3HG0A

Crystal structure of a darpin in complex with orf49 from lactococcal phage tp901-1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
137
Chain Sequence
GNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPIDHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and function of a DARPin neutralizing inhibitor of lactococcal phage TP901-1: comparison of DARPin and camelid VHH binding mode.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Protein binding
molecule keywords Baseplate protein
total genus 23
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hg0A01
2F0CA 4HEMA 4HEPA 3EJCA 3U6XA 3D8MA 3HG0A 2WZPA 4IOSA 1ZRUA 3DA0A 2X53A 2BSEA 2BSDA
chains in the Genus database with same CATH superfamily
3DOSA 1MLCB 4G6KL 1FO0B 1ETB1 2DMKA 1UHVA 2P7TB 1OTTC 1IM3B 1Z9SA 4OD2A 3RI5K 2VLMD 3P3YA 2ZOWA 3RHWK 2GC7C 3KWVA 3ZKXC 5LB1A 2QGBA 3ULUD 4M8QB 3EJJX 4NAMA 5IW1A 1JFQH 2FGWH 1NA8A 4OIAA 5DQ9B 7TAAA 4NUJB 2HZHA 3VX1A 2A6JB 2QQKH 1HHKB 4H1LH 1XFPA 5T1KA 1WBXB 4PQXA 1C5BL 3FSZA 3KPSD 2XWTB 3B3IA 4KQ3L 4ZG1A 4JPKH 4YDZA 5JQHC 2PO6D 3ZHLA 2Q6WB 2PO6B 1U92A 2MOQA 2I32A 4HHGA 4PJBE 3P1VA 4FLOA 2R1WA 3L9EA 5D7IB 3ARGD 2PO6C 3MBWA 1I9JL 5CNHA 4ALAC 5DMKB 5SWQB 2VDMH 2FBOJ 2VLKA 5JDJA 3TBBA 2LAGB 4HXBH 1Q72L 3VTTA 1ZE3C 3I50L 1OF0A 1WEJL 3L95B 3VD2A 2VO5A 2P8MB 3JBG7 5D7JA 3CFTA 3QJFA 1R3IL 3SDAB 1QBAA 3V8CA 1RZFH 2B14A 4MXVF 4AH2A 1NIDA 1FZKA 3WL9B 2FTAA 3A0OA 1P5UB 2VE6B 1BXAA 3OAZH 2KQNA 5LN4A 3CH1A 2BP0B 2F1AA 1AKJD 3FO2B 4DGWC 1OIOA 5GXBB 4OIBA 4XPGH 2FX8L 3HC0A 3IRPX 3GWJA 5ES4B 4WU7A 3V10A 1TEGA 4JPIA 4N1HB 4L3AA 2VXQH 1M4KA 3LZQA 4PWGA 3EOTH 2ZX6A 4KC3B 5B1KA 4DEWA 3EO9L 1J86A 3N85L 4HJ0C 1SRDA 3GSUB 3BUDA 4M7KH 5EN2B 1R1CA 3JWOH 1OLZA 4HS6B 3N1GC 1G4RA 2AXFA 1PZBA 3MLYL 3PGFL 2X4SA 3DX7B 1UASA 1QR4A 5M7QA 3BFOA 3LZPA 3FO1B 2BC4B 1XTMA 2Z1KA 3DO4A 3GJFK 3MV7A 2APTA 3D2UB 4M5ZH 4RMQA 4WV1C 1LO2L 1B0GB 5F7WC 3V4UL 1JGDB 1CU4L 4FF9A 4L0ZA 1IGYB 1R3LA 1A8JH 2BZ7A 2OK0L 4LLMB 4FNTA 2XZQL 2K7PA 3LPGA 5BRZB 4N2KA 1JWMB 3MLVL 4JAMB 1YEEL 4AM0Q 4Q6YA 2W92A 4FQJL 2O61A 3PS6A 5DQJA 4ANKA 2UY6A 2ZYHA 5F3BB 3UADA 2BINA 2NTSP 4OFIA 4K7PY 3LEYH 4EUPB 3P3SA 5EPMA 1KN4L 1KIPB 2P5EE 1NMAL 4I13B 5GGTH 1CBVL 4JK0D 4TUKL 4U6VL 2BSCA 3HRZA 5B1JA 4N0UA 5HDOA 1J05A 5AWNH 3FFDB 1G9HA 3MRDB 1M9SA 4TUOB 2O5YL 3HC4L 1E30A 2A3TA 2I07A 3CDYA 1Z3GH 2VNCA 2V7HB 5KVMC 3NIDE 1XH2A 3OKEA 3OXSA 2VR7A 2XETA 2JKXA 5EN2A 4LEEA 1ZGLM 3MRDA 2AGJL 3DJRA 4TPRL 1MJ8H 2A9DA 3UCRA 1JZGA 1QRNB 2OYLA 2CLZB 3MXWL 4JG5A 3B2XA 2O93L 4NC0B 4GS7C 1NAMH 2Q10A 2QELA 5KSAA 3LOWA 4AQ1C 1SEBB 3DROB 1ASOA 1MNUH 1OTUD 4ICWA 3IBOA 3FUHA 4K8RL 4BQ9A 3HB3C 2ZAHA 2DLHA 3X13A 5KBLA 2DBJA 4F37F 4ODUB 2CHXA 3DJ9A 1V7ML 3SSGA 3CFNA 3ZTDC 1GYWA 5MERB 1H3XA 1IO4C 4GG8A 1R3KB 1XL6A 3A6CL 1BZ8A 2A2QT 3PHQB 1KXQA 1VFOA 2QVTA 2ZUVA 4GEJA 2DTML 5K9OA 4Y5YC 4N68A 5DD5H 3GMLA 5IHLB 2IPKB 1HEZA 5B3JE 4UM9B 1CT8B 3O3UN 3U0PA 3ZKND 1S9XB 1DEDA 3I9PA 1A4CA 3GSQA 2DQGL 3KLHC 4OF7A 5HYSG 4KXZI 1GYAA 4OCYH 4LT7A 3SEPA 2Y1VA 3S88H 4YXLH 3DNKA 2GSIB 1KEMH 2ROYA 2ROXA 3LXUX 4MMZC 1HQ4A 2YA1A 3GJFA 2G9KA 2LVCA 4WQOA 2F8VA 3C60C 1SEQH 5AKRA 4AQZA 3MNVB 4D8PA 3VXQB 2LTQB 4O2FB 4WI2A 4LSQL 