3HFTA

Crystal structure of a putative polysaccharide deacetylase involved in o-antigen biosynthesis (wbms, bb0128) from bordetella bronchiseptica at 1.90 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
242
structure length
242
Chain Sequence
RYDNKFARISDIDINQPESWRGRIFLTFDIDWAADFVLQDTIDLIEGAGVCATWFATHSTPLLENIRRNPLFELGVHPNFNPLLAGAHAEGVQEILDRTLELAPGCVSVRSHSLVQATSILNMFGERRLRYDCNILVPWDAGIVLQPWRHWTGDMVRVPYLWEDDVACLYDWEFDSTFDYWYQPDGINVLDFHPIHVYMNTESLRRYEDSREVHRNPVDLIRWRNTSAGSRTFLQSLLARNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WbmS, polysaccharide deacetylase involved in O-antigen biosy
publication title Crystal structure of WbmS, polysaccharide deacetylase involved in O-antigen biosynthesis (NP_886680.1) from BORDETELLA BRONCHISEPTICA at 1.90 A resolution
rcsb
source organism Bordetella bronchiseptica
molecule tags Hydrolase
total genus 82
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 3hftA00
3CL8A 3WX7A 5JMUA 4F9JA 1Z7AA 2Y8UA 1W17A 4NZ3A 3S6OA 4NZ5A 4NYYA 4NY2A 3QBUA 1W1B1 2NLYA 4F9DA 1W1A1 2C79A 4NZ1A 2E67A 2I5IA 2C71A 2VYOA 4NZ4A 4HD5A 4U10A 4V33A 4WCJA 1V6TA 3VUSA 3HFTA 2J13A 4LY4A 3CL7A 2W3ZA 1XW8A 4OUIA 1NY1A 2DFAA 2IW0A 3CL6A 4NYUA 2C1GA 4M1BA 2XU2A 2CC0A 2C1IA 5BU6A 3RXZA 2QV5A 4L1GA
chains in the Genus database with same CATH superfamily
1O5QA 3KX6A 4HK5A 3T7VA 3GY1A 2HCVA 4IPJA 3R8HA 4W7WA 2FZNA 4FIRA 2OJPA 4RE3A 3TCEA 4XTDA 4EAMA 3IJQA 3WFZA 3PN8A 1BGAA 3P6LA 4J1OA 4P7OA 2ZE0A 4DO4A 2BSLA 4UTJA 4ZXLA 4AD0A 4PYSA 3KM8A 2PA6A 3CJPA 3QY8A 1TWZA 2XVKA 2OLSA 3NL3A 2FJUB 2WZTA 1CEOA 3DBNA 2A3EA 4R7OA 4RDVA 1JDEA 2AMXA 1A0EA 3TTSA 4U31A 3FJ4A 2VOMA 4AVFA 4AXNA 4LB4A 3KAOA 4RE0A 3N4AA 2DZXA 2RHGA 3NA8A 5AHIA 4H9MA 5GNXA 1DHPA 1AK5A 4IL0A 1Q5MA 3CUXA 3OBKA 3SURA 1TQJA 3XIMA 1X7FA 2WLYA 1F8MA 5D02A 1EDGA 1IZJA 2HVNA 2V68A 3WQCA 1ZJBA 2GUYA 1XICA 3TSDA 1Z42A 1UUOA 3LHWA 1QBAA 2DGAA 2AAAA 1M04A 3N19B 3FK4A 3NTYA 1NM9A 4W85A 4O16A 2XVNA 1BFNA 4LRSA 3DYPA 3GG8A 1HQTA 3GBEA 1ZSXA 2QJIA 4NI8A 1F3TA 1UWUA 1PPIA 3NPUA 3WZ0E 4YTQA 1XG3A 4R34A 1R8LA 3AXXA 4I7WA 1X97A 3RDKA 3EOSA 2HPIA 4I5RA 4NAEA 1WBHA 4OGZA 1O60A 1ZRQA 4IQDA 4NJGA 3CC1A 5BNKA 3BCFA 1WZMA 2YGYA 2PWVA 4RZ4A 3GG0A 3SFWA 2A5HA 1ALDA 2VDHA 4QG8A 2ALDA 1FHLA 4N42A 1Q3NA 5A6KA 2X2GA 4CNSA 4PMYA 3NM3A 1S5WA 1B3XA 3EB2A 1WQ5A 2VR2A 3ANVA 2R6OA 2FGBA 4GPNA 3NQ6A 4H3DA 2GSHA 1CW2A 1GONA 2JFEX 2ZZ4A 2E25A 3MCNA 2BZNA 4JIHA 4ZO6A 3QSTA 1A5LC 1M68A 1JUBA 2VCBA 1TUXA 2IQ0A 4GYPC 5LZLA 1FDYA 2ZA1A 4DEFA 3DU0A 2GGIA 3VXGA 3W26A 3SAZA 1V8EA 1XFCA 3VGFA 4K1GA 1ZJIA 1VPYA 1VPXA 4P7NA 4O11A 2VX5A 2VMFA 5BRBA 3FOKA 2QCFA 1BEUA 1UR1A 4Q8QA 1HGYA 3EWXA 1CLVA 3CV7A 2G50A 1BF6A 2Z26A 2GQ9A 4HU4A 4A8NA 4L1XA 3SRKA 1JRBA 1E1EA 4LVGA 5CJMA 1VEOA 3L68A 1H7RA 4L9ZA 4MWAC 1J0KA 3IJ9A 3PTDA 5F1UA 2NLIA 1F07A 4HZ6A 5A6BA 4RXFA 1TTQA 3SCQA 2DSUA 1ML1A 1KGXA 2PGRA 4O13A 5CGMA 3GIQA 3DG3A 1FUYA 1H4PA 2D0HA 3G1DA 5HPCA 4QISA 4J5NA 4WSHA 1A5OC 4OZOA 3VDGA 1DWFM 4LS1A 4EF8A 1OSEA 4LUSB 5CSRA 2WNQA 3MS8A 4GO9A 1YYAA 3OHIA 9XIMA 1IZKA 4W89A 1R30A 4S2CA 1BRLA 1VBUA 2XJ7A 3GYCA 1EHAA 1JGMA 3FSTA 3C2OA 2CITA 1K4GA 2J7DA 3KBWA 4P7RA 5TF0A 1L6YA 1PCKA 3LPPA 4ZQMA 3CWNA 1KD0A 1LT8A 3VGHA 4ADTA 3VAVA 3KP0A 4IUOA 5CGTA 2PDJA 4XZLX 3ITXA 3V5FA 3VMPA 4JN7A 4A29A 2Z4GA 2HRWA 3CZJA 3NGJA 2RH9A 4CKQA 1BYAA 3KOWA 3TOPA 4JKLA 2C13A 4PUNA 1P6CA 2CIPA 1EGMA 4UQBA 4S3JA 3PZNA 4S3BA 7ENLA 3DG6A 2GJXB 2A79A 3A6OA 1R9XA 3ZM8A 4RNHA 5FOOA 4AISA 1SFLA 4AZBA 4IMEA 1Q65A 4D71A 1X96A 4F2UA 4UNLA 1EUNA 3SUVA 2ZICA 4HB7A 3NO1A 3CPRA 2Y89A 4WY0B 1J18A 1FWTA 4GO8A 3T0AA 5IHRA 4IICA 1DKWA 4AWTA 1E9LA 2XVPA 3P14A 3GIPA 3LBCA 1XLAA 4D6JA 3AXIA 3EXRA 4HK6A 3N4FA 4D1IA 4UFHA 1FX6A 2C91A 2DORA 4N7QA 3STPA 3QW3A 1QNOA 3HU7A 3IRSA 3NQGA 4OIFA 1W6TA 3SUWA 3V0SA 4O1AA 4J40A 1U5VA 4MYAA 2ISSA 1RCQA 3W38A 4HOXA 1T6MA 4GLEA 2FTYA 4YVVA 1OIFA 3S9ZA 1J01A 8A3HA 4G6CA 1C92A 1EIBA 1XQLA 4MB4A 1DWIM 3G0SA 3WF2A 3NWRA 2Y62A 3E0LA 1JD7A 3W0KA 4HTBA 3OVGA 1K7EA 1JQXA 1OWQA 4FO4A 4GY1A 4X22A 4AF0B 4GI4A 2VC5A 4WX2A 3SGZA 3CO8A 4CEUC 2R1NA 1NJJA 1UOKA 4I5XA 4ATWA 3ITOA 3UA4A 5DY2A 4CVUA 4KPLA 3O05A 3PJWA 2DZWA 3RU6A 3WLQA 2QPXA 1ZUAX 6ALDA 1EKOA 4EXBA 2J7FA 3EYPA 1C3FA 4FX7A 4RPQA 4F9DA 1OCQA 2BVWA 2E28A 3AXHA 4UB9A 1U22A 5KTLA 4WGXA 4F0KA 3OLGA 3DAQA 5BXSA 3TR9A 1GKRA 1RV8A 4AZCA 3F5JA 3WF0A 1CCWB 4OV9A 1W9PA 2GJNA 2NQJA 4R3UA 3H23A 3VA8A 2NQ9A 3MI2A 2V3FA 2YX0A 1TV4A 3Q94A 3ZFHA 3IVUA 2XTKA 5FJIA 1IIGA 3IGSA 4JIRA 1KCXA 3VZZA 2E6AA 3STGA 3S9YA 2A6NA 2XN2A 3LXAA 1WUEA 4B3ZA 2OU4A 5EA9A 2WSQA 6TIMA 1W9BM 2QCEA 4IFRA 3N25A 1LLZA 3VKBA 2ESCA 3ZT6A 5I09A 1K9TA 1XIGA 3MO7A 3CQHA 4TU1A 2UY2A 5T26A 3WLRA 1DVJA 2WSKA 1ZP3A 3W25A 3U3HA 1AW1A 3CMJA 3B8IA 3O6DA 3DGRA 4HMDA 3M0JA 5LNRA 3WQEA 2WVTA 2HWGA 4JDYA 4UR7A 3R7MA 1LWJA 3B8VA 4L6HA 4PMZA 3IANA 4FXFA 3M0MA 4LAZA 2HBVA 3W2LA 1G4TA 1XPGA 1JR1A 3G0XA 1RSCA 4LAUA 3N3MA 4NZ4A 1N8WA 1VS1A 5K4XA 4U10A 1E73M 4AIOA 3BE7A 2BWGA 5M2FX 4P8WA 4E6MA 1TV2A 3HGOA 2VZVA 2R9RA 2VGGA 1A0DA 2J6XA 3SJ3A 3FA5A 4B16A 5AYXA 4CCEA 4DJDD 5KETA 4KETA 3NZPA 3INPA 4Y7EA 3P93A 1B2YA 