4J7I A;  1Y7X A;  1YJW A;  2PVG B;  1Q7Y C;  1P92 A;  1Q81 U;  2HNI A;  4Z02 A;  3TEE A;  4M7D D;  3EFS A;  1RI0 A;  3CCL T;  2RJD A;  2CYZ B;  3X20 B;  2HBP A;  3J7A F;  2D6F A;  1LNX A;  3RMQ A;  3JCM f;  3E1S A;  4C5E A;  5M9O A;  1G3T A;  3L2V A;  2Y4X A;  3C4S A;  2X35 A;  5GAM g;  3QKJ A;  4NS5 A;  5CQX A;  2WAC A;  1VQL A;  2QEX A;  3FIF A;  3CMA T;  4N4H A;  3PT9 A;  2JNG A;  1X01 A;  1Y07 A;  2F5K A;  2K5F A;  2O01 E;  2EKO A;  3MHX A;  3QYH B;  4L5G A;  4M77 D;  4NL2 A;  2DTH A;  4P5N A;  3ZFJ A;  4ZN1 A;  2QQR A;  5HKC A;  4MML A;  4M77 B;  4OP0 A;  4M7A G;  3I55 T;  4M78 D;  3OQ5 A;  4EDU A;  4M7A E;  3X26 B;  1KQS S;  4M78 A;  3OYE A;  4M78 B;  1KC8 C;  3CD6 T;  3QYG B;  1YHQ A;  2E10 A;  1Y96 B;  4XTZ A;  3JB9 J;  5LJ3 j;  4A53 A;  4A54 A;  2BKD N;  1I5L A;  4MZM A;  3X24 B;  2ZGW A;  3M55 A;  2XDD A;  4XTW A;  2RJF A;  5CCA A;  2LNV A;  5FRN A;  4XTY A;  3VYG A;  4HT8 A;  4LDX A;  1KHC A;  3HFO A;  5GMK j;  3FEO A;  4LDW A;  3CCV T;  3ME9 A;  2E6N A;  2EJG A;  3S3M A;  1K9M C;  4PJO G;  4JS4 A;  1YJN A;  1ZBX A;  4RCB A;  2PVO B;  4A4E A;  5LJ5 d;  3FB9 A;  3CC4 T;  3CXC A;  4EMK A;  4DA4 A;  3GOX A;  1VQ5 T;  4V2S A;  4EMK B;  1G3Y A;  1FWZ A;  2K5L A;  1JBM A;  2P0Q A;  5A0D A;  4DQ2 A;  4MDW A;  3SD4 A;  2X4Y A;  2QI2 A;  2RM4 A;  4OGE A;  4RKU E;  3UDC A;  2BUD A;  2RHZ A;  5CO7 A;  4F7U F;  4LDV A;  4C8Q F;  5CK9 A;  3UT1 A;  4BDY A;  2QA4 T;  3ZEH A;  1YCY A;  2M1H A;  4J5Y A;  2Y90 A;  3GNG A;  2ZPF B;  1K73 U;  1PSE A;  5LJ3 h;  2ZPG B;  3FJP A;  5GAM f;  2QTX A;  3PTA A;  5GMK i;  2E5Q A;  2VGM A;  5FRM A;  3PMT A;  3JCM P;  3QJY A;  4XU0 A;  3OMC A;  3GLX A;  1YI2 A;  5GMK h;  5FU7 B;  3X28 B;  3J81 E;  3M53 A;  1HXD A;  2DIG A;  4C5H A;  3HL8 A;  3G71 T;  2PUO B;  3SFM A;  3CME A;  3OYY A;  3AHU A;  2WSC E;  1LOJ A;  3NTK A;  3CCQ T;  4N4G A;  3BDL A;  2XK0 A;  5A2Q E;  4F7U G;  4KBM B;  1N8R C;  3LLR A;  4BB7 A;  4M7D G;  4RG2 A;  2CZ1 B;  3PIP A;  3OS2 A;  4BDZ A;  2LT4 A;  2MWO A;  4ZTF A;  4M7D E;  3MET A;  4OB3 B;  5GAO m;  3H6Z A;  2CKK A;  5J3B A;  2OTL T;  4M75 F;  2RB6 A;  4J7F A;  1LJO A;  4QW2 A;  4A4F A;  3JCM b;  1Q7Y U;  2OTJ A;  