3HFTA

Crystal structure of a putative polysaccharide deacetylase involved in o-antigen biosynthesis (wbms, bb0128) from bordetella bronchiseptica at 1.90 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
242
structure length
242
Chain Sequence
RYDNKFARISDIDINQPESWRGRIFLTFDIDWAADFVLQDTIDLIEGAGVCATWFATHSTPLLENIRRNPLFELGVHPNFNPLLAGAHAEGVQEILDRTLELAPGCVSVRSHSLVQATSILNMFGERRLRYDCNILVPWDAGIVLQPWRHWTGDMVRVPYLWEDDVACLYDWEFDSTFDYWYQPDGINVLDFHPIHVYMNTESLRRYEDSREVHRNPVDLIRWRNTSAGSRTFLQSLLARNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WbmS, polysaccharide deacetylase involved in O-antigen biosy
publication title Crystal structure of WbmS, polysaccharide deacetylase involved in O-antigen biosynthesis (NP_886680.1) from BORDETELLA BRONCHISEPTICA at 1.90 A resolution
rcsb
source organism Bordetella bronchiseptica
molecule tags Hydrolase
total genus 82
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 3hftA00
2I5IA 5BU6A 5JMUA 2C1GA 3S6OA 3WX7A 2C1IA 1W1B1 1W1A1 4HD5A 2W3ZA 4OUIA 2QV5A 2IW0A 4NYUA 4U10A 2NLYA 2C71A 2VYOA 3QBUA 4NYYA 1NY1A 2CC0A 2Y8UA 4NZ3A 4M1BA 3VUSA 4NZ4A 4F9DA 4LY4A 3HFTA 2E67A 4NY2A 3CL8A 3RXZA 4V33A 2XU2A 4F9JA 3CL6A 4L1GA 2C79A 4WCJA 2DFAA 1W17A 4NZ1A 4NZ5A 3CL7A 1XW8A 2J13A 1Z7AA 1V6TA
chains in the Genus database with same CATH superfamily
4OZOA 3T7VA 1V3JA 1BYBA 1GPWA 4DBSA 4HNCA 5DCEA 1TIMA 1A5OC 1JUEA 1ODZA 5AZ1A 2CHNA 4D6GA 3H22A 5HATA 3H54A 1I0BA 4DZIA 1Q6QA 4YIWA 1EOKA 3AS2A 4OQVA 2BVDA 2GL5A 2YL9A 4Q33A 2NLYA 6ALDA 4U5KA 3XINA 4AWEA 1MFUA 4JCLA 4TOQA 4B3ZA 1LWJA 3SFWA 1RVGA 1DJGA 1JAEA 4H9UA 2FVMA 1GQIA 3J7HA 4Y9MA 2XPKA 2WLYA 4MY1A 3FY1A 3VNKA 2VX6A 4L6DA 2QV5A 4WR3A 3QV6A 4QG6A 3ARPA 4GK8A 1A49A 2D3NA 2YDQA 4HYVA 3LEPA 3S5YA 2VR5A 5EPDA 4Z2HA 4S3AA 4DYKA 4KFNA 4Z2IA 3IRDA 3C2OA 3W1TA 4TMCA 1TWIA 3UA4A 3SDOA 2QUNA 2V63A 3DFHA 1QPNA 1RQBA 2X0YA 2I57A 3T8LA 1EGVA 1HQTA 4ZQMA 2W66A 4UZSA 2ZA3A 4QLKA 5G4WA 5H8PA 3GG7A 4KEZA 3KBSA 3ZLHA 3RG6A 3OW1A 1T8XA 4H01A 4P8VA 3VKJA 2WC7A 4C5YA 4RPPA 3GFZA 1KFCA 1WPCA 1QPOA 4JX4A 2CEQA 1EO5A 3U7BA 2V5DA 3C2EA 1GG0A 5LHFA 4F0HA 4DM1A 1DJWA 1NDVA 3V1PA 3CK5A 2XHYA 1Y0EA 4XG1A 2BODX 3M46A 1P0KA 3VKAA 3V7PA 3CB3A 3BLEA 3HPXA 5IFTA 4CCEA 4B16A 4D9PA 2XFWA 1WKFA 3PC0A 4N9BA 4RW3A 1H7XA 3AUOA 4D6DA 1IHIA 1ONXA 3DFOA 1IQ8A 1VFSA 3MSDA 2QPXA 1M3UA 4I5XA 3LM7A 3GM8A 5E9XA 3QHMA 5FJPA 3RM9A 2PWDA 1PIFA 2D3LA 5TNVA 1F73A 1UUQA 4C6NA 4ZVJA 1UZDA 2D2JA 3O6AA 3H4GA 3E3HA 2BOEX 4IFKA 3TTOA 4Q4KA 4H9XA 1J79A 2Q8LA 2QIIA 4H9ZA 1KM6A 2E6YA 1S2CA 2H9AB 3PZTA 4XZWA 3QN3A 4XZBA 4AAJA 5GJPA 4Q7NA 2BSLA 2V3GA 3E0LA 4FXJA 2G50A 2VEFA 1VJSA 3NA8A 5A6SA 2V67A 2GWNA 2QCLA 4XV0A 3R5EA 3U0HA 3H55A 3MPGA 1XLMA 4A29A 3PUDA 4C6MA 1K7EA 2OLAA 3NQVA 4P8UA 3O0FA 3NJ3A 4W87A 1LWIA 1W3LA 3GHRA 3GAYA 1CXLA 4J40A 1DJXA 1JPMA 1RA5A 1FWFC 1UPMB 5G5IA 3ARYA 4GMEA 5CAKA 1NF0A 1YW1A 2IW0A 1K4GA 4RDVA 1F05A 4LVAA 3SB0A 2VX4A 1RR2A 3BJSA 4JNMA 1XH1A 4UTTC 1QDSA 1X98A 1ZLPA 5ABTA 3RMEA 3K30A 4WXYA 3SRDA 1PX3A 1MEHA 2DH2A 3CB8A 1VF8A 1EH9A 2QDHA 3PZVA 4CNUA 1LQ2A 3NEHA 4DJEA 4MSSA 5CPLA 4HU8A 3CIXA 3CQIA 5I02A 3DG7A 2ALDA 1SO3A 5CSYA 3LHUA 2WVTA 3PZUA 4LRTA 3BH4A 4H3DA 1UWSA 4ERIA 4E5TA 4JTSA 3ICJA 4OGZA 5H2ZA 4TIMA 4N02A 2OWCA 1UD2A 3CH0A 5DELA 4K7YA 1AJ0A 1YADA 2Z1WA 3SFKA 1ALDA 1XRFA 3H2CA 4PRRA 4NU7A 2J8TA 3UERA 1VLIA 3S6TA 3W85A 3BQ5A 4XD3A 4BQ3A 4LUSB 1FKWA 4C6JA 3XIMA 3WQ5A 2AL2A 3U2ZA 3DG6A 3R6IA 4LSBA 4A8NA 4ACYA 2WZTA 2POZA 4DUVA 2OLSA 2BVYA 2J13A 4HNOA 3GTHA 3VNYA 5H6HA 5CGQA 1ZJAA 2G3MA 1I2PA 3ME3A 3M64A 4MWAC 3LLFA 4KWWA 3W26A 1RBAA 2I5GA 1XYLA 2J79A 4OOZA 2ZUNA 3GH7A 3JU2A 2VZUA 4AC1X 3BOFA 3WENA 4Q6JA 3W37A 2CBUA 3ZSTA 3V5FA 4DVOA 2WZMA 4IT1A 5M03A 3KOFA 3W2NA 3I10A 3OBAA 4M24A 3SN1A 4PUNA 1E0TA 2HCVA 4UTUA 2G3FA 1E6PA 4LUIA 2VEKA 5B7YA 2O7SA 1BXCA 2XGBA 3N6HA 4HPNA 2VR4A 5LIKX 1XLBA 4H9YA 1CECA 5BCAA 2FZDA 3NO5A 2V5LA 4JN8A 4I7UA 1HGYA 3FEMA 2W27A 5GVJA 1QW7A 1H1NA 3II1A 2PGWA 5FEXA 1WCGA 2B7QA 3BXWA 2C0AA 2ESCA 4O10A 3VZXA 1GNXA 3NL2A 4UMAA 3QYQA 3RPDA 1F7BA 2PRMA 3EMZA 4EPDC 2J7BA 4UFKA 3Q67A 1PYFA 3RYSA 5I24A 1MUMA 1WA3A 5F2MA 4LH8A 1RD6A 3LGGA 1T40A 3ZR4A 1A0CA 1EL3A 1QW8A 2X30A 3B8VA 2CXEA 4Y7EA 4PMYA 2PDUA 4C6KA 3WL0A 4QFUA 4YTSA 3C8FA 3H8AA 4DJFA 3O8AA 3A23A 4HN8A 4Q6XA 3PTQA 3W28A 4ALDA 2ALRA 2VC9A 4K36A 1X8FA 3S2NA 3CC1A 3NYDA 1X96A 1VRXA 1IXPA 3AROA 5GNYA 1XWYA 1R2SA 3POHA 1HF6A 4LVGA 1EZ2A 2HE5A 2PLMA 5B7ZA 1BRLA 5M2FX 2OZ0A 1CXFA 1P0NA 1XYZA 4OT7A 1U5VA 2VZTA 4ZA0A 5HMFA 5CZSA 2F6KA 1A5UA 3ZVHB 3S9IA 3H2FA 4LYRA 5GJNA 3CHVA 3D0CA 5E93A 3WH9A 3SCPA 4AF0A 1U1UA 5GNXA 3WJZA 1UUOA 5XIAA 2RGMA 2I9UA 1AFSA 1XDMA 1C8QA 2WCSA 1CENA 1QCWA 3CPGA 4GPNA 4R85A 4NYUA 3LPGA 4G6CA 4QNWA 3WH7A 1W8SA 3MV11 4G7FA 4G56A 4IISA 4O52A 2L5HA 3EWWA 1TX2A 4DZ5A 4TXEA 3W0KA 3MUIA 2ZZ5A 3DX5A 5J5DA 4GYJA 1H0GA 4PMJA 4KCTA 4KWUA 2OZ8A 2V3FA 3SADA 4BJHA 3VO0A 4EP8C 3QXBA 5AN7A 1G6CA 1MNZA 1C7TA 1NP2A 4YN5A 1DTNA 1NIUA 4GGBA 4M82A 4Q22A 3GXDA 3ZLGA 4DBEA 3SCUA 2BV9A 3F03K 1K4HA 3MDWA 3W86A 4CN6A 1ZAIA 4LUYA 4Q7IA 4NUWA 1ZQ5A 3DIPA 1Q6CA 1WBJA 2BXYA 1EQPA 3VNLA 4GZJA 