5AHNA 5A8QA 3PANA 3SFKA 5H8PA 4AVOA 1SZFA 3KOYA 1QPOA 3B0YA 3KRSA 5F4SA 2RJHA 2QPUA 3WBEA 3W70A 2ZZ1A 2E68A 1ISYA 3VIFA 2W62A 3P62A 1TPEA 2Z2AA 5G1YA 2OQLA 4TO8A 4L9XA 4K2SA 2H9AB 3PPGA 4KRUA 3GR8A 4LUTB 1EJSC 3W7PA 2ACSA 2NQLA 1AFSA 1R38A 5I6SA 3BLFA 2V82A 4D6FA 3R0DA 2VTFA 2C1HA 4QQUA 1QNPA 3GXIA 2JKPA 1E0XA 4XUGA 4QLLA 1QNVA 3PS7A 4ECLA 1EFZA 4ATDA 4Y96A 4G1NA 1KBJA 4RUBA 1DTUA 3SIZA 4OV4A 3S1WA 3AFBA 3PG9A 3UWZA 4MKNA 3W83A 2XIJA 3DHDA 4GABA 5LIWX 1POJA 4D2JA 5EPDA 1QI0A 3FXGA 5M03A 3I6TA 1U5JA 1VP5A 1C93A 1WAWA 3QHNA 1S1RA 2R1MA 2QDDA 1BAGA 3GH5A 3MUZ1 1ME9A 2PODA 1BTMA 2J77A 3BV4A 3FVDA 4X61A 4DBSA 4HOWA 4ORIA 2CWNA 2PTXA 4H8VA 3R79A 3TFXA 1KM1A 4PRRA 3WSUA 1EYEA 2WV8A 3WLLA 5D8ZA 1GCYA 3GFXA 2RUSA 1TWWA 2QLYA 4GNKB 4MJZA 2OCZA 3N2TA 4NRSA 4BK9A 3PZTA 4TIMA 3C61A 4ZOCA 5M1TA 1V77A 1ISVA 1JD9A 4Q6XA 2UWFA 5BZAA 1SUXA 3W2KA 4HP5A 1TR1A 2VRKA 1D3GA 1S38A 5DX7A 5CPMA 1MRQA 2VR5A 4S3GA 2D3NA 3FJNA 4BZYA 4JTHA 4KEZA 1A80A 1V6UA 5K9XA 4A05A 1AW5A 4AY7A 3THUA 2QCDA 4LVDA 3LHZA 3G5EA 5FL1A 3SCUA 3FAXA 3VOGA 4A2SA 3M0XA 2ZWZA 3KL5A 2VZOA 3TZFA 3PG8A 1PKMA 4AD5A 4JL2A 1EC8A 3IJ7A 3AROA 3TH6A 4WR3A 3CL8A 3LQLA 5H1WA 3CBWA 2FMNA 2G3JA 3A5VA 1EGVA 1HJUA 3SRDA 4C60A 3WUEA 3ARPA 2ZC8A 3GHTA 1LWIA 4QG6A 3MV11 1XW8A 4E2VA 3TN5A 3QSRA 1HTIA 3QH2A 2VVNA 4O28A 4LB3A 3I4KA 1XD1A 1A53A 2D73A 3FNDA 1EWEA 3WH7A 4BF9A 1GW9A 3KL0A 2F9RA 5EL1A 4KRZA 1K4HA 2PRLA 1RCOB 1GG0A 4O1BA 4E0CA 4E4PA 1UQYA 1JULA 1H3GA 2GJRA 1TYGA 2JALA 4GYKA 2ACRA 1J12A 1J11A 2QUUA 3GFZA 1Q66A 1R5YA 3UPWA 4FF5A 5AYYA 2V5KA 2EG8A 4IX2A 1B9BA 3GDTA 2YZ5A 3K2GA 3VIJA 4F3HA 3HPSA 1TTJA 3UVIA 3SCWA 2X0YA 5EKYA 4IFOA 4GFIA 1W17A 3MUIA 1HKMA 3VNYA 3K46A 2W6RA 3IUIA 4FAMA 4N6EA 5FI8A 4Q6JA 5CPLA 1SJAA 1UP3A 1A5CA 2Z27A 2A7NA 1GPWA 4GKTA 1DE5A 1US2A 3K13A 3A3WA 3B8DA 2J74A 2PLJA 4AZGA 3PJUA 1KXVA 2I5QA 4MNMA 1OG0A 3P67A 1XIFA 1UR8A 2ZA3A 4H1ZA 4LAKA 4IX0A 2EF9A 2WCSA 3H2CA 3UXKA 2O92A 2EJ1A 4H7VA 1CWYA 1Q4NX 4AW7A 3WNPA 2Y4SA 1HKWA 3V0UA 4NASA 3OP2A 2ZRUA 1KXQA 4AX7A 1VYSX 3I10A 3GVQA 3G22A 1MMFA 4JD4A 2QYGA 1R9ZA 4OU1A 4QDPA 3V35A 4MDPA 2BV9A 3V4BA 2QF8A 1GPFA 1H1YA 3DKLA 3OOQA 4MY9A 3EXTA 4ONVA 1XLMA 2D2JA 2A7RA 3C0LA 3W85A 2Z6JA 3VKDA 1Z44A 4LCSA 2E9LA 3B06A 1UR9A 4PA8A 1K6WA 1GYNA 2X0HA 3CB8A 4IWWA 5DF0A 3SSJA 3IJDA 5U7SA 3CWOX 4MWAD 3AZTA 1NAL1 1SMAA 1Q8JA 4D8AA 1NF0A 1RK5A 3WK1A 3OVQA 1AJ2A 1XSKA 1FDJA 1XDMA 2AGKA 1JI1A 1EJWC 3MUAA 4RNIA 5I2UA 1OC5A 4ZFCA 3O6YX 2VX7A 3U8GA 3LLXA 3SCPA 4LTSA 4TOQA 3MC5A 2D2GA 3PUEA 4O8RA 3MVIA 4GOAA 4Z08A 4QP0A 1QPRA 4HPJA 4ERAA 4M7TA 1A3XA 1GORA 3M0YA 1NY1A 4JTSA 4QNWA 1K8ZA 1H61A 1JNEA 3GW0A 1V03A 4GACA 1E3XA 2WSRA 3WLPA 3F4VA 4W86A 3LMZA 3EWZA 3WLIA 1B5TA 2V5DA 3W7RA 3ZWTA 1JPKA 5HJYA 1IR2A 3TC6A 3DFQA 4PMRA 4ZMGA 2XGBA 1MRAA 3RPDA 3SM0A 5D2XA 4ZR8A 3VM5A 4LALA 4Q4SA 4EPBC 3PSVA 4PB4A 1H60A 2HQAA 5ECUA 3WMLA 1YQ2A 2XGZA 4HU0A 2PTWA 1X98A 3NO3A 1FWEC 1NF7A 3M5XA 4ZENA 3ZJ6A 2Y85A 1V3JA 4NJHA 3NSXA 1GOOA 3DERA 3NSNA 2PDPA 4MJ4A 5G2WA 1QT1A 2RJGA 1M7OA 3RHGA 3NL6A 4PUJA 3ZR4A 1RCXB 5D09A 1SZEA 3EPMA 4EKJA 1QJWA 1TG7A 3U7BA 1UQZA 1TIMA 2O9TA 2G0WA 3F5LA 4X9SA 3EOOA 5T9CE 1FOBA 3PUGA 3B9EA 4IOTA 3PPCA 5C71A 2YCKX 3BW2A 1VYPX 2EPLX 3NQ7A 1JYVA 3TA9A 1KWGA 2WYSA 1CGVA 1JDFA 1G69A 4OUEA 1M01A 3CM4A 4QAWA 2CC0A 4KKXA 5BCAA 1WXYA 4ZB0A 3VFCA 3W7MA 3W53A 1PZ1A 1P0BA 4NJKA 5FSDC 2VFDA 4WJ8A 2OO6A 3NM1A 1BKHA 2PWHA 1QW7A 4HN4A 5CSSA 4M51A 4GGBA 1A5SA 2GDUA 1B1YA 2I14A 5HWNA 1QPKA 3GSMA 4PUWA 1CPUA 1B4EA 1NFGA 3C5QA 1FCVA 4M24A 3QTPA 1Z41A 3IACA 5C0QA 1B3YA 4Q7NA 3JW7A 5LHEA 3LEPA 3PB2A 4GJIA 4UTUA 1OJXA 3TTEA 4CNTA 4CCCA 2PDNA 3DESA 3SSZA 1O66A 1HKJA 1LQ0A 3T4CA 4JTAA 4BF5A 3KCLA 4N4QA 1PHWA 2EPMX 4RX0A 1ICSA 3BLKA 2VQUA 2IPJA 1QRQA 1J0JA 2Z25A 2Z1SA 3THDA 3D0CA 4PULA 4JPGA 3WDQA 3UCDA 3P74A 1TIWA 3WQ8A 3LGDA 3UR5A 2EAWA 1RQHA 1I2PA 1VAHA 1ZJAA 4KQNA 4LWWA 1MW3A 2WANA 2O0TA 1XYMA 1NQKA 1TJ0A 1IQ8A 3IAPA 1Q6QA 4FB7A 3MSYA 3BWWA 1CXLA 4ICNA 4WOZA 1ODUA 2G3MA 4AZCB 3GZAA 2IXVA 3U5YA 3UESA 3NVDA 4Y9MA 3FS2A 4MYXA 4AD1A 4EPKA 1C8YA 1JXKA 2PEVA 4TV5A 1BSLA 2DY3A 4GNVA 1MEWA 1TPVA 2WCGA 4UTMA 2VGIA 3UR8A 3CXOA 1L6GA 1I2OA 1LRNA 1QHPA 2YIHA 4LUIA 4HD5A 1ZP4A 1AJZA 1LTDA 1S5NA 2DZBA 5FD0A 3VUPA 1C8VA 3M7SA 4GJ1A 2V5BA 4AVNA 2QMKA 4NJJA 2VEFA 2YCLA 3PK7A 3ES7A 3GZ3A 4E8GA 3SEPA 4RLIA 4L80A 1YMYA 4NNCA 3CQ0A 1YNQA 3T40A 4D9PA 1MQPA 3TEVA 3VU2A 5IFPA 2ZYFA 3LRMA 4FOJA 3RJXA 3TCSA 1X1ZA 1U5HA 8CGTA 1ZAHA 1ZAJA 4JZ5A 3BV7A 2HJPA 3OZPA 1PZ2A 3DEQA 3C0SA 3QGKC 4RW5A 1JIBA 4LSBA 3KOZA 6REQA 5LNUA 3ES8A 4H6QA 1WA3A 3HG2A 4B2DA 1Z8AA 4LAMA 1CXHA 3R94A 4C6FA 3H21A 2YZRA 4QEEA 3ATYA 3EGJA 1TZ7A 2J4GA 3FV9A 1HIZA 5BRQA 4J35A 3SECA 1TE6A 3NFUA 1UROA 1US3A 3WD0A 2NVCA 3NDZA 2CETA 3I3EA 2GPTA 1ADSA 2WO5A 1D3CA 4L7ZA 4PEKA 4MAZA 9RUBA 4BWLA 2F2HA 4GE8A 1HW6A 1I1XA 2BY1A 2PUZA 3CK5A 4JFTA 2NWSA 5AB3A 1G67A 4LH8A 4EOUA 2ZX6A 4HNNA 1CT5A 2D22A 2DUZA 2G37A 4F4RA 1AA1B 1XH1A 5DMMA 4R5EA 3UQNA 3UYIA 2OTDA 4HA1A 3M9YA 2GYIA 1AMKA 2VENA 4Y6GA 2D20A 3GDMA 3HG5A 3NG3A 1B3VA 3FYPA 1OX4B 2KZHA 2EO7A 3M46A 1TV5A 4ZO9A 3H2FA 3E5PA 1KTCA 2RAGA 3ARSA 