4JFPB 3NDYE 3E6HB 3HE6A 4FQIH 2OLDA 3CSTA 1BVZA 4GRMA 2NR6C 4RSYA 2X87A 5FGCB 3FQ4A 2E8YA 1A9BB 1BV8A 5TE6H 1LJMA 3NJKA 3N40F 5JHDB 4XZUA 1F0LA 3WFEL 1OF2A 3F64A 5I5MA 1GYVA 3O6FC 4P46B 4PBDA 4LP4A 2P4AB 5C6PB 1QFHA 4LCWB 3MU3A 2N3JA 4Q74A 5AOJA 4GI8A 2VXQL 3I85A 2NLJB 3MKGA 4OB5H 2Y5EA 4ODTL 5C0CE 3VMPA 2FZ3A 4AY0A 5EB9A 2BVPA 3ABGA 4KBPA 4G8AC 4V33A 5EBWA 4TOYL 2HKHH 3NK3A 5D55A 5DWUH 3UPRB 1SJVA 5I8KH 2IANA 3K0YA 1FFTB 1BZ7A 4YNYB 3TFBA 1UJ3C 3V4VH 1QSED 3L3DB 4PV9A 5FYLE 4QF1B 1HHHA 4PJ7E 3DXAE 2O5XL 2IBBA 2DQHL 4Q2ZA 3W9EA 3BHBA 2BSRA 1YG9A 2Q76A 4GAJH 4N5EC 1KYAA 5EG6C 4YHYC 3MRLB 2DQCH 2YPLD 4W9GC 4XXWA 4DEPB 1O6SA 5KS9A 5CJ8A 2YJLA 5J11B 1Y18A 1XAKA 1MCPH 5K9JL 4JM0A 5F1KC 3ESNA 4PG9B 4J6RL 1KBGH 4DP1X 4QRPB 4CMHC 3OG4B 2Y5QA 4K3EL 2GIYA 3PWLA 4LHUA 1R3IH 5KVFL 1J8HE 3HKFA 1I53A 4BA0A 1ACYL 2VXVH 3E9TA 1P7HL 4QO1A 4M48H 4TUKH 5I6MA 3DV6A 3BZ4B 1OD7A 2XPZA 2CIIB 2XLLA 3O8XD 3JV4A 4DHLA 1AI1L 5ETUA 3AMKA 4A2FA 2YEZB 1A6WL 5ID1B 5EO0A 1T5XB 1JD9A 3PHAA 4MDIA 2BH0A 2OYMA 2BOBA 2GTZB 2BP0A 1I8IB 1HK6A 4ZTPH 1FYHB 5LGYA 5JOPE 4E0RA 4EIUA 2ZXCA 3D39D 1ZVYA 3HFML 5GRJH 2F18A 1YJDL 4BFGA 1BM3L 1YUHB 1TF4A 2R0KH 2CR3A 4JUSA 4KPHL 4BXSV 2UZIH 1GJWA 3APFA 4GP8B 2X2YA 2PTTB 3LMJL 1YRKA 4KHTH 5FYLD 2J6WA 5ENWA 5GJTL 3HIZA 5F9WC 3VYPA 2XTJC 1FDLH 5IT2L 4Q9QH 3ECQA 1TQVA 1PX4A 3G5ZA 3QHFH 5I1AA 1WRFA 4JFDB 5DMGC 2IVFC 2GQHA 5F9WB 3IGKA 4M5YL 4JL1A 5EUOB 3MA7B 3MPCA 3MV9B 3KLSA 2Q86A 4R26H 4KZEH 1AZZC 3LNEA 1RIUH 2MHAA 4LL9A 4PREB 2YLHA 3LPFA 5MEOB 3W37A 3FB5A 4IW4C 1C5DB 2V2WA 5FDWA 3HLAA 3UTSA 3C09C 1L0QA 1HIML 2EAEA 3NIGF 1BQLH 3OV6A 3RU8H 2K8QA 3V5DB 3VU2A 4EI5D 3I9AA 2IBZY 4ZUWB 2GUYA 2AC0A 4MQTB 5KOVC 1ROCA 4Q56A 3RPKA 3BAJA 1XF4B 5AKTA 1NCGA 4LLUA 1BPLB 1J9TA 3CIAA 3JQOB 3B8YA 4QOKE 2P80D 3MUY1 3D3VB 2GTWA 1Q9KA 5K59F 1BM7A 4BCYA 3B4NA 1HTYA 3VD9A 1BSIA 3QDAA 2WLZA 3H3PH 3C8KB 5J0BA 2LVEA 3V4PH 1KZQA 4MHHI 1JUFA 1DQKA 3BMVA 3L1GA 1KWGA 4JCLA 25C8H 1RQ5A 4S0TD 3O6MH 1NANI 4ZFOL 3DX1A 3PDGA 5JIPA 2MMXA 1ED3A 2Y9RT 4HAFA 1RUAL 3NTCH 3IMRA 5D7HA 4U1JA 3QJVB 1FNHA 5I28A 5FF6A 3JT0A 5C0EB 3CN2A 5CGBA 4KRPD 3D09A 4HJTA 1MCCA 2OXGA 2VRQA 3P3UA 3PXJA 5FYJD 3LHAA 4UZGA 2F68X 2RCSL 4XC3L 3QDJD 2Z8WC 4D94A 3PHOB 3KJ6H 1PSKL 5TPWH 2WIMA 4KTYA 3S3CB 3BAKA 2WLMA 4N2OA 4HJGB 3WLWD 2AKRB 3EBIA 1ZS2A 2Z8SA 5CCHE 5DZOA 3FN3A 4JFFB 1WZLA 1KYOK 3H6JA 5E2WL 3MZTA 2PPDA 3O8XA 4ZTOH 1B4JL 1ZV2A 12E8L 3ZUCA 2H2SC 4YHKL 1ZK9A 2BK8A 4XPAH 1F4XH 1DZBA 3D69B 3DMMB 1KENH 4FNLL 5D7IE 4EXKA 3DIFB 2H2SD 4ETYA 4ZMXA 3VXRA 3NFNB 3S8FB 4J6RH 2YAPA 2QZQA 2F15A 5DYOB 3OL2A 4GW4B 1E5BA 2DJMA 2P3YA 1V10A 3BD3A 3F3HA 3ZDZB 1JS4A 4HZLA 1NAKH 1A4AA 3QWOA 4JG1H 4YO0B 1LNUA 3RL1A 5ABDE 1N5YH 1EWHA 1UVQB 5LQBL 1T21A 4ELDA 1A1NA 4JKLA 2GK2A 3E6HA 3HPJA 1BGXL 1ZHBA 4HFUL 1VZIA 3KEDA 1KGXA 2MQGA 4XNZB 2XWXA 3ARTA 4XPGL 2PMZA 2QGCA 4U3SA 4JZNA 1RZ7H 2Q7AA 1G7QA 4A2HA 5KYUA 1W8OA 1KJ3H 1HH9B 1NDMA 2FHCA 3MRRB 4CSPA 1HJBC 4L5FH 1F11A 4FG0A 3N6YA 1IAII 4ZMQA 4JRYB 2WQ8A 4JHZA 4YHML 2WINB 5IGXH 4AUUA 3C09B 3HLAB 2AGJH 1RPUA 3FUDA 4RGOH 3O41A 5DHMC 1WS8A 1PFOA 3TTSA 5ITBH 5KYUB 1KB9J 4H8WH 4O4YH 1X3DA 3L3JA 5DEFB 4ORZC 7CGTA 4PR5A 2GIXA 1DP0A 1BAGA 4QYOB 12E8H 