1RP9A 2FJUB 5AC6A 2ZICA 4KF1A 4L9YA 1LBMA 1EC7A 3GB6A 3GLCA 3OG3A 3TC7A 2HBVA 4CU6A 1XLGA 1IIHA 3LGDA 1KXHA 3GTNA 2W3ZA 4HMEA 5I09A 3VX0A 5BXTA 5FJIA 1POKA 3Q65A 1Z69A 3PJTA 3VFCA 4DEFA 4H9MA 2WXDM 4G8TA 3DFNA 2BFGA 3BW2A 4FR1A 9XIMA 1YPFA 1XYCA 4HVXA 1N8WA 3MUY1 4NIRA 4LOCA 4LXFA 3EKZA 1WOAA 2WVSA 2ISDA 3NL6A 1B9ZA 2O4MA 1TZZA 4AMAA 1HNYA 2CZDA 4TMBA 4E0CA 3UYCA 1XIHA 3ONCA 2MNRA 2VRKA 2YL8A 3DXIA 1DIOA 5D4YA 4BI5A 4EAYA 2QCNA 4WEVX 1IR2A 3B8SA 1ZP4A 5CC7A 2RKXA 3NQ8A 1XIIA 1UBPC 5GJMA 4KEUA 4L4MA 4GJJA 1OC7A 3EX6A 4C5ZA 3SCSA 5CKSA 3UVIA 1R2RA 1WV2A 2EO7A 2YBVA 2ZUTA 3CQKA 5CJNA 3LENA 3TVAA 3CIWA 5CZTA 1E56A 3E74A 1C29A 4JIRA 4JNYA 2V3EA 4DXVA 3WFLA 2IKIA 2C18A 4O1DA 4B9ZA 4CQ8A 5HJXA 3MZ2A 2VGFA 4B4HA 3OYXA 4AY8A 3USZA 1BG9A 3RDKA 2F7FA 1FFRA 4C6DA 2QULA 1FUYA 1W5MA 2PTYA 4TTUA 3ANVA 1UR0A 1WYIA 2VDIA 1A50A 2EPHA 2J75A 3ZFHA 1TSIA 2V82A 3GC2A 1WQ5A 1F6KA 1E6ZA 5HWNA 4UNKA 1VKFA 5DMLA 3HG5A 3OA3A 3MA8A 2EF9A 1JCLA 4D1JA 3TX9A 3S5NA 2UBPC 5FIPA 3IIXA 4Z42C 1H0IA 1OJXA 1Z44A 4DIAA 1FHDA 3IPWA 3WQPA 4YWIA 1ZJHA 5DT7A 4TVUA 1XLCA 3FJNA 3MCOA 3DI0A 2CU0A 3TJXA 4WOZA 2RGLA 3UF9A 1NEYA 8XIMA 1IZJA 3PG8A 4LC6A 3AWNA 4ONVA 1FXPA 3M07A 3N25A 3TTYA 4REQA 2QCMA 3TK7A 4HJWA 1L2QA 1DQUA 3LA4A 4L9ZA 3KP1A 1PIGA 3U4FA 1MQQA 2Y7FA 2YLAA 4MYAA 3W71A 2FH8A 2CLIA 4H9VA 3MCNA 3WD4A 2IMRA 1E55A 3WJWA 2FB3A 5KETA 5E6ZA 1FA2A 2A7NA 3V75A 5HQEA 3CASA 4O4WA 2OEMA 1AG1O 5BZAA 4ADSA 1VFHA 5IHSA 2NSXA 3MB9A 1W1B1 3PR2A 1HUVA 3EA2A 3GY1A 2E6DA 1JRCA 4MY9A 3TA6A 5D32A 1DEDA 1GT8A 1A5SA 3WDJA 2GQAA 3MKVA 3HPAA 1EJSC 2C13A 4HNNA 3KOYA 4AVFA 2QGHA 2XFRA 1JXKA 5DF0A 2J6VA 4PMRA 4MJ4A 1WKEA 2ZZ3A 2J88A 3BMWA 4B5NA 2JIEA 5DCBA 5EMKA 2FB2A 3DGRA 2WAGA 1R85A 3IJ9A 4MB4A 3SW6A 3VMNA 5CSUA 3C5QA 1UMYA 3PULA 2QMJA 1D3CA 5F1UA 4C90A 4NILA 1BWVA 2W67A 1TPWA 2CWNA 3QLLA 2EEXA 3S1GA 1VENA 4GJIA 4D8LA 4AWUA 1K9DA 3KZSA 1QU4A 4ML4A 4NASA 4YTRA 4D6JA 5L9FA 1E6XM 4MNJA 4Q4PA 2HK1A 3VIJA 4C6CA 2DZSA 2ISSA 3AIEA 2GDQA 1OFRA 4CU7A 2Y8VA 4GVIA 1R3WA 4RDZA 3GIYA 3W7DA 1VH7A 4DNMA 1EXBA 1H3GA 5DFAA 2XG9A 4CD5A 4ZXOA 3IUDA 1YDNA 1K1DA 5A94A 1EDGA 2IUZA 3GTXA 1AJZA 5C70A 4LF1A 3F5JA 4A22A 5EBAA 3CNYA 1V6TA 3UQNA 5LHEA 3GHUA 4J35A 3OYZA 2E1WA 3WMSA 4E38A 4UTMA 3QGVA 3RLUA 2ATMA 4GKTA 2FFCA 3B03A 4TV6A 3BURA 2WC4A 1ZP3A 2ZZ2A 4GO8A 3WLOA 1RA0A 3PWGA 1E51A 1QWGA 3VOJA 2PZNA 1IEWA 4RL3A 1EP3A 2CC0A 4KEMA 3URQA 1EJRC 3MBDA 3WLPA 1BTMA 3T4WA 1OX5A 2QPSA 3PZGA 3A9IA 3CTTA 3W22A 4E6MA 3VPLA 3DI1A 3TNOA 2O55A 3EOEA 6A3HA 4ZO6A 4DUWA 2OYMA 4UFLA 3L12A 1WB0A 4D72A 2PTDA 1SMAA 2JGQA 4DB7A 4RZ4A 2D0GA 4MB5A 4MTVA 2OEKA 2VGGA 3B8TA 2GQ8A 1RXOB 4ERAA 3BJFA 4S38A 4H8UA 1R46A 1AZ2A 2GJXB 3KVKA 3QV7A 4WKFA 1W9DM 5RUBA 2J6XA 4JHZA 2B7PA 1O95A 2ACSA 2BVWA 4PSPA 1AL7A 1Q6OA 4I5RA 3VIOA 1RCXB 2QF7A 1UD6A 1TV3A 3DBNA 2H6RA 3L2MA 2GUUA 1E4MM 2WVUA 3W1PA 2D20A 5SWUA 3LPFA 4DO4A 3RITA 2YL6A 5A3HA 4R9OA 3LPOA 2R9RA 1H4PA 4M7TA 1VHCA 2RDTA 4L80A 3SUWA 4R33A 3UGVA 2DVXA 2RDWA 3UG5A 3LHWA 5D8WA 4HOWA 3NQ7A 2V5JA 4B5UA 5CLWA 4FOKA 4PL2A 5I06A 3GNPA 1UQYA 4XZHA 3NWRA 1Q7ZA 1R5YA 5TAOA 3BCDA 1K3UA 1QPQA 2PURA 5E5CA 3F4DA 3M0VA 1FWJC 4US5D 3WH6A 4PTWA 5E1QA 3MUZ1 4X2RA 1K7XA 4YXGA 3PHAA 2PU1A 3LB0A 4PFHA 1IT8A 3ARVA 3CZ8A 3RCMA 3TV8A 2NW0A 1A3WA 1SZRA 3P93A 4ROQA 1P7TA 2VVSA 1EJTC 5TIMA 1Q5MA 1JFXA 3T9PA 5AHFA 4MFDA 1H7PA 3I4KA 3TAOA 2I14A 3ERPA 3H4XA 3L4TA 1Z42A 2X1SA 4LFYA 3GNDA 1H7WA 2I7GA 2NXHA 3V16A 2C1IA 1IV8A 1JFHA 4PBEA 5D9NA 3PPCA 4O54A 1XGDA 1KQZA 1YDVA 4ZFMA 5EMYA 2HJPA 4GZEA 5HANA 1U5HA 3BOXA 4MNLA 4NY2A 4NNAA 3K1GA 1TV4A 2W9MA 5LZLA 1HJVA 2GDVA 3TONA 3ARXA 3EKGA 3UESA 3JR2A 3BMXA 3F4WA 2WZHA 3JS3A 3W7IA 3OVPA 3W23A 2HISA 4U2ZA 2V2HA 1PKMA 4IMAA 4EACA 1OK4A 5FF0A 3C3NA 2Y7GA 3G1XA 3UJEA 4LV9A 3SQMA 1NQKA 1QT1A 2D69A 2GJNA 4GNJA 3A5VA 4NHVA 4ZEPA 3A64A 2ABAA 5CSRA 3GH5A 3WQDA 3AU6A 4QG8A 4XUYA 1PKLA 4LC8A 3WQFA 3WQ6A 3EX2A 1A5CA 4Z1DA 1OABA 3WJYA 3EA3A 4AY7A 1OT2A 1OZQA 4GC4A 4YYCA 1V8EA 3WN6A 1JYXA 4AWSA 1GQKA 2YCLA 1UPPA 1NU5A 3B0VC 4NX5A 3STPA 1MW2A 2IKHA 3JZUA 4PUJA 4U3CA 4LUTB 1AK5A 1WE5A 1PYMA 1YNYA 1KXTA 2VNCA 3R8GA 5K4ZA 2DZTA 2BBFA 1UD5A 3REQB 4WY0F 2PEVA 1VRDA 3R10A 1ELSA 5B80A 3QR0A 5CG0A 1GKQA 4PULA 5IDZA 1F3EA 2IPGA 2KAUC 4NJJA 3WQOA 1FWWA 4F4RA 3GVQA 3JZEA 4O19A 4JCMA 2C91A 3FAXA 3IGHX 4UQCA 4XO7A 3P0WA 3L2IA 4S3GA 2DP3A 4Q8VA 4RKAA 3DU0A 1E72M 1A4LA 3MUXA 1H7NA 4CQAA 3IVSA 3TMLA 3G1AA 4F9JA 1V6WA 2JIWA 1EIBA 2WYSA 4AU0A 1OFDA 1JXJA 3ANYA 4QSFA 1HN1A 3TOPA 3BPWA 1F2JA 4O28A 1XG4A 1JYWA 3EWZA 1IEIA 3DEQA 4BCEA 5M17A 1KLYA 4UB9A 1HKIA 5A8PA 4YU1A 4R88A 1M7OA 3WD1A 4A4AA 2YJQA 4AYGA 2ZZ6A 6XIAA 3TZFA 1LT7A 3EB4A 1QI0A 1F3TA 2WSYA 1LCOA 1PTAA 3STCA 4S3FA 5LYRA 4RR4A 4YYFA 5A8QA 3G1DA 2DW7A 1Z7AA 3B97A 4LS0A 1S39A 2VURA 1RLCL 2ZRVA 1SFLA 1R8LA 3CMFA 1JCMP 2XIMA 3UPWA 5H1WA 2Z6IA 3M9YA 1W5QA 1LROA 1P43A 2BTMA 1XUZA 2UV8G 1PKYA 1OD8A 2J7GA 4DLFA 3M7SA 1NJJA 3NUKA 1ISZA 3R4IA 3IAQA 4WD0A 1EJXC 4JTQA 5AECA 2HWGA 3UJSA 3DFPA 4N2YA 2XIOA 3VM5A 3CPUA 4XD5A 3EOOA 2PWFA 3BG5A 4AZGA 3ZJ6A 2C79A 1Z8AA 1XSIA 1K7FA 4NKCA 1Q66A 2WNZA 3T09A 1DIKA 1D3GA 1H1YA 4S3CA 