4NAFB 5I3FA 5JIWA 2J9XA 1P7TA 2FH6A 2VOTA 2ZZ2A 5FEZA 3UCQA 3IIZA 2HVOA 4LCRA 3GXMA 2VX6A 3BGJA 4UWMA 5LNSA 4I8YA 2H3BA 1OD8A 2SFPA 3REQA 5F2IA 1WB0A 3H6OA 4GXWA 3ZSTA 4B5NA 4HPHA 5CBIA 1XV8A 1W8SA 2R8WA 2G4JA 1AMYA 3KUMA 5M5DA 2E6DA 1PWMA 3BCJA 4D6DA 3EX3A 1RJQA 5AVNA 4WDXA 3M43A 3ZYZA 3M47A 4DZHA 2Z2UA 2PDLA 1BVZA 5G5IA 3LX9A 3JZEA 4HZMA 5BMWA 3AYTA 3QMRA 4QX4A 3KCJA 3RXZA 3N2CA 1LM1A 3W7GA 2X7VA 4DHGA 1JAKA 1VH7A 2BGNE 1I60A 2VNCA 5JBDA 4GRSA 1GZGA 3GKAA 4C6BA 3TR2A 5D03A 1PTDA 3B0UX 1MW2A 1E4IA 4F0SA 4O8AA 1UD6A 3ZJ7A 2Z29A 5ABHA 1TMQA 4XD3A 1JAEA 2XISA 1XP3A 4K68A 2EPKX 2QCDB 3WQ5A 1H11A 5D30A 2FJKA 2WPGA 4GCAA 5JUVA 3WQGA 4NY2A 4GIRA 1D2KA 3KEHA 1AH3A 2AGTA 2PSNA 1QR7A 5AECA 1YDVA 4CQBA 4S3KA 1IHIA 1UIOA 3KBSA 4UTWA 2FDMA 3I65A 1JGIA 3SO7A 5HDRA 3TLQA 1EP2A 5D2TA 1PL9A 4GX9A 1UA3A 4DBDA 1IEVA 3CQJA 1DE6A 1ITQA 2WXDM 4FALA 3IGUA 1TCMA 4C65A 5EBAA 3EZ4A 5CZTA 3SQMA 3QR1A 3URAA 3LD5A 2I5GA 5MKGB 2FTWA 4CQ9A 1IT7A 3UERA 4MJ2A 4E2BA 1CGXA 1L9WA 3H2MA 3KS5A 1E6RA 1HFBA 1V3IA 1QI2A 3LTPA 1EIXA 2XIMA 2C16A 3VD7A 3RU8X 4JX5A 3CT7A 2VWSA 3A24A 1EO7A 3IV3A 5U4NA 4XO7A 2VCAA 1P43A 4FF7A 1VKFA 4XK2A 5MHBA 4K1WA 3ZMRA 1LBFA 4JCMA 3IPWA 2IKJA 2YYTA 5HJXA 3SBFA 2G3NA 5G1TA 3AU2A 3TQ0A 4WHBA 2CFFA 2OG9A 5HNTA 1E5NA 4K38A 5JMUA 1ECEA 1WBJA 2QNEA 1OYCA 2VFGA 3FAWA 4J3XA 5H6HA 3F5KA 2GDQA 2GDVA 4I5UA 4C6JA 1TWIA 1CECA 2BX7A 3WN6A 1ONEA 2P76A 5G2IA 3WLMA 3AS2A 4JOMA 4F48A 3GQYA 1TZ9A 2CBJA 1A5AA 4PEEA 2ZRXA 1V6WA 3CYVA 2VC6A 1YEYA 1M7JA 7TIMA 3QV9A 4IIHA 4LBRA 4DJEA 2WMJA 3E1F1 3H24A 4PMQA 3VKAA 4XQ6A 4QDMA 2C15A 1QWKA 2WHMA 3TDFA 2CLMA 3ZIZA 2NSXA 1M3UA 2PWEA 4NYYA 1XYFA 1L8NA 1UKQA 1E6PA 5FF2A 2PWUA 2WZMA 3PNUA 1PYMA 3ZJKA 1ZNNA 2P0IA 1YXYA 3MYPA 3LG3A 2XHYA 1XXXA 4N9EA 4PTMA 1V51A 3UU0A 2CLOA 2GQ8A 5BWAA 4DWSC 1ONWA 4MWAE 4KEVA 1FWHC 3IJIA 5F4XA 1AQ0A 4IZGA 3OVRA 3K4WA 3WLTA 1XLDA 3E3HA 2DZVA 3DFNA 4BA0A 2XGIA 4JIEA 3WUBA 3UR2A 1SZGA 4WOQA 1DYSA 4CNPA 2PB1A 5BRPA 1O1ZA 1Z7AA 1I0DA 1PEZA 1PVNA 2X7WA 3LHYA 4C7DA 3WD1A 5DO8A 3LERA 4O15A 1OX6A 2A7PA 3RGTA 1Y5WA 3H4XA 3N12A 1GZJA 1R0MA 1YBQA 4ICMA 1J79A 4C6EA 3P0WA 4B5XA 2EG6A 1ZU8A 3FKRA 1T7LA 4GY7A 2EXOA 2OZ3A 1KBIA 2CERA 1RA5A 2PDGA 1AL8A 2AMGA 1VEPA 2CBUA 1OFAA 5EBUA 1U2YA 5KEZA 5BROA 2QJHA 4BI6A 4M1BA 4RNFA 3O6AA 3NURA 2DP3A 5J8LA 4KFNA 1PO9A 3AHVA 1Q6LA 1N2VA 1VQTA 2J7GA 4H83A 1RLDA 2HROA 4JCLA 1H50A 3T0CA 2VGFA 4CVWA 3BVJA 5KZMA 3OIHA 3UCCA 4DAIA 5BYWA 2NX9A 4LEQA 3FSUA 4ZQCA 3N9KA 2YB4A 3LI0A 1XBXA 2YW4A 1K9DA 4NXKA 1OIMA 1IEQA 2JKAA 4U28A 3GH4A 4DIAA 5IXEA 5LA0A 4ZBCA 3SCOA 3GU9A 5EY5A 4Q8PA 1XR2A 1BYBA 2Q8XA 1V7YA 2E09A 5L6UA 1T96A 5FSEC 3TUUA 1W1YA 2VGBA 1XBYA 3SQSA 4UXDA 4LU0A 1EXBA 3OW1A 3W1QA 1GVRA 1HO1A 1XCWA 1ZQ5A 3KRUA 5DBUA 1YPXA 3W7JA 1R7AA 3VFLA 3C8NA 2JGYA 1OZQA 4MNJA 2ZUTA 1XL9A 2V2DA 1KCKA 2WK2A 2JIEA 1XLGA 3LSBA 3H22A 3Q58A 4DJFC 1P0NA 3HGSA 4OTKA 2DT2A 2WC7A 1BQCA 3LXBA 3ATZA 1OG6A 3LTSA 1KR1A 1HXJA 3UBPC 4HIBA 3HA1A 2WJEA 1KLYA 3DFSA 2VEGA 2WZEA 1EPXA 2V2CA 3CTLA 4GX8A 1IYXA 3WG6A 1DQUA 1VR6A 1Z69A 4AH7A 3T1GA 4WJEA 2HK1A 3R13A 2WKLA 1TPDA 4UMBA 2ISDA 1CENA 4OOZA 3WENA 4AWSA 1K8YA 4BQ3A 4NT0A 4JIIX 3KBJA 4GI6A 3M07A 2XDFA 5D04C 3TJIA 1XYZA 4PBEA 1RD5A 3GH7A 4QIUA 4A3QA 3OPSA 3A12A 2ZUWA 2F6XA 3TSBA 3MMUA 1TPWA 3BAYA 1KKRA 1FWGC 2TYSA 4JIPA 1UIPA 1K1DA 3UXLA 2D1ZA 3I7SA 3WCZA 4A3UA 5DANA 1QXLA 1A5NC 4ZQRA 3V36A 4DXKA 3TJLA 1UWIA 4V1YA 3T55A 3UJ2A 3S1VA 3PZUA 3GRIA 2PCEA 4NX5A 4WSJA 3RCMA 3R0KA 4H19A 4Q4MA 4F9JA 3EDEA 4M5PA 3W1UA 1FP9A 1Q2RA 1OX5A 3DN5A 2OVLA 2E67A 1AVAA 2FFIA 2G8ZA 2KX9A 4XZWA 4RZ6A 1CTNA 4ZFMA 2ZX7A 4BQ5A 1LG1A 4KMQA 4H9XA 4DLMA 6CGTA 2ZADA 3L2LA 2HXTA 4CCZA 3O9NA 3TW9A 4A3RA 3E96A 5AYBA 4DF2A 1GYLA 2WJFA 3TQVA 3EWUA 8RUCA 4GQBA 3U6WA 3WQDA 5I77A 3VIGA 3LOTA 3H12A 5CPSA 3LS9A 1I9CB 3PC0A 4TTGA 3Q65A 1EBGA 3G1AA 3OG3A 1OCNA 2YCLB 1TVNA 2OELA 1XIBA 1WKYA 4EXQA 3W7IA 4PUDA 4KBXA 3GVVA 1OYBA 4JQ4A 3E0FA 3NUKA 1M03A 2B7OA 3RN6A 1DXEA 3ABOA 3PPFA 4D8LA 1SFJA 2PF0A 4CQAA 2V6AA 3TTOA 1QI3A 3LV6A 1XF0A 3SB0A 2FZ9A 5D2WA 2PU1A 4L9YA 1E9IA 3WO8A 5HMEA 6REQB 5JVLA 4CD5A 4M7SA 4ES4A 4BF7A 4IGHA 1A5UA 2EBNA 1NDZA 4YL2A 3SRFA 2E0PA 3STFA 4NL1A 1MUMA 1M41A 2WVVA 3VNLA 1XS2A 3GU2A 2VFHA 1XLIA 1KB3A 1S3HA 1XQKA 3MZ2A 4C6QA 3MWAA 3QY7A 3SUUA 2DH2A 4GY0A 3EKZA 4DYEA 4LXFA 3RJYA 4XAZA 3CO4A 4AEOA 1IV8A 5CC3A 1BG4A 4ZQNA 4WKHA 3HMJG 5AOUA 1EX1A 4XBKA 2HNEA 2A21A 3QHOA 5DFAA 1O95A 4IH3A 4Q4KA 3FHQA 2B4GA 3EWWA 3PBMA 2HS8A 4IQJA 1WZKA 7A3HA 2ZUSA 3VILA 2OQYA 1SJDA 4XV0A 4HA3A 5IDIA 2DZAA 1AW2A 5E93A 3UZXA 1P7TB 1L2QA 2D0FA 4DRSA 4L64A 1Q6RA 2QCMA 3RM4A 3O15A 1H51A 3GFYA 1F4HA 4FNSA 3ITCA 3BARA 1BWLA 4OECA 2AOSA 2GSEA 3ZZ1A 3M6YA 2BY3A 2DVUA 5CQ1A 2VZTA 3UZYA 1EZ2A 2G41A 4W8BA 3REQB 2ONEA 3L4XA 4PUMA 4M6QA 2R1PA 1REQA 3L5LA 3NQVA 1VHCA 4Z2IA 3GB6A 3W1MA 3CZKA 2VZUA 1IWAA 3LENA 4WKAA 2WBKA 3WKZA 1A3HA 3PZGA 1P5BA 4HT3A 4X3ZA 3QFWA 3CT2A 3NQ8A 4H9YA 2FH8A 1W1IE 4FR1A 4QFUA 1UWRA 4JN8A 4UMCA 3VK5A 3TYEA 2QS8A 3HTWA 4NRRA 3DC8A 3G24A 3L65A 2W67A 3LLDA 3G18A 2HK0A 3AZRA 3TROA 1BPLB 3NYDA 3T44A 4A8IA 4FR6A 5FA5A 1GZ1A 4LPCA 3AXKA 1WE5A 