4X8JA 1OOAA 1OZUA 4CGTA 1FO0L 1JGUH 1ZVSA 2JLPA 4PB0L 1K3ZA 3D7PA 1R0AH 4YDMA 1PFCA 4WNQA 1WHOA 4FA6A 3VXRB 3V5KB 5F0PB 3EH2A 1E4WH 1KCWA 5EO9B 5T5FL 1OCCB 4NHUB 2VJ0A 2CRIA 4A66A 3CQFA 1HHHB 4TNGA 3ULSA 3UABA 3T0EE 3O6FA 3MJ7A 5A1AA 1NL0H 1P4IL 3QO1A 1UWXK 3U0WL 2R8SH 5AVSB 2K4AA 2M26A 5TQ2L 1OPGL 4Y1AD 1EGJH 3AROA 1M05B 4YBLB 2QPSA 2VR4A 3ROLA 3EJZD 3SPCA 5D1QC 4JJ5B 1ADQL 1LO5A 2A5UA 2Z9TA 3CQPA 4GAGL 4GKOA 4GP5B 4TNWF 5T1DH 4F7TB 3JWDH 2NR6A 4GW1A 4KWUA 2J71A 2BSTB 1IBBA 3B6SB 4EOWH 5GPRA 4C4KT 5BOPA 3GIZL 2CIKA 1OVZA 3CXHK 4IGBD 2R2BB 4JRYA 1A2YB 1OQOA 4LDEB 5I0YA 5IGXL 3AS1A 5GSRA 2FLRT 2Q0ZX 2AEPL 5IF0B 3DI3B 4EJ1C 1BF8A 1H9DA 5F8RC 4NM4L 2IMNA 2X1OA 5DHYB 1LD9A 2VISB 4M1CD 4BGLA 5IY5B 3G6JB 1F86A 1FZJB 1Z9LA 2B8OT 2G9HB 3K2UL 2EKJA 2C8NA 2PWGA 1L0XA 2WWKO 5ICYA 4WHCA 2WBJB 2AV7B 4HZAA 1MNUL 3HZMA 4QCIA 5TE6L 3LVTA 4XP5H 3FO0L 1VZHA 1QA9A 2GAZB 3OB0K 2CNYA 1G9MC 3VH8A 5CFHA 1QFWL 1DQVA 1CXLA 4GQZA 5C0GA 4HUMB 1KLFB 4KTDL 5CZVH 2FB4L 4FQCH 4P4KD 3IMWA 1B4JH 3UOAB 1S5IL 3K2IA 4G83A 4WENB 5CR8A 1DVFD 1FV1B 4I1RA 1TJXA 1CE6A 2QT6A 4GW5B 4HIJA 5DCCA 5DRWB 1KENL 5IVNA 4MS8D 3OKOA 3UYRH 2PTUA 3MUGB 4XO9A 1RIUL 1FGNH 2HVJA 3HMWH 5D7KD 3JVGC 2AAAA 5I1IH 3B43A 3IJEA 3MYJB 2OL3H 4B9IA 2PYEB 2C7UA 3V4VL 1FHGA 2YD9A 3QULB 4I18C 1XCXA 3CIQA 5D1XD 3G5WA 4G71B 1DJSA 4WK0B 4FXGB 3UJIL 3TN0D 4JPWL 1U58A 5IFHL 3BWAB 4L4TD 4KUZH 4F7EA 4U05A 9PCYA 1WF5A 2ZSVB 5BCAA 1HHJB 5HBBA 1KJ3L 1M2VA 2G2RA 2ICEC 2NY5H 1T7ZA 1QZ1A 4QTHA 3LYRA 2VABA 1M56B 2HYMA 5I0ZA 1NLDH 3DUHA 4BK4A 1A6VH 1CF8L 4H2AA 3EH5B 2FL5A 3ZKMD 4KH9A 2J1ZA 3T4YA 2OZ4A 4P4RB 1MJUL 5CUSH 3PU7A 3QDHA 5ICXA 4PMFA 5FWQA 5E8EB 3T0XA 3O2WH 5CJXA 2CDEA 5TDNA 1U8PB 1MH5A 3EOAA 4DUXA 2GY7B 3GHBL 5J57B 5A2AA 3P69A 3QI9C 1F4YH 3OAUH 1AD0B 3HMXL 4LSVL 4ZW5A 4KJYA 5J6GB 1KTDB 4QPEA 1BBDH 1G6RB 1JZFA 2GIMA 2P5EB 2XN9A 4G1MA 3WFCH 4HV8B 5I75C 1Q94A 3PUUA 3BESR 4XP6L 4R4BB 2DB8A 5F7KC 3SCMC 4B96A 3LDBB 4W9JC 2HWZL 4ZYKA 4N85A 5TQ0H 4JHUA 3RGVA 4CBZA 1CDHA 3VQMA 4N2CA 1BPVA 1FYTB 3QFJA 1TTGA 2YN3A 3LEXA 4EI6B 4DKFL 6PCYA 2XDHA 4V11A 1H3PH 5L6YL 4Z7IA 1U93B 2WXKA 4YHLH 4NKQB 1DVFC 4HC1A 5D2NC 4ZDHA 4RDBA 2C9SA 2ZX7A 1G7PA 5GS2D 5ABAA 5I9QC 2OMZB 4E9TA 1JZ8A 5CEZH 5DJ8B 4X8XA 3JYBA 1JFHA 1ES0B 1S7VB 4P99A 4HGWB 1DVUA 2FEDC 3OSVA 4XX5A 4XH2A 2N0KA 5D7JD 1LEIB 1AE6L 1NFIA 3D0LB 2G0KA 3TEXA 1UWEH 5SX4I 3GPSA 2V7NA 4X9FA 3UFIA 5ICXB 3ATDA 3ZZQA 5IQ7L 1FNEB 1FLRH 4MBOA 2PCYA 3T4AA 2ZWLT 1RK0A 3CZSA 4YSUA 5SWZD 1M7DB 4EOWL 4AVKA 1NEPA 4XMLL 1NCUA 2AVFA 2OSWA 4QWWC 5BV7H 1N5AB 3ZR6A 3EYSH 4XCFH 1OSZA 2AJVL 4M6ML 4NP4L 4XCNA 4IDLA 3RGVD 4LCYA 4XOAA 1QI5A 3ARDB 2IV8A 5C2UB 1IEBA 4OH2A 3HG2A 3MUHL 4KXAA 1X4ZA 5JHDA 5LGJB 2VC2H 2XWBB 3DBSA 3CDFA 5K1JA 3DV6B 1TT6A 2CDGA 2DI9A 3OC5A 3OHXC 2WGNB 1E9QB 3DURA 4JRXE 4L3ED 1GL4B 1WCBB 5IMOB 3V4VB 2XRAL 3UTTD 5CLZA 5D7IA 1F13A 4X7CC 3FONA 1MVFA 4AQ8A 4XVJH 4KTDH 1YAIA 1RPQA 1K3IA 3EJUA 3O9WA 4C56D 1QSZA 1YEDB 2W60A 3E6FA 5D7KE 4KY1H 4FABL 1PLGL 2OA9A 4F3FB 4G7SB 1XT5A 3AT8A 1D9KA 3G6JE 1OHQA 3WHE1 4YDVA 3G6DL 5HHOA 3NMEA 4YE0A 1DANU 4PY7B 1R5IB 2EDOA 1MLBB 5FWRA 5FO9B 1H8NA 3N55A 2HKHL 1V55B 2H47C 2K3HA 4D0DB 5GGQL 4P5MA 2EO1A 4Y2OB 3VWJD 3P30H 