5C0QA 2OPJA 3KCLA 4WJEA 1FTXA 1BYDA 3CQJA 4CCCA 4WY0B 3CO4A 3O7UA 1W9PA 2IQTA 2OYKA 2FGLA 2BMBA 3G8RA 3VILA 4M51A 4M5PA 2WNNA 2WMIA 4DJEC 4KS0A 4DZAA 4Q4SA 2QZRA 2PUZA 1XLAA 5ABEA 3HOJA 1PX4A 1E6RA 4K2SA 4F0SA 1B1YA 4A2SA 4HMNA 1EF3A 3WQ8A 5LNRA 4JIIX 4US6A 1JJKA 1T7LA 1UOZA 2C19A 1VB9A 4MWAB 3VIHA 3LMYA 5D9OA 3NL5A 3G1HA 3WNLA 4LVBA 4AHOA 3PFRA 4XB3A 1F4HA 4IMFA 3WMLA 5MKGA 5CPMA 5EMJA 4E4UA 1JQVA 1MW3A 2Y7EA 2CBJA 1O94A 3KFTA 1JI1A 3VNMA 1FWAC 3DERA 4OTKA 2DUXA 2Y61A 2YXGA 4JY8A 3AHYA 3LTYA 4LNCA 3I7QA 5ABGA 2EG6A 3C0SA 4LGXA 2X16A 4F2BA 1N8FA 4UQBA 2DEPA 3W88A 1H61A 3VAVA 1QOPA 4RZBA 3G0SA 4GUFA 4QSHA 1T6MA 4C1LA 4HN4A 1HT6A 3QZ6A 3T4CA 5A6AA 4LS2A 4FX7A 3VGBA 3VIKA 4C1NB 3UBPC 4R7WA 3DN5A 2VXNA 1ZJIA 4C60A 2G3IA 4J4KA 4HNTA 2VC5A 1KM2A 1RLDA 4K7VA 1X97A 2ZC8A 4HMCA 1OF6A 2QJHA 4UMBA 2Y7DA 3GE7A 3LQLA 3KVMA 1SZEA 4IGMA 2LLEA 2BY0A 3VD3A 4ZOAA 1C9WA 4OUIA 4GYKA 2DGAA 2HVOA 4QDPA 3KL0A 1VHNA 4DPQA 1PUDA 3OIXA 1TYGA 1CIUA 4DWSA 5JUVA 4N7QA 3OU8A 3IV8A 1YLVA 3OVQA 2ZE0A 4LYQA 3TFCA 3UW6A 5E0CA 1LBLA 3W1MA 1WOBA 4R7OA 2QCEA 5JIWA 5D2XA 3WH8A 3OJGA 1B3ZA 1O5XA 3ZT6A 4OBTA 2PU0A 3RMJA 4LY4A 6ENLA 4TR9A 1VBUA 1J96A 1EEPA 1EHAA 2DJXA 3EEGA 3OO2A 4A8LA 3SCNA 1I2OA 1XGZA 4HA0A 4EWND 2ZVIA 3C8NA 2YA1A 3WQ4A 4ECLA 2I17A 4FX8A 2E67A 4Y90A 4H8NA 1OGSA 3HPZA 2G95A 1T99A 5G4EA 4GXWA 4DBUA 1B54A 1KV8A 1YMYA 1EYEA 2HRWA 4UTIA 3UXDA 4HCDA 4L4LA 4O12A 1XCWA 4DJFC 4M6QA 3K4AA 2XN2A 2CLMA 2VFHA 2X40A 2ZCGA 3MI6A 3KDOA 5EYWA 4JTUA 3LV5A 4Y2WA 4L64A 4MUZA 2WVVB 2C16A 2ZDSA 3PBYA 4GA8A 3N4FA 4QRNA 1E1EA 2A3BA 3HPFA 1SZFA 1AL8A 4WJ8A 3EOLA 3WBWA 1OFQA 1ITQA 1ITXA 1CX9A 2FDMA 1R30A 2AMXA 4QAWA 2XVKA 1GEHA 3RJXA 2QCDB 1POJA 3PZNA 1I2QA 1K9EA 1YBQA 3SY1A 2CNCA 5T9BG 1MQRA 5F4XA 3KBNA 4B92A 4GO9A 3O06A 1ISVA 3KM8A 3NDYA 4IOTA 5BRQA 4TX9A 1XP3A 1X7IA 5EA9A 2J25A 2RUSA 4JFUA 3QGKC 1MZHA 1C8YA 1KB3A 4I90A 5REQB 1KGXA 1EHNA 1S5VA 1QNQA 5D37A 4ZFCA 1H2JA 1LOSA 3VDHA 3ZR6A 5D2VA 3Q37A 3WNKA 1J5SA 2DZUA 3BOLA 3QOMA 4YNGA 1JDAA 1GVIA 4QEEA 1B3WA 3GKFA 5BYWA 1V77A 2C0HA 3OQEA 2W0UA 1E70M 3SCQA 4QX4A 3E5PA 1AW5A 5E70A 1YQ2A 4FP1A 3L4ZA 4JY9A 1LUCB 3P5YA 2ZBTA 1CNVA 4OU1A 3AYTA 3U9IA 3C56A 3EXTA 1TO3A 1XCFA 3PUGA 3CYJA 3N6QA 2OQLA 3L0KA 4AG0A 2PWVA 4TX8A 3AXKA 3OLEA 1B3VA 1K6AA 4HNUA 4L61A 4PUMA 3DHUA 4BKNA 1BSLA 5A8NA 3B9NA 1E4LA 3E96A 4L6HA 2PDGA 3NEVA 4M80A 1JVNA 1GW1A 1DV7A 3QTGA 4JIQA 3RCYA 1AH0A 2F38A 1KCLA 4O57A 1OQFA 3B8IA 3FS2A 4LTSA 1ZBWA 1QBBA 2PTXA 3FYOA 3TLLA 3BV4A 3IIPA 1YTDA 1HL8A 3EDFA 4AEEA 3KL5A 4M56A 2YCJA 2CLEA 1PE1A 4YHGA 4MPKA 3FJ4A 3T78A 3VKBA 1KGWA 1U1JA 1D3HA 4N42A 3MHGA 2QYGA 2ZYFA 3PS7A 3NM1A 3T44A 1HZYA 1LOQA 3AS3A 1VS1A 2ZX6A 3GNNA 4JX5A 2I9EA 1BD0A 1D7FA 1QNSA 3G0XA 1RQHA 1EWDA 3R8HA 3GU1A 4C6EA 2X7WA 1WO2A 4DUOA 3W70A 1M7XA 2YYTA 3C61A 4BF9A 3LTSA 3HMJG 4Q8TA 1NAL1 1Q6FA 4UCGA 4KFOA 1UZHA 1J0JA 1IT0A 3W2UA 3QMSA 2VC6A 3JRKA 1Q85A 2V5KA 1YXYA 3W2KA 1MXGA 4O53A 3N34A 3L68A 5EL1A 2G4JA 4L1WA 3WG6A 1SO5A 2ACQA 3IUIA 4KETA 1LRNA 4JTDA 3A3HA 2FVLA 3EWDA 4JIHA 2GQ9A 2V81A 4DLMA 3SAZA 1RY0A 2NQ9A 3WX7A 4XSMA 4YTQA 1JD7A 2VX7A 4O1FA 3LS9A 4W93A 2ZA2A 3S5ZA 5HBFA 1VFTA 1XL9A 1K03A 1AQ0A 5U7SA 1EP2A 2NXIA 1GOIA 1WXJA 1KBBA 2J62A 3CUJA 3CT2A 1SSGA 2B31A 1Q2SA 4YWSA 3S8HA 6REQA 2PWGA 3W7NA 4HHPA 4XSLA 3VGDA 3RUBL 3CAKA 1PZ0A 4ZENA 4FSAA 2C14A 2AKZA 4P7LA 3STGA 3P6LA 2XH2A 1SMDA 5CC6A 1TQXA 3EZ4A 4A3YA 4HOXA 4RPQA 3I3DA 3W2LA 1GOWA 3SUUA 1HJWA 5D03A 2PSNA 1C8VA 1TJ1A 1I2NA 5CPSA 2OQHA 1LLWA 2OODA 1TJRA 3O07A 3F2CA 2DT1A 4Q8PA 2WKJA 3QPZA 3BG3A 2EBNA 3PNUA 4X60A 4UTKA 1IXNA 1TX0A 2XH7A 4OECA 4EF8A 2FZMA 3CAWA 3OZMA 3H26A 3MMDA 2F2KA 7ODCA 1NOUA 1GWJA 3UR2A 4IMCA 3L23A 4TQTA 3WDPP 3APGA 3MKCA 1VP5A 4P7RA 1J93A 1G4PA 2WLZA 4D6CA 2RFGA 3NQBA 1XDJA 5DBTA 4XKYA 4FLSA 1AJ2A 4IQJA 4K1WA 4Z0JA 1FHUA 1VIWA 1HTIA 4AVNA 3P14A 1UC4A 1S5MA 3ENLA 2VD8A 3MS8A 2VUNA 3NVDA 1PHQA 4UQEA 2BX7A 3IJ8A 2ZRZA 2GGEA 4HOZA 3RFAA 4LAOA 3CHFA 3AHTA 1PWMA 4B5TA 4IMEA 1EGMA 3S46A 1TVLA 4WQ6A 4UFIA 1W91A 2YDRA 3IJ7A 1TPH1 3T2QA 4ZL1A 1KRCC 2OX4A 1KRAC 3SN4A 2P0IA 4GGHA 4JR5A 1M04A 4ZO9A 3NO1A 4W4QA 4AX7A 3BLIA 1DQWA 4FO4A 4AIUA 2OFJA 4UMCA 4JKLA 1QI2A 3L4VA 1H63A 1W5OA 4XTDA 4IFOA 2HNEA 2XGZA 2HK0A 1GQJA 4MJ2A 3TQPA 1IWPA 3G3DA 1G5AA 3CL8A 4J3TA 3WK2A 3QY8A 1NVMA 2NX1A 2NVDA 1VYRA 4Q7BA 3VGFA 3O6DA 3AIWA 1ADOA 3H7VA 5F4SA 4X0VA 3SRFA 4X22A 3CLMA 3AC0A 5DY2A 1PTGA 1KBIA 5CGMA 3EXSA 3N2MA 5DMNA 3AMLA 2EAWA 2BY3A 1ICSA 4JTEA 1EUAA 4CD8A 3LYEA 1E5JA 2RDXA 1ZALA 3LCLA 3M16A 3ARZA 3U2OA 1FWBC 1TV5A 3KRZA 4PMVA 5EMLA 2DIKA 5C7VA 1VEOA 1IWBA 3P2VA 5LIWX 4HPXA 1EDQA 1T5AA 2V3DA 5DMYA 4E2DA 4R53A 2NV9A 4LYPA 2QQ6A 1XKYA 1HP5A 2HSAA 1S5WA 1QOQA 4H7ZA 2HPMA 3W7OA 4RDYA 3AYVA 3LX9A 4ZTYA 1SW7A 5LA1A 1L8PA 3B05A 1YXCA 3M0XA 3AHVA 1R0MA 4IPPA 3N11A 3WNNA 1W3KA 3CHEA 3S1WA 5KMYA 4V27A 1JZ2A 2XH4A 4JQ2A 4L65A 3BAYA 1NY1A 3W01A 1XIMA 4HYWA 1ZNNA 1A5LC 2DY3A 4LU0A 3VE7A 7REQA 3NSMA 1SZGA 1R7OA 3EPNA 2VCBA 4ZCWA 3KBVA 4HPJA 2HEJA 3O0KA 5TQLA 3UG8A 3TMQA 4FAMA 1UJQA 1C91A 3T1GA 4MAVA 5FJJA 3E2QA 4C6IA 2DUZA 4JN6A 5A1AA 1K8ZA 3WJSA 1E9ZB 1AW1A 1PSCA 3DHDA 