3HFSA

Structure of apo anthocyanidin reductase from vitis vinifera
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
331
structure length
307
Chain Sequence
IGKKTACVVGGTGFVASLLVKLLLQKGYAVNTTVRDPDNQKKVSHLLELQELGDLKIFRADLTDELSFEAPIAGCDFVFHVATPVHIKPAIQGVVNVMKACTRAKSVKRVILTSSAAAVTINQLDGTGLVVDEKTWGYPASKTLAEKAAWKFAEENNIDLITVIPTLMAGSSLTSDVPSSIGLAMSLITGNEFLINGMKGMQMLSGSVSIAHVEDVCRAHIFVAEKESASGRYICCAANTSVPELAKFLSKRYPQYKVPTDFGDFPPKSKLIISSEKLVKEGFSFKYGIEEIYDESVEYFKAKGLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and epimerase activity of anthocyanidin reductase from Vitis vinifera.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Oxidoreductase
molecule keywords Anthocyanidin reductase
total genus 96
structure length 307
sequence length 331
chains with identical sequence B
ec nomenclature ec 1.3.1.112: Anthocyanidin reductase ((2S)-flavan-3-ol-forming).
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3hfsA00
1LRLA 2UUPA 4CQMA 2YV1A 3ZW9A 3VVCA 2IEBA 2NU9A 5JDCC 1U5CA 4RV9A 4D3DA 1YWGO 2DPHA 2OUIA 3K73O 3WB9A 4Z0TA 1DOHA 3E6AA 5T5QA 1T25A 5KKCA 4M8SA 1DAPA 2EKLA 3JQAA 4Q39A 1Y8RA 4RGBA 3I4FA 4PIVA 3ZW8A 1C1DB 1JAXA 3FCOA 4FIZA 5C7LO 1CQJA 2HLPA 3SJUA 3VH1A 1YRLA 4N18A 2D1YA 1X0XA 2PD4A 3JQAD 3C7CB 1M6HA 2BFMA 5CPBA 1YH3A 1I2ZA 3CPSA 2P91A 3H5AA 4I5DA 4IMRA 1E3SA 4CLHA 2FRDA 4JBHA 3WX0A 5DF1A 3JQ9A 1EDOA 4ITUA 1U28A 3GGGA 2W4QA 4FFMA 2HMWA 2GSDA 4W6ZA 5IAAA 3ZWYA 4B79A 4ZA2A 3U4CA 1D1SA 4BNUA 3I9OA 3C8MA 3ZU5A 4RQTA 4D41A 3HFGA 1IPEA 2O3UA 4IDCA 1E7YA 2C7VA 4IINA 2ZCVA 1NTOA 1WDMA 4F3YA 4U6SA 1HDGO 4HFNA 4YRDA 4RVGA 4Q3AA 2VRCD 3PP8A 8LDHA 4CM5A 3OP4A 4R51A 5JPIA 2HMSA 3VHRA 3BYZA 2X9GA 4RDHA 1T2CA 2YFQA 4U5QA 1XWFA 4ZICA 4CMKA 3WS7A 5IXSA 3HE3A 1QYDA 4J7XA 3D5TA 2BI8A 5KWEA 1DBVO 2I66A 5TGDA 5G4KA 1JDJA 1JKIA 4QX6A 2G1UA 1ZKMA 4PG4A 3PVZA 4FB5A 3GAFA 4Z3KA 4YEDA 1BSVA 2X9VA 5L95A 4M89A 1QG6A 5KJCA 1NR7A 2C0CA 3HB5X 3JQBC 4WE3A 1IZ0A 1M76A 3STHA 3WGTA 5FI5A 1GUZA 3MCVA 1J5PA 2BRUA 3LSYA 4BNXA 1Z45A 4GSKA 4PLCA 4ALIA 1U8FO 3GY0A 4E30A 1B16A 2GLXA 1U4SA 4Z9FA 4PLHA 1UP6A 2FR0A 1KETA 3JTMA 3BHJA 7ADHA 3GRPA 4PCVA 3JQ8A 1DXYA 4CMJA 1EE2A 1I3KA 1QP8A 2VTEA 3OFSA 4CMCA 2ZKLA 1VKOA 4DIOA 5L53A 5CG1A 4EGFA 1QV7A 2QYSA 4ND1A 1Z6ZA 2DPGA 3PJFA 4II2A 1N7GA 2JCVA 2JFGA 3UGKA 4ALJA 2I3GA 2XF8A 1PQUA 1ADCA 2JAPA 4A73A 3BHMA 2YY7A 2ZQZA 4E2WA 1Q0LA 3S2GA 2PH5A 3ASUA 2BKAA 2NACA 1DRUA 2YQ5A 4QTZA 1W4ZA 1ZBQA 1KC1A 3QLJA 1YBMA 2CY0A 1A7AA 2YQ4A 2UYYA 1PS9A 1WZEA 2ZB7A 2WMDA 3HJAA 3UHAA 3RC9A 4BKPA 3O8QB 1WW8A 4TRJA 3WGYA 3GEGA 5DBGA 4R1NA 3ANMA 1YKFA 3PWSA 5MDHA 3PPIA 1SNYA 1EUCA 1KEPA 1LBEA 2IXAA 1NAHA 4O63O 4UVHA 3ONFA 5B37A 2JKVA 3K96A 4LVUA 4UUOA 2A92A 2X0JA 1ADGA 4Z6KA 2IZ1A 5COQA 5T67A 2NU8A 3SBOA 2BFOA 4ZGWA 3DOJA 3AOEA 3GQVA 2ZK7A 4FS3A 3ZNPA 4D3SA 4BGUA 3OIFA 4BO5A 4NU5A 5IFLA 1H9BA 3RKRA 2O7QA 4CL3A 3KTDA 3ZV6A 4BNNA 5ILGA 4J16A 4UVDA 3WMXA 2WYWA 1VJ0A 1CEQA 1K6IA 2A35A 4CQLB 2GN8A 1XA0A 3EW7A 4L8VA 2VOJA 4WEOA 1C0LA 1OFGA 5KVVA 4E5KA 4PZDA 2PTGA 1P77A 4CLOB 1WAMA 4B7XA 5HA5A 1MV8A 2VNSA 4FBGA 2XOXA 3DTTA 2R2GA 3IQDB 5JCJA 1IULA 2ZTUA 4R01A 3DEYX 5I9LA 2HJRA 3ZWNA 4CMHA 3LDHA 1IOLA 1BDMA 2GF2A 3CIFA 3FWZA 4GBJA 4XJTA 4R16A 2FMUA 1M66A 2W2KA 5BSEA 2E49A 3U4HA 1P0FA 2DC1A 4IQGA 2A4KA 4YA6A 4HFJA 1B8PA 1DO8A 3FSRA 1X13A 3JYLA 2G82A 3ABIA 3OJ0A 4GMGA 3TZHA 3TZCA 2UVDA 3H9UA 1M6WA 2H5LA 2I65A 3KYBA 3FWNA 1GDHA 2W90A 1DIHA 1VL6A 4GX1A 4I8XA 2ZB4A 1NR1A 4EJ6A 1EEHA 1QXSA 2DBZA 4DQUA 4ZHSA 4R68A 4OMUA 4BKUA 3LF2A 3DFZA 3AUUA 5DCWA 2PGLA 1X1EA 1H6DA 3QRWA 2OBNA 3ZZNA 1HRDA 3PRJA 3DBHA 3IS3A 4DLAA 1GADO 1HSZA 1CIVA 5EL0A 2VHXA 1RYEA 3IUSA 4CV1A 5L51A 2GN4A 3SX2A 2IZ0A 1GEGA 5KKAA 3W8EA 5G4LA 4Y67A 2EHDA 2WD7B 2PKQO 2RH4A 3M2PA 4NIMA 1EUDA 2H1SA 3HHPA 4OQYA 4XWYA 1VJTA 4NQZA 4HV4A 1R15A 4RDIA 2NV6A 2D4AA 4C7KA 3FR7A 4E32A 3GVXA 1BG6A 5IDWA 3EUWA 3TL3A 3COSA 2B5WA 2J3HA 4C7JA 4NJMA 5A9SB 4JP3A 1ZSVA 1XYGA 3HNPA 4J9VA 4FFOA 5CEFA 2PWZA 1TXGA 3OA0A 1D1TA 4NJOA 2HDHA 3BMOB 4B7UA 3BIOA 3GEDA 4BL5A 4AL4A 4EBFA 4A27A 5I7SA 4LK3A 4HXYA 4XA8A 4U0JA 3RUAA 3IC5A 4WNIA 3H2SA 2AG8A 1RJWA 1IB6A 5L3ZA 4AJ2A 4W82A 1TEHA 2F1KA 3EYWA 5A5EA 4HFRA 1A9ZA 3TZKA 4E5NA 2FR8A 3AOEC 3Q9NA 1WPQA 4J9UE 3NT4A 5JDIC 1YE3A 2CF5A 1CETA 3G3EA 3QWFA 4CQMB 3Q3CA 1L7DA 1GQQA 1K6JA 2ZIZA 1PJTA 2O3TA 5TNXA 1FDUA 3CMCO 3MEQA 5JCJD 3H4VA 1FF9A 4J4TA 1ZW1A 3MJSA 3HADA 4WCFC 1B8UA 4ALLA 4BVAA 4QXMA 3BA1A 3DZHA 2CF6A 1E5LA 2I76A 7MDHA 4JBIA 1V3UA 1A72A 1GZ3A 2Q2WA 5AOVA 4DIFA 4UEJA 3Q0EA 2CVQA 5JE8A 4RF4A 1HXHA 1UH5A 5G4KB 5L4SA 3ONDA 4Q3EA 1ENZA 3IL2A 1E7SA 2YHIB 4XGNA 1HF3A 1BW9B 1H6CA 4BNWA 1LI4A 3WGHA 3W8FA 4FJ2A 4EITA 1EQ2A 3ZWCA 4QT0A 2VNAA 1LDGA 4YAJA 5A04A 4AJJA 1FDVA 3RAJA 3GFBA 1YOVB 4NBRA 1FXSA 1LDEA 1JLLA 4E6PA 1D8AA 4GSLA 1IPFA 2PGDA 4TZKA 1LU9A 1QRRA 3K8ZA 1RM0A 3JQBA 4BO3A 5TJHA 2X5JO 1M75A 3KLMX 5JFOA 4FGSA 3JD1A 4BMVA 4FFLA 3NUGA 2NVUB 1I2CA 1BW9A 2AE2A 4IM7A 1ML3A 1ONOA 3KYCB 5F5LA 5H82A 4XYLA 4ONEA 1BTOA 1E3IA 2D8AA 3B70A 4TVOA 1BRMA 1DHRA 5JMWA 4WLEA 3JQ6A 3RASA 2ZATA 4CMAA 3AFMA 3NDRA 4D3FA 1N92A 1T26A 