3HFTA

Crystal structure of a putative polysaccharide deacetylase involved in o-antigen biosynthesis (wbms, bb0128) from bordetella bronchiseptica at 1.90 a resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
242
structure length
242
Chain Sequence
RYDNKFARISDIDINQPESWRGRIFLTFDIDWAADFVLQDTIDLIEGAGVCATWFATHSTPLLENIRRNPLFELGVHPNFNPLLAGAHAEGVQEILDRTLELAPGCVSVRSHSLVQATSILNMFGERRLRYDCNILVPWDAGIVLQPWRHWTGDMVRVPYLWEDDVACLYDWEFDSTFDYWYQPDGINVLDFHPIHVYMNTESLRRYEDSREVHRNPVDLIRWRNTSAGSRTFLQSLLARNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of WbmS, polysaccharide deacetylase involved in O-antigen biosynthesis (NP_886680.1) from BORDETELLA BRONCHISEPTICA at 1.90 A resolution
rcsb
source organism Bordetella bronchiseptica
molecule tags Hydrolase
molecule keywords WbmS, polysaccharide deacetylase involved in O-antigen biosy
total genus 82
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2009-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 3hftA00
1W1B1 4LY4A 2I5IA 2C79A 4NYUA 1V6TA 3CL6A 4OUIA 3S6OA 2E67A 5JMUA 2VYOA 2QV5A 2C1IA 1W17A 2C71A 3HFTA 2IW0A 4F9DA 4F9JA 4M1BA 4WCJA 3CL8A 3VUSA 4NZ5A 2NLYA 2C1GA 4NY2A 1XW8A 3QBUA 4NZ3A 3RXZA 1W1A1 4U10A 2J13A 4NZ4A 1Z7AA 2CC0A 2DFAA 5BU6A 4HD5A 3CL7A 4L1GA 3WX7A 1NY1A 4V33A 4NYYA 2Y8UA 2XU2A 4NZ1A 2W3ZA
chains in the Genus database with same CATH superfamily
3I10A 4Z2HA 4XD6A 2C0AA 1RY8A 1KBJA 1KFCA 4WKHA 4UTMA 5JXQA 4HGXA 3RM8A 2CLFA 5I3GA 3C8FA 3WLOA 3PBMA 4DB7A 1D8WA 4IJRA 3LCGA 3KBSA 1FUYA 4DYJA 1G1YA 3TA6A 1EBGA 4A8IA 4ZZ9A 1W3TA 3TXZA 3SECA 2W61A 3PZNA 3SQSA 4FP1A 5IFTA 3QH2A 1Q45A 1RA0A 1OFDA 3HG4A 2ACSA 4CD7A 1IWAA 3LB0A 4JEJA 5E09A 3D3FA 2XM2A 4JCLA 1XIEA 4Z1DA 2G97A 4ZOBA 3TONA 1EHNA 1QCWA 1JNDA 3CV2A 4NY2A 5AC7A 4A21A 1BXBA 2FPVA 4AWEA 3WBAA 4PBEA 4LBUA 1EGZA 4Y90A 1WKYA 2VX6A 3C3UA 4JTKA 2XU2A 3UPMA 3TNOA 4V27A 1ISVA 4XZLX 2EJAA 5ABEA 4JKKA 5H6HA 3M41A 3OVGA 4E8GA 4ES4A 4WVXA 1Z8AA 1XX1A 3P84A 2VRJA 1GOOA 4KWWA 5A6AA 5FCZA 3BW2A 1JDAA 1IE7C 4MB4A 2WNWA 1EX1A 2R6OA 1E3ZA 1L2QA 3FXYA 3UG4A 5AYZA 5D37A 4AY7A 4HU3A 1DHPA 5EMKA 5JQ9A 1V02A 1ZU8A 6ALDA 5BWFA 1B57A 4IIBA 3QW3A 1LRNA 3WLSA 2DU2A 3RIKA 4X63A 3FEMA 1E40A 2B7QA 4PEKA 4B2DD 1U33A 4GO9A 8CGTA 2FZ8A 4HN4A 4MJMA 4WCJA 3VGEA 1DE5A 1I8JA 1OX4A 4PFMA 1O1HA 4Q7NA 3WKZA 2NV2A 3WLTA 3GXPA 4OGZA 3AXIA 4HMDA 1O6IA 1LQ2A 2C79A 5LYRA 5H8MA 1ODZA 1W9UA 3RUBL 3BH4A 4GFSA 3G1FA 4WLCA 4EXAA 1J10A 2W79A 1YBQB 4PRRA 4AYSA 3G77A 4C6FA 4L9YA 1RV8A 4IX2A 2V68A 2C14A 2ZZ7A 3A64A 3AIEA 4D8ZA 3CV1A 4HMEA 4H8HA 3AU6A 3VXGA 2ZZ4A 2XN0A 1E1FA 4MWAA 4H01A 4JFVA 5LIKX 4ZL1A 1ME7A 4IM4A 3A21A 2REQA 4NZ4A 5D33A 1GHSA 2CC0A 3PWGA 3GHTA 3PZGA 1PWMA 3CH0A 3W1NA 4AZBA 4FX6M 2X1UA 3FX4A 2XN1A 4DZAA 3ARVA 1FWFC 1TE1A 2XIOA 2QF8A 1PB0A 3A5VA 4FSAA 4NI3A 2HBVA 3T07A 3PFRA 4WXYA 3GU9A 4E2DA 4KFPA 4W84A 2WSYA 4M29A 4U5IA 3U5YA 2VTFA 4AB4A 4LS2A 1K70A 3UR7A 3L66A 3KBNA 4AFYA 1RHCA 4KPLA 5CG0A 3H2EA 2DVUA 3CT7A 4AXKA 4MHBA 2D22A 1AL7A 3EB4A 2WZMA 2ACRA 4L9ZA 2WWCA 1LLOA 1WNOA 4W85A 3OJGA 4PCNA 5A8GA 3UVAA 2Z2AA 3UESA 5HQMA 1R3VA 4X60A 3ZJKA 2CITA 1XC4A 2VZVA 4ML4A 1BQCA 2ZZ3A 4L1XA 4E38A 3VNKA 1K9EA 3BK0A 3VIHA 3PS7A 4EIVA 1A5BA 3GVWA 1W5QA 1E6XM 2WO5A 3N19B 4GD0A 1XSKA 3PP7A 1BTMA 1M53A 1A50A 3UFYA 3N4AA 3MMUA 4JTRA 3URNA 3PBVA 3C2RA 1GOWA 3O6CA 2G3MA 3PUOA 2OMAA 1PYFA 2UY5A 1RXOB 3ITCA 1FDYA 1VGAA 2GYIA 3B40A 3CZKA 3WH8A 1EDQA 5K9XA 3WLRA 3EMCA 4JN6A 2DUAA 3HGOA 1J0JA 3MDUA 3IACA 4MB5A 5D2XA 3MKVA 3SJ3A 3LV5A 3BLFA 3AHVA 3FA5A 3IS4A 4GIRA 1E1EA 1TWDA 1TR1A 3IRDA 4K2SA 5D4YA 3KTSA 1JUEA 3M5ZA 2A5HA 3KVLA 4LS1A 1CXHA 4IG2A 5D9PA 3KAOA 2A3LA 2WM0A 1ONEA 2DZPA 4C91A 3PK7A 3MMDA 2OG9A 4K6AA 1CXEA 1SJCA 3TYZA 5D8ZA 3VNMA 3VDHA 3F4WA 2ZRUA 5FF0A 3BUVA 3NR0A 4I7VA 3PZ9A 5BW6A 3LCHA 2QDDA 3VD7A 4R7OA 3UZXA 2Z1WA 1UD3A 4M81A 4H9MA 3SI9A 2DIEA 4IIGA 2WCSA 4TIMA 3VOFA 1VEPA 2D69A 2FLIA 4MMWA 1NFGA 2ASHA 2XH2A 2WLZA 3NFUA 1BVWA 3KWXA 1LBFA 2PSNA 3ZJ6A 3EB2A 3UWWA 2Z00A 5FF2A 1MQRA 2Z27A 2O92A 2BY2A 3TC7A 3VKDA 4B90A 4M24A 4F40A 1G5AA 5EBAA 1XIJA 1OIMA 2ZE0A 5BXRA 2O9PA 4GXMA 1JD9A 3R79A 3TLLA 2WBKA 1TV4A 3H7VA 3WQDA 2OJPA 3NPWA 3CXOA 2C7FA 1JRBA 2VFFA 4Q4OA 4RKAA 2CBJA 4IICA 1KXVA 4KKXA 2F7FA 3HN3A 2X40A 3CEUA 3MPGA 4QLJA 2JBMA 3QBUA 3DFOA 3R5EA 5REQA 2PDXA 3GR7A 5AHNA 3E0FA 4AX7A 1GVSA 1W3IA 3FK4A 4X22A 5LNSA 3WLQA 2VDIA 1LG1A 4F3HA 1MVYA 1UJPA 3A9BA 5D32A 1H11A 3UJSA 3EXRA 1V6YA 3NQ7A 1P0DA 2WMGA 3FYYA 1QNPA 3RFAA 3LBOA 3GAYA 1OC5A 1KM5A 1XM3A 3AMLA 1QPNA 4KS0A 4LVFA 4O52A 4O18A 3B0VC 4ATDA 2O0TA 3L5MA 1RR2A 5GNYA 3QKEA 4DEFA 4Z2JA 4O15A 4QITA 3Q67A 4WSHA 5KZMA 4CQ9A 3S83A 2YOCA 2ZWYA 2VT0A 3PSVA 1YDNA 3G18A 3LYEA 4ADSA 3QGKC 3N9RA 4UOQA 1DJWA 1YEYA 3N9SA 4Y7EA 3CT2A 1G01A 1UZ4A 1CLKA 2D1ZA 3T2OA 4W7VA 3AHZA 3VTRA 1X1ZA 4O57A 1S38A 1FHLA 3ZZ1A 1OFQA 4CVUA 4LPCA 5C70A 5B7YA 3P7YA 3H23A 1TJ2A 1XCFA 3W6YA 2IQ0A 3NPUA 1TG7A 2WMHA 3EDDA 3XINA 2UY2A 5F4XA 4OU1A 3ZVIA 3FVDA 4W88A 2QS8A 3NVDA 1EHAA 4JN8A 4AIUA 4MF4A 5C9RA 2WMFA 3RX4A 3PTKA 4Q4RA 3QR0A 1N8FA 3W85A 3VGDA 3H2AA 2R8WA 3AYSA 5DCBA 2IQTA 4Q4QA 4RL3A 1VCGA 3BMVA 1OT2A 