3U3HA 1OGBA 1TA3B 1FDYA 3KTXA 4XKMA 4DQWA 1NDWA 1HL9A 1F74A 3LXCA 3K5XA 3O16A 3UCDA 1WZLA 4UZUA 3P8IA 3TN4A 5D38A 4LBSA 1BQGA 1JG9A 5FF7A 3VKKA 3ZT7A 6XIMA 4F48A 5A6TC 1TUFA 2JF7A 5CAHA 2F6XA 3VOIA 3TYDA 3CQHA 3WLJA 3T05A 2H3BA 2P3EA 1KM5A 3F2DA 2QKFA 3ES7A 1VZWA 3M4HA 1GEQA 2MUCA 1EA0A 3KWSA 2PTWA 3VOHA 1PEZA 4RXFA 3WYZA 3LCWA 1TTPA 3PBVA 4A3QA 3PANA 4H8VA 4KH2A 4FK9A 1H49A 2FTWA 1VPXA 5DLCA 3UZYA 1H5VA 1ADDA 2BGQA 3KRSA 1P0DA 1UIOA 4M3PA 4QLJA 1UROA 2PP1A 1FHLA 1QK0A 4KWOA 1TZ7A 4K8GA 3OPSA 3PBMA 1JCJA 3I6TA 3K46A 1P0BA 3N4EA 3UWEA 2QT3A 4R7JA 5FL1A 2CHOA 5I78A 1PHWA 5EGRA 4HNVA 3PTKA 4X9YA 3CHCA 3ZWTA 1TB3A 3T08A 2CLFA 1GVEA 4PUDA 1L6GA 3S2LA 1S3TC 4IZGA 3GC4A 2AAMA 2OELA 1XD1A 5GPRA 4WSJA 3ZXWA 2ZWYA 4FB7A 3HQ1A 1EEXA 3GU2A 1JDCA 4NJIA 3E0IA 1M1BA 2P88A 1GTHA 3PM6A 2VFDA 2X2YA 4HCLA 1JIBA 3FKRA 3VCNA 2ZUMA 3CV6A 3I68A 1D8CA 2YLLA 4J27A 3BCJA 3VU2A 3W74A 1V3LA 4NF7A 5C54A 3FEQA 1Z6KA 4INFA 2E5DA 1OD0A 4IP7A 4N9DA 5KEZA 2P0OA 1TREA 5D33A 2ZRXA 4EIVA 3QF0A 4MKVA 1R87A 4H6EA 4OUEA 1XLDA 1G0CA 1AMKA 4NZ3A 3EPMA 3QC0A 1E0VA 4AZ6A 4GLEA 2ZX9A 2WSKA 1TR9A 5CZ0A 3AIVA 1LDCA 1THFD 4IQEA 3DHPA 4LV4A 3JUGA 3KRBA 3GBEA 2GK1A 4DWDA 3ZLFA 2F8QA 2Q3RA 3MZNA 3LXAA 3PZMA 1HJUA 5CBIA 2GSEA 4FA3A 3C0JA 1V02A 4CN1A 1PWLA 1A3HA 4YCOA 1DPMA 1OM0A 1ZBVA 4NP7A 4I6KA 4M6UA 3DFTA 5A2BA 2E5CA 1D8WA 3W84A 3QQWA 1VPYA 3ISIX 3SGZA 1CGUA 3I65A 3QR3A 2VGBA 3K2GA 3L66A 3W1RA 1DP0A 4AD4A 3BLPX 3M0IA 3CEUA 4PODA 3N6JA 3TP4A 3BGAA 2YW3A 1DOSA 4GCAA 4CU8A 2F9RA 4M6PA 2PGEA 1RVKA 4DNHA 2CERA 4IFKB 4JEJA 3STEA 1H7RA 2C6QA 1US3A 4PUWA 2V69A 5HMDA 3ZMRA 4WKAA 3BANA 4FNQA 4WDTA 2FKPA 3P5ZA 3ARTA 2Z25A 5BROA 1ZSXA 5BXSA 1B4EA 1WZMA 1S1RA 3W7QA 1UD8A 2FH6A 4O18A 2B7NA 3CIVA 2PP0A 3QRHA 1B4KA 4AY1A 1VFUA 4CNTA 2OB3A 2XVGA 1QBAA 4MIMA 1FWEC 3EOUA 5AC5A 1B9BA 5K4XA 2P5NA 3M5XA 3P7YA 3F4CA 3NXLA 3FJLA 4XVEA 3W6LA 3NAVA 1J0YA 4B90A 1LQ0A 1S38A 1YHTA 2DVTA 2UZ9A 1DQXA 3M6DA 1GKPA 5DO8A 3TA9A 4A05A 1CLKA 5CQ1A 3GZAA 1U5JA 3GAKA 1E9LA 5I7GA 3BZGA 1SW0A 1Z9AA 1DL3A 2XZ9A 3N9RA 3DYMA 1LWHA 1WDRA 4AZ7A 2FGZA 1Z32X 3R58A 3LLXA 2XN0A 4RW5A 4W5UA 2VRQA 2C1GA 3WDHA 2ON3A 3GHSA 3IVUA 4XIMA 3LCGA 3GHTA 3WQCA 4RNIA 1A3XA 1VCGA 3MSYA 2VM8A 4LBUA 2FHBA 3ABQA 4MMWA 1U30A 1BGAA 1XQLA 2PF0A 2WQDA 5HK4A 2QCFA 3V3WA 2REQA 4IX0A 4PMZA 2J4GA 3M5ZA 3MHFA 2POTA 4FLRA 4GI4A 2QUVA 3CAVA 3WDQA 4JYDA 1O7AA 3UD6A 4R34A 4Z17A 2DT2A 5DBUA 4MM1A 4XQ6A 1LLZA 3IGXA 3LHTA 3QC3A 1M68A 4IIGA 1IEXA 3BAKA 3M0HA 4H83A 2AL2B 1JPDX 1LL4A 1DYSA 4MKNA 3HG2A 1WDWA 4O14A 1TELA 3AXHA 4QCEA 4MNMA 3UT0A 5BOFA 3R2GA 3B0UX 3RM8A 3SGGA 2A3CA 1GCYA 1D9EA 1SJCA 3EDKA 5T9CE 2YYUA 4KRZA 4IL2A 3EDJA 1EWEA 3C6CA 2G97A 4WK9A 2TYSA 3T0CA 1HP4A 1MI3A 3IK4A 3LOTA 4GFSA 1ADSA 1UWAA 4IMDA 3SECA 4O0ZA 3TJ4A 5IDIA 4A3UA 4GCXA 3FV9A 1OF8A 1RBOB 2I5IA 3OHIA 4OOUA 2PDWA 3E2VA 1HW6A 1UZ1A 1C8XA 5CC3A 4HU0A 7TAAA 1UKSA 4XX6A 5HPOA 2QPUA 3PAOA 3FA4A 4AISA 4RE3A 2A5HA 4DM2A 5C7HA 1BVZA 1EC8A 4CQCA 2ZX5A 1XBVA 3WFAA 1B2YA 3QPEA 1M9HA 1YNPA 3CTLA 8XIAA 3Q2DA 5M1TA 2Q01A 2VEMA 1J18A 4GXPA 3QPYA 5ABHA 4WJXA 2Q09A 3MHUA 4S3JA 1KWGA 1ISYA 1X38A 2JKPA 1QO2A 1H50A 2R6OA 3POCA 2VENA 1AH4A 1CW2A 3R12A 3AOFA 1UH4A 4GVGA 3A47A 3TTQA 3DOPA 1E9IA 4U4MA 3UWYA 1U83A 4PTDA 1QNPA 4MY8A 3LZ3A 2OGJA 5K9XA 3AISA 2XINA 3BJTA 3M0LA 5AY7A 1TJ0A 1XFBA 2Y24A 3W53A 4F0RA 3DGBA 3EWXA 5HINA 3GQYA 3T6CA 4TO8A 2BHZA 1TPDA 4MOZA 1V6VA 1A53A 4DWSC 2NV1A 1GW9A 3PZOA 1HKMA 4RNHA 1UKQA 4WX2A 5F4WA 1NTHA 1FBAA 2ZUSA 4OV4A 1WZAA 2A6LA 4Z08A 3R7MA 3BVJA 5HA7A 4JFTA 3VE9A 2E09A 4PN2A 1GVRA 5E6YA 4M19A 4JICA 5JBEA 3WF2A 1L6WA 3T2OA 4QLLA 1BRLB 1MZRA 2GOUA 2CWXA 2VX5A 2X7VA 3VD5A 4Q8MA 4GY0A 1J0HA 3TR2A 3HMCA 1X1OA 4E2OA 1E5NA 4AF0B 2X05A 1H1ZA 5LNVA 4FLQA 3I3BA 4YMZA 1B3YA 1WXZA 1R7AA 2E68A 2NQZA 3UWVA 3WLMA 2JF6A 3CV2A 1HVXA 3TJLA 2UY2A 4HA3A 3BZJA 2FFIA 4D6FA 2V8ZA 3PSVA 5C9ZA 1DIEA 3T42A 2CITA 2BG5A 1W54A 5ECVA 2DZBA 5ECUA 4MB1A 3NL3A 3WK3A 2GVYA 5C9UA 4FNTA 3UR7A 5DMMA 1UR3M 2C15A 1LTDA 2C8NA 1U22A 1NOFA 1XYMA 1XGEA 3WY1A 3AICA 1SFSA 3UU0A 3KS6A 3G77A 4B3LA 2BXVA 4H1ZA 4D71A 1UP3A 3CV1A 3GWQA 1ZZMA 1B57A 3K13A 1E1CA 1V93A 4Q4RA 5G2WA 2OWXA 3S42A 3HJZA 5I07A 5DY3A 4KQNA 2A79A 2YBUA 2VL4A 3UZZA 2E28A 4X2PA 1US2A 4JNZA 3O6CA 1WUFA 3GXPA 2J7EA 4Q3MA 1DXFA 5CBBA 4S3DA 1FDJA 3W07A 3VA8A 1NFBA 3AZRA 4ADUA 2QMKA 1S1PA 4M29A 2P3ZA 5F2GA 3S6DA 3BAXA 1O1ZA 3DCPA 4IIEA 1YDOA 5ENLA 3CUHA 3N2CA 1E40A 4IHCA 3U5UA 1I1XA 5ABFB 2PWHA 4TUFA 5KZMA 2XUCA 1XBZA 4P5UA 4PMOA 1V79A 2CZEA 3F5KA 2NUYA 4Z1CA 1L6FA 3OGRA 3S0CA 2OXNA 3DC0A 3KP0A 3KVLA 4JYEA 2WC3A 4AX6A 1QVBA 4EK7A 1NF7A 2DSZA 4MLJA 3MV01 3H2EA 3GXTA 2OZ3A 3HV8A 3V35A 2HS8A 2WMJA 3P3BA 3PJUA 2XDFA 4NL1A 3V18A 2B81A 3L4XA 3WQWA 1F5ZA 4F9DA 2IQDA 3RILA 1RHCA 3DHFA 3MW7A 3S1VA 1DHKA 3ZZ1A 4CEUC 1R3RA 4G9PA 1O5QA 1SO6A 1Q8AA 2GPTA 3UYIA 1EJVC 2G8ZA 3OVGA 1UA7A 4GIYA 3SI9A 1EX5A 1YKWA 3VYLA 3H6OA 3ARWA 2ANUA 2ZUUA 3Q94A 3A12A 4HCHA 3G24A 3UJFA 1B3OA 5J5RA 4LCQA 2NQJA 3D3FA 2QCHA 4G1NA 5FOOA 1O1HA 5C2GA 4QQ3A 3ITVA 3THCA 3THUA 3GDRA 3I7RA 3LERA 3W7RA 1UD3A 1CWYA 2P8CA 1A5NC 1XPYA 1J6OA 3LBOA 3NSNA 1XC6A 