3QG1 A;  4PLL A;  4E7K A;  1Q82 C;  1S72 T;  5I2M A;  5GAN d;  1KQS A;  1U1S A;  3PMI A;  1EIF A;  2EQJ A;  3JCM g;  2VGN A;  5IT9 E;  2EQK A;  2QDY B;  2E1H A;  4BUG A;  4JUV A;  3L1A A;  3OBY A;  1YIT T;  3CCE A;  3RKX A;  3X25 B;  5LL6 S;  1BIA A;  2JZ2 A;  3QPH A;  1M5Q 1;  5FU6 B;  4C92 F;  2GFU A;  4NL3 A;  3R6O A;  3M58 A;  2LT1 A;  4C5G A;  3JB9 I;  4XQ3 A;  1NZ9 A;  1Q86 C;  2KY9 A;  2FYK A;  1PSF A;  3SWN C;  3HHT B;  2ZPH B;  1O9S A;  2E70 A;  2ZPI B;  5LJ5 j;  3PFS A;  3VU3 C;  2R5M A;  4M75 G;  4JLG A;  1M1K C;  3CXC S;  4QQG A;  1BKB A;  4M75 E;  1NPR A;  5EG2 A;  5I2S A;  3DLL A;  3QBY A;  1XOV A;  3E9G A;  2DVE A;  3PIO A;  1KC8 U;  2XDP A;  4JRK A;  3BDU A;  4NOY A;  4OB2 B;  3UPU A;  3CBM A;  3L2U A;  4M7A C;  1VQ9 T;  1BIB A;  1I81 A;  2FL7 A;  3E9F A;  3FDR A;  3FC3 A;  1M4Z A;  1UGS B;  4GY5 A;  4C92 G;  1VQK A;  2O4X A;  3A8G B;  2NLU A;  2O4X B;  4N0A A;  4A4H A;  1K9M U;  3VUZ A;  1R8O B;  2X4J A;  3M4G A;  1VQ8 T;  3OS5 A;  4JDS A;  2KDS A;  5IAY A;  5D6Y A;  3QXE B;  1BYM A;  5HK0 A;  3CCJ A;  2FVU A;  3JCM X;  3JCM c;  3CCM A;  4J6X A;  2L5Q A;  3PNW C;  4M77 F;  1D3B A;  3MEV A;  3G4S A;  1D3B B;  4E7L A;  2VV5 A;  1YBY A;  2MI6 A;  2PVD B;  2XI9 A;  4PJO C;  1UGQ B;  2QQA A;  5LJ5 h;  4M78 F;  2F69 A;  3E19 A;  4UC4 A;  4PJO F;  1YIJ T;  5DY9 A;  2CZ0 B;  4BI8 B;  5GMK l;  4OB1 B;  4BI4 A;  3CC7 T;  3V8L A;  3HRT A;  2LX9 A;  3A8O B;  2KAF A;  3M4Y A;  4KUL A;  3VV0 A;  3OYM A;  4FU6 A;  1VQP A;  4FL6 A;  2RK1 A;  3HKS A;  4O5V A;  5DLQ E;  1W4S A;  2QQ9 A;  3G7Z A;  1M90 C;  3CC2 T;  3CD6 A;  2RD1 A;  3OBW A;  5LJ3 e;  3OS1 A;  3G6E T;  4BE1 A;  4ATO A;  4M77 A;  4JS5 A;  5KCO A;  2DXU A;  3LWI A;  4HCB A;  5GAO r;  1ZQ1 A;  2PUK B;  4FSX A;  4FT2 A;  5CKB A;  3RUX A;  5GAO n;  1QVG A;  5GAN j;  3CCR T;  2RH2 A;  2PU9 B;  3LGL A;  5I21 A;  4PNO A;  5GMK e;  2EIF A;  1VQ7 A;  3MCA B;  2CGH A;  3VYH B;  1BI1 A;  1Y96 A;  2X4W A;  4C0D C;  3J80 E;  4BAC A;  3JCM W;  3OYC A;  4IUP A;  1U8R A;  4M78 G;  4R56 A;  1YJW T;  4M78 E;  3JCM Q;  3L2Q A;  2QQS A;  3M56 A;  4JRQ A;  1VQ5 A;  4XU1 A;  3RMS A;  4X9D A;  5C0M A;  1N8R U;  2DD4 A;  2GF7 A;  4BI3 