1BQRA 3EYSL 1TU2A 1ODUA 2E86A 4GXUM 5GRVL 5DURB 3K6IA 5J56B 3VGEA 4AQ8C 3T65A 2V2XB 5HJ3A 5L9DH 3GSNL 2R0ZL 5DJ0A 2I60L 5DRNA 3U1SH 5D1ZA 5AAMA 4BINA 1MAJA 5B38B 4WFFD 4YXHH 5HHPA 4AGQA 2VE6A 3GFUA 5KSVB 2YAHA 3IN0A 4QXUL 3HNVL 3OX8A 5DUML 5AZ2L 4DP0X 1ZRUA 4YL9A 4TRPH 5E4EB 2D9QB 3MNZA 4YBHA 3RWHA 1HILB 4D0BB 3D1MC 4U1KB 5DFAA 2GJ6E 3L9BA 4JMNA 1WBYB 4QRPE 4ZMZA 4P2OD 2GYSA 4ABWA 4WF7A 2DQFB 2CO2A 3TYGL 1BIIA 5AYUH 4Y5XB 4ALAL 1JOIA 3B7YA 2VDNL 4MJJA 1CIUA 1YN7B 5D71H 1LO4H 5B22A 4ODWB 4I3RL 3EGDB 4U1HA 2JCCA 3EG9A 2IQAB 3S2AA 5DC0A 5CJOH 4EZMA 1NUNB 4YSRA 3ECBB 5AW4B 1Y0LA 3ZE2E 3BKYH 3LQAL 1ETA1 1U8NA 4FQHB 2FK9A 1LVEA 3S5LB 3L17A 2ICEB 4UNTA 5E1AB 5FX3A 3WEOA 2GW5A 1KPUB 2KH2B 4WW2B 5BRZA 2VZSA 3D85B 3GRWA 2VQ1A 4FFZA 4GAJL 5C0BA 3HN3A 3SDAC 3U1SL 3REVA 3GLAA 1H3UA 4LRIA 3KWWB 3H9ZA 4GS7B 5EC1A 3FOMA 3V5HA 2AXHA 2BZDA 4FQQA 1K4CB 3NDZE 4AMKL 1BVLB 2VITA 5I23A 4LBAA 2PCPB 4CMHB 2FO4B 2MEJB 3KPRA 3VD7A 1IC1A 4JG1L 1N5YL 1CMOA 3SCMA 5I0XA 1TLMA 1V54B 1IGFL 3LPPA 3V4PB 1LMIA 1QVOB 3VSUA 3NJJA 4RAUA 2ZX5A 4B41A 4OD2B 5IHUH 3JWDL 2E7MA 4HULB 5IM7A 3QI9A 5I8OH 3QUZD 1YY8A 3DHJA 5JORB 4HPOH 2YUWA 2YKLH 2J8UE 5EIIA 4LSUL 4PY8J 3HNTL 1BBDL 3VI3B 5FEBA 1TZIA 1J18A 2AP2A 4OV5B 1YMMB 2Q3ZA 3NEOA 1A25A 1N6VA 1JWSB 2H26A 2OZ4H 3NFPB 5L4MA 1OT1A 3ETBJ 1FCGA 3LQAH 4XAWH 2J8HA 5AUMB 3AB0C 1HZLA 3PXLA 3LN5A 4X9GA 2DQJL 4JZJA 1OALA 2EC9T 1SLVA 3F58H 1J1PH 1YYMH 2YUVA 4NOBA 4D3CL 5E2VH 2EIEA 3ZDYF 2YPVH 2EYTA 1G7JB 1LO2H 2BWDA 2EYRB 4P57B 3UROR 5GRUL 3U82B 1RFDL 1BD2E 5LAPA 4A2MA 1E0OB 2VISA 1XD1A 2XN2A 3BKML 1B3JA 4R7VA 3T9WA 4TNFA 3MXVL 4M5TA 1MCWW 3GSNB 4E41D 5AB0A 3TA3A 2DQIL 4MNQD 2K6ZA 3TBYB 1JZ4A 3QIWB 5D7EA 1MFBL 3MRHB 4AYMC 2I60H 2YSSA 4CL7A 3VU1A 5I16B 2CBMA 3UPAA 5ESAA 2ISDA 5IQ7H 4XTRC 2WYZA 3F65A 1HSAA 4S0SD 3NACH 1EJOH 4JM2C 4P4KA 2ADGB 2Y7SA 2N7BA 5I8EB 4MA1C 1NCWH 1UENA 2LGNA 4LLVB 3V5KA 4BFEA 5FLVA 2ZUSA 1IZJA 4MJ5B 4FG2A 2OP4L 1KN2H 4XVUC 4TPRH 1F2XK 4AL8C 1UJ3B 4ILDA 1E28A 2RD0A 3CLFL 3PWNB 5IROD 2W9EL 1NBYB 3MLTA 3SOTA 2IGFL 3ZN6A 4LQ1A 4XMZA 5AOZA 2ZOLA 4LHQB 3KVQA 5T1JA 3QYCA 4L8BB 2YBRB 3QSKB 3II1A 1E8YA 3E9UA 3QWRA 3GUTA 1DJZA 3NFSL 3NSCA 5JUEL 1RLWA 4ZFOA 1NGYA 1UOWA 1C1EL 1GGIL 3PGCA 3D18B 3Q5OA 5E03A 5CD3A 1PAZA 4XVJL 1IRAY 4DF9A 4FEIA 4Z3FA 3GKZA 1S3KL 4U6XA 1JJUA 3GUTB 1JGVH 3VD1A 2XV6B 3MO1B 3VI4A 1EFXB 5T8IA 5ECJE 3KPMA 1HYRC 5GSVA 4B9GA 4RBPH 1KC5L 3H7BA 1N3NA 4OJEH 3D5OF 2OK0H 3DO7A 2XC8A 4OQTA 3W82A 2FIKB 3FT3B 3GZOA 3MLVH 4OFYA 1IE4A 4JFYB 1KXVC 3GS7A 1XF1A 3MKKA 1C5BH 3IPBA 3PGFH 3EFOA 2VLJB 2WVUA 3QJXA 1PVHA 2YEVB 4ZXBD 1TMQA 1NQBA 2OPCA 3X3GH 1OOWA 3APNA 1UEYA 1LLAA 2ESVB 5HI5C 4HH9A 3Q5YA 3OB8A 3VE0B 3CVHL 5KYXA 2BXYA 1JXDA 4WEMB 3O45A 3IVKA 4DGVL 4S11A 1YEIH 4L4TE 1S9VB 5IR1A 3HPLB 2F8XC 5A2LH 3MOAH 3IDGB 4MJHA 3A6OA 1UKTA 2PTTA 4Z7WE 2ADFH 1PZDA 5ADPH 5IKCB 2R4RL 5C08B 3CN0A 2CBOA 4Z77B 1XXFC 2WPGA 4MMXB 4MAUH 1B9KA 5I5RA 1VFMA 5BUAA 5BS0A 4LLUB 4XH2B 5IG7B 4CJ1A 5B3JF 4WWKD 4EZKA 1AXSB 1UH2A 4JFTA 3MJ6A 3K6FA 3TZVC 4DPBX 1WWWX 1BF2A 2J8OA 4TOYH 1KCRH 2X6UA 1FDLL 5FDWB 2AJZA 3QS3A 3TN0B 1DDTA 3OMNB 3IETA 1NAMA 3N0AA 4IMKA 4NX0A 4RFNB 4ZXBA 5J6SA 4OLUL 4G82A 1MWAL 3TV3H 5DGQA 2AJYL 