4O17A 2O92A 4F8XA 5XINA 1FDZA 1ZAHA 4R27A 2NX9A 2Z29A 1CBGA 1MWOA 3M5VA 3UZJA 2AL1A 3LRLA 4J3ZA 2Z1XA 3KBMA 3ZJ8A 1K77A 3RK8A 2NX3A 3SSJA 5KZEA 4FMVA 3EWYA 3KRUA 5AC4A 4GD0A 4DO7A 1XYBA 1M7PA 2FYMA 2PCEA 1T41A 6TAAA 3QBUA 3VDGA 4L6OA 1RY8A 3KOZA 9CGTA 3C3UA 3JVAA 1IWAA 5L6UA 2XFYA 4F66A 1TPFA 5FEZA 4PMDA 2PI6A 4UQDA 3TLQA 3TU9A 3UP8A 1OWQA 1W2PA 1QOXA 4O13A 4HQVA 4YVVA 1LG2A 4B4FA 1TPEA 3MCMA 5AHEA 3QM3A 3B8DA 4AW7A 4ZQOA 1EUNA 2X41A 3O2LA 1W6TA 2W5FA 1R9XA 5D2YA 4HK5A 1RP8A 4DPPA 3S3GA 2GJLA 4HTYA 3TYZA 4M81A 5I6SA 2VD9A 1MYRA 4KIEA 3G1RA 3LGEA 3GR7A 1NP0A 3IWPA 4LF2A 2ISVA 7PTDA 2VI0A 4QBXA 5F1VA 2VR2A 4REQB 2XWDA 3H12A 1QATA 2GVGA 2O7QA 4RV3A 2EPMX 5HXMA 1V02E 2BGNE 1KA9F 3NZGA 1O6IA 2OYLA 2HMCA 3W73A 4LBRA 3WNMA 3UETA 1XBXA 1FH8A 4W89A 1IZKA 3NR0A 2VDHA 3CJPA 2YR1A 4XO6A 4FOJA 1HJQA 3CAQA 1BFNA 4UOJA 4R5EA 5A5WA 2A3HA 3SIZA 3C2FA 1KC7A 4LX4A 2DSKA 4ZBCA 1LYXA 3TQ0A 5EU9A 4BF5A 1XIBA 3EWBX 5A6MA 4H04A 1GGOA 1EJWC 4W8AA 3W1XA 3GSMA 3L0GA 4IGHA 2XWEA 4KWVA 3T8QA 3RCNA 4AD2A 1W5PA 4NSBA 4UCFA 4IIFA 3P74A 4J3XA 3RLHA 4ENLA 1OZMA 3R11A 4G5DA 3BAWA 3CGTA 2BS9A 3G8EA 4NAEA 3F2BA 4MYXA 4BEUA 4FLOA 1I8JA 4M1BA 5HQMA 2JKEA 5F7UA 3LLDA 4LAZA 2PDCA 1MRQA 1GOXA 1HKWA 2HZGA 4ZXLA 2PDNA 1EO7A 3SSZA 3GXIA 1TMQA 3A4AA 1YIXA 3EAUA 3M47A 4LY8A 2EHHA 2P50A 1AQFA 3WL1A 4F2UA 4I7VA 2C7FA 1F76A 3NPWA 1QI4A 5AYYA 1W1TA 4HNLA 3I6RA 3EKLA 3I4EA 1KTBA 4DWSD 5M5DA 3B9EA 3IIOA 4E2BA 2Z1BA 3UCCA 1WUEA 2C71A 4ZB0A 4IPJA 3ITCA 2NWRA 1GOKA 3FGCA 3CM4A 3ABZA 3TN6A 1H7OA 1QI5A 5LA0A 1KCKA 2EKCA 1X8CA 2E9BA 1JYVA 1UR4A 3SM0A 2R1MA 1TPC1 4KT2A 4ACZA 5BNKA 1R6WA 5AYXA 4LT9A 4O11A 1Q6RA 2FJKA 1P1MA 3VK5A 2CLHA 2A4AA 3GS6A 4S39A 1GVOA 4C7FA 5AC7A 1JAKA 3M43A 2WHLA 1W1PA 1ITCA 2JE8A 2CLLA 1LLOA 5LNSA 1NWSA 3IANA 4S23A 3PWIA 3F7JA 3M0MA 4P2VA 3TN3A 1PBGA 5TF0A 3B40A 5A8GA 1GVFA 1T0OA 1CZ1A 2Z1SA 1K8CA 3CZJA 3DESA 4DF2A 1FY6A 3UZWA 3MY9A 4XZNX 3NG3A 2CHRA 5FF4A 2QV4A 3N9KA 2QXWA 4OE7A 3CUGA 2HXTA 3RPTA 4KBXA 4JHOA 2WKGA 4EF9A 2J9YA 2YCKX 1FVPA 4O50A 2W91A 3M7WA 1EXPA 4W9TA 1M53A 2W63A 2GUBA 4ATDA 5CXPA 1X6UA 4W8BA 3MQTA 1KM0A 3KCOA 3G6LA 4DAIA 1ICPA 4GQQA 3W7GA 4IIDA 5HNNA 1I4NA 1V7AA 2Z1KA 3W24A 2X1UA 3VXGA 3PY2A 3WLSA 1NSJA 3A5FA 3CUIA 4JAWA 3W2JA 3UR5A 5CLTA 3SRHA 1E1FA 3VC6A 2PA6A 1F6YA 3O05A 2Z4GA 1OHLA 3NQDA 4DUXA 2FQIA 4B5VA 1PX8A 1LQAA 2D73A 5DXYA 2VFIA 4XAPA 4C6QA 4IUGA 2V38A 1DXIA 2R1NA 3KDNA 3ZSSA 1ITUA 2J24A 2TMDA 3T40A 2A1YA 4EE9A 3T0TA 1KGUA 1ESWA 3MU7A 2YZ5A 2INFA 1HJSA 4UR9A 3G3MA 1P7TB 3BV7A 4QS6A 1CTNA 3S47A 1RPXA 5D2WA 5FI8A 2YW4A 1UWRA 3LRMA 4EPEC 4AEFA 4XBKA 4CUCA 1A0EA 3PK7A 3WNOA 5CSSA 1TRIA 1C92A 1NELA 3UG3A 1W1YA 1I6NA 2ZX8A 2RJGA 1D7KA 1QFEA 4W7VA 5A6KA 1GZGA 2ZUWA 4QE1A 3B06A 3ZVIA 4S2BA 4ILSA 4KGJA 1TE1A 3NM3A 1SZNA 4PTNA 5ABFA 2D2OA 3QKZA 4GXMA 4L56A 4JTRA 1OCQA 1EJ7L 3KLLA 5G1MA 4WKHA 1WDSA 1F8IA 3EOSA 3NQFA 3LU2A 1E6QM 3OODA 4UTFA 2O9TA 1E9YB 1V0KA 1KTNA 5FAGA 4JPGA 3AMGA 2DQXA 3DZ1A 5G1YA 4NNBA 4WZHA 3FNDA 4Y6GA 4JDYA 4XTIA 4B2DD 2SFPA 1DWGM 5AVNA 1OCNA 3ARSA 3W1AA 3N29A 5AYIA 1Q65A 3SO7A 1H51A 1PZ2A 3E0WA 3FXYA 4IF2A 3BSGA 2R91A 4GH3A 4POCA 4UXDA 1SJAA 2D2GA 3FDKA 3WNPA 1E0WA 4XAGA 3FOKA 1NWRA 4GUJA 4D1IA 2YCLB 4GYPC 1XH2A 3B9AA 1XCXA 2J9ZA 4MNKA 4PTVA 1Q7QA 4C6PA 2NWSA 2Y85A 1LOLA 1Q6EA 3OOQA 2XISA 3NDOA 3CWNA 1JDFA 3HURA 4Z1BA 2D2HA 3HTWA 4GQGA 2Z2BA 5MHBA 3MYPA 2WM1A 3UG4A 1VFLA 3N2XA 1WAUA 4NZ4A 2Z7KA 2WPBA 5JQ9A 1QHPA 3QV9A 2JEQA 3D6NA 4JFWA 1ENUA 3GC5A 3IK2A 3VKDA 1O60A 2ACUA 4Q8NA 3H2NA 4QP0A 5AYBA 4LNYA 4NXSA 1UJPA 4HTBA 3AQUA 2FPVA 1W31A 1A5BA 3UPMA 3QLDA 3NQMA 2GVJA 1X39A 4PCPA 4TTGA 3ES8A 2V30A 1UKPA 7XIMA 2CIPA 1AD4A 3A3XA 3P61A 1CEOA 4BS0A 4BI7A 5C6MA 5DCDA 5D30A 4M1RA 2WZIA 1H41A 3WLIA 3GVVA 3TE9A 1REQA 2EKGA 4HBKA 5KZDA 1XPGA 2YL5A 3AMDA 1Y5WA 1ME7A 2O9PA 4Q4MA 2QDEA 1J0IA 2DJLA 4CLMA 4ZB2A 4ICCX 1L9WA 3GG1A 3H2MA 3VNIA 3V1HA 5IM51 3H21A 1XDLA 4LPCA 1GQNA 3N14A 2WBGA 4LVDA 5CPQA 3IUHA 3RRXA 3HZ3A 1QW9A 4NRRA 3U4AA 2IKJA 4I5UA 1F9CA 2YFOA 3OEXA 2CBVA 3CT7A 3H53A 3ARRA 3N1AA 3PG9A 3PTMA 2JK2A 5HUOA 3VNDA 3QFEA 2EXOA 4K8EA 1QNVA 3V0SA 1BYAA 3EXRA 5LNUA 3MI2A 2HS6A 3IAPA 2Y62A 1SGJA 4RZ5A 1KFBA 3CO8A 2JBMA 4PCFA 2RHGA 1E6NA 5A69A 1KNWA 3BE7A 1MRAA 3P60A 3W76A 4IP5A 3VKCA 2OSYA 1JRBA 4IICA 3TJIA 3HG4A 2Z1VA 1PCKA 4LAKA 3UZ5A 4C7DA 5BMXA 4N6EA 2J7HA 1A4MA 5HOSA 4QNEA 2YIHA 3WUEA 3TUUA 2HNHA 3QTPA 3BLDA 3MDUA 5DT5A 2WMIB 3CH9A 1QMLA 3TW7A 4HU4A 2CKRA 4CQDA 3TR9A 1I2RA 1LT8A 2E6FA 5J8LA 4H8HA 4NXKA 5LGXA 3VD9A 3UGRA 3OA5A 1E6SM 1CXIA 1AD1A 3WIJA 3I7SA 4K39A 3WH5A 4M0XA 3MUAA 1TKKA 2XZ7A 2JKAA 3G1SA 2VCCA 3K1DA 1XV8A 4PR4A 2PC4A 3FHAA 2B7OA 2FZBA 4QJ1A 4KFPA 3MJYA 5MKGB 5FSDC 3GNXA 2ADAA 4MWAE 1VQTA 1VC4A 1V08A 3VINA 1XLJA 1MO0A 1B5TA 5HNUA 4RJEA 3PPGA 3VDAA 2I16A 2BWGA 2BOGX 3GO2A 5MF5A 4ML9A 4D6HA 4WGXA 3IIVA 1GTEA 4E8CA 1KRBC 5C9WA 1IT7A 4M7SA 4P8XA 2CZ5A 3EX1A 3RRAA 2H8ZA 1BKSA 4XAZA 1MUCA 3TWAA 4M6VA 3PPHA 1FWTA 2Q02A 4A8RA 2J47A 3GDMA 2W62A 2XH0A 3U2CA 4DX3A 2FDSA 4GIEA 2OU4A 4NAFA 2QJNA 1GK8A 4ZSUA 2C3ZA 4Q8UA 1PZ3A 4K37A 3AZTA 3KZPA 5JVLA 5E0FA 2DFAA 2Z0IA 2EPNA 2XVLA 2WJZA 