3RIHA 1P1IA 1HE5A 3FNHA 3R6DA 2AEMA 5THKA 4E5PA 2D5CA 3U0BA 5IZCC 1IYZA 4MP6A 3C24A 3PFFA 1A4UA 4ZQGA 4U0KA 3FF4A 4FJ0A 2P2SA 3KSDO 3WXBA 1JU9A 5KJ6A 4YAIA 3Q1LA 4AVYA 1W6UA 4AJKA 4F6CA 2JAHA 3WGQA 1SOVA 2GN6A 2QRJA 2VWQA 2O3QA 3AK4A 3PDUA 2Y1GA 1RWBA 2JD0A 4AJOA 4FR5A 5CHEA 1YB1A 5HS4A 4J1SA 1UXHA 4PZEA 5L7YA 4IQ8A 3JQGB 2GDZA 2C59A 2JD1A 3GVHA 1N8KA 3KXDA 3C7AA 1PJSA 4PZCA 3QWIA 1HDYA 3WTBA 5KVQA 1AHHA 3E5MA 3CUKA 4CM4A 2Z1MA 2Y67A 4DLBA 2VN8A 4E12A 5KVSA 3Q6IA 2Y1DA 2X5KO 3HSKA 4R9RA 1DIGA 4BKQA 4CM6A 4UVEA 4L74A 3BMNB 5A5FA 3WBBA 2X0IA 3PZBA 2ZJ0A 3BTVA 1BGVA 1KBZA 1P1FA 1T2AA 4BNHA 3QVOA 3BTUA 1ZCJA 1ZIDA 1A9YA 4DWVA 1GYPA 2DFDA 5A9RA 1X15A 3HDYA 1PZGA 4NBWA 2ET6A 3PXXA 4EUFA 4WKGA 1GCOA 2IE0A 1LRJA 2DT5A 1I01A 4K1LA 4FJ1A 4RPHA 3IP1A 3LYLA 4YJGB 2EP5A 1MXHA 4WJZA 4PG5A 3GG2A 4HBGA 3ZU2A 2VRBA 3F4BA 4CLEA 2WSBA 4AG3A 2J6IA 3NT5A 2WTBA 1T2FA 2AQIA 3MOGA 3VTFA 4KTTE 1Q0HA 1R0LA 3RWBA 3Q11A 4DREA 3WWYA 3ZH2A 4BO4A 4I5FA 3DZIA 3PJGA 2O2YA 4II3A 5DDIP 3DL2A 3VDQA 5L7TA 1B3BA 4XQ9A 4BGIA 1DPGA 1SC6A 3GA0A 3V2HA 5C7IO 2TMGA 3RC7A 4G2NA 4B3JA 4TWRA 3I5MA 4TRMA 4U8GA 3KYDB 1GZ4A 1UP7A 2C5AA 2AW5A 2R00A 5IZ4A 1Z7BA 3WSWA 2FHSA 1EFLA 2Q46A 3B20A 4WPGA 2PGJA 2G76A 2HK8A 3VPHA 3WIDA 4BQRA 4I9UA 4Z0HO 2QYTA 3UOGA 4LRTB 3M6IA 1ARZA 2Z95A 3OJEA 1Y8QA 3TRIA 1R4MA 4CM3A 4BNJA 3FNFA 1O6ZA 3JD2A 4YB8A 2HK7A 3LVFO 1E7WA 3QHAA 4KP7A 2Y1OA 2HUNA 4MVJP 3PFWO 1SAYA 2YW9A 3JQ8B 2JJYA 3I52A 3R1IA 2C2YA 1BWSA 1HDXA 4BS9A 3D0OA 4MOWA 4P22A 3QIVA 1U3TA 5KJ1A 1JVSA 3TJRA 3I6IA 2Y66A 5T8KA 3UN1A 2HO5A 3DC2A 4I9HA 1ZSYA 3F3SA 2Q45A 4D46A 4P38A 2OO5A 2V65A 1NQAO 1LLUA 1BXZA 3NTOA 4EUHA 2WD7A 5JMPA 1YQXA 5CAEA 2SCUA 4GH5A 4KWHA 4YT2A 3AW9A 2VHWA 4LW8A 1EK5A 4NMHA 1WDKA 2V6FA 3BMQA 4P4GA 2EW8A 3WGIA 1OI7A 3PHGA 3DMYA 3C3XA 2X5OA 1TVEA 3VOSA 2PLAA 3ORFA 5LDHA 2PH3A 3P7MA 1Z73A 2Q1SA 4CODB 5BT9A 2DLDA 4GQAA 3GZ4A 2Z5LA 1R0SA 4XQCA 4BNZA 4BMSA 5DOZA 1N2SA 4XZ3A 4QFDA 4J43A 2YHUA 4XYBA 3LK7A 1H5QA 1BXGB 2NM0A 3PYLA 1TB4A 4M55A 4W4TA 1LQUA 1Y5MA 1E92A 1BVRA 3BZUA 1YQGA 2E37A 1EK6A 1W0CA 2TMDA 4OGWA 1ONNA 3DDNA 4GLLA 3KEOA 4MKZA 1LRKA 3ETEA 1WVGA 4HNHA 3OJOA 1C14A 3UFXA 3PHHA 2VYND 2XPCA 3OMLA 4OXNA 4FDAA 4XYEA 4NFHA 2GNAA 3VZPA 4BO9A 3FNEA 2WYVA 3I9KA 2ZTLA 4LRSB 1N1EA 1ZJZA 3BTOA 4NK5A 4WK6A 2VYVD 3RU9A 4E4YA 5BNTA 1L1FA 4CUZA 3HDHA 4YT8A 1H93A 1C1XA 2X86A 4YR9A 4DBVO 1GR0A 1JW9B 2EGHA 1U8XX 1KY5A 1PQPA 3O26A 3F47A 4FCCA 3VAZA 3E18A 1WXDA 3ZWPA 3ZGYA 4TRNA 4O0LA 3X2FA 4A2CA 3L6DA 3IKTA 1NBOA 1QLHA 2W98A 2AA3A 4MVJA 2FZEA 2X0NA 4MINA 3UH1A 3WWZA 1GD1O 5F21A 2CDCA 4I5GA 1MFPA 1CYDA 1Q7GA 2X9NA 4IIUA 4MIOA 4CR6A 2VT2A 4INAA 2BI7A 3GNTA 5DCYA 3JQDA 3KOUA 3PEFA 1LX6A 3DZBA 1MFZA 1EVJA 3M2TA 3N7UA 1I30A 2Q4BA 4GWKA 1XIVA 4L76A 3PQEA 1HKUA 5K6AC 1E77A 1ISMA 2EJVA 4MVJM 1A27A 1UAYA 3DZJA 4K6CA 2XAAA 2NSDA 2B4TO 1SEPA 3OSUA 1Y5RA 2F00A 2I5PO 1HYGA 3LC7O 4NNJA 2B69A 2Y05A 3GHHA 2X58A 3DZGA 2WE8A 2ZCUA 4IDFA 3D5QA 3NTQA 1J6UA 1F8GA 1YQDA 4ND5A 1ONPA 3FRJA 3BXXA 4AFNA 1ZJYA 1U3WA 3B1FA 1AN9A 5KNLA 3DOOA 5TRTA 5I7FA 1P1JA 4NZ9A 1PJBA 4GGPA 3W6ZA 3PHJA 1VKNA 3PQFA 4D44A 3SLKA 4CLRB 4EYEA 4E33A 4B7CA 3ULKA 4XGKA 3VZRA 4EEZA 5L9AA 3PGJA 3KO8A 1JVBA 1O5IA 1EVIA 3P2OA 3QA9A 1R0KA 3ON5A 5G2OA 3RUHA 2ZB8A 5LDGA 1XR3A 4GVXA 2HRBA 2PFGA 4AJ1A 1VRWA 2AE1A 3L07A 1HDCA 5ENVA 5B4TA 1C3VA 2NLOA 4MJLA 3F1KA 3DAPA 1A71A 4I08A 4M86A 1I5RA 3VPSA 3W8DA 4IDAA 9LDTA 1UDAA 2ILTA 1BXGA 1Y7TA 3WOHA 3SC4A 1V35A 2GRAA 3EK2A 3A1NA 3M1AA 4CM9D 1F0YA 1I3NA 1F14A 2PA3A 1R16A 3OJFA 4G65A 1KVQA 2RBEA 1KYQA 1YXMA 4WASA 3E9MA 3CZMA 4W99A 2CUKA 5EN4A 3WSVA 3ZWBA 1MB4A 4JNKA 2X8LA 2EV9A 4Y6SA 3ADOA 4TQGA 3PIIA 3K9QO 4QO8A 4YWJA 4AJEA 4MP8A 2WDZA 1WWKA 1XEAA 4O5OA 3KSUA 2POQX 3AY7A 1A5ZA 5JO9A 2WYUA 3KYDA 4K28A 3IDSA 4YXFA 5JY6A 4TKLA 5A1TA 1O8CA 1ULUA 2I6TA 1ISGA 4OKNA 3DBRA 5BNIA 3QVXA 4OJNA 3RUCA 4DC0A 4RJTA 3H9EO 4YRAA 4YJHA 4NG5A 2J5KA 3UF0A 4CL8A 1GAEO 3RJ5A 1XGKA 4TVBA 3OIGA 2BFAA 4Q9NA 4KQXA 4YQZA 1SOWA 1CF2O 1O9BA 4NHEA 2J5QA 5KIAA 1B3RA 1PR3A 5THQA 1K5HA 1P9LA 2W8ZA 4MIEA 1KVUA 3W4KA 3I23A 4MP3A 1UAGA 4MVJE 1GUYA 4R1SA 1ZXBA 2EP7A 1LTHR 4UULA 5F1KA 2WEKA 3TF5A 3WR5A 4DLLA 1N9GA 4XD2A 1VPDA 4ILKA 2DM6A 2AEJA 4RLHA 2B83A 4YTEA 5F3RA 1LSUA 2RHCA 4BQPA 5CP8A 5A3VA 3WFIA 4BGVA 3MJCA 4E0BA 3TDKA 1NHGA 2VHYA 2VHVA 3SC6A 1BDBA 3HDQA 1I32A 4CV2A 4MVJF 1RPNA 4Y8VA 1U7HA 2B37A 2C7GA 2DTDA 4J1TA 4OXKA 3RFXA 1B0AA 2D0IA 1SB8A 2VUSA 2IRWA 4NBTA 4E2YA 5I8WA 1OZAA 3WGOA 3AY3A 4YQYA 4HNGA 2AMFA 1G6KA 3FI9A 5KOIA 4UEOA 3FPLA 2IXBA 1E5QA 4BNIA 1DLJA 2D59A 4LCJA 5A02A 2NADA 5COBA 1EVZA 4HADA 4BB6A 4U7WA 4R1UA 5BQFA 4O59O 4BNMA 4PLWA 3OBBA 4E2ZA 1NFFA 3TL2A 2BGKA 3CZRA 4RLSA 3KLPX 1CJCA 3ZWMA 5EERA 4KOAA 3SEFA 3RUFA 1R4MB 3FR8A 1GV1A 3EMKA 2IEDA 4DL9A 1E3JA 1ORRA 3AJRA 2QX7A 2I99A 1X1TA 3D64A 4DC1A 1I2BA 4BO7A 1NPYA 1S6YA 4MO2A 1HLPA 3DBLB 3DONA 3F46A 1ZO8A 2PKQP 4PGFA 3HDJA 4NDNE 4FW8A 4Z9XA 1PQWA 4P4NA 3PIDA 2PZKA 5KJEA 3UCEA 2FPPA 3VKVA 4O1MA 1LDMA 3I9JA 1ISJA 3ZU3A 1HDZA 4Z0PA 5HM8A 3DZFA 1VL0A 1NQ5A 3DZKA 4ZU3A 3VH4A 4AJLA 4YRBA 4RQUA 2Q1UA 4CQMD 2WM3A 4RPJA 1FJHA 