4H19A 5CJMA 3STFA 3RO6A 1GVFA 4XX6A 1CT5A 2L5HA 2G50A 2H8ZA 3EWDA 5T26A 3NURA 2I17A 3W1XA 2DZTA 2FGLA 1XLMA 3WJYA 4U28A 3S5YA 8XIAA 2PZ0A 2Y63A 4XZWA 2OODA 2JE8A 5CPNA 2D2OA 5A95A 3CMGA 4M1RA 1GPWA 2O56A 3PBUA 4FXJA 2Y2WA 4DM2A 4I9MA 1TV5A 3NIYA 3W7QA 2A1YA 4NQ1A 3L4WA 3W6MA 3PVFA 5AN7A 2FB2A 4H3DA 5M2FX 4B91A 1LDCA 1DVJA 4HNCA 1DQXA 2XGIA 3WJSA 5MKGA 3GLCA 5FF7A 2O9TA 3L4ZA 1UHVA 1B54A 5I09A 1XBXA 3ITOA 2FDMA 1AL8A 4I7WA 2HEJA 5BXTA 4BEQA 2P0IA 4B5WA 1I2PA 3N2MA 1H3GA 4HNOA 1KRBC 3POHA 5C55A 4UFLA 1UR8A 2OKOA 1X38A 5HULA 3R43A 2WKJA 5HPCA 2BS9A 4EF8A 4WQ6A 3S5OA 4N4PA 5CPQA 2ZTJA 1DORA 3IAPA 1Q63A 2YFOA 4BQ2A 4AD0A 1W31A 1Q66A 4I9AA 4R27A 4KIEA 5FJPA 2XHYA 1ZUAX 3D0CA 4MNJA 3QZ6A 4IMAA 1EPVA 3QQ0A 5ABTA 1AJ2A 1U22A 4K37A 4KW2A 1XFBA 4P5UA 2VZSA 4Y9AA 1IWBA 1YE6A 2AAAA 4DZ5A 1LL6A 4CQCA 3O05A 1ZBVA 1E3XA 1PKYA 2ZE3A 3OODA 4FIQA 2D73A 2WXDM 4LV4A 4HZ8A 5C7HA 3GWQA 1GW9A 3MS8A 1DJQA 4IPJA 4DHGA 1EC8A 4K1GA 5JUVA 3C56A 3BG5A 1QBBA 4QX4A 2XIJA 1NDVA 4UTKA 3C2VA 5DCDA 2WNNA 2BMBA 3MO7A 5EYWA 4L4OA 2X8RA 3HG5A 3CEPA 2VC7A 3CBWA 2TMDA 1FH7A 3ALFA 2QJIA 1FWWA 3N34A 4OIFA 3GUWA 4QCFA 4CU6A 2X0SA 4FLOA 2CKSA 5EMLA 2Y70A 3S2JA 4PN2A 1PO9A 3BZGA 1H1YA 3PAOA 2ZA3A 1T96A 2O7SA 4KCVA 3E5PA 1UC5A 4FLQA 4YWSA 3AU2A 3KS6A 1E9YB 2EO7A 4S38A 3WD0A 2YXXA 3H4WA 4CCDA 4DJFC 3WK3A 4A8LA 3WLMA 4GBDA 1JUBA 5I7GA 2HNHA 2BB0A 4HMNA 3LCIA 5XIMA 2GFTA 4FLRA 1E71M 4HHMA 3DFPA 2GWGA 4IQJA 2OB3A 3TYDA 3PZVA 3PG9A 1CGXA 1E72M 2WSPA 2FFCA 4GQRA 1S5NA 4CD8A 1M7XA 1VEMA 3C2YA 3BL3A 1HKIA 5JMUA 4Y2WA 4MZYA 4HA3A 3QSRA 3BAIA 2FZDA 4YJ5A 3S2NA 4O0QA 1XBVA 2ZXAA 5H2ZA 3CLWA 3T9PA 1GQLA 1MSSA 1HNYA 4W87A 1JR1A 4N9DA 4DJFD 1DWHM 4LYQA 3H2OA 2BHZA 1XYMA 5DMNA 4GE8A 3M4HA 3FAWA 2QDHA 2Q8LA 4HK5A 3SR7A 4UFKA 3C86A 1GOIA 4IT1A 2PMQA 3ZR4A 1G6CA 3A6OA 4LOCA 1VF8A 4LUTA 1H0IA 2ABBA 2EG8A 2NQLA 3WQOA 4ZQRA 1VFUA 1K6AA 3I7SA 5D02A 5TQLA 4RE0A 3V16A 5M17A 3ZLFA 1JCXA 1SO4A 3B4UA 2ISWA 4PUMA 4OOUA 4S3KA 3OG3A 1US3A 3KP0A 3BLPX 2TYSA 1RUSA 2TSYA 5LNUA 5AYYA 3E0LA 3IV8A 3O9NA 3ONBA 1PS9A 4CNPA 1ZJIA 2PRLA 5A8QA 1J8VA 1PZ1A 4GNJA 3SRFA 4JTLA 3B8WA 4PMJA 1HW6A 3U3HA 5ABGA 3VNDA 4DF2A 3L5AA 1XIHA 3H55A 1VB9A 5I3DA 1CXFA 1E56A 1OBAA 1RPKA 3IJ9A 1RA5A 3N4FA 3R4IA 2Y62A 3OQEA 4D72A 3C0SA 1KTBA 1KXHA 3BLIA 2J8TA 2R1KA 3QPZA 3VKJA 3QEZA 3ONCA 4NJHA 4IXXA 5A2AA 1KFEA 5CPLA 5LXXA 4A8RA 3FXGA 2OEKA 1U1HA 1V6VA 1TUFA 1XYZA 4F9DA 4TVCA 1KM2A 3OA5A 4GI9A 2V5LA 5H8PA 3EWBX 2YYTA 4JY9A 4YS1A 1LQAA 1R8LA 4MVAA 3D5HA 3GR8A 2Z26A 3B9AA 1F6PA 1B4EA 4PMUA 3STCA 3NQEA 4LVDA 2YGYA 4JNMA 4UR9A 2CCRA 2BTMA 3BSGA 1JCMP 3LERA 4UTWA 1W9DM 3TWAA 4ZQMA 4H04A 1XDLA 1PX3A 2E1WA 4GQBA 5KEZA 3V0UA 3QM3A 4Q7IA 4YPJA 4AVOA 4GG9A 3UCDA 3RM4A 1H63A 3ARWA 3BW3A 3GTFA 3A9IA 3BCDA 4WDWA 4Z0JA 2QLYA 3U2ZA 4BF9A 5KSWA 2VL4A 4QSHA 3W7EA 1UKOA 5L6UA 2F6KA 4JCMA 1EJWC 1OYAA 4ZSTA 3PY2A 4E8DA 1OFAA 1PE1A 4RZ6A 1B1YA 4Q8WA 1NOFA 3EWYA 1REQB 3ABSA 2GJXA 5DT5A 1POJA 5CC5A 2CPUA 1WYIA 4GNVA 5F2MA 3WH5A 3QRHA 3KS5A 3BAKA 2EPHA 3RX2A 2PTYA 3SQLA 3BWWA 5FJOA 2OWWA 3AS3A 1TRIA 2YCKX 2YYUA 3W3OA 4EPEC 2CZVA 3C2OA 3BGAA 3KW3A 1YQ2A 1SFLA 3OVRA 3U8GA 5RUBA 4REQB 3B06A 1WDSA 4CN4A 3WZ0E 3BCJA 3B04A 1MRQA 2B31A 3UPWA 4EWJA 1K03A 4ZSUA 1DYSA 3DG3A 4FNQA 1ODUA 2TAAA 1ZL1A 4L5ZA 4H41A 4S3AA 2VUNA 5CAKA 3BXWA 1DBTA 5D04C 3ITYA 2BZNA 3SZ8A 3GG0A 1YPXA 3QMRA 3WMBA 4AD1A 1FHUA 1NU5A 1TPVA 2ZX5A 1AVAA 4O4VA 4PODA 1X1OA 1PL9A 1JRCA 3VZXA 1O12A 3M9YA 4ERIA 3RYSA 3GIYA 4NL1A 3T0TA 1S2UA 3KDNA 4IIFA 1EL3A 4QG8A 4GVGA 3UY7A 4L1WA 4UTFA 1F3XA 1T41A 1NQKA 3AIVA 4L6HA 3PZTA 1HL8A 2QJNA 3STEA 1MW0A 3E2QA 3GFZA 5K2ZA 1QWKA 3UZJA 1VRDA 2UV8G 4WGXA 4HPXA 3W1TA 4KIRA 3RMEA 4LANA 1V3IA 1XIBA 1FWCC 3SCQA 3VGFA 3V1PA 4Q7BA 1CZ1A 5CJNA 2ALDA 3O1NA 3KXQA 3HFTA 3ZSSA 3W7NA 2OU4A 1W1YA 4AISA 3FAXA 2F84A 3W2KA 4AVFA 4UOZA 5HXMA 1LOLA 4JQ3A 3CQJA 4IJBA 1XIGA 2V8ZA 3M6YA 3NQVA 4KCUA 3GDTA 3VVGA 3W1QA 1W1B1 1TZ7A 3PTQA 3TJ4A 3TSDA 1VBGA 2Y4SA 1IHIA 3ZR5A 1I45A 1DWGM 4LGXA 3ZJ7A 2CZEA 3A3XA 3T2PA 1C29A 2WK2A 4C6JA 4P7RA 3MW7A 3UJEA 3BV7A 4PR4A 4NKCA 4QJ4B 3W7GA 1GHRA 3AWOA 4C1NA 3ENLA 3UERA 4I5RA 1VIWA 3IK2A 4HHPA 3DECA 2J47A 1V5XA 1SUXA 2VOMA 3WYZA 2D0FA 5E9XA 3PZUA 2VC5A 2G41A 1LBLA 4RNIA 5EMYA 4F48A 1P6BA 1W3NA 1WXZA 4LBSA 3UGRA 2BVWA 4XO6A 4O13A 1TQJA 3UWUA 3WF0A 3GO2A 1F3TA 3LK6A 2GSHA 3CZ8A 1QJWA 1IGSA 1NF0A 4L4PA 2X1RA 3O0KA 1ZJAA 2AKZA 4KETA 3WIJA 1XICA 3LDVA 4QLKA 2CHRA 3UZZA 3SN1A 2HBXA 1LF1A 1QPQA 1V02E 6CGTA 4YL2A 3KRZA 3PUDA 4IOTA 4IPNB 1CNVA 1TPB1 3JU2A 1DTUA 3VZZA 3SQMA 1UR4A 2HROA 2VGGA 3R8GA 2DORA 1XGZA 2XZ7A 4PMDA 1E4MM 1W3KA 1S3HA 4DUXA 4S3BA 3CAVA 1OX4B 2KX9A 2GDUA 1SMDA 3VCNA 3QYSA 3TQKA 4OT7A 5TNVA 4Y8EA 3HJEA 4R88A 1HO1A 4KCTA 1IYXA 3FJ6A 1Q65A 3M43A 1B31A 4PUDA 5FKYA 4XO7A 2QMKA 1XDJA 4RDVA 2PDIA 3AMGA 2DT3A 1M04A 1EIXA 1R7AA 2I5IA 2QW5A 4FI4A 3VE7A 4OOZA 3BV4A 1TIWA 4MG4A 1PTDA 4RE4A 2XFRA 1RALA 2WV8A 1FRBA 2ZX7A 1NH6A 3M5YA 4LT9A 5CBJA 2A2IA 2C15A 4FX8A 4XBKA 1KKRA 3ID7A 4CCCA 2V5JA 5HJLA 3USBA 4W5ZA 3ZQ9A 2QCLA 1A5MC 4HZ6A 3T0BA 2DZAA 3QMSA 1UH3A 3BW4A 5C9ZA 4Y96A 2WAGA 4FXSA 3VIFA 1JGIA 2YCLA 2WKLA 1BF6A 