3U2SA 3CX2A 4QF1A 3QYNA 1VSCA 2WO3B 1I1RA 2DQHH 4RVBA 5C9JA 2OL3B 4O2CA 4U7SA 1BX2A 4G43B 4BQ8A 2ENJA 3NACL 3AWFA 4HUNB 1SHSA 3AUWB 2YD7A 1MG2C 1A64A 5HI4C 1NMBH 4QDGA 3MXVH 5A2JH 1V27A 5DJAA 3RVTC 4LCUA 1DQQB 5FYJL 4DH2A 5LWYH 2E7DA 5I71C 3HB3D 3T77B 1P4IH 3U0WH 3GRWH 1OF2B 3V5DA 4Z7WF 1AHMA 5F8QC 4U6VH 5E94A 2HVKB 3HE7D 2MQ3A 4ZPVA 2R39A 2AQQA 2CA3A 1AKJA 1T04B 5EUOA 1E4KC 5EO0B 4URTB 2G2RB 2X89A 2ZKYA 1EERB 3OF6A 2FWLB 2KLSA 1P2CB 2MQCA 5E9AA 1ZA3B 3SD5A 5D8JH 2BNRB 4U6HB 3T1FA 4BUHA 1HCFX 5CP3H 3QAZC 2O72A 2JJSA 3IGAA 1A7NH 1J5OH 5ANME 3OXRB 4W70A 5IROA 1EX0A 3GNMH 2DQEL 1NUFA 1T21B 1TZIB 2VR6A 3MTXA 4JRFA 1AGDB 5GJSH 4P3CL 1SFHA 4L4VA 3RWGA 2GABA 1KGIA 1YY9C 3OKDB 1A1OA 3QA3A 3LMJH 1WA1X 4HBCH 5I15H 4XP9H 4PG9A 4X6FB 5FYKH 3V0VB 4HUWB 2VB5A 3ARXA 2YIHA 1T0MB 2DH2A 1MCJA 1HHIB 2CJ3A 4RWYH 4ZUUA 3SE3A 2X4UA 3PPEA 5F7EL 2VRKA 4Y89A 3FUMA 4K9EC 2PW2A 4UT7L 2W9LA 5FYLL 1IC4L 3BZFA 4JGMA 5LXVA 1WAAE 1DANT 3A21A 2YRLA 4X80H 3T65B 3BZ4A 3V4VA 5BS0B 5LO7A 4QWWD 4GI6A 4KVCL 2AK4B 3U46B 2RQ8A 3QHTC 4IEFB 1O7DE 1T83A 4CSZA 4XNXL 5INDB 1BG1A 1BJ1J 4E68A 3IKKA 2CHWA 4NN6C 1J5HA 4J3OF 3KYAA 5E8DH 32C2B 1URIA 2CO6A 3RNQA 3V0IA 1D9KB 1DVZA 3LKQA 5LBVA 4M6NL 2Y2WA 4FKHA 3RVWC 2VDML 3GZKA 2YQGA 5MP6L 1DLFH 5CO1A 2WSKA 4FZEH 4Y4FA 2Q1EA 1CK0H 1W0VB 4OI7A 1YN7A 3GBNL 5I6KA 2ZXGA 2A74C 4JM4H 2XKUA 4LSPL 4M1CC 4N3UA 4WI5A 4NQCA 1F02I 1MCKA 5JQ6H 1KB5B 2J6EH 3ML8A 4JQXA 3D8MA 3ECBA 2JQMA 3OR7A 1H8LA 4CSTA 4PB0H 1D7DA 3NZHL 4QRTA 4IGBC 2RB8A 1GHFH 5TD4A 2WLLA 3T3ME 2NSQA 4XC3H 4TQ8A 4AL8H 35C8L 3GHPA 5D2LE 2V9QA 2NX5D 3OX8B 2NXZC 1MSPA 4Z7NE 3Q9PA 3CHXA 4FQ2L 1A7QH 3QORB 2ZXWB 4P46A 1XGQA 3WAJA 4AX3A 4XNXH 3ZDYE 1YY8B 3O3AB 1J0ZA 1WFOA 2JJTC 5F1IA 1S9WB 5ICUA 4ZMOA 2ETWA 3P4NB 2E6PA 2VITB 4KDVA 3HAEG 4LVOB 2GSIA 2YXMA 3GIVB 5EOQL 3MODL 5FHAH 1GJUA 1H3PL 4WV1B 2MKWA 3HS0B 3IMBA 5JW5A 4WKXA 4YUEH 4C56B 3MNVA 5C1MB 1NEZB 1KBGL 4AMWA 5BUGA 1YAZA 3BE1L 4G9DA 4W9ZA 1AZVA 2WUBL 4PSPA 4FQXB 3LXBA 1ITBB 3WIHL 5JW3H 4OJYA 1JHLL 3GBLA 1OSPL 5TE4L 3KBFA 2ADFL 4X7TB 1A7NL 1J5OL 4KZEL 4PJ9A 1QLEH 4BSWA 1UOLA 4CJ0A 2YWZA 3I74A 3D2UA 5GZND 2C9VA 3B1TA 3NCJH 2IGLA 3MLZL 5IR1B 4WJKB 3LKRB 5KN5A 1NFDA 5T3ZE 5DJYB 1IGIH 1MI5B 3FO0H 1KJ2A 4NHCH 4N90E 2I25N 1E4XL 1IFHH 3DX9A 4N86A 4X0KA 2OCJA 4XNUH 5ESAB 3TCLB 3P3RA 4KROD 4PRID 5D8JL 4ZOCA 3BUYB 4TUJB 4GYBA 2CJUL 4ZPTB 1D5IH 4H44C 1CO1A 1G7HB 5AVUB 5INCA 5BRQA 2HPOA 3MRIA 3N42F 2RCSH 4P23A 3E3QC 1MKFA 2DEWX 3CC5A 4Z7QF 5JOFA 3RVXD 2YARA 2P8LB 4MCYA 4L4VD 4OZGF 3ZO0A 2I07B 2IGTA 1YQVH 4MYPA 1RFDH 1NMBL 3P77A 3V2AR 4TKWA 1TNNA 1JZEA 3N1QC 4GFXA 1RUAH 3NTCL 5DK0A 3V55A 3WFEH 1MREL 4QEGA 3F7LA 3GTVA 2YK1H 2VABB 5B3SB 4PLOB 5I1GH 4PGCB 4M7JH 5IBLD 2W07B 1UYWH 3NAAH 3MRQB 4L8DA 4HJSA 2AMUA 2YOAA 3KDMB 1NH6A 4LOVA 5CWSA 1GYUA 2VL5A 4OJFL 1HE8A 4F2MB 3BMWA 1DJXA 4IKJA 1JNLL 4Y5YA 5A6LA 3FPXA 2OTPA 2EC9U 3KL5A 4JE4B 2Y22A 3WNKA 3WNJA 3ZE2B 2DQGH 3D4GA 4BA8A 4F91B 4BSJA 3BUBA 2BX5A 3DSNA 3ZDWA 4LNVA 3PRZA 4QHLB 1EAPA 1AGCA 2Y4SA 3C75A 3MRCA 2B59A 2VL5B 1JV2A 3IXAA 5DO2C 2FZ3B 4G8IA 1R3KA 4YEEA 2IEPA 2F54A 2X2IA 3SBRA 4CW1B 1WCQA 1D3CA 3KPQB 3CLFH 5HVHB 1CL7I 3HEIB 1WUZA 5B1AB 1QWHA 3WL9A 2V5RA 5GRZA 1TTBA 