4LISA 1YOVA 3JQCA 4DA9A 2C07A 3AFNA 1ADFA 3NRCA 1DC5A 2YDXA 3I83A 3GT0A 1K2WA 3KVOA 5CDSA 4EDFA 3VH3A 5DZSA 5CG2A 2DQ4A 2G17A 1F8FA 2FZWA 3DFUA 1EZ4A 1Z82A 3LLVA 4ZQBA 1U1IA 3ETDA 3I9LA 1LA2A 2IZZA 3U09A 3WJ7A 3LLSA 4BO8A 4I1IA 4NK4A 1VSVA 2GGSA 1F12A 4K9DA 3JQFA 2C5EA 2DVMA 3GPDG 1ZMOA 3MJTA 1OMOA 3AI3A 3K30A 4UUNA 5I9NA 4L4RA 1UZMA 3NKLA 5TJ9A 4MPDA 3MOIA 3LT2A 1LC0A 3O03A 2W2LA 4OL9A 3K2EA 3GNSA 3INRA 1IL0A 4L9RA 5CDGA 4ALMA 5KCZA 1CDOA 4BB5A 3GDOA 5F1PA 1P0CA 4CR7A 3ZWXA 3MJ4A 4QSMA 1YBVA 2EKQA 2V7PA 2CMDA 3H9QA 3QJ5A 4RVSA 1GCUA 1Q1NA 4XJSA 4F6LA 2C2XA 3GNQA 3DBHB 4W7IA 1X7HA 3HFSA 3VKUA 3DO5A 3FD8A 5JYDA 3P19A 1YL6A 3GR6A 4GKVA 3GDFA 1MX3A 4J7CA 2ZTMA 5BR7A 2HMUA 2VWHA 5EJ2A 1IY8A 3H5RA 2VWPA 4CR8A 1GFSA 3PJEA 2H9IA 4OXYA 4N5NA 4M1QA 1DIBA 4LN1A 1NM5A 1JKJA 1KIFA 1LDNA 3GGOA 4KTVE 1RYDA 2QW8A 4M54A 4X54A 3KV3O 1WZIA 4A5OA 3N74A 4R3WA 2D2IA 5LCXA 4HY3A 2D5AA 3S55A 1PJ3A 5A9SA 3RU7A 4J49A 1RM3A 3NDIA 1DRVA 3RVDA 2OMEA 1JA9A 5GMOA 4CLDA 2J3IA 2VQ3A 3F4LA 2QRLA 3H3FA 5G0SA 4ID9A 4I5EA 1U5AA 1Q0QA 3U3XA 1GU7A 2RHRA 2ZYDA 5G0UA 3GOHA 1SO8A 3INTA 4KMSA 3A14A 2A9FA 4XCVA 4YJFB 3T7CA 1Y6JA 2Q1WA 2O7SA 3FTNA 5JC8A 1OOEA 1P1RA 1LLCA 4CM7A 4CLOA 5EINA 4R5HA 2YYYA 3FPCA 5JDIA 1KEUA 3L4BA 3NEPX 3NX4A 1PX0A 3U5TA 1B14A 3VPFA 4IDGA 2O2SA 4BO0A 4BNLA 3MWEB 5HWSA 2HMTA 5EMHA 1DC6A 4ZRNA 3V2UA 1VI2A 1YL7A 5FEUA 4L4SA 2NWQA 5JBIA 4AJPA 1H94A 1I36A 1PZHA 3NGXA 4WOKA 1A7KA 4LSWA 2Q4EA 3ZWVA 1CWUA 4E21A 1LDYA 3RFTA 2VUTA 3GRKA 4PLFA 1T1SA 3JQEA 4H16A 3AU8A 4B3IA 3K6JA 1LLDA 1WMAA 5FI3A 1I33A 4WCFB 3PWKA 3EY4A 1R4NA 3QVSA 2VOEA 3GVCA 5JYEA 2YFHA 6ADHA 2HQ1A 4A7PA 5FFFA 3IJPA 3TFOA 3S1LA 1I3MA 1V9LA 4YJGA 3U9LA 5KVCA 2ZYAA 1V8BA 1PL8A 1LSJA 4BNYA 3OQ1A 4J91A 1NFRA 4CLXA 1W73A 4M87A 1EBFA 1KY4A 3ZHXA 2EGGA 3JV7A 1K3TA 3I1JA 2OBYA 5K0ZA 2Y0EA 4IDDA 3NGLA 1DIRA 2AQKA 3OQ6A 4E13A 3D4PA 1XKQA 1XQ1A 1PGPA 5FF9A 4BIIA 1QV6A 4BHTA 4D45A 2B0JA 5TSDA 3ZN2A 4JX8A 3RUDA 3DBVO 3ASVA 3F1LA 4Y6RA 2GD1O 2PD3A 2JFHA 1NWCA 4NPCA 5F5NA 2V6BA 5DULA 3ZV5A 4G5HA 3AY6A 1E7QA 2EXXA 3NAQA 3RJ9A 1JN0A 2Q2QA 5CDTA 4MKXA 5JS6A 2VYVA 4J0FA 5COAA 2YZ7A 2NTJA 4LCEA 1T24A 4L0QA 4IS2A 1DC4A 4J1QA 4CQLA 5A9TA 1DEHA 3ADPA 2R6JA 4XIJA 4L73A 1L7EA 5EQDA 2DBRA 3B1JA 2CDBA 3U4DA 4PG8A 3OQBA 3IP3A 2UAGA 1KEVA 3K5PA 4GX0A 3DBRB 4L75A 4R3NA 4Z3DA 1HETA 3H2ZA 2P4QA 2OHXA 5KTKA 5T8KC 3RROA 5J23A 4WLVA 3WGZA 3PYMA 2HJSA 2AG5A 2ZQYA 4OSPA 3R3SA 5T57A 3H5NA 1ZNQO 2Q3EA 1NP3A 1YL5A 5F1OA 2J8ZA 4FOOA 2FPIA 1YB5A 1ID1A 3L4BC 3CMMA 3E8XA 3PK0A 2PKRA 4UREA 3HUDA 2FOIA 4DIBA 3ICCA 2VZ8A 2VHZA 4FD3A 4JP2A 4CV0A 3LT0A 1N1GA 2P5UA 4K6FA 3LZ6A 4FFNA 4ND2A 3GZNB 4CJXA 2QHXA 1PSDA 1EMDA 3V2GA 4J0EA 3TOZA 1YO6A 3RC1A 1MGOA 3PJDA 1GYRA 2GASA 4H15A 2W2KB 5TT0A 4PLPA 3DHEA 3JQ7A 1H2HA 1R66A 3DQPA 5BNFA 2CNBA 4N7RA 5JY1A 5H81A 2EKPA 1PEDA 1UXGA 4RF5A 3ZCXA 4DXHA 2X4GA 5JLAA 1MXFA 1E3EA 1U4OA 2EWMA 3GFGA 4H7PA 4UUPA 4GKBA 3ROMA 1GQYA 1JWBB 1K89A 4DUPA 3OICA 1R6DA 3LF1A 3ZI0A 2FSVA 4R9SA 2HMVA 1KC3A 2Y68A 3KM0A 2NVUA 5DP1A 4CMEC 2EG9A 4YCAA 3DOCA 5IN4A 1C1XB 4P8RA 4A10A 3ZNOA 4D0RA 4BNTA 4NBUA 4XKJA 1OBFO 3JQAB 4EUEA 1GEEA 2NVWA 3KBOA 4R1TA 2BH9A 4CM4B 1PZEA 1QSGA 3WQRA 3C85A 2Y0DA 1LNQA 3E48A 2BMAA 3U49A 3ROQA 1B26A 5TIIA 1VM6A 2O3JA 1B2LA 2RAFA 3B6ZA 2XXJA 3OEYA 3ENKA 4GWGA 4YT4A 1IHYA 1MC4A 1G1AA 3GAZA 4I9NA 3HB4X 1P45A 2AEFA 4JXKA 3QP9A 3F5SA 4WEQA 3X2EA 4RPGA 4IY1A 5C7OO 1NPDA 3EVNA 4BV9A 5C37A 4D7AA 3NV9A 3RC2A 4WNCA 3QVTA 5U9CA 4GX5A 5ILOA 1FDTA 4NBVA 2GR9A 4IZIA 1T4DA 2GZ1A 4FGWA 4QEDA 4QO7A 3WMWA 1E7RA 1E3WB 3H8VA 4RVDA 3AWDA 3LQFA 2B5VA 1KOLA 3TNLA 1EFKA 1PZFA 3EZLA 2B35A 4GI2A 4D79A 1Q7CA 2QZZA 4TKMA 5DBFA 4OAQA 4N5MA 4N54A 4FOSA 3DMTA 4L4XA 2NVBA 1UDCA 2HK9A 3DHNA 4NFYA 4DPMA 1MLDA 1V0JA 4HKTA 4BO1A 2WWRA 3IMFA 3WJAA 5T6BA 3ROKA 1LDBA 1HDRA 4XGIA 5G0WA 3EAGA 4E3ZA 4RPKA 1TT7A 2Y1EA 2JCYA 2LDBA 3H3JA 2E48A 3IKVA 1PS8A 1LLQA 4BKRA 1I3LA 3D4NA 3L6EA 1E3WA 5TX7A 1NXQA 5A03A 1U2GA 1WP4A 3JYPA 2QZ9A 4CMEA 3LT1A 2NU7A 1SEVA 5BSGA 4RO0A 2HSDA 2DTXA 5IJZA 4YJDA 1U3UA 2WE7A 3H9JA 4RF3A 3BTSA 2JFFA 4OHUA 4O6VA 5IDXA 3JSAA 1RM4A 1DJNA 1N5DA 4HP8A 2OORA 1ZUD1 3S2EA 3HN2A 1WMBA 3QQPA 2P4HX 1CERA 3AU9A 2DBQA 2NQ8A 4YJHB 1B15A 2GZ2A 3RBXA 2QRKA 3Q2KA 2H63A 1NWHA 4LGVA 5IN5A 5ITVA 3CINA 4JIGA 4PLTA 5JO0A 3JQ7B 2JHGA 1QORA 3L9XA 3TN7A 3UAGA 4GPD1 1W8DA 4UUMA 4W9NC 4YACA 3ZNNA 3UKOA 1UZNA 1SZJG 3GF4A 5I7EA 1ADBA 3MWDB 4J7UA 1E6UA 1X7DA 1GPDG 2YV3A 4ZD6A 3W1VA 2DKNA 2C29D 4ND3A 1NVGA 1TI7A 3NDJA 1AE1A 2B4QA 3BMNA 3AUAA 3O9ZA 5H83A 4GL4A 5MGBA 1S7CA 1YVEI 2E82A 4RVUA 1PR9A 1YJQA 4PRKA 1HYEA 3F6YA 4PFJA 1ENPA 1H9AA 2DUUA 2Q99A 5A4DA 1R12A 1IZ9A 1SMKA 2OGUA 5DT9A 1U9JA 2EW2A 3U4IA 3I9NA 3MZ0A 2BHLA 1O95A 1QMGA 2J3KA 4Y9DA 3BMCA 4FN4A 1P74A 3LC2O 4CUJA 4M49A 1ISIA 4JJIA 2PD6A 2Y0CA 3BAZA 3JQGA 4PLYA 4BO2A 1CRWG 4XQEA 3ST7A 3E9QA 1BVUA 3ZWOA 4JJFA 4KUHA 4TZTA 1X14A 1ZVMA 1JKFA 4IGFA 3TZ6A 2QQ5A 3E82A 4EZBA 5AYVA 1WDLA 1QYXA 3FN4A 5I8ZA 1UXJA 3G17A 1V3TA 3K92A 1IE3A 1Q2XA 3GMDA 1O89A 4IS3A 3ROPA 4DPLA 4JLWA 3O38A 2C82A 3SVTA 4Y6PA 1QYVA 3UICA 3JD3A 3PQDA 5JAQA 3AUTA 3C1OA 