3HB9A 3QOKA 4GH1A 4AZIA 1V02A 5CSYA 2QF7A 4KH2A 1RHCA 5G4WA 3U57A 1UD5A 4E4UA 4IG2B 4GHRA 4XAYA 4WZHA 1XSJA 3CHVA 5IBXC 3AS3A 4DUOA 3TX9A 3BCDA 1SO3A 1WV2A 1KRCC 3B8UA 3I3BA 3EX4A 2F7FA 3LUTA 4XVEA 2PCQA 3LPFA 1YNYA 3VMOA 4HYRA 3JVAA 5HXMA 3T07A 3BJTA 1VC4A 3GHSA 5J04A 2ACQA 3ALFA 1VJZA 1T99A 4B9YA 1T8XA 2CXEA 2E5DA 4M3PA 3T2PA 3O2LA 2YA0A 2O4MA 4B90A 1HG3A 2VQTA 4FNPA 4EX4A 4JDBA 4IP7A 3RUBL 5BU9A 4F0HA 1XFBA 4P7QA 1KV8A 2BTMA 3A13A 2IXUA 5AKQA 3SCTA 3VDHA 3P80A 5K9DA 4JXCA 2DSWA 3EWDA 4K39A 4AU0A 2OODA 2YLLA 2J47A 1F73A 1B31A 3PBYA 3SW6A 5FF4A 1CGYA 3QZAA 3BAIA 1GQLA 3NEVA 3IIVA 4MB1A 3MY9A 3OO2A 4DX3A 3TN6A 2Y2WA 1QUMA 4ILSA 3GHUA 1SR0A 3OLDA 5CAKA 3QPYA 5K7JA 3ENLA 2IKHA 3BOXA 1J96A 1UWTA 2J25A 4A21A 3W72A 2FZDA 1AQFA 3R0UA 5JQ9A 4AZ6A 2R1LA 1K8CA 3ARXA 2VEIA 1B3WA 4JFSA 2Q01A 3HM7A 5E6ZA 3AHZA 3QOMA 2WC4A 4RNJA 1TCDA 1V5XA 2VL4A 1K8XA 1QVBA 3BW4A 2ZX8A 3II1A 3CZ8A 3CV1A 2JK2A 3KOFA 1LCOA 1X6NA 4UUIA 3SR7A 1NDWA 5DLCA 4QSFA 4F66A 1O1HA 4JQ2A 3PTMA 4FMVA 3MPGA 4FK9A 1V6XA 4OWGA 2C79A 3LZ3A 2ZUMA 2A6LA 2VFFA 4QAIA 3UWWA 3B03A 4RW3A 5FF7A 5C70A 1CXEA 4NKCA 1D8CA 2QHAA 4JY8A 3COTA 4QJ4B 1AZ2A 2XU2A 4LUSA 2F2KA 2OXNA 3FJ6A 7XIMA 1EHNA 2EQDA 1A3WA 1OFEA 1POKA 1E9ZB 5AYIA 4PODA 1KKOA 4N2YA 1NP2A 4TVDA 1WCGA 1FWRA 1EZWA 1OCBA 2I57A 3E2VA 3W1LA 1LL6A 1G5AA 1SZNA 2Y8UA 4JBRA 3NQ2A 1QBBA 2Y5EA 1WO2A 4AZ7A 2YA2A 2XIBA 1H41A 3VO0A 4NSBA 4LT9A 4DWSD 1UMLA 1V3MA 2DPEA 1G4PA 3WQWA 2V69A 3H53A 1LBMA 3DDMA 2CU0A 1W54A 5FJOA 2Y7DA 4XTIA 5T8GA 4YXGA 5E5CA 1TX2A 2PMQA 3OZYA 4O1FA 4A3YA 4CEXC 2GJXA 1JCNA 1V7AA 3IGHX 2WKJA 4B3KA 3O63A 5FCZA 2NXGA 3O7UA 1P0EA 2ABAA 4M82A 1NVMA 1W3LA 2PZ0A 3O06A 1Y5XA 5H8MA 1W1VA 3CUZA 3UWEA 1YBQB 5HNUA 3KTSA 4RPPA 1JYWA 1V0LA 2A3LA 2ASHA 5AY7A 4ML9A 5C9UA 1QMLA 1GOXA 3CH9A 2ICSA 4IIBA 1W3TA 4H8HA 4CU7A 4DPQA 1HL9A 1ZBCA 3PPHA 3C8FA 4TXEA 3W28A 4WSKA 4CCDA 3N1AA 4R85A 2Z2BA 3L7RA 4ZQPA 3BMXA 1YHTA 2P5NA 1W9XA 4IPLA 3QYQA 4G1KA 3VPLA 4WRHA 5CPTA 2PTDA 2ZTKA 4G5DA 4GZ7A 4S3AA 2Q02A 3N6JA 1PX3A 2NXIA 3BJSA 1L2UA 3UNDA 4AD3A 2XH2A 3O0KA 1UB3A 2DV0A 3XISA 2IKIA 2HBXA 5E1QA 1EWDA 1WP6A 2A3AA 2G96A 3N29A 2IUZA 1KGWA 1YADA 3H7UA 4R27A 5C55A 4M6UA 3AIVA 4UQEA 4LVBA 2FQIA 1YE6A 5DEZA 1GOWA 2YDRA 3CNYA 2ZRVA 4BHYA 2J88A 1V6TA 3ZLHA 4MJMA 4CLMA 1UWQA 3U48A 4XKYA 3W27A 3WY1A 3UWYA 1DJHA 3UWVA 4LBUA 5CZKA 3W7CA 2O56A 4DJFD 4PE8A 1NH6A 1W32A 4FI4A 2Q3RA 5KZDA 3EA3A 1EF3A 5HOSA 4GWEA 3P0XA 1OFDA 4LFYA 3CIWA 3WJWA 2CZFA 4Q4QA 2NT0A 3WF1A 4UNIA 3G2GA 3W7KA 2GK1A 4I9MA 1ICQA 1S2CA 1ZB5A 1DJIA 4WEVX 5EYWA 4HA4A 3LI1A 4BS0A 2CLLA 2FPVA 2MNRA 2Y88A 1EF2A 2HE5A 3E74A 3MUXA 3USBA 4M0XA 4GQRA 3TOYA 1ONRA 3E9AA 1ME7A 1HZYA 5AFDA 2FHFA 3TW7A 1C9WA 4KWVA 3NDYA 3MKKA 3TFCA 3JUGA 1Y0EA 1CB7B 1N7KA 4E2OA 1UBPC 4Q3MA 4DUVA 2YXGA 3MSRA 1RK6A 3AWNA 4W84A 3FYYA 3LLFA 1WNOA 1HL2A 2PGEA 3QBUA 4JL1A 2INFA 5IOBA 1QI5A 3S6TA 5HWMA 3UG4A 3N6QA 4LF2A 1EEPA 3STEA 1W37A 4S1FA 1ZENA 1SU5A 1LOQA 3S5SA 1QPNA 3GBDA 3UZZA 3ARTA 1P6BA 4LYKA 1DWJM 5DCEA 3DHUA 1F05A 3KVMA 1OHLA 4PTDA 6PTDA 3EEGA 1RAKA 3SIMA 3AHYA 3WK0A 3D3FA 1ZY9A 4KS0A 2DZUA 3LV5A 3MO4A 2HTMA 3LNMA 3DX5A 3W1PA 1E71M 1QCWA 1VBHA 1KFKA 3URQA 1ISXA 3ZR5A 2Z00A 4MY1A 1ZPTA 2X09A 4M81A 1W5NA 1JDAA 2OMAA 4CU6A 1VBJA 1LBLA 4V1XA 4H00A 3RG6A 4H8NA 3QLLA 5K9CA 1V79A 1OYAA 1QWGA 3UG3A 3GNPA 1US0A 4FLSA 1XBZA 4I9TA 5HMSA 3MUY1 1SM9A 3ZVHA 4G56A 2Z1XA 4QG9A 1I75A 2H9AA 2GVGA 2E6YA 3NQBA 1JQVA 4LUTA 4EAYA 1UZ1A 5FACA 3DFPA 3AUJA 3GAKA 2GVLA 2FHBA 1L6SA 4PMXA 2FB2A 2CCRA 4OQVA 3ITYA 4A6GA 3GNNA 2A4AA 2C8NA 1F8IA 4FA3A 2BDQA 5HMFA 2PRMA 1LL4A 1PKNA 3BOFA 2VC9A 4X0NA 3W74A 4K8HA 3T0TA 3O3RA 5K3VA 2INZA 5T91A 5TNVA 4PGLA 4FP1A 2J13A 4KIRA 2W3ZA 1XINA 5ABFA 2HXUA 2J6VA 3HIJA 4U5KA 1EUAA 1XUZA 2H8XA 1DJXA 3D46A 1RPKA 1C8QA 4A4AA 4YHGA 1V0NA 2CW6A 5CG7A 2DVTA 3L4UA 1YDOA 3GVRA 1UKPA 3M0ZA 3WMSA 1EX5A 5I3GA 2OKTA 1U1HA 4R9OA 3PB0A 3NOYA 4TVCA 1HP4A 4DO5A 3IVTA 1FFQA 3P5ZA 3EWCA 2CLPA 4XZMX 5D9NA 3NQAA 3OZMA 3QHMA 3OLEA 2HZGA 1J9YA 1JUKA 1T40A 4AFYA 2VD9A 2ATMA 5FAGA 2ZVRA 4LJ3A 1VCFA 3RX2A 3LN3A 2IQDA 4BI5A 2QKFA 4WUIA 4GH3A 3GNOA 4JTKA 4PUKA 1PIGA 4Z2GA 5AC6A 1OB0A 3T0DA 2OYKA 2H8ZA 3GNDA 5EMMA 1OGBA 3TYBA 1UBSA 1RA0A 4LAOA 2OLAA 3CIXA 1K03A 2NQHA 3M0IA 2ZZ6A 5HWJA 1EB3A 3WQOA 5I24A 3H2NA 4JX6A 4B5TA 3YPIA 2CHOA 1JZ5A 5HNNA 1REQB 3QC3A 2NUYA 3TLLA 1RXOB 3RR1A 2XSAA 2YCEA 2BVYA 2V0TA 4QS5A 1GQJA 1E6NA 3UVAA 4G7EA 3ANYA 1K6AA 2WOQA 2V2HA 1EP1A 2PWGA 3MHGA 5ABTA 4PCTA 1XIDA 2PBOA 4OFCA 3CAVA 2OLHA 5A69A 3MWCA 4HYWA 2E6FA 3I7RA 3W7OA 5RUBA 1WPCA 5FIPA 4CQ8A 2WHJA 4KF1A 2HNHA 3U5UA 3AHTA 2V38A 3UXDA 1F3WA 1O6IA 2PTZA 1D7KA 1XIJA 3EWBX 1E0WA 2YDQA 3RRAA 2EG7A 3W2JA 5HBFA 3H70A 4XISA 1GKQA 1W1B1 4AY1A 1X8CA 2W9MA 1FP8A 3BURA 2MANA 4FXJA 1B54A 3BLPX 3M6DA 1WKFA 4NQ1A 1MO0A 1J6PA 2AL2A 2PDQA 2B0MA 1RJRA 2ZZ5A 4PTWA 3PM6A 2GVJA 2QPSA 1OBAA 2EJAA 2J8TA 4LYRA 3W3OA 1ZCOA 5AN7A 3RLHA 2ZBTA 5LYRA 4OHQA 2Q8ZA 3BAXA 2GZXA 1UJQA 4J3TA 4TMCA 3MANA 4FPSA 4UTKA 3L67A 3VNJA 3CHCA 5D33A 2EHHA 3W7LA 1O12A 4FNUA 3WX7A 4DZ5A 4IL2A 3VD4A 3MKVA 2XFWA 1E72M 2X42A 5A2BA 3W1RA 4HMEA 1UYQA 1S5TA 3B3DA 