4YC2B 3SDCA 3SKJL 4UI2A 2DQUH 1MJJB 3ES6A 1Y6NR 2VJXA 1UUNA 2CLVA 2H6PA 2YC1B 4ANVA 3CFBB 3BVNA 4HOXA 5I17B 5K9KB 3MRPA 1ADWA 4NT6A 1YVLA 2CHZA 2ZCKH 1HHJA 3P4MB 4LKXB 3WXVL 5I2IA 4AUYA 1SJEA 2YK1L 4ZSOA 4C57C 1SDYA 2H3NB 2ZF9A 5SX5H 4ATTA 3NPSC 4HV8A 3KPNB 3ZE0B 3MODH 1SXAA 3GSWA 3QRFM 1UT9A 2XIBA 1WTLA 5B1JC 1KPRB 2O6CA 4FYRA 1SHWA 3RZWA 1N0XL 3T4AB 2UY7B 1U8PA 3UYPA 5CJOL 2EUWA 1RJCA 3EGXB 3VFMA 3TBSA 5BS0D 2ZONA 1B9ZA 2DQTL 1QPPA 3FPYA 2YD6A 3WEXA 4AEEA 1TJMA 2VLRD 3GRBA 1KN4H 2VGLM 4OGXL 5F88A 3TT1L 3W0WB 5FYKD 4GT7A 4ZTOL 2AHIA 1T3FB 4WTQA 4GAGH 4I0PD 1RL1A 4Q4EA 5H2BB 4UANA 1RZKL 1DVFB 1IC5L 1AZUA 4FNUA 3WO4C 4MHHG 4V1DA 3T6ZA 4H25A 3BO8B 4P23B 3T3PF 5JLZA 3IF1A 3QPXL 3ML9A 4AYFA 5DQ9A 5DLLA 5GGSA 1CK0L 2HKFH 4U6YA 1AIFA 3WJJA 3U7YH 3RKPA 4NYLB 4HIHB 3WELA 3MV9E 2IAMD 1DBBL 1EEZB 1EO8L 5FCSH 2BNUA 1JXJA 1NPJA 3F00A 4PJIA 1DQIA 4Z6AT 3W1ZA 8FABB 3F05A 4GW4A 4R0LC 3FU7A 1AD0A 3QQ3B 2VR8A 5FKAA 1A4JB 4EZJA 2MCMA 4HK3N 5SWSB 1LP9F 5BOZG 1OP9A 3FUNA 3RFZC 5AB2A 1E3FA 1Q9OB 1SYVA 4TL5A 4TUUA 2Y06H 2IOOA 4ZFZA 4N1CA 4PJ9C 1VACA 3SDDD 1JNHB 4NI6A 5I1DA 2CHDA 1L0YA 1BFTA 4PFEA 3IMTA 4YZFF 3SIKA 3HB3B 1H0DA 1HINH 4W9EC 4MNGA 3FB7A 2VN7A 3FFCE 1X7SA 3MBWB 1BYOA 4I0PB 4LVNB 3IGAB 4N2LA 1Y07A 5PAZA 2VDOL 1RZGB 4PSRA 1ES0A 1S7VA 5T5FH 1KY6A 2AXGB 2QADB 3MRNB 5BW7C 4PV8B 1S9YB 2XQYK 2NUTA 3FU5A 1YYCA 2QZ5A 1EGJL 1UB6A 4ZW8A 3WMSA 2CGZA 3NJNA 1AG0A 2PCFA 4PW4A 3U7AA 3BGFC 3K4ZA 4PJIB 1HN1A 2X6AA 1X4YA 3BH4A 3VFPA 1M7DA 4TQEL 2NCEA 2RGSA 1AJ7H 3TZVD 4GLRH 3MFGB 3RBSA 5B4MC 5I0DA 4TSAL 1KYUA 4I48B 2R83A 1IEHA 1A7RH 4ENED 4RLDA 3D87B 5BQ7A 1LE9A 1GXEA 2PXYC 1UCBL 3PHOA 3TH4T 1TVHA 2GSGB 2NQCA 1NSNH 1J9SA 1BREA 2AEQH 3O41B 4PCSA 2FH8A 2YLKA 3WY1A 2A74A 4G5AA 4NNXB 4YFDB 4OD3H 2ZF8A 4HWZB 1ZEAH 3V9EA 5TDOA 5J1SC 3IDUA 2Q7YA 1P4UA 3O4LE 4B95C 1MCHA 2OV0A 1HU8A 2JXMA 3Q2CA 4X6CE 4U49A 1JWUA 3AXLB 3N85H 1O6VA 4M7KL 3RWDB 4BWUA 4GKZA 3GB7A 2HTKC 1EV2E 1AMYA 4Y4HD 3B83A 4G6MH 3H42H 3ZYZA 1A65A 1CTNA 1R17A 4HFUH 4DJMA 3IMUA 2KLTA 2PTVA 3IJSA 4ZMNA 1ZLDA 1MW3A 2H1LM 3SO3B 4MA8H 3L7EA 3DTUB 2BO0A 2VJ8A 4YHLL 3QAQA 5IB3A 4HUVA 1SVZA 2BNQE 5DK0B 1FAIH 2B77A 4HHAB 4ZQKA 3R0NA 3OKNA 5CEZL 1O0VA 3WS6C 5DHVH 4MRBA 5INDA 1KIUA 3SN6N 5H4ZA 3NSYA 5TPWL 4HQQH 4ZO8A 3T0ED 2HT3D 1JPTL 2I7OA 4MA7L 4MJ4A 4ZTEA 4Z7OF 5SV3A 4OGXH 5DZJA 3DHMA 4JFVA 1P7BA 4TSBH 5FXCH 3X2QB 5E4EC 2IALB 3P9MA 1W72H 1ZTXH 1IEBB 2P24B 4F27A 5GS0H 3T77A 3WSQH 2VH5L 4XO3A 5AW2B 1CS6A 2Z31C 1L9OA 2LR4A 2YSSB 1CF1A 4NRYB 1A14H 3FHQA 3US0A 4K7PL 3CH8A 4L9LA 2W8CA 4PGDB 5T1MA 4G8IB 2QL1A 1OK8A 2PABA 4ATWA 4LDCA 4FQLH 3BQUB 5D93B 4TM9A 2FX9L 5IROC 2AVGA 1P4BL 3IWUA 3CNKA 4L1DA 1ZT1A 2WINA 5GZOC 5GRXG 4XBGA 4HETA 2CZNA 4XMLH 4S1QH 3S36L 1GHFL 3RAJL 1INDL 2R0LH 1M7UA 1V3LA 4LKCB 2ZOLB 2AAVA 3ASWA 3X17A 1ZVHA 4OFYD 4U1IA 4MD0A 3DRTB 1OM3H 2JB5H 4JFOA 1TO5A 4QLRA 2VERA 3VXTA 3ZYIA 3TN0C 3KPLB 5ANMB 4HUWA 1FORL 1PLGH 2GITB 5FK9B 4HU2A 3HJ0A 2ODIA 3Q2WA 3NUKA 3HPJB 1PZ5A 1EEYA 3ZT5A 4NP9A 4S2SB 1G7IA 1BBJA 3FYEB 1YEJH 4FTVE 2HUEA 4RMSA 3MLTB 1ZV9A 3GXIA 4P0DA 3FFOA 4UIKL 3G6JA 4YXKH 4PRHE 1XH0A 2IDCA 4AE1A 1OE3A 4P8QA 4HHWA 5CEZE 3DX8B 4DCQA 3QUYD 4ADGA 1HQRA 4MD4A 3UZQB 3AY4A 