4ZRMA 1I0ZA 3GVIA 2GN9A 1SPXA 4OO3A 4IJUA 2CDAA 1R37A 4URFA 4HFMA 4RZHA 2IYOA 2AQHA 2QG4A 3OECA 1QYCA 3SXPA 4MIYA 5B1YA 2E4AA 2ZJ1A 1XQ6A 4MVJG 5IDYA 4J2HA 3WQQA 4IJVA 4J90A 1VE9A 3P2YA 4IJWA 4B8ZA 2UV8A 1JQBA 4RVFA 1WLYA 3QWBA 1F17A 3ZDFA 5B4VA 2YV2A 1GTMA 1SBYA 3D3WB 4BNGA 1LC3A 4HX5A 4XB1A 3V1UA 4XYMA 4W7HA 4D43A 5IF3A 1DAOA 5IXYA 1TT5B 5EQFA 1XG5A 4OYRA 3EDMA 4IJKA 3GG9A 5AXDA 1P31A 4QQRA 5B12A 2NU6A 2OL4A 1KS9A 3GH3A 4TROA 3VDRA 4IIVA 4AJ4A 2DBVO 1F06A 4FFPA 3L6OO 3MTJA 3WLEA 4ZN6A 1QKIA 1Y81A 5U1PA 1ZK4A 2NUAA 1E1KA 4GAEA 4XRGA 5JW6A 2HU2A 4BNKA 1UZLA 4QUKA 1IHXA 3NYWA 3QY9A 2CD9A 5K9ZA 1PWXA 5GZ3A 1E3LA 3DTYA 1P44A 3I6QA 5A05A 4S3MA 3UVEA 1UDBA 3F5QA 4WLUA 3IOYA 4R4JA 5DOVA 5CFZA 4XYGA 3ZNQA 1PS0A 2PZLA 3AI2A 4Y98A 1YDWA 5A3JA 2GYYA 1JWAB 1Y9AA 2FPGA 2HRZA 1Y8QB 1PWZA 3G1TA 5GZ6A 1C0KA 3KYCA 4EJMA 3UXYA 1ZFNA 3R3JA 1U7TA 5HBRA 4B8WA 4FQ8A 1Z75A 4IDEA 3VH2A 2O3RA 3PI7A 3ZHBA 4XX0A 1VL8A 4WCFA 3MJEA 3L9WA 5DNAA 5IG2A 4KZPA 1GUFA 3QE3A 1ZSNA 1DFHA 1DHTA 1E0DA 2BD0A 3GN1A 4TMFA 4S1VA 4DBZA 4BOYA 4JK3A 5CDYA 2X6TA 3OHSX 5GY7A 3SJ7A 4ZJUA 4UVIA 1ISFA 4U6QA 3SLGA 1D3AA 1UXKA 3OEWA 4NU6A 4LVCA 3WYBA 1ZK2A 4Z9YA 2X0RA 1UP4A 3ANNA 5TF4A 1R4NB 3RD5A 4ESOA 1ISHA 1YB4A 1X7GA 1DIAA 1ENOA 3H65A 3WBFA 4WOJA 2DFVA 2BFPA 3D4OA 3PLNA 4B4VA 1PJCA 1PL7A 3KHUA 4YAGA 1P1KA 2O3SA 4UVGA 2P9GA 4HUJA 1X0VA 2CVZA 1YS4A 1FMCA 4E5MA 1HYHA 4BNVA 1XELA 2GO1A 2P9EA 3JYQA 4KUGA 3GUCA 3VC7A 4WGGA 4XEHA 3ZHZA 2OFPA 2PZJA 4BGEA 3V8BA 3ICPA 4FFRA 4OKIA 2RH8A 3GC6A 1J49A 4OH1A 3S8MA 1DRWA 1LUAA 3JD4A 4J2OA 3WYEA 4EW6A 4LMPA 3TPCA 3EC7A 2VYNA 4OIMA 1DDOA 1PJ2A 4YYZA 1YONA 4IXWA 2FWMX 5L7WA 1DFIA 4RL6A 5DBIA 3V5NA 3LT4A 4IPTA 5L45A 5AXBA 3V1YA 1EDZA 2GERA 3JQFC 3S2FA 3T4EA 3PGXA 1AGNA 1VLLA 2V6MA 3ETGA 3QV1A 4IBOA 1XDWA 5I9MA 2ZTVA 4Q3DA 2X23A 3INGA 5ES3A 3KSZO 3LU1A 5G0VA 4ROSA 1ZEJA 3G1UA 1NQOA 1Q7BA 1E1LA 3L0DA 4WLFA 3VZSA 2EJWA 4D0SA 2H6EA 4NFSA 1EBUA 1HLDA 3RCBA 4UEKA 2P9CA 5ICMA 1C1DA 4RVHA 4CMGA 8ADHA 1AHIA 2W2LD 1UJMA 2OP1A 3DAGA 3KZVA 1PGJA 1GZ6A 2B36A 4QFCA 2AHRA 3DWFA 1NYTA 3OM9A 3RSHA 3RUIA 4CMBA 2VWGA 5FWNA 1EVYA 1EUZA 4RZIA 3KETA 2DAPA 2PR2A 4JN6B 5DN9A 3MTGA 3PLRA 2HAEA 2UDPA 1H0KA 3N58A 2CVOA 1V3VA 1ZEMA 1HSOA 4FC6A 1ZH8A 3U62A 1VSUA 1EQUA 1K6XA 3DHYA 3H6KA 4RORA 4BV8A 2NQTA 2UUOA 1PGNA 3GVPA 4RPLA 3ENNA 2Y99A 3GLQA 3IJRA 1H6AA 2VT3A 4IGEA 1HZJA 3C7DB 3L4SO 1KERA 1GY8A 3RQSA 3D3WA 1ZK0A 4GX2A 3ZV3A 5TS3A 4BKOA 3DMTC 3VZQA 3KEQA 3DBLA 1OC4A 1HE4A 1RM5A 2BGLA 5JXWA 4R5MA 2Q1TA 4XIYA 1C0PA 2O4UX 2DTEA 2PZMA 4FSHA 4JCOA 4J3FA 5TLSA 5BSFA 3AM5A 3D1LA 2Q49A 4GLOA 3T7EA 1FDWA 1YJ8A 5TQVA 1IUKA 1OAAA 3EGOA 4CMIA 1PJQA 4KQWA 3JD0A 3LC1O 3WQSB 5ENDA 4EI2A 3JYOA 2HCTA 1KVTA 3RFVA 1MP0A 5JAZA 3VTZA 4R54A 3FTPA 4JQCA 1TA4A 1M2WA 4W9NA 4DGSA 3OH8A 1HT0A 1B7GO 1FK8A 2EF1A 4PLGA 4XRRA 4J4BA 2ZB3A 3PTZA 4NI5A 3OJLA 3WG9A 3JYNA 1XSEA 4JBGA 2O4CA 3DB2A 2AQ8A 3PZRA 1T1RA 1MG0A 3P5SA 3QVWA 2OXIA 2R00C 4LSMA 5ER6A 1EE9A 3CH6A 3FNGA 3HG7A 1YBAA 1NVMB 3W4IA 4JJGA 1KVSA 3TZQA 2IYPA 3CE6A 3GGPA 1I10A 4FC7A 5JAMA 4BNFA 2I3AA 3MJVA 3A9WA 1Y8RB 4GMFA 3JQ9C 3OIDA 4PG7A 1J0XO 2FY8A 3CXRA 4A03A 3NJ8A 4GGOA 3C1AA 3L77A 5DP2A 3QWAA 2NNLD 3H9GA 4KUEA 4OOEA 2J5RA 3C1TA 3O4RA 1I8TA 3A28A 3ITDA 1ULSA 3PDJA 4YVFA 2G0TA 4PVDA 3WGGA 4RCVA 4CPDA 2FSSA 1H6BA 3ANLA 3DAFA 3UW3A 3G49A 4A26A 3V1TC 3VVBA 4OSOA 3A06A 4WECA 5C3MA 5IZCA 3HWRA 3W6UA 4Q3NA 4CM8A 3NTRA 5ER9A 1YDEA 5JDCA 4WUVA 1LJ8A 3UCXA 4MVJI 5BSHA 1O94A 1PGQA 2D3TA 2RCYA 5JC1A 1XCBA 2OOSA 3G0OA 2PV7A 3W4JA 1E1MA 2I9PA 3KB6A 3AI1A 2IODA 2ZYGA 3GUYA 4N5LA 3RBZA 3ZHYA 1NX6A 3E1KA 1BHSA 4LMRA 4CM8B 4F45A 3ZV4A 2JD2A 3WNVA 4BO6A 4E31A 1RKXA 2YUTA 3TOXA 2LDXA 4BMNA 4E5YA 2IDZA 3OETA 1U3VA 4CM9A 5T64A 3WYCA 1B8VA 1PTJA 3EVTA 3JCZA 2I67A 4ALKA 4IXTA 1J4AA 3WLFA 3KUXA 5ITWA 2JCXA 3GN2A 4E2XA 2PY6A 3Q2IA 2C54A 2XXBA 3GPIA 2Y1CA 3CSDA 2CZCA 4PRLA 5U4QA 3I4CA 3AOGA 4A0SA 1D4FA 3EZYA 3KRTA 3GEMA 2X22A 3GMSA 5HRUA 2B4RO 1C0IA 1DSSG 3PHIA 2X1HA 1XLTA 4WCDA 3GZNA 3G79A 4IQ0A 9LDBA 1G0NA 2GCGA 1LXCA 3FHLA 1Y9EA 4CMIB 3RUEA 2VZ9A 4CLRA 2J3JA 4OM8A 4WLNA 3UCFA 4MVJD 2P68A 3I3OA 1NAIA 3Q9UA 4XDZA 3ZU4A 2AXQA 1Z74A 4EJ0A 5KJFA 4DRYA 1PIWA 1PL6A 4IMPA 2FN7A 1Y1PA 4MVJH 4H3VA 2GPTA 1E1NA 2OZPA 5ADHA 2BELA 1LQTA 4XDYA 5K6AA 4DTIA 3WIEA 1NNUA 3S2IA 1CQIA 3I9MA 2WJPA 2X7HA 1HDOA 2RIRA 3DR3A 1KVRA 3DXFA 3E5RA 2Z1NA 4FPXA 3IAHA 2VZ0A 3K31A 4XB2A 1GYQA 5GZ1A 3QW2A 5B4UA 4CM1A 1NQTA 3F9IA 4OOFA 3QWHA 4DMMA 4NR0A 4KWIA 1NHWA 3BMQB 5FYDA 1D7OA 3E9NA 4XR9A 5IDQA 1YGYA 1BXKA 1GPJA 4ZQHA 4DPKA 4HWKA 2O48X 5AXCA 4BUCA 1MG5A 5EIOA 1MC5A 1QR6A 1SB9A 1ZXLA 1HZZA 3ZWAA 4ZVVA 3PHLA 4PG6A 1XHLA 5L40A 4YDRA 4K26A 1UR5A 2Y93A 1DB3A 4YT5A 3B1KA 1HE3A 4B4WA 3TFQA 4CV3A 3HQ4O 4Q3BA 5CEJA 2GZ3A 6LDHA 3AM4A 2V6GA 3VPGA 1GL3A 5L4NA 4G81A 5DCUA 2G5CA 2Q2VA 3UUWA 4YAKA 5L4LA 1P3DA 3HZZA 5JNLA 3VPXA 2C20A 3WFJA 2EEZA 5HS6A 5TC4A 2O23A 1T2DA 1NFQA 2PK3A 1T4BA 1A4IA 5CDUA 5JCXA 1ZK1A 3NJ4A 2DU8A 3O8QA 3IUPA 5EPOA 3M1LA 4XR4A 4WLOA 1LEHA 2VRCA 3AUSA 4TSKA 4YAEA 1GQ2A 3GK3A 1N9GB 3NT2A 1GV0A 5HTOA 1ENYA 4J4HA 3CKYA 5AVOA 3WTCA 2DUWA 