3B8WA 1WDSA 4N9DA 4IM4A 1V3LA 3O0FA 2VI0A 1KFLA 1X6LA 4UNKA 2RDUA 3NXFA 4AG0A 1MUWA 3E0WA 4HPXA 2QEZA 2GGEA 5CEWA 5EMKA 5H8UA 3SDOA 3ITGA 4LCQA 5LNVA 4IGSA 3VNIA 4XWUA 5A2AA 7REQB 4UCGA 3C2RA 4H04A 5B7ZA 1RQEA 1X6UA 5BMXA 3USZA 3KOXA 3L4VA 5D05A 3QJAA 5HNRA 3ORWA 4F2BA 4D6EA 3U2CA 1ZGDA 2X2YA 3KVJA 1GJWA 1W3HA 1EJRC 3CV2A 1CZ1A 3CZGA 1VIZA 4XUYA 1GJUA 3U4AA 2QIWA 1PX4A 3GUWA 4Y9NA 2BODX 1OY0A 4ERGA 5LIYX 3L5AA 2QR6A 4TR9A 1GKPA 3T0BA 4ENLA 3L23A 4HCHA 5JH1A 3R2GA 1ESWA 3GTNA 1S2UA 3UJSA 4M1RA 4Y8EA 1OC7A 4RE2A 2FKPA 1HT6A 4C5YA 3CIVA 3MB9A 3F4CA 3WNOA 1W91A 2WBGA 3GR4A 1MVYA 2YW3A 3LK6A 1WOAA 3PWIA 4QDWA 1YXCA 4QQ3A 2P8CA 3ARQA 3VINA 1RP9A 3QGVA 5ENLA 3L5MA 2E5BA 3URNA 4H9TA 3T42A 4XZBA 2GUBA 3S2CA 3SJNA 3GKFA 3UGRA 1H2JA 4DZAA 5XINA 4CQDA 2L5HA 1R47A 3SGUA 1FBAA 4DUWA 3W7QA 3W6LA 3RX4A 1H7XA 5IM51 1E1FA 3BSGA 4C91A 5C2XA 5B80A 4W8LA 2NX3A 3OEXA 1XRVA 2Y7GA 1HKKA 2V3EA 3OGSA 1JF6A 1H7NA 2Y24A 1HKIA 4MADA 3PAOA 1F74A 5HR6A 4NG3A 1C91A 4GQ0A 1YNPA 2BP1A 3AJ7A 1HP5A 2B7QA 2FZMA 1MDLA 1R3VA 1Q6EA 4B5SA 1XIIA 1TUFA 5PTDA 4JTFA 3UGVA 1ITXA 2REQA 3ARUA 3CLWA 3G1YA 2XUCA 4C6DA 6XIMA 3CHDA 1C7TA 4CN6A 3LRKA 1KBLA 4XD6A 3GXFA 2NW0A 3C2EA 1F6KA 4LQ1A 3MHFA 4R53A 4MF4A 2ZCGA 1UKOA 1HF6A 1XISA 2DT3A 3S6OA 2VO5A 3BLOA 3G0UA 2ZXAA 1H49A 4F0RA 2I16A 4I7UA 3S2NA 4PCNA 4H9VA 1XWYA 4IIGA 4Q7IA 5FEXA 3SCVA 1JRCA 3EPOA 3E38A 4LNCA 4NVTA 5F4WA 4FOKA 3GVWA 1S5VA 1BLIA 2A1YA 1J4EA 3C4UA 1KV5A 3S2MA 5D9MA 4XSMA 3V5OA 1QOXA 3N04A 5EMLA 3G6LA 1JVNA 2F38A 1GT8A 1EBHA 3LMYA 3MKCA 4O18A 2XFYA 3TXZA 1E0VA 3UY8A 1FCBA 3RLVA 2RKXA 1XKJA 3M7WA 3AMKA 2VC7A 1EJ7L 3EKLA 1HO4A 3POCA 3EB4A 1XGEA 3HZ3A 4IMGA 1H0GA 2DQXA 3T2OA 1UD2A 1EEXA 3C86A 3JR2A 4Y2WA 3GD6A 1NOWA 2LLEA 4AHQA 1ITCA 4BJHA 1HN1A 2FTPA 2GOKA 2W92A 3A3XA 1L0PA 3OODA 3CAQA 1PWLA 4PTVA 4C6PA 2WM1A 4XKYB 4J3ZA 3MJMA 1GWJA 1XKYA 1VFOA 1XGZA 2F6UA 3G1XA 4GZJA 2ZQ0A 1GOQA 3LPOA 5EFDA 3UZJA 3AMCA 4JYEA 2DJXA 2ISFA 3EMCA 2HPMA 1UA7A 2C71A 3H8AA 4IIEA 2V5JA 2Y61A 4DN1A 4MZYA 2E77A 2BHYA 2GK1B 3ABRA 2C6QA 4EXAA 5ABEA 1Q7ZA 3MU7A 4CQCA 2P1FA 4JIQA 3SCNA 3VC5A 2VX4A 1OGGA 1A47A 2PP0A 3B04A 3AIBA 1UWSA 1JJKA 3TN3A 4Q4RA 2VM8A 1TMLA 4MFDA 3HPXA 1XIEA 2Y5SA 4UFLA 4DBUA 1KM5A 3N14A 3W02A 3T78A 4RKAA 3EX2A 1TZZA 1KXTA 3IGXA 4ZSTA 2WC3A 4LV9A 5HMDA 3UJEA 3R8RA 3CV6A 1W1ZA 1T41A 2O4QA 1TPUA 2PDMA 3F4WA 3W1XA 5HQEA 4JGDA 4MPKA 3W37A 2YB1A 3SY5A 3MA8A 3MSGA 4HJWA 3OG2A 4OBTA 3QMSA 1LYXA 1A50A 3APGA 3UPMA 4DYKA 1E43A 3BLEA 1RPXA 1ZS2A 4KCUA 4UCFA 5I3IA 3LGGA 4PBGA 2HE8A 3FJLA 4E3TA 3MYOA 3F2DA 1VGAA 1XJBA 2DVXA 4ZOBA 2ZUVA 4F8XA 4HBKA 5GNYA 4DF0A 4J2PA 1TVPA 2YLAA 3BLLA 2PLKA 3C0JA 3Q45A 3SUTA 4H6KA 2WQDA 3BC9A 4OJYA 4ACYA 2TPSA 4C1NA 2X40A 1XRFA 4CGTA 5AC5A 1E4NA 1PDZA 1AZ1A 3N6HA 4A3HA 3ZVHB 4FXRA 2RDWA 3VGEA 3AS0A 2ZRZA 5GPRA 4O54A 2QGYA 3QPZA 1K9EA 1OX4A 1EC7A 1VJSA 5HPOA 1VBRA 3AMLA 1BSIA 1ZHAA 1IEXA 4BY3A 1UR2A 3WMCA 2Q71A 4NAFA 4RDWA 4XIMA 3NDOA 4GNJA 3GDBA 1UC5A 3G1SA 2DW7A 1JCXA 1OADA 2FDSA 4G8TA 4S23A 2WHKA 1LJYA 1S2AA 1MZRA 3ARYA 1GOMA 3G1VA 1JF5A 3S83A 1PYFA 2XH7A 1ECQA 1U1UA 4JQ1A 4DPPA 2YXXA 3GNXA 3IJ6A 5LXXA 5A5WA 1DIKA 5GJNA 3UD6A 2V8ZA 3UWQA 4JX4A 2HDJA 5ABFB 3HQ1A 1XGDA 1W1A1 2YCJA 3FYOA 1NELA 3IWPA 1MQQA 4XSLA 1MXGA 3S9IA 2YL5A 3UETA 3T8LA 2OKOA 3SY8A 3CQIA 4AD2A 2I1OA 2P10A 3VMNA 5A6TC 1AQHA 1IGWA 4RL3A 1UH3A 3OA3A 1PX8A 4ZQOA 2VR4A 4J3VA 1E6XM 1SYTA 2YBTA 3PF3A 1I4NA 2YDSA 1VFUA 3VVGA 5HAOA 4JTUA 4ZA0A 5AHLA 4AMAA 1I8JA 5CXPA 2J7CA 5LNWA 2VRQA 3G1HA 3QV8A 4IIFA 2ZDRA 2CKRA 4E38A 4K37A 4DJDA 1I0BA 1J0HA 1J10A 2OR2A 2PFHA 4RDYA 7ODCA 2INEA 1GVQA 3L4TA 3NQEA 1UP0A 4PTXA 3BZJA 2F6KA 1AODA 1L6WA 1QOQA 1DJGA 1XCXA 1DJYA 2YSWA 3VIMA 1R9YA 3MMTA 2B7NA 2YDAA 4M6VA 4AD4A 5CSUA 5I78A 1RBLA 2ZZ3A 2J75A 1IF2A 4FNRA 1Q4WA 4I90A 4NZJA 2BGQA 1LG2A 4G7EB 2X1RA 4GIEA 3DCPA 1PB0A 3VUSA 2XM2A 3L0GA 4JN6A 1SPQA 1R85A 1OVDA 1P6WA 4QSHA 5EGRA 3DFYA 3H2AA 1IXNA 1VRXA 4P61A 1OT2A 2W27A 3GYEA 3VTRA 3W07A 1LROA 5MKGA 3OBEA 3W7NA 4N02A 4WDUA 4U2ZA 3UYCA 4HQVA 1V0MA 3LTYA 4LVFA 1OCJA 4Q8MA 3GO2A 1FDZA 3HG4A 3W22A 2JF7A 1DWGM 1UD8A 3I6EA 4UQCA 3ONCA 5AHEA 1TRIA 1JNDA 1KNWA 1XYAA 3PY2A 4HSOA 4RDZA 1DJQA 1EP3A 1XD0A 2QMJA 4PTNA 2Z24A 3PJTA 1KTBA 2AL2B 4LYPA 2Y63A 4N0RA 4LYQA 4O53A 1PSCA 1RY8A 3QRHA 3A9BA 4IPPA 3DYOA 4B4FA 3QYSA 4L1GA 2NXHA 2PD9A 3VOFA 1V6YA 2VDGA 3WUFA 1OD0A 4Z2KA 4TVUA 1HJXA 2FIQA 3RIKA 2ZFAA 4PMVA 1NWRA 4HSHA 1OFBA 3DXIA 4Z2LA 3O07A 4KESA 1S2TA 2OSXA 3WF3A 3H2OA 3O16A 1M53A 3M4HA 1R3RA 3GS6A 1XDJA 3JU2A 3PUOA 2DSZA 2XM1A 4LGXA 3BLIA 1KM4A 4DWDA 1UH2A 4E5TA 4QITA 5LIUX 5F2LA 1N55A 4OT7A 2XZ9A 1M7XA 3KZSA 1SO5A 3K5XA 1Y65A 3HBLA 4LEFA 3QZ6A 2QJGA 3LCIA 2CZ5A 2Y5JA 1DTNA 4QNEA 2BHUA 3OLIA 4Z2HA 1BQGA 3BZGA 5HA7A 1DJZA 3FGCA 3BGGA 3LM3A 3UXIA 2Z0IA 3R1ZA 4GKLA 4YS1A 4RJEA 1UD3A 1BKSA 1J93A 3NXLA 3WD3A 3VD3A 3EPNA 4M80A 3TYAA 4JHZA 3SI9A 3DZ1A 4XZIA 5CC5A 4XZHA 1XLKA 1TTPA 5G2HA 2YL9A 3WH5A 4DAFA 1HL8A 3U9IA 3QFEA 3S6DA 1DWAM 2YL8A 3CB3A 2Y0FA 2DZPA 9XIAA 5GNZA 4MGGA 3VOIA 1XCFA 2OGJA 5HATA 2A85A 2PDYA 1K02A 4ZSUA 1IXQA 5CZJA 1ZBKA 2XH4A 3GK0A 1QO5A 3E2SA 4UBPC 3BSMA 1CGUA 