5K7JA 1UWUA 1A4LA 1AFSA 1KFWA 5CSUA 1Q3NA 2FHFA 3KP1A 4GVHA 4ZGYA 4MY8A 4S23A 3L4VA 5HDRA 1NP0A 2VGFA 3SB0A 4ILSA 4M0XA 2WSRA 3P67A 5EFFA 3SJNA 4PUJA 3CUZA 4L1GA 5HBFA 4PTWA 4CEUC 1P0KA 2RDXA 1RBOB 2W6RA 1B2YA 4O17A 2VRQA 4D6EA 1W2PA 3NA8A 5I6SA 2Q02A 3VMOA 4HYRA 1VYRA 1EEPA 4PZVA 4LH8A 3KHDA 1UJQA 4UNLA 1CXLA 5LA0A 4QE4A 4LYKA 3HQ1A 3IK4A 4PUEA 1FWAC 1UROA 3G24A 1H60A 4HIBA 3DG6A 4MY9A 3BJTA 4YTRA 3AXHA 4S3EA 1UD6A 2VGIA 1DE6A 2AKMA 4GIYA 2ZXBA 3L2LA 1VJSA 4BQ4A 3IIXA 4OBRA 5HA7A 5FOOA 4O8AA 3AHXA 2X0HA 1CXKA 4HU4A 3WNKA 1F3EA 1GJWA 3NM3A 1V51A 1NJJA 3KRSA 4EANA 5IRPA 4EPDC 3W29A 3MUXA 3V5FA 1P48A 4LEQA 4NJIA 4AZ7A 1R46A 1M41A 3VKBA 2PLKA 2Q3OA 4IP5A 4K3ZA 2Q6ZA 4KEMA 4K8EA 2PWGA 4FA3A 1TJPA 4LAMA 1QHZA 4LUJA 5AHLA 2NX3A 2RHGA 2IKJA 4D6IA 4X2PA 1OINA 3ZT6A 1V3JA 4HOZA 5FACA 1B9ZA 4FPSA 3HU7A 4UCFA 3DFYA 2HVOA 3UW6A 5DX7A 1JPHA 3ARYA 3RR1A 1F2JA 4XKYA 2QJHA 5D9OA 2CXGA 2A6NA 2VX5A 3AHYA 3QQWA 1UMLA 4LVAA 1B3YA 4UTLA 3FW6A 4ZE4A 3OPSA 2WC4A 2J77A 2BGQA 3DU0A 2A21A 1VH7A 2F38A 5TAOA 4HSOA 1KCXA 3BQ5A 1JI1A 3NZPA 3EPNA 4HD5A 4ICNA 2PWVA 2WSQA 4MZ1A 4QAWA 1P0NA 4RK8A 4ZQNA 3MHFA 1NAL1 2Y7EA 4LCRA 4W86A 3ARZA 4D1JA 1UBPC 4UNKA 4UXDA 4IFRA 4JYFA 1J0IA 3SY8A 4MDOA 4OTKA 2IUZA 3ALGA 1GOKA 4MKNA 2VJXA 2POZA 1ZRQA 5A8PA 3N2CA 3RU8X 4MB3A 3S1WA 4P7OA 3WCZA 3QC0A 3TTOA 3ZR6A 3GDLA 3THQA 3W72A 3GM8A 1DIOA 1XIDA 1MXGA 3FNDA 4LBRA 1CLVA 1P1MA 2R94A 3FLUA 5D09A 4LXFA 1HKWA 3T6CA 4MSSA 2V30A 3G5EA 4GX8A 2J62A 3M0HA 4JKMA 3UY8A 2RKXA 1ZBKA 3KVJA 1S2WA 1V0KA 2VEGA 4CKQA 1CB2A 1Z7AA 4NI8A 5KINA 2OCZA 2BY3A 2XIQA 3MCOA 3LNMA 4PMVA 3HM7A 4OBSA 2YBVA 2W62A 1BRLA 1QHOA 2B4GA 4US5D 4HNTA 1GG1A 5I07A 2ISVA 1FCBA 4QG6A 4WJ8A 1VS1A 3GRIA 3CPGA 4U3AA 3REQA 3LM3A 5A8NA 4BF7A 2E4TA 1BD0A 3N2BA 1E0WA 2E68A 2FGBA 4J3XA 4DLFA 4TVUA 3WD4A 3WEMA 5EB8A 2E8ZA 4JY8A 3PZOA 3W86A 4B9YA 4QTGA 5CPOA 4ZODA 1GOMA 1S5MA 1LWHA 2NXIA 1UD5A 5SWUA 3WQFA 4K1WA 2NXGA 4ALDA 1TV3A 2D23A 2VELA 2NXHA 2EGZA 1P0EA 1O5QA 2X41A 1HJQA 7TAAA 3GSMA 4RNFA 1S39A 3JZUA 2V63A 1DJGA 2Z6IA 4KQNA 1DEDA 4X9SA 1QNOA 2WKGA 3HO8A 4IGHA 3S46A 3M0LA 1BHGA 3P61A 1WOBA 3OU8A 2W3ZA 3NQGA 4DZIA 2E67A 2AQOA 2X0YA 4LRTA 2GVYA 1LLWA 5G2IA 1JVNA 2NQZA 2XVLA 2QXWA 2NV1A 4KWUA 4B3LA 3ARPA 4NNCA 1X98A 4IPIA 5C7VA 1OG0A 5C2XA 5IDIA 1EXPA 4JX4A 1KR1A 2V3DA 2WQDA 1IV8A 1BKSA 3HG3A 3L4XA 3QKZA 1AW5A 3LZ5A 2PU1A 3NQ6A 3WQPA 5BWAA 1OFOA 4D6JA 3BAWA 3NYZA 1GJPA 2Q8XA 2WBGA 1GNXA 3K2GA 4BKNA 1SZGA 1BPLB 1EJRC 5GVJA 3OBKA 4UIOA 1A47A 1VBHA 2OWXA 4JBRA 1SR9A 1WDWA 2BNJA 2PTZA 3GZAA 3T81A 3PWIA 1R7OA 3VCCA 3ISIX 2C8NA 5FAGA 6XIAA 3RITA 1NOUA 3QR1A 2WNZA 1MDLA 1BTCA 2PDUA 1PJ9A 2ZUSA 4C7FA 3TJIA 1TV8A 3TKFA 3ZYZA 1GQJA 3UVIA 4H9UA 5BROA 3B4YA 1WZMA 1Q6LA 2NWSA 2YL5A 2WCGA 1GQKA 3MCMA 3W2JA 4DJEC 1SMAA 2VNCA 3H8AA 1H7XA 3DKLA 4V1XA 4CNNA 3CQKA 1A5SA 3LS9A 1BYBA 1OC7A 2GL5A 1NSJA 3LU2A 4CN1A 2VEMA 1XR2A 5LGXA 1FOBA 1OX6A 5A6KA 3G0SA 1ZP3A 1Q4NX 3DHFA 4AC1X 4HYVA 5HATA 1TWWA 3BE7A 5DN1A 1XGDA 3N6HA 3RILA 3G1HA 2YLAA 2VZTA 1H4PA 4QROA 3KRUA 3LHZA 2QDGA 1UOZA 3SCRA 3NOYA 1YE4A 3DOPA 5C6MA 4NXSA 3SAZA 1ZAJA 3N2OA 4ZXLA 4JICA 1Z44A 3VD9A 1EOKA 2FZBA 4U33A 4RDYA 1OK6A 3QV7A 3KL5A 3TEVA 3WDQA 4JQ2A 1A5NC 2FTPA 5AVHA 4FXRA 2P8CA 2WJFA 2VD9A 1JGMA 2FHCA 4PC8A 4BZYA 1J9YA 1KFJA 4O1FA 1H7NA 2GK1A 3I6TA 1VBUA 5HR6A 3CAQA 2JKEA 3LCWA 3N17A 1BEUA 4N02A 1LT7A 1VHCA 5DEZA 3QSTA 3R8HA 1EJXC 3PJUA 5M5DA 1ME8A 3NSXA 3SRKA 1T7LA 2OVLA 3WQEA 1ISYA 2ZUNA 2NWRA 1TCDA 3U5UA 2NT0A 4GYPC 1Q2RA 4TX6A 1QO2A 3C5QA 2WWDA 4UTIA 2AL2A 4YVXA 3WNNA 1XG3A 2OGYA 1C9DA 2J7FA 2GUUA 1R9XA 1XG4A 3IIOA 3EDKA 1TMLA 4L9XA 1KGWA 4F2UA 4DWSA 2PDBA 1B9BA 3TA9A 4FO4A 3KEHA 1FFQA 3W24A 2OEMA 1NIUA 1TA3B 3N6JA 5KZEA 4KRUA 3WEZA 2BWGA 1OK4A 1TA3A 3LTYA 3NXLA 1XLGA 2A85A 1HG3A 2PFHA 3BLOA 4NAEA 2HE5A 4TXEA 3FV9A 4HSHA 3BO9A 4B3ZA 5KZ6A 1B3XA 2JF7A 1QI3A 5F1UA 4NIRA 4DWDA 2OR2A 2FPYA 4A3HA 4GGHA 4WDXA 1SYTA 1R30A 2DV0A 2IXUA 5ABHA 3H24A 2R24A 5DBTA 4MJ4A 3UXDA 4S2CA 1J11A 2NSXA 1CGWA 2V5KA 2WMIA 2XG9A 2VI0A 5I3IA 3LM7A 4W89A 4RE2A 5C54A 1VFOA 2VRKA 5CZSA 1Y0EA 1OD8A 4G7EA 1QATA 3Q94A 1PDYA 4RNJA 1R85A 8RUCA 3VC6A 1NDYA 3VFCA 3G1YA 3HOJA 4NJGA 1OGSA 1HJSA 3WNPA 5CZKA 3P8IA 2WC3A 4GLEA 3W01A 1ZB5A 3LPGA 4O16A 1G7VA 3B03A 4QCEA 4E3TA 2V81A 4B9ZA 5EMJA 2O9OA 3URQA 4ERAA 4IQEA 3T42A 1TJ0A 3NQAA 2WSKA 1R47A 2HS6A 4GPNA 4MOZA 3EX1A 2R91A 1FY6A 3WNMA 2E6DA 2O55A 3AS2A 2QVHA 4IMDA 3MUZ1 3CYVA 4MWAC 2AOSA 3ARQA 4XZHA 4QS5A 1QNRA 5E0KA 4DJED 1KTCA 3FGCA 4HBKA 3TVAA 3A13A 3L9CA 2QF7A 1TPWA 2PDMA 3PANA 2VWTA 3CNYA 3LLXA 2MUCA 3W70A 4BA0A 3CZGA 4EP8C 4O11A 3TQVA 1GPFA 5CBBA 3ZOAA 1TMHA 3NQCA 4HPJA 2OO0A 3C3NA 1F61A 1LWJA 3NQ2A 3O16A 4HCDA 1F8MA 3M16A 3ZVHA 1E55A 1IIHA 1WKFA 4M7TA 4WIWA 4MNLA 1OM0A 2NVDA 1TB3A 3B0UX 3W2NA 1KM6A 2P8BA 4RDWA 3GB6A 3WD1A 1VHNA 5JBEA 3ZIZA 1JCLA 3THUA 1H41A 4A05A 2PTDA 4RR4A 3BAXA 2XFWA 1M1BA 4FK9A 2ZRZA 1RCQA 1DXFA 4MAZA 3O06A 1ZPTA 2Q3RA 2PB1A 3TN3A 1EP2A 3P3BA 3QY8A 3SUUA 3P8JA 4MB1A 3B0XA 1A53A 3W27A 1G67A 1TTPA 4R5EA 1NFPA 4AU0A 3DGRA 3ITGA 4TV6A 1S1PA 3MSGA 1TWZA 1LORA 3I7QA 3HMCA 4KEUA 3VIOA 3PAJA 4RLIA 3V4BA 2YBTA 