3BMCB 1WNTA 2E6UX 3BMOA 5JAIA 1HE2A 3CTMA 4GVLA 5C5IA 2OP0A 5CEEA 2QIOA 4F46A 3RI3A 1N7HA 5AQ1A 2BLLA 4DQVA 1LSSA 3E03A 3K2BA 4RF2A 3T4XA 5JSFA 2P5YA 4PN3A 1KEWA 3TQHA 1DLIA 1NPTO 1FDSA 1H2BA 1Z7EA 4NH4A 1TT5A 1UUFA 3WNQA 4D42A 2JL1A 2HKIA 4OQZA 4J6FA 3GDGA 3WDSA 2VCYA 3A4VA 4Q3CA 1E7MA 1DFGA 1TLTA 1VJ1A 1UXIA 2NTVA 2Y1FA 4PLZA 4ALNA 5I7VA 2YJZA 4KDFA 1I24A 2JHFA 5ICSA 2NTNA 3PYXA 4UAGA 1U2DA 4AJIA 2O50A 5LC1A 1HWYA 1QYWA 1HL3A 3OF2A 3RBVA 2BGMA 3ZWWA 2PNFA 4MDHA 3D3EA 4ZQFA 1E6WA 1JTVA 4J1NA 2BF7A 4CUKA 1P33A 3GHYA 4ND4A 4AICA 1ZZEA 3TWOA 1PJ4A 1QLJA 1P1HA 1T2EA 2VUUA 5EESA 1PU2A 2Q50A 4IZHA 5A06A 4DMLA 4IDBA 4PVCA 2GUGA 1E6EA 1BMDA 1MUUA 1M67A 4YBZA 1NASA 1JAYA 3ONEA 1PJLA 4EEXA 1V6AA 2WD8A 4B3HA 1MA0A 3TSCA 4TRRA 4MKRA 4QECA 5TT1A 4C4OA 4AJNA 1PGOA 3ITKA 3OA2A 3CEAA 2VTDA 3PWZA 3EHEA 4YJFA 1XU9A 2CFCA 2A94A 4XQGA 1ZMTA 4JGBA 4AJHA 1SCUA 3R0IA 4ZQEA 4P4LA 1XU7A 2EIHA 3FBTA 4B4OA 4R41A 2FR1A 4KDEA 3FBGA 4NJMB 4PLVA 1AXGA 4IUYA 4YPOA 1K0UA 1DJQA 1VC2A 3HN7A 4DQXA 1NVTA 3AM3A 1AXEA 1AUPA 5G0TA 2EERA 4R69A 4DYVA 3BHIA 3RKUA 2CSUA 3D7LA 1O0SA 2FP4A 1ZK3A 2YDYA 1LSOA 3IIEA 4DYDA 1HTBA 4DVJA 1OC2A 1DC3A 4JROA 1G0OA 5AXAA 3QSGA 1HEUA 2YHIA 3WICA 4B4UA 3H7AA 5CPFA
chains in the Genus database with same CATH superfamily
1GSAA 1VE7A 4N0MA 4CGYA 1LRLA 1FC0A 2MU1A 5DNYB 2UUPA 1BE0A 1XNHA 2P9ZA 4GC5A 4CQMA 2BMFA 3EGCA 4ZAGA 2VHTA 3L8GA 3HFRA 3ZW9A 4BC0A 2GM3A 4HDSB 4S0XA 3A6PC 2W0SA 4D3DA 1Q95A 2AD5A 3LXMA 2DPHA 4MUAA 3VYSB 5T5QA 1DOHA 3QU9A 1G41A 1SZDA 2FEOA 1T25A 4OPMA 2WZDA 2FGKA 3UWMA 4M8SA 3H11B 2CNLA 4DR3B 3JQAA 4J0QA 1EVKA 1Q7RA 1L4YA 1OFUX 1RBYA 3B9QA 1Y8RA 4MWOA 5TQ2A 1DCFA 4PAGA 1ZVQA 2K2QB 5DYGA 2JGDB 3WMRA 5JCPA 1AH2A 1Q83A 1UJBA 1PV4A 3TLCA 5ICEA 3DDOA 1TYBE 2X7XA 4D0NA 4AM8A 3AHHA 5C7LO 1CQJA 4NE2A 2CDNA 2HLPA 2HLDA 1GN8A 2O05A 4K6HA 4QXPA 5E9QA 5BSUA 3SJUA 3WL5A 3DXZA 3TW8A 1X0XA 2FVXA 2HREA 5THXA 2IH2A 3E4DA 1H66A 2H7XA 4U9UA 2WP8J 2P91A 1BKDR 3FOWA 4I5DA 3FKQA 2ZR7A 2RHWA 1YQ9A 5JANA 1HOXA 2O8BB 3WLJA 1ZI9A 1AK1A 1IG3A 2QP3A 3B3GA 2NZ2A 2ZUTA 1QIIA 4AKTA 1WCWA 2GSDA 4LXGA 5DN6D 9ATCA 4WXYB 4ZA2A 2DE0X 1NW4A 4EB0A 1D1SA 3NCTA 1W5EA 3ZU5A 3UW1A 2Q6OA 3HFGA 4S2UA 4DEXA 1KF0A 1M2VA 4YCBA 2EYUA 2M9MA 3NIBA 5EKXA 4NCNA 4LE0A 2OBBA 1NTOA 2UZ3A 5HZGA 4RD4A 4U6SA 1J22A 1CQJB 2WV9A 4HFNA 1NVVR 4P0TA 4YRDA 4TSRA 2WW8A 1B43A 3OP4A 4U5XA 2HMSA 3FZNA 1GUDA 2X9GA 3I6BA 4MZDA 3HXLA 4XFDA 4KIWA 3FOAA 3PG5A 2DPMA 4QPJC 1XWFA 4BNDB 4YRGA 1T8RA 2DH5A 2YWJA 1H22A 3WS7A 2QVXX 4CMKA 3NIWA 1GTL1 1GFIA 4I6JA 1N2XA 4GD3Q 4J7XA 4ZVPA 5JARA 4H6VA 2F55A 2YC4C 1BD3A 2ZS8A 1DBVO 2A0XA 3Q15C 1P72A 4RCYA 4RU1A 3CLKA 2I66A 2HHHB 4DLSA 4LRWA 4P5DA 2XT9A 1TRKA 5E7QA 2WMYA 1UMBB 1ZKMA 4YMTA 1XUOA 5KTOA 3AR2A 2A7QA 2A86A 1UWKA 2FP3A 3NYQA 3GAFA 2DJIA 1BSVA 1QGED 2X9VA 5B1SA 3E0XA 4Z4GA 4MRVA 1SPBS 3ANTA 1RLJA 1HFWA 3HB5X 1EKXA 2DSTA 2O2JA 3EH2A 5CDHA 3MCVA 5BOVA 1HEIA 4G0QA 4JYZA 3LSYA 4JHLA 5T41A 3T7KA 4DV6B 2P30A 3L84A 4PLCA 3GY0A 4E30A 4ER7A 3UIEA 4Z9FA 2VCEA 5D5HA 1MOQA 3EPJA 2A0YA 2JCSA 2Q62A 3IQWA 4C4YA 3GRPA 4B3BA 3JQ8A 1DXYA 2YIDA 2OHFA 1G20A 2NYUA 2DQSA 3OFSA 4E22A 4DN6A 5F98A 1YGPA 1GITA 4O33A 3JATA 5LMNB 3A9RA 4I6EA 3GGJA 1YU9A 4ND1A 3LZDA 1Z6ZA 2DPGA 3U2QA 3A9SA 3EFBA 4NBLA 3E23A 2O57A 5HILA 1ESDA 4L9AA 2FSVC 4L8LA 1B1CA 1IBRA 4ALJA 1AQLA 2XF8A 5JBNA 1X7XB 2D0PB 2NXCA 2VDWB 1KZ9A 1M34B 1VCIA 4ACAA 4E2WA 1J2EA 4PSDA 4LF5B 3RC8A 4IDHA 2XYHA 2WZBA 3ORYA 521PA 4X1KA 1AB6A 2YQ4A 2UYYA 3AEKA 4BFWA 5I4IA 2WYHA 2ZB7A 3UHAA 1ELOA 3FIUA 1CZOA 2JI4A 3WGYA 4AUKA 2ZZKA 2QM7A 1I5EA 1Y7IA 3KEGA 4GMKA 3PPIA 3HLYA 1KR2A 1SNYA 1EUCA 2HSEA 3EEYA 3W78A 5I51A 3FOFC 1T6ZA 2TMKA 1BOOA 3UO8B 4UUOA 3OWOA 1OD6A 3OUUA 2PUFA 3VR5A 3U4AA 4RMGA 3C3JA 3S2SA 2IV7A 3NI2A 5COQA 3T7TA 3V9AA 1ABEA 1N9KA 1R9JA 4ZGWA 2QZJA 5BWMA 2ZI6A 2ZK7A 1QFSA 4ISCA 5T3YA 4HO1X 3U26A 2IL1A 3LNCA 1CY6A 4KQJA 3WRYA 3PPVA 5IFLA 1W47A 4LTMA 3DM9B 4WBSA 5JCOA 3RKRA 2C7QA 4I3GA 2ID4A 1RWOA 3KTDA 3QVJA 1USUA 2VNKA 4ZU1X 2GXAA 3LBYA 5ILGA 4D8XA 3BGVA 2IH4A 1TMKA 1PNRA 1C7QA 1SVSA 1CEQA 3REQB 5A4MS 2P2LA 3P0JA 1G3RA 5KZMB 1RNLA 1JBEA 2R8RA 4X7RA 2WV7A 3N9IA 3VHXB 2QUJA 1MB3A 4KK3A 5F7ZA 1G8HA 4WESB 3EW7A 3UFXB 1E2NA 2DHCA 2IPLA 2VOJA 4Q1CA 1US8A 1C0LA 4UBMA 1S02A 5ALOA 1OZFA 2RGGA 4LWPA 3T0GA 2NGRA 3EA4A 1MBZA 1C7JA 1P77A 1U1GA 1X3SA 5CVEA 3V1NA 5HA5A 4Y9TA 3TZLA 1Q15A 4B7XA 1NBIA 2AXEA 2CLMB 2VNSA 4V0LA 4MQEA 5C4GB 4Z5XA 3GLGB 2ZBEA 4JLKA 2I4OA 1IULA 3ZVKA 3DEYX 3B1XA 5BR1A 5I9LA 2EIXA 3AHGA 2NOAA 2DWPA 4MS3A 4V0NA 4C2BA 1N2ZA 5DHPA 3TCNA 3VV2A 5KU1A 3G2MA 1CEYA 3BILA 5CFLA 2F8SA 3HCWA 4QRHA 4I1VA 1W4RA 4TXNA 4XJTA 3Q8MA 3EQ8A 1CQIB 1D4OA 1MU0A 4OP1A 4R6WA 4QZVA 3ED1A 4QDTA 3UC5A 2FPPB 2E49A 4GMDA 1K63A 4OP2A 2IYZA 1OYWA 2WHQA 1P0FA 3HJUA 2DC1A 3F8WA 5EJ6A 4JU8A 2A4KA 4KJZA 3R0VA 4H0FA 1H0HA 3IQXA 1B8PA 4Q7KA 5DU2A 1X13A 3JYLA 3V6MA 4A3SA 2REQB 4D0LB 4GM0A 2BKLA 3DXYA 5LNK1 4EH1A 1E62A 1KH3A 2H51A 4PINA 4DAOA 5IJAA 1OTHA 5LU8A 2FP4B 3M5CA 5CXUA 1EWYA 3ICWA 2XCQA 1SVUA 1VL6A 3CKMA 1WY5A 2V55B 4EJ6A 2ZJ3A 2YYAA 3BFJA 1M33A 4UCFA 4HH4A 4ZYLA 3CNBA 1VDMA 