3CLMA 2BOFX 1H7WA 3WLHA 1OINA 3D47A 2G97A 4CD8A 4UQDA 2QCCA 3LSCA 2J7HA 3TYDA 2IW0A 1O5KA 3WFAA 4QJ1A 1P48A 4D6HA 3W7EA 7TAAA 3AALA 4GVIA 3QLDA 2DU2A 1ONXA 4GQQA 1BWVA 3EDFA 4EWJA 3BXWA 3W1NA 4JFUA 1OK6A 1EQCA 3MUCA 4YWSA 1V02E 1YRRA 4HHHA 4IXHA 3WIJA 3DENA 3M5YA 1WUFA 2X1IA 4HNLA 1WDRA 1S2WA 1S1PA 3QGAC 3H7RA 2IS7A 4PCSA 2WWCA 2NUWA 3EOLA 2ZDSA 2REQB 3MCMA 4X2RA 4JY9A 2ZUNA 3OJGA 2WNWA 2PRHA 2WZHA 3EDKA 1FHDA 4GUFA 4C1LA 1WDDA 3E49A 3N2OA 5DN1A 2Q3OA 4GYPA 2DDXA 4IPNB 3CAWA 3BW3A 3OB8A 4DQWA 3MCOA 3CUHA 3PZIA 1VFHA 3VX1A 1IR1A 4J3WA 3QQ1A 5IHSA 1DPMA 1JZ6A 5XIAA 3EAUA 1GG1A 5I79A 1A4MA 3TYZA 2GUUA 3HV8A 1WKDA 1DXIA 3BTNA 1XHGA 4DB7A 1XLBA 8XIAA 1VPQA 4D8ZA 1PIIA 3OQEA 2PPGA 1G7VA 1GHSA 1TPFA 5C9RA 3LB0A 3QC0A 1UPPA 4CNUA 1DOSA 3P2VA 1M9HA 3G8EA 4MWAA 1S3TC 2PTYA 3RITA 2WWDA 2UY5A 4GZIA 2OOGA 5G4EA 3CEUA 3MDUA 2IPGA 2OX1A 3AI0A 2PDXA 3N4EA 3VKCA 1UKSA 1Z89A 1E55A 3G1RA 2PDBA 4LUJA 2D2OA 4FIQA 3ISIX 1EDTA 1TR9A 2FHCA 3ZLGA 2ZTJA 5HK4A 2IMRA 3QEZA 3EBVA 3FKKA 3F4NA 1XYCA 1PZ0A 4WK9A 4HTYA 3A21A 1XLEA 4V2XA 5FKYA 1W5MA 3RPMA 3ARVA 4H41A 1C29A 5JBFA 4FLOA 1E6SM 3B8SA 1TPB1 1SFSA 5C9XA 1V3HA 4GZEA 1WZLA 3OQ8A 2YBUA 1QAPA 3K8KA 1QU4A 3SCSA 1ENUA 3TU9A 2V81A 4O4VA 3UG8A 4EVZA 5CG0A 2W5FA 5LA2A 2PAJA 4ZE4A 4HNOA 3PHAA 2ZKMX 4NILA 4ZEPA 4O1DA 2YPIA 1J0ZA 3TC7A 5FEPA 5CBJA 2O9PA 2QJNA 2OEKA 2BVTA 2GGJA 1OFOA 1DXFA 3FVMA 3KBMA 3S47A 4POCA 2NVDA 5LKYA 1KBBA 5A6BD 3CZEA 1OEPA 2EKGA 2W79A 1PV8A 4JEQA 3WQFA 3B0VC 3EB3A 5HJLA 3NO5A 4S3CA 3VE9A 1I6NA 3DKJA 4LY4A 2DSKA 5A2CA 2Z6IA 5I3JA 2YL6A 2QXWA 4NU7A 2QV5A 6XIAA 1RUSA 4DO6A 4AB4A 3GIYA 2HEJA 2R14A 3AMGA 1NWSA 4PMJA 1FCUA 3HFTA 3IAQA 3IK4A 3P8JA 3BG3A 1LLOA 1LOLA 1OQFA 1UZDA 5D32A 5LA1A 2WKGA 1GVIA 3U0HA 3WELA 3MZNA 4C7FA 2NV1A 3LM7A 3PBUA 4LW7A 4PCPA 1JG9A 5D38A 3IIXA 3NNTA 1LP6A 1KCLA 3FA3A 4CNOA 1MW0A 3AIQA 1JCLA 5DCBA 5BWFA 2BNJA 5HUOA 3W00A 1YLVA 4Y8FA 5CCZA 4UZSA 4DNMA 3ITVA 1GGOA 3IS4A 1ZJHA 5ECVA 5KSWA 2C0AA 5I7GA 3FDGA 1UR3M 3KBVA 4DVOA 3IUDA 2EPNA 2D69A 1HGWA 4JFVA 1WX0A 3UNTA 5KMYA 4UFJA 4UFKA 2TRSA 1KFCA 2XN0A 4AUBA 2JGQA 4H01A 4MLJA 4B5UA 4QXIA 3H55A 3U4FA 2BXVA 4NZ3A 2E4TA 3NZQA 3BG9A 4ERIA 3R10A 3J7HA 3QY6A 3KW3A 1A5BA 3WL0A 1W0MA 3FXYA 3KS6A 1BG9A 5AHFA 3RCYA 3VDCA 1FVPA 4PSPA 1RJPA 2J8GA 4YN5A 1PZ3A 3P82A 4H2CA 2WHLA 5C2CA 3SQLA 4A2RA 2WMKA 3LGEA 2R24A 4C1NB 5F2GA 1MW1A 4Q8NA 3MQTA 2CLKA 2FFCA 3IARA 3WBYA 1SO4A 2V5CA 4LBSA 2ZRYA 5DCDA 5C7VA 3CWHA 1H0IA 1WDPA 4O52A 5DY3A 2RFGA 1QDSA 1X1NA 1B90A 3WDIA 3RCNA 4AZHA 3IV8A 3W81A 5CH9A 1P1XA 1V6VA 1S46A 2PLCA 1AG1O 1MZHA 2J79A 3BAWA 4UQAA 1H1NA 1GVOA 5E0KA 1D8WA 1KO0A 5G4HC 3TQPA 4UTTA 3NPVA 3QZEA 1UKTA 4HA0A 4S2BA 1J5TA 4DLFA 3S8HA 1F3EA 4AHOA 5K2ZA 3TC3A 3KVLA 1VCGA 3CQKA 2XZ7A 4OVXA 1AD4A 3O6CA 3TV8A 3G1FA 4CN1A 2DZSA 2FYMA 2CKSA 4Q8OA 4WDWA 1HUVA 1KTNA 3LZ5A 1K70A 3OA5A 6ENLA 1FWNA 1HJWA 2PGWA 3UF9A 2BGSA 1W56A 3H4GA 3MVTA 4Z2JA 3N17A 3WH6A 4ADUA 5CC6A 3ABQA 4YTUA 3QF0A 5DXXA 3AU6A 1XLJA 4GYFA 2Z1KA 4REQA 4MNLA 2D23A 3WNKA 4TMBA 1C9DA 2J78A 1NSJA 3QKZA 4IG2A 1MFVA 3GXDA 5E9AA 3E2RA 3CPUA 4U2YA 5KZ6A 4YMZA 4LANA 3VCNA 1GOKA 2BHZA 3CUFA 1UG6A 3MP3A 3MI6A 1MNSA 4UOQA 3L4YA 1QTWA 3M5VA 3H54A 3PULA 2YBVA 2PGFA 4D72A 1OGSA 4BEQA 3CS2A 5KITA 3FEMA 3TMQA 4JAWA 4DBEA 3W4RA 3DG7A 4UQ9A 4GUHA 3EXSA 3BOLA 3GUGA 2GJLA 1XLCA 4YYFA 2FPYA 3VD9A 2JEPA 1YXDA 3AAMA 1JL8A 3G3DA 2OT0A 3U2OA 4O0QA 4QM1A 1AQMA 3PSWA 1D7FA 3EMZA 1FQ0A 4US6A 1KRBC 4HU3A 4FEZA 4M56A 2NQZA 5FAJA 3DH7A 1J5SA 2O7SA 4Q4OA 3H7VA 4M8UA 1DQWA 2I9EA 3NZGA 1MQRA 3N18A 3RM8A 2I7GA 2AL1A 3BK0A 1YTKA 1KQYA 1IWPA 3HGRA 3HQNA 2DT1A 4KT2A 1BTCA 3PP7A 4AYSA 4GFSA 4KGLA 2CZDA 3LYEA 2O9RA 3MMDA 3HJZA 4W5ZA 3CHFA 4AEEA 5CGQA 4PUEA 1YIXA 4H4IA 4N9CA 4JTIA 5CBBA 3MTWA 4BWLC 5G1MA 4C5ZA 3TAKA 1TVLA 1VLWA 1E6QM 3W23A 2WMGA 1QK2A 1S2VA 4PRWA 3BAJA 4B9ZA 3ICJA 4U3AA 2WMFA 1F6PA 3W6MA 4Q8UA 4R7JA 4V15A 1SO6A 1K3UA 4JFWA 2YOCA 1IIHA 2X05A 3TXVA 2UY3A 3R12A 4RV8A 5EB8A 4E8CA 3WJXA 2BOGX 3APYA 2QVHA 2IPFA 2YKKA 4AEFA 4FS9A 4J2MA 4UTTC 3W2UA 1LL7A 4YPJA 1KRAC 1XM3A 3A4XA 3UP8A 1LRTA 5FEWA 2VEMA 2Z1BA 2PLMA 1W3JA 4ATLA 3IRDA 4JQ3A 4DYJA 3NQFA 2V3GA 4RXGA 4AQLA 1UWAA 1FHUA 2CLIA 3PBVA 1CDGA 2HISA 4HU8A 1O5RA 4IHCA 3RM9A 3FGCB 4ZZ9A 3HQOA 4JTTA 4PCFA 1LORA 4B5WA 2X1UA 3GM8A 4GBDA 4P2VA 1E15A 1M65A 1DORA 3N11A 3R89A 2JIWA 1XBVA 3EDJA 4JHOA 5DELA 4BQ4A 3JRKA 1MXDA 1K7FA 3N2BA 1NEYA 4ACZA 3NR0A 3WQ6A 3WH8A 4BKNA 3WBAA 3QW4B 3DFHA 2WSYA 1R3YA 4JNYA 3WNNA 4PMOA 4W8AA 5I3HA 1B0IA 4DM1A 1VB9A 4R7WA 1PDYA 4LC8A 3FFSA 1OFRA 3RO6A 2ATSA 4O50A 1CI1A 2ZC1A 3BPWA 3VZXA 4WXZA 3WBWA 2OSYA 1H62A 3K1GA 1JCYA 3CHEA 3PZQA 3GW3A 1JCJA 2WMIA 1B3ZA 3DECA 3HJEA 4L6OA 4HK7A 4I6VA 3TP4A 3M0HA 3O8AA 4L5ZA 1QNQA 3TONA 2XPKA 1KM6A 2IPWA 2WNNA 1HKVA 3KDOA 1DV7A 4UTWC 1E9YB 1NTHA 1KFJA 1E3ZA 2MUCA 1QASA 4DZIA 1AJ0A 3GXNA 4MB5A 4HKPA 4MZ8A 8XIMA 4F0MA 2C7FA 1FXPA 1PE1A 2PDUA 4PRTA 1MWOA 3L2MA 1CGWA 3S5OA 5CC7A 5AZ1A 2JE8A 2ODOA 2V30A 3V0TA 1UASA 2QCGA 4LV4A 4F0LA 1SW7A 1ELSA 5A8GA 3URBA 1Q8AA 1H7OA 3ARWA 4CD4A 2DIJA 1VEMA 1W5PA 1WDWA 3AYVA 4MPQA 4Z42C 4KFPA 1MSSA 5I07A 1ZALA 1EJVC 1R2TA 