4YYFA 2HTMA 3W9ZA 4P2VA 1OZQA 1M65A 2C1IA 4PTNA 3EGJA 3KOYA 2HCVA 4K7VA 3OLEA 1W1A1 5J5RA 4GH1A 4PYSA 3VX1A 1HL2A 4W8LA 2YXGA 5BU6A 1RBLA 3TZNA 3GU2A 3AQUA 3PNZA 4YWIA 1Q8AA 4JIIX 3ZT7A 3BGGA 3VD3A 1OX5A 5HNUA 4LVBA 2OO6A 3HA1A 1A5AA 4UZUA 4CN6A 2V67A 2JQXA 1M01A 1TVPA 4Q8OA 5F2IA 3C0LA 3TP4A 3YPIA 3TN5A 1B3OA 2YW3A 3QZEA 4PL1A 4V15A 1S2VA 2R9RA 4Q4KA 5AHMA 3VKCA 2GGGA 4H9TA 3DAQA 1AQFA 4RX0A 2QIIA 2Z7GA 2WNQA 3B8TA 1JFXA 4AXNA 4PULA 3M0IA 2B7PA 3GX9A 3N12A 3SUVA 2E6YA 3W75A 4PGLA 4GCAA 1J18A 1YDYA 4O50A 1MXDA 2V5CA 1WQ5A 1TPEA 4LB3A 2B0MA 1Q85A 4F0RA 2VVNA 4HP5A 2Y89A 2POTA 3TR2A 2FJUB 4ZFCA 1CW2A 1K1DA 1TVLA 1R3SA 4TMCA 2XIBA 4ONVA 4GZEA 3RJYA 1CGTA 1AG1O 3O6AA 2V2HA 4ZOAA 4CU7A 1VFFA 5DXYA 1NTHA 1RK5A 3VD4A 4DUWA 1JPKA 1PHQA 4AIBA 4ECLA 3BQ6A 4M19A 5FL0A 1RAKA 1OY0A 1MRAA 2Z2UA 3U9IA 1E73M 3B9OA 3EB3A 3V1HA 2A3EA 1RCXB 1UZHA 2Y8VA 5BOFA 3TMLA 4EKJA 4DI8A 4POCA 4RNHA 3SADA 3QVQA 1KXQA 3W1MA 1FKXA 1XW8A 2DH3A 3W25A 1EEXA 1GZGA 2NSOA 3CHVA 3VIGA 3AAMA 3N6QA 4C6OA 1DKWA 3VNLA 5G2HA 4LQ1A 2Z25A 3G22A 1MZRA 5D2VA 1UG6A 1TRDA 5IXEA 4RW3A 1NWTA 3MV11 1C7SA 2CHOA 3W76A 3I7RA 3MP4A 3SRHA 4A8NA 4G9PA 4U31A 4KH2A 1HKVA 1V3HA 4PBGA 3T78A 1HKMA 2V5BA 3EWXA 4LB4A 2DZXA 1CCWB 3GDBA 3GNPA 4Q4PA 4ZB2A 1IZKA 2QKFA 1E6QM 3WLHA 1K77A 2R1LA 3ANVA 3HPZA 1YNYA 4UBPC 1HZYA 2PD9A 1UPMB 3MY9A 4Z1BA 4S2BA 3GFXA 2BLEA 2FTYA 3B97A 3N18A 2X7WA 3CUJA 4L65A 1QWGA 1WAWA 2W27A 2X09A 1A49A 4GQQA 2P10A 3VM5A 1KV5A 2ZQ0A 4JFSA 3D46A 2D3LA 4IQDA 1XF0A 3CK5A 4GHRA 3VCRA 5CZTA 1BG4A 2HVNA 3E6EA 4NSBA 4AEFA 3IGXA 4UR7A 4XAYA 3GYEA 3DXIA 3GIQA 1RVKA 2VURA 3D47A 3NL3A 2OWCA 3A12A 2PURA 4GQ0A 3KVMA 4OWGA 3QGVA 2VR4A 4LC8A 4WY0A 3W1LA 3RXZA 4H8UA 4WSJA 1V3MA 2E28A 1XLKA 1CGYA 4AIOA 2QYGA 5D2YA 2HE8A 4CQDA 2DIKA 3HQNA 2WVVA 2H90A 4UFHA 4XUGA 1HX0A 2YX0A 1XIIA 2ISFA 1UZ1A 4JNZA 4NZ5A 4UFJA 1HFBA 1QI5A 3WK2A 1E6ZA 3P82A 3QHMA 3CV7A 6ENLA 4KMQA 1SO5A 3MMWA 4N7QA 1JAEA 3S6OA 1MFUA 2HK1A 1JYVA 4MLJA 4Q3MA 5A69A 4ZOCA 5LNWA 1OSEA 3NM1A 4PUKA 5IHRA 3DHPA 2EPMX 4LS0A 4J3TA 2XSBA 1AQ0A 2RDUA 4JTGA 4W5UA 4A29A 4JN7A 4O8RA 3G8RA 1AH3A 4AW7A 2P3ZA 4AQLA 4F0KA 3CYJA 3A22A 3V0SA 4QG9A 1CDGA 3TTEA 3P2VA 3W4RA 3K5XA 3TTSA 4W7WA 1JPDX 1PVNA 4UCGA 4JDBA 5CSRA 5FJJA 1BG9A 2ATMA 3TIMA 2QCCA 3O2LA 2JGQA 2WPGA 5HNNA 3AYTA 3L2IA 2J88A 4IUGA 3TFCA 3WUEA 1IXOA 1OG6A 5E0CA 4IXHA 3LY0A 3I3DA 3ABQA 4EXBA 4WOQA 4QR6A 1UR9A 3LMYA 3W7LA 2YJQA 3GUGA 4DNHA 4FNSA 4YCPA 4HKPA 5DLCA 5I0DA 2XFFA 2ZBTA 4K68A 2GVJA 1SSDA 4UQEA 4RZ5A 3QPEA 3U7VA 3S2LA 2AL2B 2CLKA 4H1ZA 1YIXA 1IGWA 1ESWA 2GSJA 4IJCA 2PDQA 1MDRA 4AF0A 1OYBA 3O63A 5A6SA 2E9MA 2PP1A 1KFKA 5HMSA 3GK0A 1XQLA 4NVTA 9RUBA 1UUMA 5AC6A 2OYMA 4ZXOA 4L4LA 2X42A 3CZLA 1JZ7A 4Q33A 1NWRA 5D2WA 1EZ2A 2XVNA 1K8YA 4HK6A 3MZ2A 4PMZA 4FAMA 1AH0A 3DFNA 4OUIA 3VU2A 1KXTA 1FXQA 3IANA 5T9BG 3D6NA 4JXCA 4AC7C 2BHYA 1QI4A 4HPHA 5DBUA 4A6GA 5JU6A 2ZICA 1AQHA 2R14A 3LPFA 3BC9A 1UWSA 5F2LA 2ZUTA 3B8DA 4B5VA 5GJMA 4B5NA 2GGHA 4S3JA 1E5JA 4WKFA 3RPTA 4HOXA 1KBLA 2EBNA 3B8SA 3A24A 3NXFA 3P80A 1GUVA 2ADAA 2C16A 3UR5A 5FEPA 4DF1A 1XLEA 4OBTA 1BQGA 1XCWA 3WLJA 1E6SM 2H9AA 5AZ0A 5FEWA 2AAMA 3C0QA 1XYCA 3WJWA 3W1AA 1AMKA 1TELA 4Z1CA 4F0HA 1L0PA 4NXKA 1QT1A 2XISA 1E6RA 3PTDA 1BXCA 3ABZA 1W37A 2XINA 4PFHA 4B3KA 1P6CA 1EQPA 1K7EA 2X05A 1V08A 2YDQA 4GABA 4LF2A 3BICA 4UQAA 2G5WA 1KBBA 1O7AA 2VYOA 4P7LA 4YHEA 3NZGA 1JF6A 1J93A 2AGKA 2DEPA 1L8NA 4DJDD 2RGLA 3ABXA 1R6WA 2OZ3A 1XIFA 3GVVA 1XYBA 2OGJA 3ZVHB 4JL1A 3EOOA 3S2MA 4F8XA 2QCNA 2EPNA 3W84A 3AOFA 3NO3A 4ZEPA 2FYMA 4UUIA 1O5RA 3TUUA 3K4WA 4UTTC 2V3FA 1KM1A 4D8LA 4MJZA 1J2BA 3CO4A 2G4FA 4PB5A 4N2YA 3URAA 3DC0A 1NOWA 1C3FA 2VX7A 4AZGA 8TIMA 1LYXA 2HRWA 2VWSA 1XLIA 3LGGA 1K8CA 3OLDA 1W54A 3MTWA 4MKVA 2PC8A 1HJUA 3RNDA 1YRRA 2W9MA 1GOQA 3CJPA 4WR3A 1YDOA 5IDZA 4Y6GA 1KM4A 4GYPA 2J8FA 3NQBA 5KETA 1IXNA 1V0MA 2GJXB 2R1NA 1PTGA 1REQA 4HA0A 1UD8A 2CZFA 4ZTXA 4BHYA 1O1ZA 3Q45A 2YFNA 1W8SA 5G1TA 3C6CA 3ME3A 1DJIA 3TLQA 1I1WA 1ONWA 4EVZA 1R0MA 2VEFA 1GVQA 1QK0A 2ABAA 2D2GA 4GYJA 4GA8A 2PA6A 3MKCA 4UC5A 3LLFA 4QLLA 1XRFA 3H2NA 1FWDC 3R11A 3K13A 1KW1A 4ZFMA 2R82A 2OOFA 3TR9A 4DQWA 4J1OA 3SURA 4MYXA 5DXXA 4C6MA 1V3LA 1JULA 4Q8PA 3NNTA 4URIA 1R3YA 1UMYA 2BOFX 1R3TA 2VUYA 4W8AA 2PF8A 3N14A 1IF2A 3FKKA 3UQNA 4DJDA 4FEZA 1DQWA 5B7ZA 5M3WA 2ZVIA 1YHTA 1SZFA 3FSTA 3NZQA 4JTTA 3R25A 3CU2A 4LUSA 3W37A 3G1XA 4DO7A 4QRNA 2PWFA 3C2EA 3SIZA 4NAEB 3STGA 3WSUA 5DQPA 1RJQA 3S6TA 3CUGA 2P88A 1J4EA 1DIEA 4O54A 4IMCA 4UTJA 3LXBA 1DP0A 3HPFA 1MEHA 3W87A 1OFPA 1G69A 2XGBA 3SO7A 5F7UA 5C2GA 4QJ3B 2CWXA 3HZ3A 1TTQA 3QN3A 3TQPA 2ZDSA 5E9AA 3ERPA 2JIWA 2NUYA 4DPQA 3VPLA 3ABOA 3SCWA 2ZFAA 5A6LA 3BLDA 3CUHA 3OO2A 3BLKA 3W1RA 4X3ZA 3HTWA 1FH8A 3WF2A 2Z28A 3L0NA 4HHHA 1JZ3A 4QE1A 1QW7A 1S5TA 2VFIA 3S4TA 5LGZA 3GVGA 4BY3A 4PE8A 2LLEA 2DSWA 5CSYA 3RLVA 4HMCA 1MUMA 4DXKA 1TV7A 3GG7A 1ONXA 4WSKA 2DZSA 5CSSA 2PBOA 4JAWA 3L4TA 2BVYA 4C1LA 4WDUA 3DH7A 4GQGA 1QI0A 3LMZA 2PD5A 1NM9A 4ACYA 1H49A 4O1DA 3EOLA 4IGMA 1EB3A 3NSMA 2P50A 3H70A 4I5XA 3ICJA 2H9AB 4XD3A 3GZ3A 4O1EA 4GK8A 5TBOA 3OHMB 2J7BA 3NDYA 4XD5A 4GNKB 2XTKA 1KBIA 1S5VA 3S1XA 3TWBA 