3L4JA 4BKUA 5G02A 2PXAA 1Z15A 1C80A 3GYBA 1PR1A 2ZRGA 1USWA 3AUUA 3DFZA 3L46A 3O83A 3QQ5A 1LI7A 4LDQA 1A3CA 5DCWA 5C34B 4JEMA 2IIQA 3BJEA 2QYOA 3DH0A 1QB8A 1HSZA 4KGDA 3PDIA 2JI7A 1Y3HA 5IHPA 2AWNA 2M32A 4PFSA 5L51A 3CLTC 3A10A 3SX2A 1NUUA 2VF8A 3OIUA 4LMAA 1VLVA 3HEBA 4NAUA 1QC5B 4HVAA 1NNSA 2XNCA 1OFIA 1SVKA 4D3ZA 4EJSC 3P9RA 4NIMA 3KALA 4OQYA 4KAAA 4NQZA 1SUPA 1T91A 4DM7A 4RKRA 1OREA 1VE6A 2MOKA 2CJWA 3QUBA 5HF9A 2ZTHA 4B33A 2MJLA 1OQAA 3FR7A 4O4JF 3GVXA 4OCZA 1ZOPA 4RHFA 3W8NA 3TL3A 3COSA 3FLAA 4C7JA 2A8YA 2QGZA 3CPJB 4XD7D 3EC2A 4J9VA 4DHWA 2UXCB 2JZNA 3SR3A 4W9MC 1CQPA 4B7UA 4QLOA 4RD1A 3MMPA 3AEXA 1O6CA 5HIAA 2NUBA 2YKGA 1MAAA 2FMFA 2C42A 4QRIA 3IC5A 1JSCA 3PV0A 3H2SA 4JWTA 4TZ6A 4DZTA 5L3ZA 5JCOC 4AJ2A 2V7VA 1UAAA 1U8EA 1T34A 1ILEA 3G7UA 2FR8A 4LZWA 4Q18A 2GRUA 3A6KA 1CP3A 4XWOA 4H1VA 3WNBA 4PSVA 3NT4A 3STYA 5JDIC 3HYRA 1AKQA 5IK2A 4CQMB 2WWFA 1J2RA 2Z8YM 3LQYA 4C1BA 4BUJA 3DG9A 5EKDA 1PJTA 3KDPA 1JYFA 2BFFB 1ZRNA 4RIIA 1E8DA 1FYDA 3CMCO 1S01A 2P4SA 5DLQC 2FOLA 4REOA 3MJSA 2ZXEA 4KVFA 1ACLA 4O2AB 4GR4A 1IXSB 3CC8A 1P60A 3NXSA 4BVAA 4JLDA 4HQKA 1E5LA 1QX4A 4R8RA 3T8YA 3Q9LA 3EZXA 4HYYA 4QPZA 5AJWA 4DLXA 1W4AA 3CRVA 3MQ2A 4F1WA 2Q2WA 1HNWB 2GPYA 3NZEA 1T3GA 4KX5A 4CNQA 1WW3A 3DVAB 1K7CA 2CVQA 4C88A 3U16A 2ZBQA 1LPOA 3QE9Y 5L4SA 2ATVA 1Z62A 2ZVDA 4GLJA 4XUEA 5JXJA 3ONDA 1TMGE 5FFMA 5BOSB 3WWPA 4BP3A 4EHJA 5EMKA 1HF3A 5EKTA 4CEJA 1YB6A 2QTHA 3CT6A 1JPVA 4TV8A 1Z2OX 2FI1A 3H5VA 3W8FA 5CUQA 5KPDA 3PLAE 1YQQA 1F1JA 3CUSA 1KRXA 5J47A 2HGZA 5ILQA 1KDPA 4QT0A 4G97A 1CUYA 1L0BA 2IYAA 4L8FA 2VYCA 4GR9A 3EEFA 1FDVA 2VUHB 4KN9S 2HEGA 3OCCA 4FHFA 3SSNA 1TA9A 1TU4A 4QREA 3T38A 1D8AA 2EQ5A 1RLUA 3B2EA 3H86A 2PT7A 1FYEA 1GQSA 4GSLA 3B51X 2PGDA 1LU9A 2PM8A 1QRRA 3MGBA 1Z6GA 2VJMB 5EEGA 3U3JA 5DK6A 3K8ZA 1RM0A 2ZUUA 3GLVA 4BO3A 4HVCA 2NVOA 5K20A 2X5JO 4B43A 4KPUB 5FUXA 3W9UA 3L49A 5JFOA 2R1TB 3FOCA 4RIEA 5BR8B 2HD4A 4FFLA 3FVQA 1I2CA 2AE2A 1SG0A 2VDMB 3VZCA 3F3KA 3KYCB 4D1YA 2XQGA 2YWXA 1GKIA 1GGKA 3OPQA 5H82A 2OA0A 3M4XA 1PT5A 4TVOA 3NOQA 1K1EA 1BRMA 3DS8A 4C1NA 2A30A 3RASA 1NKTA 4Z4QA 4RA9A 4WZ6A 2GWRA 1KA9H 4D3FA 4ZPJA 1G291 2IIVA 4DB2A 3MC1A 4D4MA 5ALGA 1TIBA 1WPRA 2WB4A 3FNHA 1IRXA 3CFYA 2ZW9A 4A2PA 5THKA 4E5PA 5ALHA 3AL2A 2YS7A 5IZCC 1UOPA 3DTNA 2QENA 3ZD8A 3SKVA 1ZGCA 5JTUA 3DE3X 3R7AA 3A1WA 1U90A 1R4ZA 2CXRA 2Y1WA 1B4DA 4ZVTA 5LP1A 4FDUA 4EY4A 5KJ6A 4YAIA 3NHRA 2JATA 3WZLA 1BA3A 2OV3A 4ECAA 1W6UA 3EB9A 3JR7A 4M88A 3PUYA 3JY6A 2W42A 3ZIUA 2BR5A 3BF7A 4LV8B 3QELB 1MW9X 1SGWA 1WPXA 4QBIA 5FHQA 1JDBB 1Q1QA 3EXFB 4HDKA 3TZEA 2CMFA 2BE9A 2JJ8A 1XZLA 3VVLA 4F5WA 2VWQA 1YZTA 2A0WA 2Y1GA 4TM8A 2D5LA 3DDHA 1X9GA 4FR5A 4I5IA 1AKRA 4WT7A 4GKKB 3LQ4A 1P2FA 3T3IA 4E46A 3F49S 1UXHA 2XUPA 2ZUFA 3H2JA 3TLYA 2WR8A 4JB2A 3TAXA 1NXPA 1TO1E 2JD1A 5AHXA 1GRVA 4DCVA 4CTNA 4OFBA 3GVHA 3KXDA 4ZZIA 4GDFA 3D0QA 3UT5B 3I34X 3THYB 1L5FA 3O6VA 1M10A 3C87A 2BBOA 2AEEA 3K9GA 4YCJA 3SYNA 5KVQA 3VHXA 2QQ0A 3WTBA 5KUTA 4KPEC 1XALA 4CM4A 2Z1MA 3P9IA 4BVHA 2QN6A 4DLBA 4G1UC 2OC9A 1AKVA 4MYUA 1ZHOA 4O8CA 5DX0A 4ZI3A 1DIGA 1KHTA 1GP2A 1Z22A 4IXNA 4MWBA 4CM6A 1R88A 4LJ9A 1SELA 4MQLA 4UVEA 6Q21A 5FOTA 5AVVA 1KJ8A 5CA0F 1G3MA 4BAZA 4HDMB 2V4UA 2P11A 1VFNA 1F4LA 3R2JA 4B9AA 1T2UA 5CBPA 3BXEA 3HUTA 4MUEA 3U7HB 1ZCJA 5HZKA 3PEEA 1C1HA 3JZMA 1PTKA 1SIWA 4ZGGA 1EGVB 1D5WA 1Q44A 1VJCA 1PEYA 2XX3A 1CS0B 3NALA 1HLGA 3M3PA 1A8HA 2JANA 1YIOA 3PXXA 1GCOA 2GBLA 3O8OA 1LRJA 4TLEA 4EGJA 4XIFA 1E2KA 1PX2A 3DT6A 2BE7A 2C78A 3KPVA 2I7TA 4L6AA 1KOFA 2WICA 4PM4A 4R7TA 5FA6A 4LOAA 4EO9A 1GTZA 5TF0A 2KLHA 1X19A 3SHWA 2ZDGA 3QH4A 2VXYA 3NFRA 4K1LA 3EMDA 4ZK6A 2WMNB 1ZIXA 4F7WA 1CS0A 2EL9A 2Z8YA 3H16A 4WJZA 4PQEA 5AKJA 1M9NA 2I2AA 4LC0A 2VSNA 4UJ5A 4B6RA 4CKBB 1FDIA 3ZU2A 5EHZA 3F4BA 4CLEA 1SXJC 1KI7A 2X14A 3KUCA 3V7WA 4NE7A 2HWYA 2O2EA 2AJLI 3HA3A 5EWJA 3MOGA 3P26A 2XTAA 2P75A 1GQOA 1E1YA 3GRCA 2PTHA 1U6JA 1D6SA 1XTTA 1BFKA 3H0CA 1G3IA 3Q11A 4DLKA 1N32B 2RC5A 2Z2YA 1M2OB 1Z37A 3QF7A 3K5IA 4I5FA 3DZIA 3PJGA 3P9CA 4II3A 4WDQA 2Z6VA 2PUJA 5CH3A 3VDQA 5CBKA 2WINI 1SIUA 3COZA 1B3BA 5JCZA 1AUVA 3V2HA 3KD3A 2TMGA 2VIIA 3AVQA 1QQTA 2VT7A 5I9BA 4B3JA 5ALQA 3KSMA 4AZ0A 3H8WA 4MW5A 2BT4A 3WRVA 3OZEA 1GZ4A 2Z09A 3GAMA 2VK2A 1X1QA 1Z7BA 5IBRA 2P79A 5FWXB 4WPGA 3B20A 3PUJA 4MGHA 3AVXA 2PGJA 2Z2JA 2G76A 2HK8A 4RZ2A 2PJZA 1P73A 3PSHA 1O87A 4X95A 1VSQA 5LXTF 5LZ9A 4I9UA 4Z0HO 4FXPA 1NQVA 2QYTA 2EG5A 1UBMS 2AHOA 3D8TA 1XAHA 4LRTB 1ZJ4A 2GX6A 2O2CA 2QVLA 4O4LB 4TX1A 3WHKA 3OJEA 4CF6A 3UMGA 2LE0A 1NLZA 3TRIA 4B3TB 4ZQIA 4BNJA 3NIGB 4IHJF 3DMGA 4YONB 5ADVA 1KPIA 2QV0A 3U44B 1SCDA 4BO7A 1XTRA 1IVSA 4G0WA 3MTIA 1E7WA 2UZIR 2Y0BA 3JALB 1DBPA 2Y1OA 2Z8XA 5LYJB 2JBAB 1REQB 5DYYA 4D9EA 1XTPA 3I52A 3R1IA 4KQ6A 4DA4A 3H4TA 1BGXT 2R6AA 1PR5A 4UFNA 2CW5A 2DR3A 3TXXA 3TJRA 1PV1A 1L8QA 1SRQA 1WMSA 2INGX 3F67A 3K5WA 1B2RA 3LQQA 3QHPA 4G0YA 3OT5A 5DYIA 5AVJA 5LYJA 4HT3B 3MD9A 2V8OA 2GHIA 4BEJA 2BKUA 3C6MA 5I7OA 5EIFA 1N6IA 2ROQA 4I9HA 4D26A 1EXVA 4NMWA 2XGJA 3GJ8A 4C0XA 3BIWA 1BXZA 2XT0A 2G4VA 3O73A 5CAEA 2X41A 2SCUA 3KPYA 3OPXA 1NMZA 1S2GA 2E4ZA 5GINE 5DGHA 5IC5A 1PFWA 1ZA2A 