A;  1M1G A;  4BY6 B;  5GAO p;  3RER A;  2LVM A;  4C5I A;  1OZ3 A;  3QHS A;  1M8V A;  4B9X A;  4RCC A;  2WSF E;  3CCU A;  1KD1 C;  2H3J A;  3C12 A;  4C8Q C;  4PJO E;  4WF2 A;  3CBP A;  2KQW A;  3RKW A;  3KBG A;  3EAE A;  4PKC C;  4EMG A;  5GAO l;  2LDM A;  4M7D C;  2L89 A;  1VQL T;  3M9Q A;  4O6J A;  4J8O A;  3SB2 A;  2QA4 A;  3NFC A;  3OB9 A;  4MZT A;  5D6X A;  3OY9 A;  3O8V A;  5GMK m;  3A8L B;  3OYK A;  2DXT A;  1JJ2 S;  5GAN h;  2XIC A;  4N4I A;  2KMT A;  2M9U A;  5GAN 6;  2XD0 A;  4XTU A;  3SDZ A;  1XTD A;  3OYN A;  2X4X A;  3QO3 A;  2DXB A;  1YHQ T;  3G71 A;  2IG0 A;  2ZPB B;  1VQO A;  1W2B S;  1Q86 U;  3MP1 A;  3BY7 A;  3KUF A;  4ZGD B;  1OI1 A;  3OS0 A;  1VQ6 A;  1N9S A;  3L2R A;  2JTF A;  3CCQ A;  3JCM J;  3DLM A;  2JVV A;  1M1K U;  2MMP A;  1JB0 E;  4MZP A;  5GAN 7;  3OYG A;  2RO0 A;  4RMO A;  2V8K A;  4ZGJ B;  2DXC A;  3I56 T;  1TH7 A;  4KUI A;  4A4G A;  3OYF A;  3S3O A;  5CAI A;  2EJF A;  4OGC A;  1YJN T;  3HRS A;  2HQE A;  1XQH A;  3L2Z A;  4M75 C;  2AHJ B;  3M54 A;  2GQV A;  2IVW A;  3NTI A;  3URG A;  3JB9 H;  2K5I A;  3BW1 A;  5AYF A;  4C8Q G;  4L59 A;  4LD6 A;  3A8H B;  2GFA A;  2XHC A;  4VUB A;  4C8Q E;  1N9R A;  3P8D A;  4LDU A;  4D6W A;  4F7U E;  2I2L A;  1X6O A;  1BI2 A;  3QDR B;  3VJP A;  4FT4 A;  3L2W A;  3JB9 D;  3GF5 A;  4ZN3 A;  1M9S A;  3OYI A;  4BE2 A;  3ZBD A;  3GP8 A;  2LTO A;  1YIT A;  1YJ9 A;  4KT0 E;  3M59 A;  3TU4 K;  4C92 C;  1QVG S;  2JOY A;  1U1T A;  4QQ6 A;  2EWN A;  2LRQ A;  3S3N A;  2E12 A;  5A0G A;  5KCH A;  1VQM T;  3H8Z A;  4XAX B;  3JCM V;  5J39 A;  5GAM j;  2D0Q B;  1H3Z A;  1Y71 A;  2K57 A;  2RHY A;  5LJ5 e;  4HKE A;  1MHN A;  4XU2 A;  3GNF B;  3MP8 A;  4QVC A;  4E7I A;  4X9C A;  1YI2 T;  1GXI E;  5LJ3 g;  4XTX A;  3LW5 E;  1M90 U;  4ZGE B;  2WSE E;  3VUB A;  3CCS A;  5HK3 A;  3CPW A;  3JRZ A;  4DOV A;  3WVD B;  2VC8 A;  3WXM B;  2RJC A;  1I8F A;  2DAQ A;  3JCM d;  4LDY A;  3DB3 A;  2CS7 A;  4OF1 A;  3OW2 S;  1OZ2 A;  2DK3 A;  1IRE B;  2E64 A;  1VQ8 A;  2HAX A;  1G3W A;  2L8D A;  1QVP A;  2OTJ T;  1G3S A;  5GAN 4;  1JJ2 A;  1N6A A;  1VQ4 T;  4M77 C;  2DJZ A;  2YRV A;  1QP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...