3MMWA 1UPMB 3KFTA 4W88A 4MHBA 3TKFA 2VRJA 1CYGA 3W86A 4RZ5A 1VYRA 1I2QA 4B4HA 1BYCA 1X39A 3TK7A 1W5QA 1E1CA 1GHRA 4MWAB 3Q67A 3W2MA 3PVFA 4PZVA 1KBKA 4O4WA 4BCEA 3T08A 2DQWA 2QUMA 3H26A 1FXQA 4LS0A 3OU8A 4JHMA 3NPWA 2XSBA 4F40A 3SY1A 4NNBA 1S5MA 3CPGA 3ABSA 4LOCA 3WF4A 1GTHA 4Z0JA 5DMYA 4GBUA 1ISWA 3VIOA 3I6RA 2RGLA 2JEQA 1BXCA 3KBNA 3PWAA 4GA8A 3DYMA 2CESA 4DJEC 3W6YA 4QE5A 2Y1HA 1LDCA 2OQHA 4A8LA 1EC9A 4HJFA 4EPDC 1U83A 2QDHA 4ICCX 4ZTXA 5C9ZA 5I00A 3KWSA 2I5IA 1GUVA 1FH9A 3G8RA 5C6MA 1FHVA 1ADDA 2PS2A 5DBTA 4PR4A 3BO9A 3W2NA 2DEPA 2P88A 2R91A 1EA0A 5JU6A 1P1MA 2ISVA 3K4AA 3VIIA 3M0VA 4WDTA 1YE4A 3W9ZA 4QLKA 1NOFA 4HNTA 1DWHM 1YTDA 2WJZA 4NZCA 1MFUA 1QNRA 1R2SA 1ZL1A 1TWSA 5D8WA 5BU6A 1RZMA 4LRTA 3DBPA 3PTQA 4MM1A 1CLKA 5A6MA 1PTGA 2OYLA 4HYVA 3WL1A 1V4YA 3BG5A 2WJDA 1B30A 3T81A 1OZMA 1HX0A 2VD8A 1TMHA 1TV8A 4EP8C 1FCQA 1PBGA 4MVAA 4HMCA 2OWCA 3MDWA 4FLRA 1GQKA 1D9EA 5LIKX 1ZAIA 1MNZA 3ZOAA 1W8GA 3FIGA 3WK2A 4HCLA 1CB2A 2I17A 1E40A 2GQAA 4NX0A 4W93A 2CHNA 2R1KA 2HVMA 3GU1A 3F2BA 4NAEB 2CHRA 4JTCA 4XD5A 4JQAA 4QE1A 3C3NA 3C3UA 3LCWA 4MOZA 5HINA 1ZCCA 1H5VA 2WPBA 1C7SA 2DUAA 3TE9A 1FWDC 2P3ZA 2VEKA 3OHMB 4NI3A 4HSNA 2V3DA 5BXPA 5CPQA 1EA9C 3W1AA 4Q8TA 5LIXX 4QEHA 2Z1WA 1WXJA 2QDEA 3GDLA 2AQWA 4LC6A 3VABA 4GCXA 4DXVA 2VT0A 1EDQA 3VD5A 1DJWA 3UZ5A 4DBWA 1UZ4A 3M0LA 4XIAA 3R4IA 1HVQA 4Z1BA 3RF9A 2TMDA 1OF6A 2PDIA 1TPC1 1TA3A 1JFXA 4ZCWA 1CNVA 2Y7EA 1EOMA 3HPFA 3VOCA 4S39A 1TV7A 3VX0A 4MMWA 4LY8A 1I1WA 3N73A 4O0ZA 4JNZA 5A8PA 1BF2A 3ZJ8A 4B15A 2F61A 4OUIA 5KINA 5H2ZA 2WCAA 4DM2A 3IIPA 3NL2A 4Q7BA 1EYWA 4CU8A 3L21A 1L8PA 4XBJA 1V08A 2XIQA 3E12A 3HV9A 4EWND 5B7YA 3EOEA 3WD2A 1DJNA 1WDQA 3DFTA 3D3AA 5BXTA 5AYZA 3RAOA 3TTYA 1YKWA 4JYFA 4KWWA 3S3GA 3E6EA 2Q6ZA 2C0HA 2OWXA 5D4YA 4GI9A 5FJTA 4JR5A 3F03K 1W2PA 4PB5A 1IT0A 5F2MA 1VBGA 1V0KA 2DT0A 4WXYA 3VKKA 1GVFA 5FJPA 4NYUA 4ZOEA 4WKFA 1BRLB 4G9PA 3HPZA 3QN3A 4PL1A 4AIUA 4AZ5A 3BLDA 4O12A 2GGHA 4WD0A 3P81A 3DI0A 4HGXA 5AHMA 3SCRA 4FXSA 3EWYA 3JS3A 4C90A 1JYXA 2WAGA 4O1CA 1LUCA 3K8LA 2CBVA 2BG5A 4WJXA 3R25A 4WGHA 4WLCA 4WVXA 4R9XA 1XDLA 3GTIA 3IVSA 2C1IA 5HUPA 4Y9PA 2FVLA 3A4JA 4XO6A 3ZR6A 2OSWA 3KLLA 3AIWA 4URIA 3K4DA 1FH8A 4TV6A 2CZVA 2P3EA 3QV7A 4PC8A 1XIHA 3FEQA 2JKEA 1F2JA 3RMEA 3WEOA 4AMCA 5E09A 3P60A 1WOBA 2F8QA 4REQB 3GVGA 1UOZA 3RLUA 1FWJC 4XAGA 2GJPA 1LRQA 2CBIA 1XLLA 3B97A 4OE7A 3UR7A 5TIMA 3P8IA 3SZ8A 3WDRA 5CKSA 4D6IA 3ITTA 1N8FA 3IIOA 3A4WA 1M7PA 1XRSA 3A9IA 4XB3A 1TKKA 3GTHA 3ANUA 5I03A 1OFPA 2QV4A 1JCTA 2D0GA 3LXCA 4GINA 2CZEA 3TWBA 3GX9A 3QMTA 3QVQA 3W24A 2NSOA 1SFTA 2OZ8A 2WSPA 2QUNA 3N15A 4IUGA 3KE0A 2DW6A 1GVSA 4JEJA 3A4AA 4EK7A 1VIWA 3QR0A 3CU2A 1U33A 3E0VA 3KCOA 3IK2A 2CXGA 4NXSA 3N2XA 3APTA 2XWDA 2PZNA 3L0KA 1AL7A 1UJPA 2QCLA 5D9OA 3STCA 4GGHA 4I9JA 3AIEA 3UJRA 2W4XA 1AD1A 4JICA 4EIVA 1PUDA 1EJUC 2H90A 3ZLFA 3SRHA 4N6FA 4J3UA 5CAHA 1SW3A 4B2DD 2EPOA 3R11A 2Q8LA 1A5MC 2YJQA 4J7RA 7REQA 3PAJA 3KVKA 1HNYA 5M3WA 2Z1VA 3BMVA 3MSDA 2WVUA 2CLFA 3RX3A 1K9FA 1UP2A 1LQ2A 1OM0A 1E0UA 1EL3A 4D6GA 1B9ZA 3A64A 3T4WA 5LGXA 3B8TA 2PF8A 4GIYA 3FA4A 4D1JA 3G3MA 3N9RA 1GW1A 1WZAA 2BBFA 1Q6CA 4NZFA 2FVKA 4X0VA 3MHUA 5DXYA 3TYUA 3GTXA 2TAAA 4KWOA 1JPMA 2X1TA 3L9CA 3T09A 1UZHA 1SW0A 4GVFA 4MAVA 2NUXA 4O19A 3E5BA 4WY0F 4I9AA 4PMNA 1E6ZA 4XAFA 3W1TA 4UC5A 1EGZA 4Z1AA 1GVEA 3QV6A 5SWUA 2D3LA 3N34A 3XINA 2NQ5A 3VC6A 2E40A 4NIRA 5C2GA 2WQPA 4ASTA 2Y70A 2PURA 4YNGA 1O7AA 2QCNA 3E02A 3EMQA 4K6AA 4E2DA 4ZO8A 4KFOA 1VD6A 1KLZA 1R2RA 4IFKA 3LQGA 4XKMA 1ZTVA 3NEHA 3THQA 3D6NA 4A8RA 1PHQA 3I3DA 1GVYA 2WW5A 1NDYA 3BUVA 1NIUA 5A8OA 2H6RA 1GYMA 4ZB2A 2ZZ7A 2ZWYA 2X1SA 3L66A 5FJRA 3ZT5A 2VEPA 3KP1A 3W01A 4FLQA 1X8FA 3WH9A 1VFFA 4O17A 1E70M 5IDZA 4KWSA 1KM0A 1ICPA 2G3IA 2VXNA 2G4FA 4AXKA 2Y6ZA 4UMAA 4R33A 2P50A 4LF1A 4UR8A 2ZX9A 1NFPA 5LGZA 3ITLA 4ZVJA 4ACZB 3FLUA 2C18A 1RD6A 2UBPC 3N3TA 4MUZA 3TZNA 2R94A 1UMYA 1QATA 1J0IA 3TWAA 4QHRA 4RCXA 1JDDA 4U4MA 1G01A 4BQ2A 1Y8BA 1FY6A 4YHEA 1GQIA 3W7HA 4NZ1A 4J3SA 1H63A 3NOEA 4GXPA 1F9CA 2O9OA 4ML4A 4MKSA 3QXBA 2WMIB 5TBOA 4UOZA 1W1TA 3BMWA 3GR7A 2B31A 4P7LA 3SN1A 2CEQA 1CGTA 1W9UA 4I7VA 4KCTA 2VUNA 1XC4A 1WAUA 3WYZA 3N13A 4S3DA 2JBMA 3LRLA 3HPAA 2X16A 2OZ0A 5D2YA 5FL0A 3NYZA 2BY2A 1G94A 2QUVA 1QK0A 4N9BA 1Z32X 7CGTA 3L12A 2OZTA 1DIOA 4F2TA 4YVXA 2NV9A 2QAFA 2G95A 5A8NA 4GMEA 2FMOA 4MZ1A 3PFMA 2BASA 1I2NA 2XFRA 1NARA 4MUPA 2XIIA 2P0OA 1ZZMA 1Q7QA 2PWFA 4XZ9A 4JS3A 2XIOA 4W7VA 4Y90A 3TNOA 3S1GA 4CNNA 1XIMA 3NPXA 1JEZA 1K7XA 4HPNA 2GVYA 3EA2A 1D3HA 1JUEA 1XH2A 5I5RA 3KXQA 1WXZA 2WB5A 2C14A 3S42A 1VJIA 2QULA 1F5ZA 2O7QA 2QGHA 1F4AA 2OOFA 4US5D 4DI9A 2VFEA 1FWAC 2A3BA 2OEJA 4DWSA 3UG5A 4C6LA 2E5CA 2W63A 1TJPA 2NT1A 2IKGA 4HMNA 3AS1A 1RLCL 3ZT7A 1E1CB 4ZO7A 1KW1A 3NZRA 2E9BA 3AYSA 3NAVA 3WNLA 4UFIA 4W7UA 5EMJA 2DIKA 1M6JA 3V1HA 1Z6KA 3HN3A 3OYZA 1JPIA 5MF5A 4NZ5A 1EQPA 1NP0A 3C2YA 1KQZA 3RRXA 3LCFA 4MDOA 4KERA 3U2ZA 5LHFA 5EU9A 3OTRA 1AH4A 5A3HA 1XG4A 3VNKA 1O94A 1LOSA 1JZ4A 1PKYA 5F1VA 3LBOA 3LHVA 4DJED 4L4MA 4JNMA 3C2FA 1LT7A 1E4MM 3GXTA 4ALDA 1ISZA 1KC7A 2OGYA 2ANUA 2VYOA 2XFFA 1RBOB 1ZBVA 3DI1A 4FHAA 2PDHA 1V3KA 1HJVA 