4UJ3A 4A9AA 1H4VB 4NMHA 1V8PA 2MSCB 5ARCA 2O19A 2PSEA 1K98A 4RJ2A 4X6XA 5EHIA 5BSRA 3V7YA 1SHLA 3BMQA 4KPGA 4QOJA 2EW8A 5K3AA 5HXAA 3WGIA 1XTSA 4L1KA 2EFJA 4P2GA 1K7FB 4HK4A 2NSLA 1AZLA 1GT6A 3JWJA 5BW6B 4CODB 4N48A 2WIJA 3PC3A 5HQ3B 3P5BA 1A1SA 3CYFA 2AMLA 4QATA 1OASA 4PBSA 2VBCA 3VR6A 4KL8S 5K45A 1WHSA 1NX9A 2Z5LA 1K8XB 2Q3BA 1XJQA 1WCIA 3K1ZA 3PE4A 4BMSA 4QFDA 5JZSA 4EA7A 5FD8A 1DWUA 4X8OA 1H85A 1W2GA 2BGUA 4FDTA 4KBGA 3A4TA 5BUCA 1NI3A 5D1HA 1LQUA 1GPNA 4TWBA 3FPAA 3QOYA 1FTNA 2ZG6A 1MB9A 1ZUNA 2ZEJA 4OF4A 1EK6A 4C22A 1BS1A 4WA8A 4D8WA 1JJIA 3IUEA 5FL7D 2O8FA 3BZWA 3JARA 5FUQA 2P9FA 3KEOA 2XNJA 1M0EA 5CJJA 1RJEA 5CM2Z 1KO7A 3IE1A 1WVGA 4HNHA 4L4UA 2QJTA 1YCGA 2D5BA 2QZSA 4HPWA 2C03A 3FCCA 2XPCA 4NCIA 4EKDA 2IBMA 1Q0SA 4NFHA 1G7RA 1LW6E 1ZN7A 3E05A 1BGWA 3VZPA 4BO9A 4PYQA 4OSEA 5AVRA 4LRSB 2E1RA 2G1AA 4X20B 5B1HA 4BV3A 3BTOA 1UMKA 1KTVA 3UWSA 3EOZA 2GS9A 3GLSA 4E4YA 4JITA 4CUZA 5JOQA 2OHJA 1TTQB 3QSYA 1Y1RA 4MWGA 3NC1C 2CUTA 4RK0A 2QK4A 5EAIA 7YASA 1GA1A 1E2BA 3H1FA 4Y2RA 1PQPA 4BX2A 4GI5A 5JFGA 3WK5A 2E4VA 2D00A 1N8NA 4F4UA 1O6FA 1QCZA 4C4AA 3R44A 3AI7A 4DWWA 4TMZA 1PBTA 3U4GA 2IYFA 1NBOA 3EJWA 1QU3A 2I8LA 2JFPA 2II6A 2X0NA 5ALRA 3ZBPA 2PJUA 3WWZA 1BE1A 2ZRJA 4I5GA 4IIUA 1CYDA 1Q7GA 2VP4A 4FYYA 4LNUB 2OBXA 3OPYI 2BI7A 1CVRA 2AF4C 1VRCA 3GNTA 1U81A 3KOUA 3PEFA 2LCFA 4HH3C 3EFOA 4O4IF 3R5JA 4RDXA 2F1OA 1JEYA 3M2TA 4EG4A 1GPWB 3NEYA 4Y1RA 4G5OA 3PVSA 2F9LA 4XM2A 1XZQA 2PMEA 2OOKA 5K6AC 4CG1A 3H3XA 4MVJM 1PWYE 2NT4A 5EJFA 1WE2A 4EPWA 3GPCA 1J8YF 1AD2A 4FTWA 3GLHB 5EUCA 3FCUB 4MV8A 2G67A 1OR8A 4Y9SA 2NSDA 2A58A 3DT9A 1ESZA 3ZVMA 3FWYA 1DAKA 5GONF 4COOA 3OSUA 3BL5A 3IUBA 3ZGOA 3M81A 2VDKB 3CUTA 3K1TA 5IBPA 1JQ3A 4NV1A 3PNBA 4IDFA 3DZGA 4TTVA 2J6CA 3FMPB 3JAWA 1O94D 3EVGA 4G0PA 1I2AA 2XEXA 3AETB 4ZTBA 1J6UA 2BP7A 3OKFA 4C6TB 7GPBA 3FRJA 3K32A 3BXXA 2J0UB 2MYPA 1JB9A 3KWJA 1HOTA 1AN9A 3Q5DA 1U9IA 3ZCTA 5KNLA 1RJFA 3QPCA 5ECWA 5KOJA 5I7FA 1N4DA 2VAPA 4GGPA 4YK7A 5G1PA 4KLZA 3E8MA 1ZHFA 4FEYA 3OFJA 5JYBA 2PKCA 2YINC 1Z13A 3HBFA 2QSUA 1KMHB 3V46A 4ZYZA 1YZVA 2C8LA 4P4SB 4XGKA 3EGDB 5L9AA 4FM9A 2PBFA 3PGJA 4KR2A 5IEJA 3KO8A 2FUEA 1FLAA 3HV0A 3QA9A 1EVIA 2G40A 2XDYA 2ZB8A 1ZNXA 1XR3A 1JFFB 2HRBA 5B64A 3HRKA 1KY2A 3O9VA 4GUAA 3KKQA 3L07A 2VTBB 1B0ZA 2NLOA 4P5EA 1A71A 3QI7A 4CT4B 5KX5A 3VHLB 3WGVA 2WZCA 3EGDA 3S2UA 3W8DA 2ZVPX 3CUVA 2IU0A 1BXGA 2IVFA 3OKCA 1Z0ZA 4KE7A 3F74A 2ODBA 3SC4A 2GRAA 3EK2A 3A1NA 1E58A 1TZCA 4JLUA 1F0YA 1N3IA 3TIXB 2RMKA 3ADDA 3OJFA 4G65A 4DV3B 2Z3WA 3NAMA 1KYQA 4FOTA 5D8DA 5EE1A 4NDZA 1G7SA 5J2UA 3QLUC 2KLBA 2I54A 1MB4A 4JNKA 4JVMA 3KP1A 4QOEA 3DZCA 4QYIB 1KQGA 4Q9IA 1HK7A 1CKEA 2SICE 3QEMA 4QO8A 4YWJA 3C5WP 4AJEA 4LXTA 3B36A 2JH9A 4IW3B 5AJTA 1WWKA 1XEAA 1I94B 4O5OA 3NUQA 3W5UA 1A5ZA 4DM4A 4FYKA 4FK8A 1VKZA 4BCDA 1PN3A 1T1IA 1ULUA 4GMXA 4HTFA 4OJTA 1ZGHA 2OZLA 3IAM1 3KYIB 3LFUA 3QVXA 4OJNA 4WZBE 4DC0A 3QEOA 3I92A 3NC0C 4YJHA 3LPDA 5J4YA 2H16A 4TVSA 4EKEA 1QNFA 2OB1A 2WY2D 4CL8A 2JVJA 3U7EB 1YRQA 3WIBA 3G6WA 4GM1A 4KQXA 1H1DA 1N2IA 1O9BA 1SOWA 2JB9A 3CSSA 2JLBA 1C9KA 2I2FA 4BE4A 2ZWPA 4JUCA 4DCMA 4E5DA 1JR2A 1K5HA 1H4TA 3BB3A 2CZQA 1KK1A 4ARBA 4C0KA 1TNDA 1T8YA 1IWOA 4MP3A 1UAGA 1KTIA 4JJKA 1ZXBA 1FRNA 4WUTA 3WKAA 4S1NA 5F1KA 1GCAA 3TF5A 4IG4A 5JROA 1N9GA 4XD2A 4EQ6A 1U3FA 4I4LA 2A5JA 5JJLA 3QXJA 3ZZ1A 3ZHOA 5DB4A 5AM0A 2B83A 4GI1A 4G4GA 4YTEA 1KFBB 5F3RA 4A2QA 4MLPA 2ZPAA 4BQPA 1V9SA 4LF9B 4AI6A 3W5SA 3MJCA 5A4IS 2VP0A 1U1FA 3E3OA 4EX7A 2I22A 1KHHA 3TDKA 3K9FC 3W2GA 4YX9A 1V1MA 1NHGA 3BWEA 4I1RA 1NVAA 2JBHA 5FBZA 3UAVA 3UOWA 3EVCA 4W8OA 4MVJF 4Y8VA 2ZYSA 1L2TA 2QE7D 2Q2OA 4PSCA 5DYWA 2B8NA 3MUFA 2PWBA 4KH1A 4OXKA 4Y6OA 2B1QA 3RFXA 3ZJUA 1I7QB 2QRVB 3TLKA 1Q17A 2GN1A 4Y18A 1UT5A 3FPBA 5A6SB 3DLBA 2IRWA 2PKXA 3K0KA 3KKKA 4L5BA 4MUXA 3S70A 4NBTA 4XVHA 1QIKA 5I8WA 1UKBA 2JVIA 2R8YA 2WYIA 5GP1A 4YQYA 3HN6A 1RPZA 5IAEA 4FNOA 3UAWA 2YMLA 3U31A 4X3PA 1ORTA 1C8VB 3FPLA 2IXBA 1E5QA 4UEOA 4Z1MA 4AURA 4Q7JB 4YCDA 4OGKA 1P2VA 3RFUA 3U44A 2XUQA 1UXOA 2O6LA 4TN5A 4TV9A 3TJMA 2FFHA 3STTA 3X1KA 4I99A 1G9XA 2WKRA 1TIPA 2YC2C 4J0IA 1Q1BA 5COBA 3G0GA 3UK1A 4ZXPA 1R7RA 1M1ZA 1A7UA 2HQOA 4U7WA 3SHFA 2RAPA 4O59O 4NLLA 1KJ9A 5CK5A 3OBBA 3H9BA 1TUBA 4B6SA 3FH0A 1NFFA 4JOBA 4PWZA 4WXEA 3SS8A 4EECA 3TL2A 2GCEA 3M7IA 1DBRA 3ZWMA 2UYOA 2D1QA 4OKSA 4UNPA 2C3PA 4MK4A 2I6SA 3RS2A 3RUFA 5LQMA 1R4MB 3KQHA 5EHXA 2NMVA 3EMKA 1ZQ1A 3QKUA 1U2GC 3KXPA 1W49A 1KO8A 1ZA1A 2JCBA 1K0FA 2M6RA 1F2UB 3T5MA 1NPYA 1S6YA 1V7QA 1YVPA 1HLPA 3EIHA 3DBLB 2PKWA 2QUIA 2X3YA 4EKGA 3AINA 2DWUA 4GP9A 4PGFA 5F2EA 4NDNE 4FW8A 4Q1FA 1YFLA 3WKEA 3KJZA 4P4NA 3PIDA 2PZKA 2FPPA 1RRMA 3NONA 1TE2A 1T4GA 3I9JA 1HDZA 1NC3A 3AY0A 3B48A 3MYYA 4B5LA 5IXJA 3DZFA 2OTCA 1G20E 2JI8A 1NQ5A 4YRBA 1UMCB 1G5HA 1EP9A 2Q1UA 4RQUA 4M0EA 2AR7A 2PSDA 3DEIA 4LX8A 5HZMA 3PTLA 5E6SB 2VBGA 4KIGA 4U1RA 1NJ2A 3RE1A 2DMRA 4ER6A 1FE8A 5ARBA 2YDXA 2QTFA 1GCGA 3QI2A 4O1IA 1P2GA 2HXSA 4NEQA 3KVOA 2P1ZA 4Q24A 2JIZA 2R47A 4I9FA 2CLKB 4E4TA 3PXUA 4EDFA 3GLIA 1Z7WA 2OD7A 3O75A 4LKOA 5DZSA 2CE2X 2M6LA 4CI9A 3QV2A 1S8NA 1Z82A 4DT1B 1NT2A 4HN9A 1DBIA 3WV5A 2VO1A 