3L65A 5K4XA 2DIJA 2TPSA 3P62A 2GPTA 3N29A 2E6AA 2HNEA 1F76A 2PDGA 4ZTYA 4WKAA 4CCZA 1C8VA 1W3JA 3IEBA 3TFXA 4DIAA 1OF8A 2DT2A 3EZ4A 5MKGB 4I7UA 4C7GA 2ZRXA 4JYDA 1FWJC 2YA0A 3WMSA 4ZE5A 3W88A 2WJZA 2YPIA 3FJNA 4B5XA 1KCZA 5HANA 3GXMA 4JIQA 3E2VA 3JR2A 4TUFA 3MUCA 1MNSA 4PCTA 2XSXA 2HZGA 1AZ2A 4YVVA 3FDKA 1LLZA 4FNTA 4MZ8A 3TJXA 4A3QA 1IQ8A 5C2CA 4W7UA 4AUBA 1BKHA 3HGJA 3GW0A 4AF0B 1ZAIA 1CXIA 3RN6A 2Y7GA 4CNTA 3TK7A 1K9DA 3PTMA 2GUBA 3CWNA 1XSJA 2ZRVA 2XM1A 1CBGA 1N2VA 1HKJA 1KNWA 1VBRA 3ARXA 3GHSA 3QY6A 3BCFA 1WDQA 3GNXA 3V0TA 1E6PA 3UPBA 4K36A 1AMYA 3FKRA 2Z1KA 5C9WA 1KCKA 4AY8A 1VJIA 2I56A 4BI7A 1PKLA 2WMKA 1Z6KA 1EGMA 2EEXA 2D2HA 3VC5A 2J66A 4NT0A 3TNBA 1W5OA 4M82A 4JTJA 1TV2A 3WH7A 4H9XA 4W93A 4LY4A 3NQMA 3F7JA 3W7MA 3K1GA 4FB7A 4BK9A 3CIXA 1BVZA 3LLDA 4E2VA 1VYSX 4JFUA 3WUFA 3GC2A 4HCLA 1WPCA 2JF6A 1QOQA 2NQ9A 3EEGA 3UEQA 4E3VA 1GYMA 3E1F1 4N0RA 4OQVA 4JD4A 4CQ8A 3WNOA 1W5MA 1ZSXA 1PAMA 3UCQA 3EMQA 1JJKA 2D20A 2A3AA 1Y5XA 1ITUA 2Z2BA 1PKNA 2PP0A 5U4NA 1FWEC 4PMOA 4WZHA 1X1NA 4A2RA 5D9NA 1PHWA 1QPKA 3UWQA 1P6WA 3FVMA 4AD3A 2X1TA 2RJHA 3G3DA 1YW1A 4LSBA 4LVGA 3NQFA 2I9EA 4UFMA 4J27A 2F2HA 4JHMA 5AOUA 4AMAA 1XRTA 2ON3A 3RU6A 5I3HA 2CZ5A 2JALA 1H7RA 1H1NA 2CERA 3WFAA 3WBXA 4V2XA 3L4YA 4F0MA 3M7WA 1J6OA 1JL8A 2Y7DA 4FLSA 3MV01 2PAJA 4L64A 2PWHA 2JEQA 4G1KA 2CWNA 2W0UA 4FXFA 4HNNA 1K8XA 1A0EA 1UWTA 4PTVA 2JGYA 2Q01A 3SN0A 3F5LA 1M9HA 5EU9A 4M6UA 3G1SA 3AXKA 4XTIA 3LBMA 1H7PA 3FY1A 3WDIA 3RHGA 1TPFA 3AYRA 4Z2LA 3PZMA 4WEVX 4R3UA 3ZXWA 1ZZMA 4LFYA 1F8IA 2FZ9A 4KFOA 3AS0A 5TF0A 5C5YA 1XSIA 3R0UA 1ALDA 5HAOA 5IBXC 4O1CA 3WDRA 2PWDA 2DH2A 3MC5A 1KKOA 3RR4A 3VOIA 1O5XA 2ZC1A 1Q13A 4ZQCA 4DJEA 3W7CA 1W1IE 3LG3A 1FCQA 1UR3M 3HQOA 4RXFA 1T8XA 2PLJA 4I9JA 1X7FA 4UWMA 4E2OA 3TQ0A 3WDHA 3J7HA 1JI2A 1XBZA 3NL6A 2CLOA 3NDOA 5F4SA 5BNKA 3KOFA 1SU5A 3ZLGA 2BOGX 1QI2A 1LTDA 3I65A 4LTSA 1PUDA 1WV2A 1UASA 2ACUA 1QFEA 5DO8A 1KLYA 1UD4A 1NVMA 5D03A 2YW4A 4WOZA 2E5DA 1SM9A 2F8QA 4YN5A 2Z7KA 3WQCA 2EG7A 3G1AA 2Y85A 4C1NB 3AIWA 3NZ1A 3TYAA 1GVIA 2IXVA 2VR5A 3FHAA 1V7YA 4C7DA 1UWQA 1LBMA 1SVDA 3QPYA 3PSWA 4GINA 1ZGDA 3WELA 1K7FA 3WMCA 5A6BA 4TTUA 2UWFA 4OHQA 1Q6EA 5E6YA 4FNRA 4Z0SA 2JKPA 3NPVA 1PCWA 1XP3A 2D0HA 1AZ1A 3NG3A 1WUEA 1W1TA 2BASA 1K9FA 3M0ZA 4LYPA 5CKSA 4AD5A 4GY0A 1I0BA 2G8ZA 3LCXA 1XS2A 4ATLA 1EUNA 1PIFA 1VPYA 5LNRA 2DUZA 3EOUA 1G7UA 4B5TA 3K8MA 4M6PA 1ZBCA 5AC8A 3T05A 4Q4SA 1GVYA 2GWNA 1KRAC 1KWKA 3TC6A 2O7QA 5CPTA 1L9WA 3RM9A 3ORWA 4Z1YA 3IRSA 5I02A 1A5OC 1RP8A 3OB8A 5J5DA 2YCIX 3GQYA 4W9TA 3ZS4A 2I5QA 3DFQA 1LUCB 5E5CA 3HPAA 1E5NA 3CH9A 3DESA 5CC6A 4DF0A 5A6TC 3DI0A 4WHBA 1E0TA 4NHVA 1HJVA 3IGSA 4J3WA 3FYPA 4LEFA 4MYAA 4MADA 3TW6A 2C19A 3VNIA 3S9ZA 3WLKX 2RAGA 3GNRA 4TTGA 3SY5A 3VKKA 2VM8A 1UIOA 4Y9MA 2HWGA 5F4WA 5A8MA 1QHPA 2C13A 3R7MA 3CWOX 1DWFM 4DBUA 2FH8A 4JS3A 1VR6A 2FMNA 5AYBA 2BVDA 1KRCC 2GOUA 3CIVA 1ISXA 2PDPA 5A2BA 3VOJA 5E70A 1Q7ZA 5CBIA 1TSIA 1QR7A 3UBPC 2QGHA 2EPLX 3C2FA 2J9XA 2DVXA 1RQHA 3V3WA 2D24A 4HTBA 1KGUA 5C71A 5FJUA 2VMFA 2XDFA 3DX5A 3E0VA 1OWQA 3W7KA 5H8UA 4ZO9A 2XPKA 1Y8BA 3GS6A 1GYNA 1E0VA 4GRSA 3SM0A 1C91A 3IPWA 4BF5A 1DJHA 2QT3A 4MDPA 5EMUA 1EJUC 5FEZA 5JIPA 4I3GA 4HU0A 1OYCA 4JTQA 4WXZA 1O68A 3W1UA 3KTCA 2NVAA 1M7PA 3SFWA 2Y5JA 1C90A 2INFA 3F1QA 5A6BD 4EACA 3BURA 3ES8A 3R0DA 1DV7A 1KQYA 2WCAA 3PN8A 3ZT5A 3WG6A 1ECQA 1HL9A 4QNWA 4ADUA 2BY0A 1MMFA 3A4WA 4G6CA 3FS2A 1IEIA 1HP5A 5DANA 4IG2B 3ANYA 2ZWZA 3PNUA 5D9MA 4BQ5A 3LI1A 4BJHA 4JHOA 3W74A 1VCVA 5EL1A 1VLWA 3RCNA 1ISWA 2XJ7A 2J7EA 3W53A 5MHBA 4NZCA 2GJRA 2C71A 4DLMA 1RPXA 1F5ZA 3G3MA 4GO8A 3DGBA 3CAKA 2XFYA 1QTWA 1V3KA 1L6GA 4QP0A 4H7ZA 1F74A 3D3AA 3MVTA 3FHQA 2VEKA 2VEPA 3TJLA 4GFIA 2IPFA 4IIEA 3WENA 2BSLA 3LN3A 2ZDRA 3C4UA 1BLIA 4V1YA 3F4CA 4BI5A 3NPXA 3LENA 3E2RA 1TE6A 5CZJA 4U10A 2CLMA 1MI3A 1FWIC 2PDJA 4A3UA 3VIPA 2DQXA 1XD1A 3S1GA 3TTQA 1HF6A 4XV0A 3T8QA 4UQCA 1WZKA 2OELA 3FJLA 3POCA 4PMRA 3DFSA 3AISA 4QGCA 5CGTA 1QMLA 5AY7A 5HOSA 3FFSA 4RPPA 4C60A 3U0HA 2ZRWA 1SPQA 3QHNA 1E9LA 4LUTB 1YPFA 3M0YA 3SUSA 1MEWA 5FL1A 1RSCA 3GY1A 1TIMA 4GBUA 1GVOA 4EF9A 1FXPA 1VFSA 1DJNA 2J4GA 1EA0A 3GTXA 2P3EA 3O6YX 3WBWA 2GVEA 1IR1A 4XAFA 4CLMA 1A4MA 3F2DA 3RPDA 2XUCA 3OA3A 3VINA 2QV4A 4B15A 1Q6FA 3HV9A 3W28A 3AHTA 3G0XA 1JPIA 3NAVA 3UF9A 4R53A 4ACZB 2OTDA 5CC7A 2CLLA 3ZM8A 4JNYA 1OB0A 3T08A 4AWTA 3NGJA 4G8TA 3W81A 1S5WA 1VENA 3LRMA 5DELA 1HT6A 2YR1A 1EP3A 1OD0A 3KWSA 5DF0A 1EC9A 4IMEA 4RE3A 3RDKA 3GXDA 4FIRA 1ZY9A 3GYCA 3W7RA 2GDQA 2XIIA 1D8CA 1YBQA 1WKEA 2GLKA 2ISDA 4TU1A 4FNUA 3KFTA 3H4XA 1MQQA 2J13A 1JDDA 3A4AA 1FKWA 4I90A 3USZA 4PSRA 3WQGA 3UJFA 4J3VA 1TQXA 3R8RA 4PTMA 1NWSA 3WH9A 4BWLA 2OOGA 1VC4A 1E70M 1D9EA 4INFA 5REQB 1S2CA 2IW0A 1NEYA 3DHDA 2OQYA 5CG7A 3QGAC 2WW5A 4S3CA 2FFIA 1IT7A 1AUSL 4JTAA 5LIYX 1U5JA 3CPUA 3QFWA 1E4NA 1IEXA 1LL7A 2PLCA 1P1XA 3N3MA 1E15A 5HWMA 2J74A 3VMPA 2XIMA 4TV5A 2Z24A 1R38A 4JEQA 4WDTA 7REQB 5JH2A 2GGEA 1OC6A 4TX8A 1IT8A 1HP4A 3FYOA 4DBDA 1CECA 2BXVA 2G3JA 5ABFB 3GVRA 2AQVA 1OFEA 4D6HA 4RZ4A 4J35A 3LRLA 1MW1A 3UP8A 1VIZA 2GK1B 3GKFA 1XH2A 1TTIA 1D2KA 3NL2A 2JK2A 3GDMA 2QZRA 2I16A 1QNVA 2YLLA 3VILA 