3QZEA 2VWSA 3QHOA 4QGCA 2G41A 1P1XA 3DFSA 2CZFA 2E1DA 1NQ6A 2XIIA 1E15A 4C65A 3QW3A 3N19B 4DWSB 1OEPA 1QPKA 2ISWA 1DKWA 2VQTA 2DPEA 1TV7A 5I3HA 4ORIA 3SJ3A 5KTLA 2V2CA 4LYKA 2VZVA 1CI1A 2R1KA 2PP3A 1GJPA 3BW3A 5F2IA 4HSHA 4HD5A 1GHRA 3W72A 4YTTA 4NX0A 1Y65A 4F40A 4OVXA 8TIMA 3TCEA 4RE0A 3P8JA 1OC6A 4JTKA 3LD5A 4WDXA 3HJEA 3NQGA 4JTCA 1IGWA 2NXGA 5EB8A 3FYYA 4H9TA 3TROA 2FMNA 4XAFA 4GQ0A 4MDPA 1RUSA 4PTMA 4FR6A 2OCZA 3EX3A 1G7UA 3IJQA 1WP6A 5C5YA 3IEBA 8CGTA 1M6JA 4E8DA 4WCJA 3WD0A 1S2TA 3DFQA 4FXSA 3NGJA 3KXQA 1U2YA 3ID7A 4Y8FA 5C9XA 2Y8KA 5CG7A 4TVCA 3LBCA 3NZ1A 3W6MA 1I75A 1J6PA 3ABSA 1PO9A 3RIKA 3LY0A 2J27A 4FIQA 4NZ1A 2H8XA 3QQ0A 3H23A 1SQ7A 4E3VA 2EG8A 4X61A 5FJUA 3Q4DA 3PUEA 1OADA 2GGHA 5KITA 3EYPA 2OZTA 3TYEA 3E2RA 4UNLA 3CWOX 2GSHA 4FEZA 2PLCA 2IQ0A 3TSBA 1XC4A 1RBLA 2YA0A 3IGSA 4IIHA 1TWZA 4MF4A 4BFAA 1KLZA 4U28A 1YBQB 1J12A 2YXOA 3CZLA 1GZJA 2IKGA 2BLEA 3BGJA 2XM1A 1R9ZA 3SGUA 5BXPA 2ZX7A 3LMZA 4W8LA 1R3TA 3UWWA 4B5XA 1KRMA 3QGAC 5HPCA 3T2PA 2VUYA 3WF4A 4QITA 3PVFA 1BWKA 1W3IA 2RJHA 3LSCA 2X1TA 4DELA 2AGKA 1JR1A 4KPLA 2HXUA 3NDZA 2QUMA 3NYZA 4WUIA 3WF1A 3SCOA 2G96A 3WLQA 3AXMA 3N3TA 2XU2A 3PP7A 4FPSA 1OFAA 3S9YA 1TZ9A 5K9CA 1XXXA 3LNMA 5HAOA 4KGLA 1G69A 4Z2KA 1TE6A 2QIWA 5BOEA 4C6BA 1JL8A 2ABBA 2B4GA 1X1ZA 3FW6A 3TSMA 1YTEA 3WKZA 2GYIA 1EQCA 1JCXA 2PDPA 3HG3A 2AOSA 2VHLA 1OFPA 4AHQA 1V0LA 5EKYA 1UC5A 3K8KA 4OWGA 3CZGA 4YVPA 1I0DA 3TQKA 4BY3A 4LAUA 1F4AA 3WLHA 3ZR5A 3K8LA 2BVTA 1GJWA 2WQPA 3WO8A 4GQBA 3EBVA 4EXBA 1JCNA 1S2WA 5IRPA 2Y2WA 1PS9A 1U1HA 3GUGA 3IJ6A 3L67A 2UY3A 1C7SA 3N04A 4B5SA 1SJBA 2OQYA 2EGZA 4B9YA 5KZ6A 1N55A 1C90A 1VPQA 4PRTA 3V5OA 3GR4A 5LKYA 3BLOA 1PDZA 2WOQA 2ZIDA 1PAMA 4AD1A 1W56A 2A21A 3OIHA 3W7EA 4D8AA 3LBMA 1BKHA 4UQ9A 5DQPA 2FTPA 2ZZ1A 2NVAA 2OR2A 3FJ6A 2X0HA 1WDPA 3SURA 1RJRA 2PDKA 4AVOA 4BI6A 5FKYA 4Z2LA 1J4EA 1Q6DA 2W6RA 2ZXBA 1R38A 4K1GA 4JL2A 4G7EA 1NM9A 3D3AA 5AC8A 5AHLA 3SZ8A 2QF8A 2Y5EA 3VUPA 2PCQA 4GE8A 1OX4A 1FP8A 3WLNA 3EMQA 3MMTA 2GVEA 2DT0A 1F3XA 1PB0A 3QYSA 4UBPC 4OHQA 2WB5A 1AH3A 1KCZA 4A3HA 2BHUA 1BWLA 4BF7A 4IQDA 4QTGA 2XM2A 3FSUA 1K70A 3WCZA 4HZMA 2WHJA 3WLKX 1SM9A 1E4IA 5IHRA 2BGSA 2XIQA 4GKLA 2BNJA 3TTEA 2ZADA 1OT1A 4GOAA 3UPBA 3EB2A 2O56A 3PF3A 3H24A 4AZCA 4BQ4A 1UIPA 3N73A 3A13A 3VOCA 3WFZA 2X1IA 4AIOA 1ZRQA 4XIAA 1OBAA 3ABOA 3OLDA 2E4TA 2ZUVA 3BW4A 1LL7A 3UY8A 3U5YA 4V1YA 6REQB 1G01A 2E77A 4GX8A 5FF2A 1KM3A 1N82A 1NWUA 3N9SA 4YLWA 1JGIA 4Q8WA 5G4HC 1AMYA 2YXXA 3OLIA 2HPIA 3MT1A 3VM7A 3UNDA 2GUYA 2W92A 2MANA 4ZQRA 4IG2A 5K3VA 4FS9A 2QCGA 1FOBA 1JDEA 3WLRA 2IPFA 4RDWA 3HBLA 2BXZA 3QY6A 1BAGA 1RH9A 3IRSA 5IXEA 2X2GA 1JZ3A 4DO6A 3NGFA 4YS1A 1MXDA 1ZPTA 1IZCA 1CXHA 1VFFA 3OZOA 5HWJA 2Z6JA 4PFMA 2D23A 1K02A 4ICNA 3VZZA 3W6YA 3CZKA 2FLIA 2ZFAA 1LG1A 1TCDA 4NYYA 7TIMA 3W1QA 3GDLA 4QS5A 4RXGA 4F79A 2VRJA 4Y9OA 3G2GA 3HU7A 4C7GA 1VCFA 3PZQA 2IXVA 1MW1A 1AA1B 1QNRA 3R1ZA 4WDUA 2OOGA 5CEWA 1EZWA 5DN1A 3H70A 1S3HA 3NNTA 4QDWA 2PODA 1XR2A 1YTKA 2ZWZA 4XKYB 2J78A 3U6WA 3G5EA 2DDXA 4N9CA 2QEZA 3CMJA 5I0DA 3O6YX 5TD4A 3BLLA 4B91A 2QJIA 3KVJA 3RX3A 3B0YA 4AZHA 4CVUA 2E8ZA 2VQUA 3AU2A 1WXYA 3FN9A 4CQBA 5AZ0A 3F4NA 4J2PA 1R2TA 4HKPA 5K2ZA 3MMWA 5LIXX 5CPOA 4CN4A 4GVFA 2QLYA 3TQVA 3D5HA 2OSXA 3SUTA 1AVAA 4W7WA 1F61A 4QROA 4S3KA 3S2JA 4K6AA 2DZAA 3RU6A 1CGTA 3GFYA 4HHLA 4JIEA 1DHPA 3N17A 4DYJA 1W9VA 3G0UA 1V5XA 4PGLA 4JIPA 5D02A 1R9YA 4WDWA 1FCQA 1VBGA 4JTIA 1CCWB 4N4PA 3MKKA 3E9AA 2ZE3A 2EPOA 2ZXDA 3GRIA 4PBFA 2EJAA 3QJAA 3KUMA 4ICMA 3OG2A 3WQVA 2PLKA 4GIAA 3NZRA 2GZXA 1UD4A 2HVMA 4ZOBA 1QUMA 4AD5A 4HA4A 4GH1A 2XVNA 3V5CA 1JPIA 2I5QA 3VNZA 4EPKA 3HGSA 5GNZA 2CFFA 4XBSA 4A3RA 4MADA 3CS2A 1N7KA 3WDIA 1DBTA 2QAPA 3QFWA 4U3AA 4IMGA 2ZTJA 5I79A 1CXEA 2Z26A 3G1VA 4NG3A 4JTLA 1V3MA 5D09A 3KBJA 1NDZA 3G22A 1DORA 3WUGA 3BL3A 4A6GA 3QY7A 1RD5A 3E5BA 3AHZA 3AIBA 3D46A 4ERGA 2NQ5A 1FWSA 2PTZA 1KV5A 1LORA 4XD4A 4ADTA 4PUUA 2WJFA 4BK9A 2FZ9A 3A4JA 3PB2A 1G1YA 4FX6M 3ZS4A 4IJRA 3S1UA 1KFKA 4PB5A 2F6UA 2WMFA 1QHOA 3W02A 4PTXA 4QEHA 4JTFA 5JMUA 1OG6A 4GI9A 5I77A 4BZYA 3KOWA 4OIFA 3ZT5A 5AHMA 1B0IA 2FIQA 7REQB 1Z48A 3SY8A 3WMCA 1G9HA 2BASA 4NZ5A 1Y8BA 3W29A 1DWFM 3NVTA 3S2CA 3SCRA 2FZ8A 5G1TA 4E4FA 4J9JA 3AALA 2WMKA 3W7KA 4E2VA 4S3EA 3HF3A 3FA5A 3R0KA 4OKDA 1KR0A 2VEIA 3S5SA 4JDBA 2PGFA 3RJYA 5AB3A 2GGIA 1TCMA 1QO5A 3SBFA 1KBJA 2ZDRA 1CLXA 2HDJA 4QHRA 5T91A 1L6YA 5LA2A 3G6MA 1X7FA 4FHAA 3MWCA 3W7CA 2DIEA 1EKOA 1V03A 5FSEC 4V28A 3VOFA 1SJDA 1Q7MA 1V0MA 2VOMA 5I00A 1KWKA 2V5BA 4I6VA 1MW0A 1XYAA 3U57A 1C3FA 1OGGA 4IP4A 5A6JA 1X1NA 1VLWA 1TWDA 3WBYA 2VJXA 2WWDA 3W1UA 2OKOA 3W3OA 2DQWA 4EPBC 2E0PA 4AB4A 1RCQA 3S6OA 3H4WA 2EQDA 4PB3A 3MSRA 4I8DA 2R1PA 4O0QA 1XLIA 1DIDA 3NZQA 3LZ5A 4GZ7A 1IIGA 1PVNA 1X6LA 4DI8A 2H3DA 3NIYA 1FWNA 5T26A 1W9UA 1XG3A 4FXFA 2J8FA 4GX9A 1NH6A 2IPJA 4JD4A 2WANA 4JTGA 3CBWA 1DWIM 4QAIA 3UWQA 1K9FA 1GVYA 3GBDA 3S83A 5CJ5A 3R0DA 1XS2A 2ODOA 2TAAA 3VTRA 3QMTA 1CGYA 3W7MA 1E3ZA 4RNJA 3MVTA 3HGRA 4GBUA 4PA8A 3I3EA 1QXLA 4UQAA 3M0JA 3N15A 3V36A 1UP2A 3AS1A 4KMQA 2DZWA 2GSJA 3BO9A 3KLKA 4DJDA 2GFTA 3HGOA 5AOUA 2H9AA 1O66A 4G1KA 3NO3A 4AWTA 3L21A 1V3IA 