3G9VA 5DI8B 4ZXBC 4P4RA 1I9JH 4DKEL 2EE6A 3UTTA 4AENA 4GBXC 4ZNEE 2YPKB 2YGNA 4XP1H 1W15A 3BHBB 3IAQA 4X6EA 5DDHB 2XTJE 4ZAKD 2APVA 1I75A 4Y16C 3DDGA 2AJXL 3QE5A 3RAJH 3CHOA 3O9WD 3SKOA 3X13B 5BV7L 1DBKH 1I82A 3E7JA 2V6HA 3ZTEA 4D8PB 2Y36H 4XN2A 3PY9A 5I1LB 1I9EA 4B5EA 2IDSA 3QO0B 5L9DL 3LXCA 4G8GA 4EKJA 2N0MA 1QKZL 4NKOA 3FB6A 3P4OB 3HPLA 1PX8A 5L2KB 4KUZL 4H1LG 1LXMA 2H0EA 3GSXA 3HHRB 3X12B 5JYLA 4JDZA 5D7LB 1NEZG 1B6UA 4UOQA 3EJRA 2J3SA 3AQZA 4OLVL 1G7IB 5IW3A 2J1WA 4FZEL 5TDPA 5CR1A 3OD3A 5LGHH 5FB8A 5JQ6L 1JPTH 2XQBH 3US1A 4WFGD 2VN5A 3HBGA 3II2A 2W0PA 1DE4B 4J3WA 3CFEA 4N2DA 3GMMA 3IYLW 4P2QA 3B8SA 3BQUC 1UM6H 3C6LD 3KPTA 5GHWH 4XCCH 2DZEA 1MIEL 3WSQL 2HG5B 1M6OA 1IBGH 2DD8L 3JTSA 4TQPA 4G7VL 4RNRB 3G08B 3L3DA 4K5MA 2PXYB 3FB8A 1PL3A 4N0CD 2PYFA 2MIZA 2XZQH 5EEXA 1UD5A 2C1PB 4N6RB 3BVWA 4HLJA 2ATPB 2FWOB 4OCYL 1JRHI 2P8PA 4PJ8C 4PS3A 3GDCA 4HF5L 3T3PB 2F08A 4W9KC 1RIVL 1ZHKA 2B1HH 3DK0A 1SPDA 2C9RA 4GKNB 5B7EA 1NIAA 2ZKHH 2FIRT 4KQ3H 3EO0A 1FH2A 4G1EA 4H8WC 4FADA 1YNLH 4NKOB 4QHUB 1S9VA 4J3TA 4ZS7L 1L9TA 3EGXA 4LCWD 3VFMB 3AREB 2DI8A 4BZ1L 3S36H 1P4LB 2BRQA 2KZ1B 2ADJB 1XR8A 3H9HA 4AMKH 3ELQA 1ED3B 3RPIB 5CSGA 4ZZFA 3R0MA 3ARFC 1NGYB 1IIKA 5ITFB 4PS8A 3TPUB 4FQ1L 4LK4A 4H7VA 5TK4A 2ZYSA 2A74B 1TFPA 1T2JA 3UYPB 1II4E 4GXFA 1EZUA 3DX8A 4MDIB 4MXQD 2L7JA 5CEYB 3T2NL 4JAMA 2ZUTA 5D71L 2IPTH 2XQYG 2P42B 4G3YL 3HE7B 3EFDL 1XR9B 2QV2A 1N3NB 2X2UA 2W0LA 2KS0A 3WD5L 2WV3A 2IAMA 4AIZB 5BJTA 2R1XB 1U91A 4XO4A 4KK5C 4HIXL 4EO5A 5T1LB 1OSYA 3MV01 2R8SL 4NT6B 1R75A 2PUQT 3CTTA 4KOCA 5F21B 2KQMA 3OKDA 4JFFD 4IBTA 3KH4A 5E2VL 5EUOE 2R1YB 2R29A 3CXFA 1MQ8A 3BVVA 4TTDC 1CFSB 1TVBB 3BH8A 5BZXA 3TT1H 1KB5L 1SXCA 3WEMA 2R29L 1EAQA 2AJZB 2BHFA 1UB5A 2BVQA 2E4TA 2H4EA 3FN0L 3L3IB 4M5ZL 4Y9GA 4HMEA 5E1QA 3B3BA 2FWUA 2BS71 5DD1L 4CC4A 4U0RB 3WOVA 4AZ8B 2GFBB 4CKQA 2E9JA 5JXAH 1RD6A 1N70A 3LKOB 2WUBH 3Q3GB 1YEGH 3DROA 4NFBA 3I6LD 1H0DB 2IJ0C 3FCSA 2B0SH 2XJLA 1IGYA 2C5DC 2E47A 4XODA 2G30A 5HYQB 1GY1A 1YDPB 3DRQA 4DIXA 3KXFA 1IL1A 5GGQH 5T5NG 3WTVA 3NSXA 4H0LC 5H8DA 2D03L 4LSSL 2G5UA 4IIZA 1BD2B 5LNEA 3NFNA 4YL4A 4ZJ9A 3EG9B 3QQ9C 1A6TA 4QOKD 1S3KH 3VXMB 4RISL 4U6YB 5EZJA 4I0CC 3MA9H 5EF3A 4RH4A 3ARDC 2AEQL 3TV3L 3S8WA 2Y6SD 3EFOB 1PTZA 3HG1A 1KB5H 4G2AA 2XG4B 5AW6B 4EI5B 4G43A 1NGQL 4WO4B 5I1IL 3BUQA 3S97C 3ATAA 2HLEB 2X4OA 4BIKA 2UZIL 3KR3H 1J8SA 3BUIA 4XMWA 1QBLH 4JBSA 4UQCA 2Y1ZA 4G42A 2Y1AA 4G80B 1F45A 3LZFL 3BW9A 4UT6H 1KCUL 2WQUA 4NBZB 2LFGA 5IVXF 1OW0A 4M00A 1U4EA 1CR9H 1CI3M 4LPYA 4OUUB 4RMRA 3T8XA 3GB7B 2JCCE 3ZSTA 1VGEH 3MRMB 1KJMA 3E1F1 3Q1SL 1N0XH 1FN4A 1PYWA 4JUTA 5CJ5A 1DJYA 1F3RB 1OAQH 1W91A 1A4KA 4HIIA 2AJXH 3PQYA 4XVSL 1E5UI 1WC7B 4OZFA 1EO7A 3EGDA 4WTZG 4EUPG 1J0IA 2XVLA 1BGXH 2MCG1 3FQYA 3HC2A 3BKJH 3GSNH 2VH5H 1X5GA 3MRBA 1S3RA 4NQEE 5JHLA 3OG6B 1A14L 1WBYA 3QDGA 1J1XH 3V4PL 3WN6A 4N2AA 3GIVA 1L3NA 4HCIA 1IKFL 1KLFA 1UT1A 2OMUB 2X4OB 1KPUA 2YHGA 3ZE0F 5B8CC 2V9TA 3UAEA 3BD4A 2QSCH 5E9NA 3PG2A 3QDGB 5B38G 1BLIA 3OAYK 4DKFH 3D52A 1DVSA 3QH3A 5EOCJ 1ZK5A 3SJVA 1XHHA 1U92B 2C1OB 4X9HA 2AQRA 3TBYA 2M83A 3J07A 1MIEH 2Z91B 4GRWB 1VACB 4ZPTA 2YKLL 2X1WL 4QD2E 4PLKD 3D39E 1E4WL 5CZXC 1JI1A 5DMYA 1AGCB 3MRCB 4DTGL 