1XLCA 3W7OA 1LG2A 5GNZA 2X1SA 1M03A 1W5NA 4XTDA 5EKYA 1ZENA 1PX4A 5LNVA 4K7YA 3T2QA 1XRVA 2PI6A 4FX7A 3KBVA 2DGAA 2D0GA 3EBVA 2P76A 3K4DA 1JZ4A 4PEEA 4Z1AA 3OVQA 3NJ3A 3N73A 1NY1A 1GKPA 4JKLA 2E9LA 4LV9A 3VFLA 4J3ZA 3VX0A 5AKQA 1GEQA 3IVSA 1B3VA 3SIMA 1A3XA 4GI6A 2E1DA 4XQ6A 1DJXA 5C0QA 4R33A 3N2XA 4AY1A 7ODCA 4BI6A 4ORIA 3KCOA 1DTNA 5FAJA 2QAPA 2GJLA 1FCVA 2OXNA 1XLAA 3FEQA 4KFNA 1ZJBA 1J0HA 2XVGA 2OT1A 4L7ZA 4JIRA 3MI2A 4AH7A 3R58A 1F73A 4GJ1A 2QUTA 2NT1A 2INZA 5LHEA 4QQ3A 5ECVA 1E9ZB 3I4EA 4NYUA 1JZ6A 2H8XA 4CU8A 4UOJA 3U6WA 4AYGA 3RMJA 2ZZ1A 3BSHA 1LOSA 1FCUA 2NVCA 3FA4A 2F61A 3DIPA 3GXFA 1Z9AA 3QMTA 1JYNA 4ACZA 1TWSA 3BOXA 3E0WA 3UGVA 3E2SA 2DW7A 1EC7A 4LAZA 2QJJA 4O4WA 1SW7A 3MP5A 3T0DA 3AI0A 4H6KA 1SJBA 3W02A 3BJFA 3HMJG 4M3PA 4E4PA 2C1HA 2OLSA 3M0XA 2G96A 4ZBCA 1ZTVA 2Y61A 3UG5A 4LUIA 3KLKA 4LAUA 4AZCA 1QPRA 1PIIA 1DHKA 2WVSA 3AMCA 1ZCOA 1YXCA 4NNBA 1CLXA 3WBYA 3MYPA 1A5UA 3LXCA 4QEHA 3AXXA 1G4PA 3L5LA 1JDCA 5BYWA 3W1PA 3RJXA 1SJDA 4C6QA 2I1OA 1EDTA 2GQ9A 5HMEA 4GI4A 4MPQA 5EMMA 3M0KA 2YIHA 1TPDA 2PDWA 3OZPA 1WP6A 4D8AA 5J8LA 3FJ4A 2PGFA 4K8GA 5K4ZA 3MBFA 1H7OA 1JDEA 2XH7A 4IQLA 3SCOA 3EWCA 3EX6A 4R9OA 4NAFA 4R7JA 1FQ0A 4WX2A 1DOSA 3AJXA 3F5JA 2VFEA 5JIWA 1NDWA 3EMZA 4B92A 4MWAB 1C8QA 3GBEA 3HF3A 2YB4A 1VJZA 2QUVA 1QOPA 2I9UA 3I4KA 1F4HA 2E3ZA 1EA9C 1ML1A 1GVRA 1SFJA 3IARA 4M51A 2Q09A 5FF4A 4ZQPA 1JIBA 3TZFA 5IFPA 3E74A 1AODA 3ZFHA 5CJ5A 1EFZA 2CEQA 2WZEA 1D3GA 4JGDA 3W2LA 3TSBA 2RJGA 4KWOA 4V33A 3REQB 3L68A 1CI1A 2YL6A 2XH4A 4DN1A 3T40A 1LL4A 1LROA 2RDWA 4AZIA 3QV9A 1BF2A 2OQLA 4GZ7A 5I5RA 3SCVA 3NQDA 4WJXA 4LCQA 1ADSA 2ZZ5A 2GJPA 4FMVA 3VGGA 4PMNA 2E6FA 3HGRA 1Q6QA 3SY1A 3NTYA 2BP1A 4C5YA 3WLNA 4A3RA 2J6VA 1JDFA 4QEEA 5M1TA 2X2GA 1B0IA 1IR2A 2WVTA 1JUKA 3M44A 3DUGA 2PP3A 4JL2A 2GGJA 1MNZA 2RUSA 1GGOA 1W3HA 4CQBA 1Q6CA 3QLLA 2HPMA 4JX6A 4FNPA 4XBJA 1UWAA 3OGRA 4KF1A 2FGZA 4JQ4A 3SUTA 1OCNA 3W6LA 2I57A 1OFRA 2V3GA 4U4MA 3CQ0A 1W1PA 3UXLA 1A5LC 2PTXA 1HVXA 3WF4A 1XBYA 4C65A 5BZAA 3AZTA 1KC7A 3M46A 1LT8A 3CHCA 5CLWA 3TV8A 5ABFA 4WK9A 3ARTA 3AMDA 3LHWA 3K46A 1KCLA 3Q65A 2CLPA 2WHLA 1XLDA 4O14A 3G6LA 4XIMA 1ELSA 1KD0A 4Q8NA 1EJ7L 5CGQA 4ML9A 4GIAA 3U57A 1AH4A 1GQNA 3WX7A 2YA1A 2CNCA 4A22A 1EUAA 2GUYA 4IISA 1EWEA 1H0GA 1JCJA 1XWYA 1ITCA 1I6NA 5BCAA 3P74A 2V0TA 5JH1A 3VA8A 1KR0A 3ZWSA 1VFLA 1E0XA 1WXJA 4ICMA 3WQ4A 2CBUA 4KWVA 4B4HA 3GXIA 4MY1A 3AZSA 3K30A 3FCPA 3S5NA 2FJKA 2YA2A 5GJNA 4E5TA 3EX4A 4NRRA 4ENLA 3VM7A 1JCTA 1GKQA 4IFOA 3UCCA 5HUPA 3WQWA 3H4GA 3V7PA 3TW9A 4P8VA 1FWGC 3GDKA 2HISA 1DWJM 2I5GA 3B9NA 2INEA 5IM51 2CLIA 4LYRA 3LA4A 3MUIA 1J79A 2ZYFA 3KLLA 2QMJA 1F4AA 3DHUA 3IIZA 4MTVA 4X61A 2HXTA 2DZWA 4EX4A 3LX9A 5E1QA 3TYUA 1QOXA 3N9KA 3OBEA 3WEOA 3HQPA 1M6JA 4QAIA 3G0UA 4HHLA 2DUXA 3GDRA 2IPWA 3KOWA 4DNMA 1Z42A 1XYLA 1ZCCA 4ROQA 7CGTA 3N1AA 2VX4A 4IPLA 5IHSA 3WD3A 1V6WA 4D6FA 2J7CA 3NVTA 2QCHA 2NX9A 1UH4A 3U2CA 2IQDA 1JYWA 4I8DA 4JR5A 5T8GA 2ZUVA 1PTAA 3BAJA 4JTEA 4HPGA 5HQLA 2HS8A 3W38A 4YHGA 1RD5A 1W17A 4UFIA 1RJPA 3NOEA 3GHRA 2E5CA 1EYWA 1SJAA 3V35A 1K4HA 4LC6A 1XJBA 1XFCA 3RGTA 1WZAA 1N55A 1R2TA 3LD5A 3OIHA 2GDVA 2HJPA 2NLIA 1ZJHA 4MNMA 1KRMA 4Q22A 1QUMA 4AX6A 1KA9F 4U3CA 3M5VA 4YNGA 4DO6A 5HPOA 2MNRA 1QXLA 3ZLHA 2XGZA 3B8IA 3B0PA 5LXEA 1W6TA 3C8NA 1JZ8A 2YCLB 2OZ8A 5KMYA 4Q8QA 1KV8A 4GJIA 1DWAM 4YTUA 4M80A 3W2MA 5CC3A 1IT0A 4QXIA 1FHDA 1N8IA 3IJ7A 2VCBA 1N82A 1P4CA 5EFDA 4DYEA 5BXPA 4MKSA 4JOMA 1OQFA 5H1WA 4MFDA 1T6MA 4QJ5B 5T9CE 1TJRA 2C6QA 4JTUA 3TOYA 4HVXA 3B3DA 3SFKA 3K1DA 4GX9A 3T4CA 2PS2A 2PDKA 2WVUA 1FWTA 4D6DA 2V2CA 3PZIA 1PYMA 3Q58A 3UWEA 1PPIA 3NUKA 3KHJA 5AYIA 1GONA 4MPKA 3MU7A 2FHBA 3VUPA 3CZEA 3TN6A 3V36A 4UNIA 4DBSA 3VOCA 1XLFA 2E09A 2UY4A 4TMBA 1MW2A 3PJTA 1BYCA 3H6OA 3MBDA 3MHUA 4AZ6A 1Q8JA 3E12A 3EX3A 3S8HA 4AMCA 4DVOA 4IMGA 4EK7A 1G0CA 4U2ZA 1A0CA 5A6JA 4DUVA 3N11A 3PULA 6A3HA 4P61A 2AGTA 2YKKA 4K39A 2J75A 2WM1A 4YTTA 1X96A 2IKGA 1ZS2A 1XINA 2QR6A 1K8ZA 3W22A 1E43A 3DCPA 3CHEA 4F0SA 3OZYA 3HFYA 3E38A 3HPSA 2A3CA 2GQ3A 3KL3A 1YYAA 3OW1A 1HO4A 4WF7A 4WGHA 3I6EA 1TZZA 2OX4A 4YLWA 7REQA 3FOKA 3QLDA 3HV8A 3TYCA 2VCCA 3WBEA 2W4XA 5HR7A 4ZB0A 3G2GA 3P0WA 4JYEA 4PCFA 2PDHA 1EKOA 5A5WA 4NASA 3CL8A 1HUVA 3H7RA 3MSDA 3WF3A 3M6DA 9CGTA 2W63A 3LPOA 4HYWA 1WO2A 3W2UA 4CD6A 3T7VA 3W7DA 1XH0A 4HZMA 4JTCA 3VIIA 1A5CA 3L7RA 4J7RA 3TOPA 3QOKA 1JZ5A 3CIWA 3RRAA 4QSFA 4UMCA 1O4UA 4XAZA 1YNQA 3DKJA 1MWOA 1TVNA 1TTJA 4D6CA 2OX1A 1FWRA 4L80A 3QQ1A 4PUNA 2NZLA 2QJMA 3U7BA 1OZMA 1WBHA 1SZNA 3T09A 3GTNA 3WQ8A 2BOEX 2V82A 4O19A 2DSUA 4OECA 2WMJA 3PZQA 3R1ZA 3EWZA 2QJGA 2DJXA 3RAOA 2R1PA 3O07A 4GVFA 4GXPA 2FKPA 1G9HA 3K8LA 3IV3A 3CL6A 3EDEA 3APGA 2ODOA 5AZ1A 3TYEA 4O10A 1C8XA 3UWVA 4PTXA 4OFCA 3OP2A 4DUOA 4GUGA 4Y9NA 2TODA 1K3UA 3PF3A 1TX0A 4HTYA 4XWUA 1W1VA 4NAFB 2VDHA 2Z1XA 1A80A 1IWPA 1WUFA 1LCOA 1PZ2A 4QJ1A 3WO8A 1EWDA 2BGSA 3DZ1A 2VC6A 3IJ6A 3R2GA 2CIPA 3OIXA 2Z6JA 1EJVC 4MIMA 1V0LA 4ZA0A 2RDTA 3VDCA 3WLIA 1UKQA 2BDQA 2A7PA 1PEZA 4PCSA 3H2MA 3VDGA 1NP2A 3CTLA 4W4QA 5AC4A 1P7TB 1ICSA 1XGEA 1FFRA 1TUXA 3O0FA 1QRQA 2HQAA 1F9CA 1VD6A 3E3HA 2VGBA 3PJXA 1LZOA 3F03K 5IOBA 3B0YA 1VZWA 