3BZBA 3GGCA 4MRAA 5AVQA 3F6EX 3LLSA 4G4IA 4W7SA 5GM2A 1XTIA 2DBYA 2XUHA 4I1IA 2QMUA 5UKDA 4S1TA 4FCVA 5EQTA 2WMOB 4NK4A 4D9MA 3QJGA 2GGSA 4Y6GB 2B82A 4LEIA 1JECA 1DQYA 1JAIA 3GPDG 3JQFA 1ZMOA 2WF9A 1JHQA 3AHFA 3S6JA 1L7RA 4M0CA 1YULA 1M5UA 4FBMA 4JC8A 3VNAA 1TF7A 1WX1A 3D8RA 1NE7A 3ZY4A 4RTLA 2ENWA 2P78A 4MPDA 1CRPA 2QUZA 2IK8A 4KAFA 4TTRA 1UPCA 1GRRA 1Z6XA 1DUVG 2WP0A 4DAEA 3BGOS 1JR6A 4S1OA 3FDZB 1B6TA 2IA5A 2HU5A 5JNUA 1BE8A 4BB5A 2D0DA 3GDOA 4UKDA 4CR7A 4RZSA 3ZWXA 5CB8A 5HK9A 2F9FA 1MAVA 4M6WB 1P5FA 3NAGA 4NC9A 2EKQA 1QTIA 2CMDA 2DJ5A 2GEKA 2V7PA 3H9QA 3M6UA 4RVSA 4BB9A 1Q1NA 1YJAA 2CYCA 3IIMA 3GEEA 4FILA 3GNQA 3DBHB 3I04A 2FQXA 1RMTA 1V43A 1JE1A 4GPIB 3EQ6A 3DO5A 1M1UA 3T5AA 3P19A 1YL6A 5KOHB 1Q0TA 4PTZA 3KSBC 1TC2A 2NX2A 1GPLA 3GMTA 3KR9A 4C3UA 2FN3A 2VWHA 4B3CA 1W25A 1VJDA 1IY8A 4WK4B 4R2MA 1GFSA 2CNWD 2A1UB 2H9IA 3PJEA 4JUAA 4N5NA 4OXYA 4M1QA 3ZHSA 3ODPA 5I45A 4HJXA 1JKJA 1PG5A 1H65A 1NL3A 2QPLA 1LK7A 5BRNA 3UB4A 4OYHA 2RE8A 1YQTA 2JAOA 4M54A 3R8FA 3HMKA 5GJVC 1E2DA 5TQ2B 4XD7A 1QF7A 3HJGA 2IEGA 4R3WA 1MVNA 3GX1A 2KX7A 3P2JA 2D5AA 2H0RA 5F78A 1TA0A 2QYHA 4LDPA 5E8JA 3Q7TA 2VTKA 2BFFA 5IASA 4FGJA 1W52X 3L1KA 4CLDA 1YFKA 3DF9A 2VQ3A 3KWFA 2ZCJA 1XJ0A 2QRLA 3CW2A 3F4LA 4O2BB 4ZOEA 2G1PA 3U3XA 5NLLA 2EX4A 4BASA 1FYVA 4E07A 1Y7PA 3AB3A 3FVWA 2A14A 3GOHA 4XI9A 2ZRFA 4LTDA 4XCVA 5D84A 5G0UA 2JJ1D 4F7DA 3DKKA 2O7SA 4D6YA 3FTNA 3O93A 3I2HA 4D56A 1OOEA 3LRTA 2OZKA 3GUHA 3H18A 4FZVA 2YYYA 1ULHA 3QW4B 3CA8A 2COUA 2E9SA 3OVMA 1DAHA 4QU8A 5KWIA 3OJWA 4L28A 4TL9A 2R62A 3DTVB 1USIA 5FPPA 2V7QA 4BO0A 4BNLA 4DSUA 1JQEA 2J45A 3L6RA 4F71A 1W9MA 3EWSA 3GGSA 5EMHA 1W96A 1MMFB 3F7TA 4DMLA 3M6WA 3EUAA 4IQ4A 4DANA 1TTHA 3O2QB 3QKRA 2QX6A 4C4RA 4L4SA 5JBIA 4KI7A 1I36A 1FX0B 3EW9A 4URYR 2VZLA 4WOKA 4PYRA 4ID3A 5AP9A 4DFDA 2EL7A 3OLZA 4G0MA 4OIFA 3ZWVA 5KTNA 3OIWA 4BEWA 4TPKA 4HTAA 1LDYA 2AMYA 5A7HA 1XQXA 3RFTA 1XMQB 1L5WA 1VHQA 2VUTA 1J8MF 4KO3S 2I3DA 5T4BA 3THRA 4BVGA 2OBFA 3N3AC 1E3DA 2I71A 3RYFA 5I7RA 2WWWA 5DRYA 4ZK2A 1KH1A 4MW2A 2WG1A 1YS2X 1U6IA 4WXPA 1I33A 3UAOA 2PUWA 5ESWA 3EY4A 1G18A 1S96A 2C4TA 5C1BA 4BDSA 2G5TA 3L8ZA 3EIFA 5CCDA 1CB7A 3GVCA 1V5WA 1H2WA 2VQDA 5JYEA 3M6MD 3IXMA 4HAYA 4A0QA 4A7PA 3ZHTA 4LNHA 1JKXA 4R2WA 2GETA 4URHA 1SBQA 2TMYA 1AGPA 3PX3A 2MCFA 4JXZA 2BTQA 1I3MA 1X1DA 3KT6A 3OTIA 4YJGA 1LB1B 4RTPA 1Y89A 2A5GA 1CDEA 4RBNA 4X1YB 2GN2A 4J91A 2ESRA 3VJKA 4IHKA 1NFRA 4D80A 1W73A 2PEZA 2WT8A 3EOAI 4RH1A 3LO5A 4G37A 4JJEA 5HMMA 3ROXA 3WB2A 3I1JA 3MT7A 5EZSA 4YCSA 2PJDA 3PXBA 3EA0A 3RTBA 3SZLA 4PXAA 4DOMA 5T3UA 4OLAA 2KWIA 3KOWA 1DIRA 1VHWA 5I01A 2AQKA 3V97A 4ACBA 3AR6A 4IUBS 1PUIA 5GOZA 1PGPA 1OWPA 3RVRA 1FA9A 1N75A 2WJYA 2JFWA 2OHOA 3G7NA 1R0CA 3EIOA 2ZUCA 3HO6A 3K0BA 5E2IA 1QHHB 4MPRA 1GPH1 3T06B 3TDNA 4F21A 4TL6A 1NKVA 2JFHA 1JS1X 4QE3A 4EMUA 3ZX4A 4HDQB 5DULA 5DLPA 3V34A 1DRJA 2B7BA 2CXTA 2HJ9A 3NAQA 4MROA 1KQ3A 1Y1QA 3SXUA 2X76A 3U3KA 1EXDA 3ZHUA 1OXMA 4MKXA 2PN1A 5JS6A 1WF3A 2AUNA 3IP5A 3OOEA 1NZDA 3NANA 3BXPA 4Y1GA 3IQZA 3L1JA 2NTJA 2JFVA 1Z17A 1OJLA 3AVWA 1DEHA 3ADPA 1Z2PX 3L0SA 1P17A 4QBGB 3G23A 2K6GA 2E4XA 1FU4A 2NU6B 3B1JA 2VF7A 2UAGA 3H1PA 1G6OA 1KEVA 2B2CA 2GFQA 1BVHA 2P4QA 3LUHA 2HA3A 1AURA 3FTDA 3OT1B 3QVLA 4C87A 3PYMA 5FKJA 5LR6A 3DV0A 4G8JA 2FYTA 5CDFE 2VPTA 4BYGA 2QRPA 4HQRA 1G5QA 3R3SA 4QDUA 1AK9A 5IT0A 1APBA 2X13A 2XJ9A 2CJXA 4QWWA 1CUWA 3QX3A 4RAOA 1I51A 2BFEB 3OE7D 1XRRA 3RPEA 3L4BC 2P1DA 2O7NA 4QTYA 1DCMA 3E8XA 3KXLA 4JA2A 3PK0A 2PKRA 3DKPA 4UREA 4IOJA 2CKDA 1MABA 3S81A 4FD3A 4ZV7A 1TL7C 4FEEA 3ND6A 3V4VB 2EKZA 5DHFA 1K92A 2QTVA 3GZNB 4YH1A 1U8YA 2H18A 2GYWA 4CJXA 4MWCA 1KAEA 4G26A 4ZCMA 1MGOA 2GZHA 3HB0A 4DV7B 4I8IA 1ISSA 4EG8A 3A7EA 2ERXA 3KR2A 3PC8A 1D2NA 3MD0A 5G3ZA 3DHEA 3JQ7A 1R66A 5BNFA 4TLMB 4N7RA 4LHZA 4F1KA 1EFUA 1OHHA 1PEDA 1UXGA 1XRMA 2IZ7A 1A97A 1H69A 3GFQA 4RF5A 5HMLA 5JLAA 2EWMA 1LPBB 3T3PB 3TNFA 3WA6A 2OBLA 3RVBA 4MB2A 4WI1A 3SVZA 3MTEA 2ISQA 2VAWA 3IBGA 3Q10A 1R6DA 1WRBA 1SUDA 2V7TA 3G2JA 4DZRA 2JARA 1ZZGA 1EP1B 1VOTA 3JXEA 2HDOA 3T15A 2PLWA 1IQPA 1KC3A 1Q2UA 9ABPA 5AW2A 2Y68A 5HZHA 3DYVA 2NVUA 5DP1A 1XDSA 3AVOA 3DOCA 4P8RA 3EPHA 1IJKA 1KI9A 1HZZC 3BGIA 1JIJA 3C4JA 3JQAB 3DC7A 3CBQA 2Q4TA 1GEEA 4R1TA 3KBOA 5BQOA 2ILVA 3N53A 1J0CA 4U6NA 1T8PA 1Q14A 1VHLA 4IKPA 3RRMA 4C5CA 2NO5A 1O2DA 3C85A 3IT3A 3KQNA 3LT5A 5K0TA 4TLAA 2Y0PA 4ZCIA 2RAFA 3OEYA 5DI9A 3ENKA 4BN0A 4YT4A 3BQNB 4EEKA 2GBLC 2Q5CA 2XUJA 4YRKA 5HJEA 3A3YA 4G89A 4DR5B 1VB5A 4AUMA 4W63A 3LC0A 4TVKA 4EI9A 1ULAA 4RPGA 3EG9A 1U9YA 1NF2A 4D7AA 3RC2A 4N40A 2G1JA 5ILOA 4P92A 2PE5A 5K2OA 4NBVA 1YJBA 1JKJB 4IZIA 2GZ1A 5KO2A 2W0MA 1XEWY 5HWSA 3H1BA 4ZXFA 3D43A 3KFXA 3L6UA 4V0KA 3C5EA 3H8VA 4X85A 4E15A 1MZVA 3V00A 4RVDA 3AWDA 2B5VA 3AB8A 4LOLA 3P4YA 4GI2A 2B35A 3W6NA 4DGQA 1Q7CA 2QZZA 4TKMA 4BP8A 2H1OA 2XDQA 3BCHA 4EG0A 1YK0A 5HSGA 2FE4A 2JLCA 2LW7A 1ZIYA 3IMCA 3LK6A 4IIBA 4OAQA 4TKVA 1N5RA 3A6FA 4GOND 3DQZA 2B3TA 2GVDC 3D6VA 3JASB 3GRAA 3THOA 2HK9A 2PFSA 4TQ9A 5I3CA 5KS2A 4QJBA 1OTYA 3LXUX 1V6SA 3WJAA 2E87A 3VJRA 1LDBA 3W8RA 4XGIA 4E1AA 3R09A 4W1PA 3EAGA 4GXQA 1CHNA 5KSOA 1BDHA 1VBMA </