1AZ1A 3IGUA 3NOYA 3PBWA 3EWCA 3W87A 3QSRA 1XISA 2QUTA 4B2DA 3TW9A 3B9OA 1ZAJA 1DE5A 1HXJA 4GJ1A 4CNOA 4ZGYA 4FF5A 1SPQA 1KD0A 4AD3A 4EANA 3WZ0E 5JH2A 4JKKA 4TV5A 2NZLA 2Z27A 3O9NA 3KW3A 2I56A 2PB1A 2X42A 1SFTA 2WNQA 4BQ5A 7ENLA 3BCFA 1JZ7A 2PRHA 3GZ3A 4CCZA 2GK1B 2QDGA 3W1LA 3CLWA 1VGAA 3VCRA 1CGXA 1XW8A 1G7VA 4AD0A 2HQAA 5CZKA 4ZR8A 2UWFA 3TN5A 1K8YA 1EYWA 4PRWA 5A6LA 2FGBA 4GUHA 4ATWA 1UBSA 4JQAA 4AIEA 1JD9A 2ZXQA 1K6WA 4PH6A 1NWTA 4H00A 1EJUC 5D9MA 3AXIA 1OYCA 3APTA 3GIQA 1R3QA 1UCWA 4CVWA 2VYOA 4MWAD 3RN6A 1TVPA 1OFOA 3TAKA 1MQPA 4K3ZA 1IEQA 1W17A 5CBJA 3O3RA 1FWGC 4NJKA 1GG1A 1GZ1A 4UFHA 2GJPA 2D24A 3PAJA 1E3XA 2D1ZA 4YJ5A 1UYQA 2G3JA 3LPPA 3QKEA 4MVAA 1TQJA 2GQ3A 3PBGA 3H7UA 1BVWA 3NCOA 4LUSA 2WCAA 2R8WA 4RZ6A 3NPVA 1UZ4A 2J7CA 3QHNA 3W7PA 4GNKB 1XRTA 5I3IA 4GIRA 1JNEA 2J74A 5HULA 3MYOA 1WKYA 2WO5A 4R3UA 4BR1A 1IXOA 1A5KC 3HO8A 2RH9A 1P6WA 1V7YA 4PMUA 4WXZA 2NT0A 2F84A 4ZZ9A 1AODA 4HU3A 3UZXA 1MNSA 3BAIA 2A3EA 3PZ9A 2ZA1A 3UR8A 2OTDA 4GINA 5A8MA 1VFOA 4H6QA 3BQ6A 1DWAM 2Q6ZA 4PCSA 3CXOA 2VEGA 4KESA 5A2CA 3WF0A 3QV8A 3GXMA 4A21A 1UH3A 1CPUA 1EPVA 2VGIA 4TX6A 3T55A 1VBHA 2CLOA 3AJ7A 2ZRWA 1E43A 3B0PA 4BWLA 2WMGA 2TODA 3AYSA 4PZVA 1XLLA 2A3AA 2EPLX 3ARUA 1TJ2A 3P67A 1IF2A 4NT0A 1VD6A 3IJLA 2REQB 5KSWA 3N18A 2WSRA 5BU6A 1R3VA 1CT5A 1UASA 3VD7A 1QRQA 3BC9A 4JTTA 3AIUA 3R8RA 4QCFA 2YCEA 2VFFA 1YRRA 1I9CB 1MFVA 5D05A 5I3DA 1W3NA 4AC7C 3RGTA 2O9RA 1ZTVA 1H11A 1HVQA 3SRKA 1GOOA 1ZHAA 3HV9A 1F07A 5EMUA 4GZIA 4GQRA 1V4YA 3UWUA 2QJMA 3NTYA 1JEZA 1CB2A 2DVUA 3KHJA 1QI3A 1PXGA 4AEOA 5E09A 5XIMA 4QJ5B 2E9LA 3GUWA 3O63A 1FWCC 4KW2A 2AQVA 4MKSA 3Q58A 1MVYA 4IXXA 3EDEA 1RALA 3TTSA 1XSKA 3MO4A 1A80A 2UY4A 1H5YA 3PUOA 3PPFA 3EA1A 1S5TA 4H19A 1Q63A 2YZRA 2WMHA 3K8MA 1I45A 2R94A 1YPXA 1ONEA 4AH7A 3E02A 4HP5A 1EP1A 1W1A1 2VFGA 1TTIA 2AMGA 4IWWA 2BY2A 4IGNA 3ZVHA 4H6KA 1Q8JA 4Q8OA 3LHVA 1FFQA 1M65A 5HUPA 1H62A 5FCZA 2PDMA 4O4VA 4UR7A 1J11A 2G4FA 5DRCA 1N2VA 3N2BA 5HMEA 3ZIZA 1KCXA 3OLGA 3WJXA 4PB4A 2V9DA 4UUIA 4EXAA 1O12A 4DI9A 1T8QA 2J7FA 2P8BA 4EOUA 2W79A 3WLLA 4CCDA 3VIMA 2R1LA 3WEMA 3SUSA 5HMSA 4X3ZA 1JDDA 5A2AA 1IGSA 3SJNA 1JCTA 1W3HA 3N3MA 3VNJA 2D0HA 1MDLA 3AHXA 4JKMA 4NVTA 3ITOA 2VKZG 4HSOA 3DENA 2I1OA 1SUXA 3CWHA 4UNIA 4MZ1A 2PDFA 3DECA 1O68A 3PJWA 2XIBA 3OBEA 2P76A 1G4EA 4V1XA 4NI3A 2UY5A 4LW7A 1PKNA 2YDSA 1K9TA 3DYPA 1FH9A 4QDMA 3WDRA 5GQBA 4O16A 3TCSA 1W9BM 1RSCA 2AQOA 3ITXA 5C2XA 3EWUA 2QAFA 4PL1A 1YEYA 2ZVRA 3E0VA 3B3DA 1QASA 1PPIA 3VX1A 2X0SA 2HVNA 3UY7A 3E6EA 3TXVA 1WZKA 3AI0A 3LXBA 3IVTA 2YFNA 4J3WA 1F3WA 4FXRA 5E9AA 3TKFA 4PYSA 4IJCA 2PS2A 1QTWA 3CUFA 1FH7A 2J8GA 1KKRA 1Q6LA 3VD4A 4E8GA 4CD4A 5J04A 1VEPA 1Z3NA 3BMVA 4HPHA 2CLPA 4EVZA 4JYFA 1QWKA 1G4SA 4ZODA 3L4UA 4IM4A 4M8UA 5I3GA 1Z41A 4FI4A 3RR4A 1EBHA 1UWQA 4GNVA 2DUAA 1L8NA 1EPXA 4IX2A 4FZIA 1VBRA 1VYSX 3HGJA 2VWTA 2YSWA 1NARA 1GONA 3USBA 4LCRA 1E0XA 4IPNB 4LQ1A 4CNPA 1FKXA 2PE4A 3EB3A 1DXEA 3KTSA 3RPMA 1AQHA 1EFZA 3GNOA 2IPWA 3COTA 1E73M 3W9ZA 3C4UA 3LV6A 4DBDA 3BAJA 4N9EA 1XF0A 4NJHA 1XJBA 2HTMA 4KRUA 1J8VA 4JTAA 3WEOA 1HO4A 4FNPA 3M0ZA 1R3YA 3P81A 1E1CB 1EBGA 4AHPA 4RE2A 2PMQA 4EX4A 4IPLA 1OSEA 1MUWA 1UH2A 5IBXA 2YKKA 4LALA 2HV5A 5D2TA 1GOQA 2FPYA 2PDJA 1ZENA 3THDA 3VGGA 3FYPA 4GYPA 3FHQA 3HM7A 4QR6A 1W1ZA 3QSTA 3EPOA 4X9SA 3T0AA 3L65A 5BOOA 1W5NA 1BTCA 4AZBA 3NQAA 2NUWA 3TSDA 4WGHA 2V68A 3VABA 5BXRA 4MUPA 3WQEA 2JEPA 3M1ZA 4U2YA 3DKLA 2W4XA 2WJEA 1C9DA 4U33A 3AIRA 2Z2AA 2EPKX 4J28A 2BB0A 3XISA 2TPSA 2QJGA 3KE0A 5FACA 4S3BA 2OMAA 5BRPA 3EEZA 4JS3A 1KFJA 1MMFA 2DT3A 1Y7VA 2OT0A 1JZ5A 3G1YA 1VBJA 3R43A 3IS4A 5AYZA 1JI2A 1JNDA 2XFFA 3VIFA 5I3KA 3DG3A 1MEIA 2E8YA 4WRHA 3R79A 4PCNA 4D6IA 1EIXA 1I60A 5CGTA 3BWWA 4DRSA 1FHVA 4ATLA 1FP9A 1PZ1A 2VFEA 4FALA 1SR0A 2NV2A 3BG9A 4PSRA 4XK2A 1UHVA 3PBUA 3VZYA 4XVDA 4XUGA 2FMOA 4UFMA 4I9JA 1Q4WA 3N4AA 4C91A 1DJHA 3TZNA 3N2OA 1BLIA 3ZYZA 3OB8A 2DSWA 1WNOA 4FF7A 5FL0A 4JZ5A 4QM1A 2QNEA 2JGYA 1RAKA 4TVDA 2VELA 1UKTA 4GHRA 3E12A 3MUCA 2VDGA 3T07A 1OK6A 1CGWA 2PBOA 3T0DA 5EFDA 3KBWA 1FX6A 1BPLB 1CXKA 1XM3A 1ZB5A 5JU6A 2PF8A 1FWIC 1ISXA 1J0KA 1L0PA 4GUGA 3GVWA 4QJ3B 1RCOB 1UKOA 4GI8A 1OINA 3ANUA 3L0NA 1YPIA 2AQWA 2NVCA 4LANA 4OV9A 3UVAA 2V5CA 1M41A 3GDBA 4ZE5A 1A0DA 1XSJA 3CQ0A 4G2DA 5FA5A 4HZ7A 3BARA 3E38A 2J66A 3WK1A 3VGEA 2YB4A 2E7FA 1XI3A 4AFYA 2OEJA 4D8ZA 1XIJA 1RJQA 5LXEA 3V0TA 4J3UA 2XVPA 3AS0A 4EWJA 5HNTA 3UXLA 2WSPA 1HGWA 3SY5A 4QIUA 2JALA 4HYRA 3THQA 3TYBA 2HE8A 4O8AA 1S2UA 2V0TA 4H7CA 1KBLA 3ZM8A 1TTQA 1FRBA 5IFPA 3R25A 2VO5A 1DVJA 1M01A 4HA1A 1RJPA 2F61A 4C6OA 3QVQA 1ISWA 4H2HA 3ALFA 4GWEA 4AIBA 3W1NA 5AKQA 4KRTA 3LTPA 2P1FA 4UOZA 4UOQA 5EMMA 2RAGA 4L4OA 2VOTA 1VJIA 2V6AA 3KHDA 4JN7A 3CPRA 4LUJA 3HA1A 3B4YA 4KCUA 2VVNA 3DYOA 1NOWA 3RLVA 5A6BD 2OWWA 3TW6A 3WMBA 1YXDA 3P80A 2WZEA 4WOQA 2OO0A 1EC9A 3ZJ7A 1XBYA 4QE4A 3GIPA 2Y8UA 2ZOXA 3BLFA 3EX4A 1QAPA 1LL6A 1H60A 3OZPA 1YDYA 4GG9A 4Q4QA 1TMLA 3N2TA 1EDTA 1AUSL 4O1AA 4S2CA 2DU2A 1WDDA 4L4PA 4ORMA 1ONWA 1JZ6A 4CNSA 2OVLA 3LDVA 4XWUA 2QHAA 2GJRA 1TJPA 4JXCA 1XLEA 3L9CA 3L2LA 3W7JA 4Z2JA 3UXIA 2EG7A 3L5LA 4GY1A 1JQXA 4F0LA 4NAEB 2PWEA 4GYFA 