1HXJA 1OJXA 3ATYA 1DIKA 1D3CA 4LF1A 4C6NA 3AMKA 4D1IA 4D71A 4C6KA 2ZUWA 3G8EA 2EPOA 2CKRA 2E77A 4KGJA 3IGUA 3EDJA 1H1ZA 3GNNA 2ZTKA 4IZGA 4HJFA 3BOLA 3GH7A 3O3RA 3APYA 3QV6A 2QIWA 1OEPA 3P5ZA 3LPPA 3VE9A 1GORA 1NF7A 4G5DA 1EF3A 3VABA 1QK2A 5HJXA 5GNXA 4ZMGA 3PB0A 4TOQA 2WANA 4UR8A 1VBJA 3DG7A 4WJEA 4LX4A 4DPPA 5E6ZA 1JQVA 3GBDA 4RZBA 4LW7A 3DBNA 5CEWA 1B30A 4DJFA 3T8LA 4Y8FA 3KOZA 1XKJA 7XIMA 3V18A 3KOXA 1UCWA 4NX5A 4Y9PA 1IXQA 3H22A 3T4WA 4MUPA 3G1RA 3GTHA 2P1FA 3UR8A 1CEOA 4E0CA 4HZ7A 4NZJA 4J9JA 4P7QA 2XZ9A 2FVLA 1UUOA 4GYKA 4Q8UA 1SO6A 2V3EA 4IIDA 4EAMA 4BFAA 1UP0A 3TE9A 3SDOA 3IVTA 1YMYA 1H2JA 4DAFA 1HN1A 4QE5A 1T8QA 1LUCA 1VP5A 2D2JA 3HIJA 2QPUA 3L0KA 3NEVA 1BWKA 3DFTA 1TYGA 1U5VA 2QVNA 2QULA 2J9ZA 4LAOA 2J7DA 4RCXA 4AEEA 4M7SA 8A3HA 3OEXA 1J12A 3VUSA 3SCNA 2WC7A 1EQCA 4H2HA 3TC3A 2Z4GA 3PPFA 3QTPA 3QZAA 4P8WA 4LAKA 4ROPA 1D7FA 1L6WA 1P43A 2J78A 4O1AA 1BYDA 1BFNA 2ANUA 4NU7A 3S42A 3MI6A 2J79A 5HMDA 4CQAA 1A5KC 4IMFA 2YSWA 1I4NA 3VMNA 3MA8A 3MUAA 4RDZA 3CM4A 1POKA 4FHAA 1JF5A 3H26A 3LGDA 2FVMA 5CPSA 3OYXA 3VD5A 5KZDA 5HUOA 4XD4A 3OGSA 5LIWX 2YL9A 1E4IA 5I3KA 3WMLA 2GVGA 1WB0A 5G1YA 1F7BA 1DQUA 1H7WA 2XVKA 3V75A 3UYIA 1LWIA 2QHAA 4DWSB 3LGEA 5D05A 3W7PA 1VPQA 4BWLC 2B7NA 3AXMA 4Z08A 4H6RA 3P0XA 4P8UA 4OJYA 3M07A 2HMCA 1X8FA 3EPMA 3HB9A 2FZNA 1X6LA 2ZUUA 1VPXA 3CGTA 3ECQA 4J5NA 2REQB 1XLBA 3GAKA 1AJ0A 3JW7A 1W9PA 4LNCA 4CNUA 3MSYA 4G2DA 5ENLA 2VHLA 4CEXC 3N2TA 1R3QA 2ZKMX 4J3SA 1XC6A 3IJDA 2RGMA 3GKAA 1WAUA 1Z3NA 3VK5A 2J7HA 5DFAA 2H3BA 3BMXA 3WLPA 3TSMA 3NEHA 1H09A 4IIHA 3KL0A 7ENLA 4GUHA 1GJUA 3NQ8A 1L6YA 3BG9A 3DN5A 2Y8UA 6REQB 1AQMA 1PXGA 1CIUA 5D8WA 1B3WA 2DZBA 1VLIA 4A3YA 3TAOA 2ACQA 3GNDA 1J0KA 2G95A 4L56A 2CU0A 3W71A 1EOMA 4GZJA 2BHUA 3UWYA 2NV9A 1J96A 3AS1A 4M6QA 3HPXA 1S2TA 3MZNA 2PWUA 4U2YA 4N6FA 4C5ZA 3JS3A 4NJJA 4PB3A 2E8YA 4JIHA 3M0JA 3N15A 3MANA 1EH9A 3CWHA 1E4LA 2WHMA 3U2OA 3KUMA 5EA9A 4K38A 1KTNA 4OV4A 2QUMA 4H8NA 3DENA 3EKZA 3EWUA 1XXXA 4IFKA 3UU0A 1CTNA 4I6VA 1XQKA 4AEOA 3C61A 4UTTA 3S9YA 1M7JA 4AD4A 1LP6A 2J27A 1V6XA 1TZ9A 1E0UA 3SCSA 2E9BA 4JHZA 3DDMA 4IH3A 5A8OA 1Q7MA 3GH4A 1UC4A 1O66A 2OT0A 5FSDC 3QJAA 3K4AA 1QNSA 5I23A 2X7VA 2OZ0A 4Q6XA 2WJDA 4AVNA 1F6YA 1RCOB 5I78A 3MHGA 5G5IA 3IUHA 2Q71A 2IPJA 3N25A 4S39A 3A47A 1RQBA 3VDAA 2QDEA 4M8UA 1Z32X 1K02A 4I5UA 2V38A 2V2DA 1FP9A 3DBPA 1Q6GA 4H6EA 1CX9A 4DI9A 5BRBA 3LSCA 4QDWA 3THDA 2EKGA 3WF1A 4CNOA 1G94A 2CETA 2J6XA 3ES7A 4C6BA 4GY1A 4I9TA 3IGHX 1CYGA 1LJYA 1Q6OA 3CQIA 4ZO6A 3BDKA 5A6MA 2ZOXA 3W26A 3IUDA 1O60A 4Q8MA 3KDOA 5U7SA 3U4FA 4V28A 2OFJA 3KCJA 2QEZA 3H54A 1QVBA 3N13A 4DM1A 3P81A 3AFBA 3CL7A 3KM8A 5M03A 1IZJA 3CC1A 1YXYA 2UY3A 3R94A 1THFD 1ZLPA 1AK5A 3R10A 4GMEA 2EHHA 2XWEA 5GPRA 3II1A 3VIMA 4MWAE 1S46A 5AB3A 4NNAA 1FWSA 3M64A 1RLCL 1J01A 2PC4A 2BODX 1YX1A 4XB3A 3RLGA 1GG0A 4Z17A 2P0OA 2OYKA 2HSAA 2QV5A 3W00A 5CCZA 3ZWTA 1EX5A 2VO5A 2Y7FA 2ZZ2A 4DXXA 5K9DA 4F2TA 2KZHA 2QCDA 2YZRA 3HURA 4X2RA 2O4MA 3S6DA 3LOTA 3EDFA 3BG3A 3LXAA 3PC0A 3T0CA 2QPSA 5HK4A 4QDMA 1ADOA 4HB7A 1TPC1 3KX6A 4GOAA 2DZUA 1GQIA 4DBEA 3PPCA 1ENUA 1WCGA 1JD7A 5HJYA 5AHIA 2XVPA 1SZEA 2B81A 4GZIA 2ZX9A 4QDPA 4KRTA 5EBUA 1NELA 3RO8A 5FEXA 2IKIA 3LTSA 5A2CA 1XYFA 2DT0A 2ZXDA 1G4TA 3WDPP 4DBWA 3W7JA 2DPEA 1UH2A 1ICQA 3PM6A 8XIMA 1TKKA 2GGIA 2GQAA 1U1UA 4DO5A 1HGWA 2PEVA 3N04A 2PGEA 1D7KA 3UXAA 2KAUC 2NQHA 3CASA 4J40A 5LA2A 3S9IA 4NZFA 2GZXA 3M47A 4IL2A 1L6SA 2PDLA 5DMYA 1BGAA 5C8BB 2BG5A 4LWWA 2J7GA 5IBXA 1XLLA 3V5OA 1YPIA 4P8XA 4HNLA 4US5A 4F9JA 2C3ZA 2PCQA 1A3WA 3HBLA 3GH5A 2WOQA 7TIMA 3EEZA 4E8CA 4IF2A 3VNZA 1J6PA 2ZRYA 3EXSA 4YYCA 2A6LA 2PF0A 2PBGA 3P60A 4KERA 1X6NA 5FI8A 1SO3A 2NUWA 4X9YA 4PB4A 2PLMA 1H51A 4F79A 3ITTA 2QPXA 5FSEC 3F2CA 5E0FA 2A4AA 1JYXA 5BOEA 1B90A 4IGNA 4LJ3A 1SGJA 3LCLA 4WRHA 3MCNA 4S3DA 1G4EA 3SGUA 2X16A 5I3JA 3RK8A 1T40A 3KZPA 4IL0A 1US2A 4HA1A 3ITVA 3BZJA 4RXGA 3AZRA 1FP8A 1C8YA 1QNQA 3SUWA 4S3GA 4RV3A 1FWHC 1UR1A 3A3HA 3RRXA 3VZYA 1Q6RA 2I7GA 3CUIA 4GXWA 1LRQA 4XBSA 3MVIA 1U83A 2Y5EA 1S1RA 4JDYA 3ZJ8A 5EY5A 3NCOA 7PTDA 2G3IA 3UD6A 4N4QA 1F6KA 4S3FA 4EOUA 1WDPA 1XHGA 2PRHA 1W9VA 4XUYA 1W2VA 4XZMX 3INPA 4MUZA 2WPBA 4R7WA 3ITLA 2YCJA 4GWEA 3A4XA 3UNTA 4ATWA 4J2MA 5GJPA 2C1GA 2C91A 1WXYA 1JZ2A 1KO0A 5H91A 4LALA 2EG6A 4ERGA 4JFTA 4XZIA 1X6UA 1TJ1A 2YBUA 4LCSA 5BMXA 1RZMA 4OKDA 1R87A 4F66A 1WDDA 1WOAA 4NX0A 1M5WA 3AO0A 5HQEA 4ZR8A 1KWGA 3LCFA 1Y7VA 2CLEA 4HSNA 3WH6A 4RJEA 2VR2A 4BQ3A 5BOOA 3BJSA 2FH6A 5LKYA 1RLDA 3WL0A 4PUUA 4EPBC 2WQPA 1AW1A 1TO3A 4QBXA 2A0NA 1ZHAA 2AMXA 3IWPA 2OSWA 1F07A 1GOXA 1LQ0A 2G37A 4QM1A 2VZOA 4JTFA 2PZNA 3BAYA 4H9YA 3AUJA 4J28A 5DRIA 3LHTA 4MLRA 3LNPA 5G4EA 1CENA 3S47A 1PZ3A 2EJ1A 5G2WA 4F4RA 2DT1A 1B4KA 1I2OA 2HV5A 4YXGA 1ME9A 1O95A 5LZLA 3T0AA 1DXEA 1JFHA 3N4EA 3UZWA 5AC5A 1ZQ5A 1XH1A 3TXVA 3T55A 1B3ZA 1UW9A 3GG1A 1NFBA 4E4FA 2P53A 3Q37A 4XZNX 3O8AA 1QO5A 3K8KA 1S3TC 4PTDA 5HINA 4ZO8A 4AD2A 3OBAA 1L6FA 1VQTA 1QAPA 2WB5A 2EF9A 3TYBA 2A79A 1OT1A 1RQEA 2BY1A 2WZTA 4ZO7A 4OUEA 3MUY1 4X0NA 4ZCWA 1MXSA 2VFDA 4QISA 4HNUA 4HNVA 1OCJA 3SGZA 4JFWA 1UYQA 2ESCA 2UBPC 1JCNA 1EXBA 3W73A 1ICPA 4JZ5A 1MEIA 4LY8A 