2BXYA 2POTA 4X63A 4IF2A 2RDTA 4U5IA 4UTFA 3ZWSA 4FX6M 3K8MA 4W4QA 3ABZA 4DF1A 4TX6A 4U33A 2GGGA 5AZ0A 1VHNA 1YX1A 2VDIA 4B3LA 3LCXA 3VDBA 2H3DA 2ZXQA 4YTRA 2VP8A 4MB3A 4YCPA 4ADSA 3KRZA 1G4EA 4LX4A 1CXKA 1RALA 1Z9AA 3OYXA 1QNSA 1OK4A 2W91A 1UH4A 2CWXA 4ZTYA 2VUYA 4Z17A 1F7BA 1Q2SA 3BL3A 4EPEC 3TN4A 4IT1A 3U2EA 3PWGA 3DHFA 4UIOA 3KTCA 4HN8A 3MV01 1YW1A 3B9NA 2QJJA 1C90A 2BXZA 4YWIA 5EMYA 1PTAA 5A95A 1UR4A 4XX6A 1IWBA 4PBFA 3TTQA 3ZSSA 4PFHA 3KLKA 4HNUA 4D6CA 1QW8A 4Z1DA 6A3HA 5L9FA 3BQ6A 3V75A 4US5A 2CLEA 3IUHA 1IXPA 3CMGA 4HPGA 4A22A 3AHXA 1J2BA 4DJFA 1W9VA 5LSMA 2B7PA 4JTDA 2BS9A 3PUDA 2YFOA 3G6MA 3BANA 3NCOA 1KA9F 3V7PA 3AICA 4IJRA 5BXRA 3KWXA 3S1UA 1ITUA 4XD4A 1MEIA 2KAUC 3H4WA 2GLKA 3TW6A 2P8BA 3LNPA 4O14A 2QUTA 4WQ6A 3SGGA 1IEIA 4GG9A 3VGBA 3V5CA 1DHKA 1SR9A 1PKLA 2J62A 1EH9A 1TJ1A 2G5WA 1CXFA 3T6CA 3OIXA 2C19A 1T0OA 3M1ZA 2Y8KA 3MW7A 3NQDA 3U7VA 3FHAA 3VIHA 1Q85A 2RDXA 1F76A 3R5EA 1G4SA 3UZWA 3C56A 2ISWA 5DRIA 3S5YA 3VKJA 4GJJA 3B4YA 2QQ6A 3HG3A 1HVXA 4QBXA 3P61A 2V9DA 4RZBA 3LHTA 1KM2A 1Q7MA 4B91A 1TA3B 1XPYA 2OT1A 2YYUA 1VFSA 2F84A 3GG1A 2ZRWA 5XIMA 2VKZG 5HANA 1H1ZA 4V28A 3VOJA 1ME8A 3VNZA 1C8XA 3NQMA 4X60A 2OO0A 3Q37A 2X0SA 3HOJA 2VCCA 2VZSA 3SN0A 1X7IA 3QM3A 1UUQA 2QW5A 3OZOA 3VI2A 3WLJA 1KFBA 3HQPA 2VURA 3SN4A 1WYIA 3P7YA 3OGVA 1UW9A 1GQNA 2P53A 4KEUA 1GK8A 1XSIA 2XVGA 3HO8A 3RYSA 4QJ3B 3LDVA 3AIUA 4V33A 1IEWA 4QCEA 1A5KC 4X2PA 4PSRA 3BAKA 2QZRA 4JTEA 4ORMA 2PU0A 2X8RA 5FF0A 1T8QA 3CTTA 1R3WA 3C52A 1IT8A 3E0IA 3NQCA 2Z7KA 1GOIA 4XVDA 1KGUA 3R8GA 2JQXA 3AUOA 3NVTA 3WLKX 2VHLA 1EPVA 3NZ1A 3WNMA 3LCGA 4IIDA 1W3KA 1W5OA 2PDFA 4W9TA 4E3VA 3HURA 2VJXA 1LUCB 3W29A 4KWUA 1F61A 1Q6FA 5E0FA 4GUIA 2QJMA 1RY0A 4H6RA 2FVMA 2XG9A 4Y9AA 3RNDA 4L1WA 4MG4A 3RILA 5A6LA 3CH0A 5KZEA 1DEDA 4IMFA 1XI3A 1RR2A 1P0KA 1JZ2A 1W1PA 3QQWA 5GJMA 3WD4A 4C6CA 4QJ5B 1M5WA 2XN1A 1KXHA 1JZ8A 3LHUA 3ARRA 3NJ3A 5DQPA 3HFYA 2PDWA 2FZBA 4FOUA 3ME3A 2UV8G 5C9WA 2V63A 4RV3A 4TX9A 3BH4A 4M19A 4RR4A 4PMDA 1QI4A 1LQAA 2J9YA 5E6YA 3QQ0A 1EJXC 2WVSA 4QCFA 3D5HA 2XYLA 1PIFA 2CNCA 4QLJA 3W84A 3UXAA 1R46A 4UR9A 1PS9A 2PDCA 4MIMA 1HJQA 3GE7A 4LNYA 4PUUA 4IP5A 1N8IA 4L65A 3PR2A 5HR7A 4GIAA 3PZOA 3M0KA 1A49A 4Q33A 4GI8A 1F3XA 4MLRA 1XX1A 5K4ZA 2YA1A 3VNDA 5BOOA 3CUJA 3PZMA 4BR1A 3HMCA 4KEMA 3GNRA 3P5YA 4S3EA 2B81A 3MP5A 1KCZA 2GVEA 4K3ZA 5DT5A 4IQEA 3OGRA 3M44A 4O10A 4W87A 2AAMA 1RBAA 1OABA 1SJBA 3PBWA 1FKXA 4AX6A 4BFAA 3WQ4A 5C7HA 3THCA 1TQXA 1NWUA 3A5FA 4H9ZA 3UA3A 4GVHA 1UCWA 1JDCA 4CD6A 1TTIA 3IJLA 4NUWA 2WNZA 1XH0A 3TSMA 1YPFA 4GVGA 1FA2A 4GXMA 4HNCA 3VIKA 3LCHA 1Q13A 4ZE5A 2IQTA 3SADA 4IISA 4MY8A 1U1JA 2CLHA 1YDYA 3VIPA 1R86A 2OX4A 4LUYA 2OPJA 1LWHA 4BI7A 1DBTA 1TX0A 3W75A 4YYCA 8TIMA 3QKEA 3PJXA 2Y8VA 4QR6A 4IP4A 1MDRA 3DC0A 3ZO9A 5T9BG 5IBXA 1A4LA 1CLXA 4TX8A 4C1KA 3B4UA 3KRBA 1E51A 1BXBA 1SVDA 3KL3A 3G77A 3LBMA 1IXOA 3TJXA 1OC6A 3T2QA 3FDKA 3VGGA 4H7ZA 1N82A 5REQA 2GQ3A 3POHA 5A8MA 3UW6A 1T5AA 4G7FA 4H7CA 4ZL1A 2A3HA 1XLHA 2QVNA 4K8EA 1W2VA 4S3FA 5A6AA 1VF8A 1NDVA 4IFKB 3CASA 1TJ2A 3RLGA 3WJZA 4Q32A 1DL3A 1G1YA 3V16A 4UFMA 4K8GA 2HV5A 4YJ5A 3PFRA 5E9XA 4X9YA 2NLYA 2PDKA 3AJXA 2FPTA 2XSXA 5I3KA 4G2DA 3TNBA 3CEPA 4FZIA 1CXIA 2QDGA 1FWWA 5H91A 4FSAA 4B5VA 1FH7A 5AVHA 3PTKA 3MBFA 4YCOA 5AC4A 1Q45A 1GNXA 1NWTA 4DELA 1X1OA 2GSJA 4JTRA 2YXOA 2TSYA 3EX1A 2QAPA 5C54A 4INFA 1BYDA 1BHGA 4NJIA 1TB3A 4PB3A 4HZ7A 1BVNP 3FCPA 4GC4A 3WFLA 1LF1A 2ZXBA 1MI3A 4UOJA 1BXNA 4HHPA 2A2IA 1L6FA 3W76A 3ABXA 5E0CA 1VRDA 3LCLA 3W82A 4KCVA 4Q22A 5D37A 4CD7A 1RH9A 3AWOA 1TO3A 3GWQA 3VDAA 2ZXDA 1DQXA 4MKVA 1KR0A 1QW9A 2Q09A 4EF9A 4NP7A 3MBDA 3LA4A 3CGTA 5A6JA 4AWUA 3WLOA 1W9DM 1KWKA 2Z7GA 3TJ4A 5BOEA 5F7UA 5CJ5A 3TQKA 4P8XA 2WZIA 5I06A 1E4LA 3WJYA 1DP0A 2DH3A 3F4DA 5J5RA 2GOUA 4AC7C 2AKZA 2J7EA 4C6OA 3N9SA 3IJ8A 3NGFA 2V5LA 3CMFA 4FNTA 3S5ZA 3WLNA 1H5YA 2ABBA 2NZLA 2ALRA 1XYBA 4EANA 4S38A 3QTGA 1R3SA 5CLTA 4IJBA 3WLSA 1EOKA 4J27A 1Y5VA 2C1GA 2QCHA 3GLCA 2XVLA 1VFLA 3S5NA 3DUGA 5CJNA 3WQVA 3P84A 3OVPA 3VZYA 4LS2A 3B0PA 3ZQ9A 4FNQA 1V93A 2PP3A 3S46A 3Q4DA 3WMBA 2BB0A 5I23A 4QTGA 3WQPA 4IQLA 1J0YA 5DT7A 4DY1A 1B4KA 4L56A 1NU5A 3AOFA 3O1NA 4UZUA 2Y7FA 1GEQA 1X38A 5GQBA 1JYNA 4HHLA 4JTJA 2XWEA 4MNKA 5EMUA 2EPHA 1YPIA 4DWSB 3S2JA 3E2QA 4L4PA 2YR1A 3WEZA 1FKWA 3KDNA 5C8BB 1E56A 3LY0A 1TELA 2NWRA 3EKGA 1SZRA 1YDNA 4AAJA 4BEUA 3B0XA 5I0DA 4QRNA 2GL5A 3AIRA 4AWEA 5IRPA 2I9UA 5EFFA 2AKMA 2CYGA 4L6DA 3L0NA 3LPGA 3F7JA 3QR3A 3HGJA 1UC4A 2OFJA 3PNZA 5CPOA 1MYRA 3BICA 3V18A 4IGNA 2ZE3A 1QPQA 3B40A 2DZTA 2PP1A 9CGTA 4M6PA 4KIEA 3RPTA 2PBGA 4Z1CA 1ZFJA 1PXGA 1BGGA 1NFBA 4IXXA 1MUCA 2UZ9A 2J66A 1NOUA 1QO2A 3ECQA 3Q2DA 3UWUA 1VENA 2DFAA 4AIBA 1I2RA 4N4PA 4PH6A 3ELFA 2DSVA 2OB3A 4KRTA 3UT0A 1OF8A 1H7PA 3P3BA 4PL2A 3CUIA 3CUGA 1XUUA 4C7GA 1ZBWA 3GDKA 1VFTA 3GTFA 4GISA 4OBSA 4P5UA 1TSIA 2UY4A 4LVAA 3AXMA 3THAA 4IGMA 5GJPA 1B3OA 3UJFA 2ON3A 4IMCA 4YTTA 4RK8A 1Y7VA 5CPNA 4KCWA 3SUSA 5HQMA 2HSAA 3V3WA 4QGCA 1RVGA 1LZOA 4JTQA 1JCMP 1UR0A 3TMLA 5JIPA 3VCCA 4YLWA 4JKKA 2VELA 1FTXA 4EACA 3C0QA 4Q4PA 4ZB5A 3L4WA 1TV3A 1HJSA 4ZGYA 5CLWA 3PZVA 2ADAA 2XINA 4PFMA 4MFEA 4P8UA