1VAHA 2Q8ZA 2V2DA 3C86A 2DH3A 3U7VA 1HIZA 2CCRA 1H09A 2OJPA 1C93A 3DBPA 1CDGA 3HB9A 3I6EA 4X63A 3ZOAA 2Y88A 1OCBA 1BHGA 4RLIA 3A21A 1AQMA 4H6RA 4Y9AA 1RV8A 1SVDA 3GFXA 4ZQCA 3L4WA 2GJXA 1WX0A 4P7OA 1AW2A 3U8GA 3URNA 5CH9A 5D04C 4ZOEA 4AZIA 3B9DA 1TR1A 1WKDA 3CMGA 3S1XA 2GVLA 1SU5A 3FGCB 3HQOA 1R3SA 3LRKA 1XX1A 3M6YA 1UWIA 2O0TA 4GFIA 4V15A 1S5NA 2G3NA 3RM4A 3AUJA 5AVHA 3BSHA 3BK0A 3KTCA 3NPXA 4ACZB 2XSAA 1W32A 1NDYA 1ZCOA 5I03A 4HIBA 2WSQA 1XIGA 3B4UA 3UCQA 1ZUAX 3CUXA 4AUBA 2A7PA 5I3JA 4ZSTA 3W4RA 4GC3A 4YHEA 2D0FA 1D2KA 1FWRA 2A85A 2AKMA 1JUKA 1KBKA 1LBFA 3SR7A 1EX1A 2A7RA 3Q45A 4W86A 4UTWA 1RZMA 3F5LA 3FA3A 4JOMA 4GUIA 1J01A 4RK8A 2E3ZA 3B8WA 4NNCA 3NOEA 3IJIA 4DN1A 3TDFA 5C71A 4XZ9A 1OYAA 1EB3A 3W25A 2A3LA 3PFMA 4IXHA 3IARA 4HZ8A 3WUFA 3A3WA 1FXQA 3GVRA 3OP2A 5F2LA 2WBKA 2NSOA 1UA3A 2DSVA 4Z1YA 1W3TA 3LUTA 4D2JA 1TRDA 3UA3A 5BMWA 3SCTA 4HGXA 3NXFA 4UTHA 2ZRYA 1JF5A 3TNBA 1J9YA 1P0EA 4NRSA 4P7QA 4XD6A 3GNRA 2PBGA 1TUXA 1DJQA 2ONEA 4MJMA 2ZKMX 3AMKA 3P82A 2BZNA 3TYCA 3ZJKA 1J10A 3UXAA 3URAA 4GACA 3MMUA 4KKXA 1HKJA 3FX4A 4HB7A 5DEZA 2VEPA 1HG3A 3HIJA 3FAWA 4WHBA 2Z24A 1ONRA 1BG4A 2WK2A 2YA2A 3WBAA 3W75A 1DJIA 3UJRA 5HNRA 2J9XA 2GDUA 3LM3A 3TC6A 2EJ1A 2WNWA 4GRSA 3C52A 1F6PA 5K7JA 4P61A 5FJRA 3M44A 2O4QA 4CQ9A 1B3XA 1B90A 4IJBA 3FKKA 3CZEA 3PTDA 3SEPA 3RXZA 4Z1AA 1BQCA 3NFUA 5C55A 3W2MA 3BSMA 5C9RA 2INEA 4P8WA 4DO5A 2PDYA 5G2IA 1GYNA 5HDRA 1CGVA 4PBGA 2DORA 3WQGA 3FVDA 3RX4A 4JL1A 1T96A 3GKAA 1BGGA 1OCJA 1S2VA 3ATZA 3WELA 3WD3A 2Y63A 4JX6A 1XIFA 5LNWA 3CL7A 1XFCA 4LUTA 1ZU8A 4DXKA 2PWUA 2QDDA 3LI0A 5H91A 4F0KA 5EFFA 5JXQA 1JZ4A 2WKLA 1G94A 3L5MA 1XH0A 4WLCA 2Y1HA 1ZBKA 3FCPA 4I3GA 2B0MA 3REQA 3A6OA 2BDQA 1KR1A 1ZY9A 1HJXA 4C6FA 1WDQA 3DKJA 5D8ZA 5KINA 6TIMA 3ITLA 2OLHA 4KEVA 3FFSA 4Z2GA 5BU9A 4CKQA 3FDGA 3TFXA 3U2EA 3RO6A 1J0ZA 4AXNA 4AZ5A 3PJXA 4PC8A 3HQPA 3ALGA 4LS1A 1EF2A 3NQCA 1FCUA 2CW6A 1YE4A 2Z00A 3MWAA 1IE7C 4K68A 4LB3A 1V3KA 4ROPA 1FCBA 1TWWA 2PDXA 3A4WA 3B04A 2CYGA 2P53A 1V6YA 4J3VA 4KCWA 9RUBA 2GWGA 4UTLA 3GDKA 4WF7A 4PEKA 1PV8A 3TIMA 3FSTA 2BOFX 2VP8A 4ZQPA 3GK0A 5LSMA 1LRQA 1UOKA 1PDYA 5HWMA 3GDTA 4Z0SA 8A3HA 5JH1A 2BP1A 4LVFA 1OFEA 3NZPA 3L5AA 4OFCA 2Y70A 4W88A 3ONBA 1HFBA 1UWTA 4JEQA 3M41A 1A5MC 2Q8XA 5CJMA 2ZC1A 3OVRA 3EMCA 3LK6A 4UTTA 1TV2A 4GISA 4KERA 4DJDC 1ECEA 1BSIA 2ISFA 4Y8EA 1OG0A 5FAJA 3M5YA 3MBFA 1TV8A 4DJED 1GYLA 4J1OA 1IXQA 3ITYA 4HK7A 1ME9A 1U33A 2WPGA 1Q13A 2GGGA 1RQEA 4JFVA 3MVIA 4NJGA 3S4TA 2XYLA 4NZFA 3VIIA 4JTHA 1J2BA 1ZBCA 3O15A 1TWSA 2BY1A 4YPJA 1KFWA 3HFYA 2Z28A 3N12A 3THAA 1MEWA 1B31A 3OBKA 3PNZA 3LQGA 1PTDA 2YDAA 4HMDA 5AHNA 1J2WA 2YPIA 3APYA 3HFTA 4DF1A 4PE8A 4UIOA 4F0MA 4WY0A 3TOYA 3H7RA 1F8MA 3W27A 1VIZA 3ZQ9A 1KM4A 2OKTA 4L5ZA 2FHCA 4ZQNA 3A24A 4JGDA 1SW3A 1TMHA 3DUGA 3BLKA 1REQB 3SCWA 1M5WA 2ACRA 5A95A 1E71M 1ZL1A 3ITTA 3A22A 2IXUA 1RPKA 3DC8A 4IFRA 4N4QA 3GR8A 2R82A 3CEPA 4MWAA 1HO1A 1YYAA 3RX2A 4IL0A 3H2OA 4LCSA 1GQLA 2PDBA 2HROA 5G2HA 2ICSA 2PGRA 4O1EA 4A35A 1ODUA 3QMRA 1XD0A 2AGTA 1VYPX 5AFDA 3OGVA 1OYBA 5FEWA 1YE6A 2D22A 1ZGDA 1TPVA 2Y0FA 4AMCA 5FF3A 3BICA 3VDCA 3ELFA 3ATYA 1W0MA 3CV7A 3G18A 4GBDA 3W82A 3GG0A 1K8XA 4GVHA 3CUZA 1BXNA 2Z2UA 1P6CA 3KL3A 3MSGA 3K4DA 2WCGA 2QVHA 1JCYA 4BEQA 1P5BA 2PPGA 3OHMB 1UUMA 4C1NA 2CLKA 1DJYA 3C2YA 2WHMA 1JUBA 2XSXA 3S9ZA 5FD0A 2WM0A 2FPTA 2CPUA 3VCCA 4XBJA 2XGIA 3KEHA 1XUUA 1KXQA 2VZOA 1NFGA 4LAMA 4AQLA 3EGJA 1JPKA 1LRTA 2VT0A 2ZRUA 1FWDC 1R47A 2PFHA 4NQ1A 3WBXA 3KWXA 4ZOCA 2ZXAA 3U48A 5K9DA 3AO0A 2ZTKA 3QQ1A 4DJFD 4A2RA 1QPRA 4BWLC 1TPB1 1M7JA 4XZLX 1P48A 3LI1A 1O4UA 4LWWA 1Q4NX 1ZS2A 3GX9A 1XIDA 1V0NA 2FTYA 4LRSA 3RF9A 3TEVA 5LGZA 1OB0A 2TRSA 1HKKA 1LJYA 4C6LA 1UW9A 5FJTA 1LM1A 4YL2A 1KFLA 3LHZA 3GTFA 1Q2RA 3R0UA 4H2CA 4HJFA 1XRVA 3C0LA 2QS8A 1KFEA 3KX6A 3NURA 1KW1A 3T0BA 4DBWA 1ICQA 1WBHA 4ES4A 2ASHA 4X0NA 5I3FA 3UFYA 2OX1A 1UB3A 4IH3A 3FXGA 3WSUA 1BXBA 1CYGA 1US0A 1V6UA 3HQNA 4V33A 3CHDA 2DZVA 1TFVA 3K4WA 4B5WA 4NAFB 3SN0A 1BF6A 2E6AA 5DX7A 4TU1A 1DJZA 2CESA 2WVVA 1JGMA 4JQ1A 3AWOA 5FEPA 5JBDA 3GXNA 2VC7A 1XINA 3AZSA 3N13A 5CPTA 4CEXC 2QUUA 1ECQA 1VCVA 4JFSA 1JZ8A 3ZWSA 3LNPA 3VGHA 4MJZA 2PC8A 4XZIA 2QCDA 3G1FA 1W1IE 3L7RA 3VI2A 1Y5VA 2QGYA 1HX0A 1QJWA 3AIQA 1L2UA 4I8YA 2KX9A 4AYSA 4ZO8A 3PWAA 1XLFA 2INZA 1W8GA 3WK0A 7A3HA 5LIYX 4PCTA 1ME8A 2DSUA 2YB1A 4J2MA 5C2CA 1UR1A 3ZO9A 1UWUA 4URIA 5DXXA 1B30A 2CZVA 3WBEA 3BDKA 3NPUA 5JIPA 3DFYA 5REQA 4Q8QA 4RE4A 2Q3OA 1UR2A 2CXGA 3AFBA 1I1WA 1X6NA 4YCPA 1XLKA 4CD7A 2AAAA 5H8UA 4B15A 4EKJA 3O1NA 1G67A 2G0WA 2XJ7A 4ZE4A 2FHFA 5H8MA 3B8UA 4W5ZA 1IEVA 1W9XA 4MZYA 3W7HA 1RK5A 1UMLA 1HKVA 3E1F1 3FVMA 2VZSA 5FJOA 1GVQA 2IS7A 4J3SA 2YOCA 4US5A 3VVGA 8RUCA 1LUCA 1V3HA 2JFEX 4NZJA 7CGTA 4JQ3A 2OG9A 4IPIA 2FVKA 3GW0A 3VMPA 2KZHA 2GLKA 3LN3A 4MB3A 4GABA 2F2HA 1JYNA 1ML1A 4LEQA 4Y96A 5EY5A 1TG7A 2XN1A 1QHZA 1TPUA 4FNSA 2HBXA 1BYCA 3NSXA 4O1CA 1O5RA 4O8RA 2X8RA 4NZCA 1W3JA 2NT1A 1KXVA 2WHKA 2Y6ZA 1MXSA 1S2AA 3MANA 4H41A 3VIGA 1P4CA 4KIRA 3YPIA 3GXFA 3P0XA 2R24A 1KM1A 1UR9A 3S2MA 4L1XA 3A4XA 2XIJA 4ASTA 4QE5A 4L1GA 4Y9NA 3L4YA 3VFLA 2CKSA 2GOKA 3GH4A 3ABXA 5U4NA 3MJMA