3OOQA 5EPDA 3TMQA 1RJRA 2DVTA 3CMJA 4RUBA 4DRSA 1YXDA 1LOQA 1J2WA 1Z48A 2PWEA 1XV8A 1RH9A 3BVJA 3FSUA 5I77A 4Z42C 4WY0B 5MF5A 5JBDA 3EX2A 4JIPA 4L6DA 5CLTA 3EAUA 3VNYA 3ARUA 2BBFA 1GVEA 4EAYA 4Z2KA 5FIPA 3UT0A 4B2DA 2Y24A 3TX9A 1OGGA 4FOJA 2V6AA 2PGWA 3WUBA 4PCPA 2Y1HA 4NZ3A 3DFHA 3UNDA 2XH0A 4PMXA 4HPNA 1CPUA 3ZSTA 3TH6A 3SSZA 3CS2A 4PH6A 1X8CA 1UA7A 3SRDA 3MSRA 1SQ7A 1I75A 4KGLA 7A3HA 2VXNA 1ZALA 1JPMA 4GISA 5I2UA 1XISA 3OQ8A 1UZDA 4F2BA 2PU0A 4QS6A 1MZHA 1JNEA 6XIMA 4A4AA 4WY0F 2AQWA 1GWJA 3B9EA 1EP1A 4HOWA 4BR1A 3CHFA 1UR0A 4G56A 3PPGA 4FZIA 6REQA 1W3LA 5JVLA 3EOSA 3WL1A 4QFUA 1JEZA 2GSEA 4J4KA 3BPWA 4X0VA 1DJYA 4DYKA 2JEPA 5DMMA 4S1FA 4NP7A 3RG6A 3SEPA 4JQAA 4Z2GA 2HDJA 1C92A 3ARRA 4RPQA 2CHNA 1YLVA 4QNEA 4O1BA 4H83A 3Q2DA 3HGSA 3IJIA 1R2SA 1VFTA 2QAFA 1SZRA 4G7EB 3MO4A 5FJTA 2ZX8A 4XVEA 1A3HA 1A0DA 2A7NA 2F2KA 4JTSA 4H9ZA 1K6WA 4KCWA 1EO5A 5G4WA 4CNSA 1ITQA 1OCQA 1Y5VA 3M0MA 2AL1A 3P5YA 4C1KA 1PWLA 1P5BA 1V93A 4KRZA 5BXSA 1CWYA 3SSJA 3L4UA 2BXYA 1GZ1A 4B16A 1KQZA 1OCBA 3THCA 3CQHA 1I2NA 1M68A 5FA5A 4EE9A 5K3VA 2DW6A 3DC8A 3LHVA 3U2EA 4DY1A 1H61A 4NRSA 3TW7A 5LHFA 3WN6A 3S1VA 4O0KA 3GE7A 3S2CA 4XG1A 2A3HA 2WVVB 5HMFA 2OYLA 3DI1A 2ZA1A 2YDAA 2ZCGA 3OTRA 3MYOA 2BX7A 3OGVA 4OV9A 4N6EA 4PMYA 3S0CA 1OF6A 1YDVA 3ZMRA 1C93A 5BMWA 1TR9A 3KBWA 3PWAA 4XAPA 1AA1B 3W0KA 4UZSA 3S5SA 5I00A 3MDWA 3COTA 4AG0A 2VQTA 2WHJA 2ALRA 3TAKA 2QGYA 1L2UA 4H2CA 3LQGA 5TIMA 4FF7A 4YU1A 2X30A 3JUGA 2NLYA 3BTNA 5FF3A 3W83A 3M5XA 1TFVA 1TPUA 3A23A 1SFTA 3ARSA 5C9UA 5K9CA 4YIWA 3OVPA 1UP3A 3BMWA 3DERA 1Q2SA 2GJNA 2HK0A 3AWNA 4IGSA 4NJKA 4KEZA 1EBHA 4FR6A 1JG9A 1V77A 1XPGA 3UXIA 3PUGA 1QASA 3BLEA 1YKWA 4C90A 4H00A 1HJXA 2H6RA 3M1ZA 4TQTA 4H7CA 1WE5A 2GVLA 3QF0A 1NWUA 3EYPA 2E7FA 3L23A 2FTWA 6TAAA 3NZRA 2PDYA 1BRLB 1YTDA 3RCYA 1ONRA 2EKCA 1DXIA 3W23A 1XI3A 3AJ7A 3LUTA 4EWND 2EQDA 1J5SA 3VGHA 4HA4A 1QW9A 3PUEA 2J25A 2DFAA 4DWSC 3C0JA 3NGFA 5T91A 5XINA 3E5BA 1YTEA 1WBJA 2YXOA 3WDJA 1XDMA 2O4QA 2UZ9A 2BXZA 1V7AA 3NL5A 2CZDA 3QR3A 3UWZA 3L0GA 2Z29A 5I79A 2CBIA 2W66A 1FDJA 2DSZA 5A3HA 1JAKA 2A7RA 3UA4A 3SCPA 4O0ZA 4DJDC 3NSNA 5I24A 3AIBA 4XK2A 3S5ZA 4NUWA 9XIAA 1VKFA 4H9VA 3GW3A 1C9WA 2D3NA 3CAWA 2WZHA 4IWWA 4LUYA 1W8GA 3E9AA 3P6LA 5CQ1A 1DL3A 4XKMA 3UXKA 4OZOA 2NW0A 5HWNA 1W1ZA 1P7TA 3VGBA 1TCMA 4O28A 3DEQA 3DYPA 3LBCA 4BS0A 3GIPA 1SSGA 1DIDA 1CB7B 4O12A 4CD5A 2X2YA 2WLYA 2FB3A 4LUSB 3LSBA 4AHPA 4D9PA 3O15A 3ITXA 1XUUA 4M5PA 1GT8A 2DSKA 3E96A 3VKAA 5A94A 4HT3A 1X39A 1D3HA 1J5TA 4XKYB 2F6UA 1XIMA 3WY1A 3WUGA 3XIMA 3L12A 2J24A 3LEPA 4GC4A 3FN9A 3MB9A 3L67A 3RPMA 3T44A 3UR2A 1E1CB 3IVUA 3TU9A 3CB3A 1UQYA 1WDRA 2PDNA 5DRCA 4JTHA 1KB3A 1OVDA 4PBFA 3M0VA 2GQ8A 1FDZA 3QW4B 2PGRA 4DZHA 3I68A 1H5VA 2FVKA 4XSMA 2OLAA 1EJTC 5B80A 3H53A 3PBGA 3NO5A 4Q8VA 4H6QA 4DWSD 2BGNE 1H62A 5HWJA 1U5HA 4IX0A 3B9DA 4RV8A 1UWIA 2X1IA 3KBMA 4ADTA 2VENA 3EOEA 3IIVA 5FJIA 4KESA 3NWRA 3TCEA 5ECUA 3EKGA 1FWNA 3JZEA 2B7OA 3Q4DA 3E0IA 2FQIA 1XL9A 5JBFA 4L4MA 1DJZA 1N8WA 1SW0A 3EWWA 1L8PA 4ZB5A 1TMQA 1CGVA 2ATSA 2XN2A 4IP7A 2QUNA 3R13A 3S3GA 2YL8A 5LSMA 3MI3A 4E2BA 3RF9A 1RK6A 3B05A 2DZVA 4A2SA 3G1VA 2NUXA 3LQLA 3B8UA 1I60A 1VEOA 1G4SA 1RP9A 4IUOA 3GTIA 3H12A 3WK0A 3QV8A 3FA3A 4GUIA 1Z89A 3DYOA 4M6VA 1SR0A 3AIUA 1YTKA 3MJYA 2WZIA 4AAJA 2DQWA 3MT1A 1X97A 4C6LA 1FX6A 3PR2A 2FPTA 3I3BA 4OVXA 1HGYA 3NYDA 4FOUA 3I6RA 1LM1A 4YTQA 3CMFA 1WZLA 1VYPX 5TD4A 3IJ8A 3TCSA 5F2GA 3URBA 3GXNA 3A5FA 4AZ5A 4GI8A 3PJWA 3QOMA 1TWIA 2WJEA 2OSYA 1K4GA 4KEVA 5HNRA 4GJJA 2VKZG 3FGCB 3H21A 4UMAA 3IUIA 4GKLA 1JXJA 1NQ6A 4R85A 1I2QA 1OGBA 2IPGA 2NQJA 1LRTA 3MKKA 3MWCA 5J04A 5I03A 1DPMA 3ATZA 1MQPA 2W5FA 1I9CB 1Q7QA 3ABRA 4I6KA 4B5SA 2G3NA 2VDGA 1U2YA 1UP2A 4GUFA 3B8VA 3VOHA 1F3WA 4C6CA 1CGUA 1Q5MA 1Y65A 1H5YA 1K7XA 1R3WA 3CV6A 1UUQA 3W07A 4UQ9A 1OFBA 1XLHA 1Z41A 3GD6A 3VIKA 1QPOA 2HPIA 4CD4A 4Q4MA 2C18A 1R3RA 4UQDA 2QCEA 3KRBA 2PPGA 4N9CA 3UJ2A 4CCEA 4GH3A 1RBAA 3TTYA 1MW3A 5BRPA 4AWUA 4UB9A 2P5NA 3IJLA 2I14A 3CHDA 1UD2A 4UTUA 1EF2A 2BV9A 1BVNP 3BOFA 3NDZA 2VOTA 5CXPA 4Q6JA 3OZOA 3H2CA 1BSIA 2WMIB 1KFLA 1BYAA 4GCXA 1V0NA 1KBKA 3W7IA 3OLGA 1M7OA 1TREA 4YVPA 4PL2A 1XRSA 4H7VA 1HIZA 4LU0A 3E02A 3KCLA 3F4DA 1WKDA 4PA8A 3U48A 1GCYA 4NYYA 3OYZA 3JRKA 1V6TA 2DDXA 3T1GA 3CUXA 4TR9A 2OQHA 2DP3A 3H7UA 1J0ZA 1MUWA 5PTDA 3MP3A 4PRTA 5FESA 3UJRA 3RLHA 3GC4A 1UA3A 3LI0A 1EO7A 5E93A 6PTDA 4JTIA 1V4YA 3ELFA 1UBSA 3CZJA 1KGXA 4Q32A 4MNKA 1W0MA 5AHFA 1XCXA 1XKYA 3OG2A 4GY7A 1MO0A 1UKPA 2VEIA 1EIBA 1F05A 5LIXX 2XYLA 4ORMA 1FBAA 4G7FA 2YB1A 4MFEA 2GOKA 3OHIA 2YDSA 3UG3A 3ZO9A 1IEWA 4MAVA 4MJ2A 4C6PA 1RD6A 1FH9A 3LHUA 1NDZA 3PHAA 2ZA2A 1UKSA 5XIAA 1QW8A 1DWIM 2YDRA 3MJMA 5I3FA 4Q8TA 1R86A 4MGGA 4CUCA 3EXTA 3PG8A 4DELA 4DX3A 4GC3A 2ZXQA 1R2RA 4IHCA 4B4FA 2W92A 1JQXA 1W9XA 1W56A 2ZX6A 4FS9A 1QBAA 1HKKA 1Q4WA 2CFFA 3F4VA 3MQTA 4D6GA 5G4HC 3AALA 1UWRA 1KFBA 3TROA 3O6DA 3O7UA 4Z2IA 1W32A 3R12A 3WJXA 2MANA 3KZSA 2QCFA 2PODA 4M56A 3CUFA 3UETA 2YZ5A 3EA2A 4U5KA 1VFMA 1US0A 3FIGA 4R9XA 2Z1SA 3RCMA 4HQVA 4N9BA 3SN4A 3IIPA 2Z1VA 2VQUA 5CH9A 4TO8A 1OIFA 3WFLA 4N42A 3HJZA 3PBWA 3GHUA 1PIGA 3L21A 2R1MA 1AW2A 1Y5WA