4AZUA 4F1ZA 1MCQA 5BXFB 3QZWA 3DUUA 2C1OA 1BDYA 1OCZB 4U6XB 5LBGA 2N4IA 3FTSA 2JB5L 2HX7A 1I9IH 2MTAA 5JW3L 2QFPA 2OJZH 5AW7B 1T04A 1T1WB 4C83B 2PR4L 4DEPC 3N04A 4RAVB 4NEHB 4J4PD 4K55A 1FNGA 1QSEB 3OMAB 3OR6B 3S4SA 1HC1A 2CGRH 3F7VA 3LTVA 1R3HB 1U95A 3HKZA 1SHXA 3WDHA 3SBPA 3DIVA 1YPZF 2BOBB 3O9WC 2F0CA 2VSDA 5AW1B 4GJTB 4F8LA 3BKMH 2EICA 2AJVH 3PIQA 5C0DA 2DQ6A 1Q0YL 1R4XA 2BIPA 1AO7D 3FQXB 1JXGA 3AS0A 1GZPB 3QI9B 5FGBA 5JMOC 2BP8A 4F8OA 3SGKC 4QHLA 2ZKWA 5AG8A 2EDEA 3GQFA 2DEYX 2P5EA 1JTTA 3IFNH 4OCSH 2CR0A 5IEHA 5C0IB 1ZA6A 3NZHH 2YXVA 3VXTB 4HIJB 5DRWA 2N01B 3KVPA 4FQQB 4YMPA 2E7CA 2A6IB 3QUMH 1OZTG 2EDRA 2GJ6D 1IFRA 3SQRA 2R9HD 4DGIH 1QMUA 3MA9L 5H2BA 2G60L 3QI9D 3TBCA 4U0RC 1F58L 2OJ1A 4K5OA 1W8EA 2IGFH 3L7FB 3ARYA 1GZQB 3MREB 1N59B 1CLYL 1KIPA 1UA6L 2EZ0C 3R1GH 1C7TA 5I1LA 1FBIL 2W5PA 3BQVA 1W16A 2VXUH 4HFWA 4XNMB 4LVHC 3MUZ1 4CC4C 3WTTA 4Z0BH 4NAQA 1A02N 1JD7A 1JV5B 1SY6L 3LS5H 4DKDC 1GS6X 1SY6A 5FYJH 2WWMC 2Y5TB 4DPAX 3NFPA 1CUOA 5A2IH 1VPOL 1T4WA 1BJ1H 5LNGA 2LE9A 4XCEB 4R4BA 1LDPH 3BXNB 4LHUG 4KRMB 4FNSA 4NWUH 2PPCA 5LNDA 2QV4A 1WBXA 1QG3A 5I2IB 1IGJB 3LRHA 1U8QB 3ROOA 3O0RL 5T1DL 2NY5L 2CK2A 2F53B 4ACPA 1OAQL 4WKZA 4Z23A 1UM4H 3LSOB 4AV4A 4OD1H 3TNMB 3WO3B 1FL6B 1TYJA 2GJ6A 3MRFA 4L9DA 2E3VA 2AERT 4YLCA 4L2YA 1B4LA 4XVOA 1G6RA 3JZYA 4G1MB 1NCTA 4XNQB 2ID5A 3G08A 4L18A 1PF3A 4F2MA 2XZCH 4JVWA 4NCC2 5HGBA 2E76C 4TYUA 3ZDXB 3CHPA 3GEFA 3HI1B 2I9TB 1YQ2A 2B2XL 2FATH 5GS2H 2DQEH 1OWWA 4JKKA 2KZWA 1R3HA 1U95B 2QKSA 1T3FA 4M7LL 2NY6D 5MP6H 5AB1A 4MQXD 2Y3NA 3PYCA 4JHWH 3GSQB 3LH9A 1PG7X 3NFSH 5JUEH 2HMIC 1RK1B 5LKNA 3FBKA 4XX1G 2HWZH 5LN8A 5LGHL 5E7BA 1HYSC 5ANHA 5IMKB 1HL5A 5CMAA 1A21A 4HS8L 3HZYA 4MZRA 3BC9A 1N19A 1FNLA 2C1PA 4PJ8A 1UOKA 1QFOA 5EOQH 1BXXA 4AEIL 3K8KA 4DP7X 4I88A 4JCMA 3V4UH 1E2VA 3PWNA 1ET8A 4IRSB 4N2FA 1TYEB 5E6RB 4K0OA 5FYLH 4BD4A 4D9LL 2QSQA 1ZHKB 4HA1A 4PRAA 3UAJC 4PJDA 4N2IA 2VMDA 3TCXA 3IMVA 3L1FA 4X80L 3FJTA 1DVTA 1NGPL 3BE1H 5B21A 2F8OA 3V4LA 1QFUL 2DWXA 4MXQC 5JIDA 1LE9B 2HRGA 3EUUA 1G6VK 3MJ8A 3G5VB 3L2LA 3OJDA 5E0FA 4ZUUB 3UJTL 4OLUH 1UWEL 4OAWA 3TBVA 3HE7A 4AYID 1FSKC 4LLWA 1MY5A 2FJHB 4M3KB 4P2RE 4UNIA 4OZIE 2CGRL 3FQTA 3KPSE 4ENEC 1Y6KR 4RRPG 3FT4A 3MJ8B 4FOMA 5DFWH 2IOIA 2P43B 3SE8H 3TPUA 3LIUA 2FSDA 1BVKA 3DARA 1MG3C 1OD9A 5D93C 5H94A 4Y5XC 4JHWL 4RA3A 3QUML 4EE2A 1BFOB 1MIMH 2CLRB 4WI3A 3WNLA 3DX0A 4JY4A 5FM5M 3HG0A 4OZHE 1G9NH 4UQ2B 1E2WA 2WGXA 1A7BA 2VN3A 4PRHB 1CLYH 3R1GL 2D7PA 5DO8A 3SGJA 4GO6B 4NJAH 4PVNA 3BWZA 5HPMA 1BM3H 1NKGA 1JN6B 5D4JA 5SWZB 1PCSA 2AI0H 1WVZA 4QAMB 2LU4A 2NW2B 5EV7A 1F8TL 2VMCA 4N24A 5ISZB 1A1NB 1UB5B 1Y1UA 2BVQB 3DO3A 3KNBA 3A6CH 1FZOA 3OMIB 2FRGP 2XFXB 3UG5A 3OKKA 3QJQB 4OLZL 3MRKB 5D1QA 2Q3XA 5ITBL 2DKMA 3T0EA 8PAZA 4QRTB 4X6FA 2ZNXA 5EUKA 2P49B 3L5HA 3OKMA 2C9UA 2QLYA 3HI5L 3CMOL 4UQ3B 5D1XB 5BQ7B 4K94H 4PRPB 1UXMA 3HN8A 3GS4A 5IFJB 5FHAL 4GQQA 2RAMA 4UYQA 3PWPE 4L4VE 2FR4A 1WFJA 1M71B 43C9A 1A1MA 4HLZH 4OD1L 3UAJD 2EO7A 2IPUK 5D1XA 4XP9L 5F7BA 4XO8A 1V7NH 4MB1A 4P2AA 5DEFA 4JX0A 5I6OA 4YE4H 2ZNWA 3SYPA 2NZ9C 2LU7A 2J12B 4LF3B 4RWYL 5DHVB 4G6JH 5L7XH 3TN0A 4C54A 5F2FA 1YEGL 4K71C 5DK3A 5LG1A 5HYJB 1NSNL 3BD5A 2CO3A 1DR9A 3B2VL 3HVNA 4HT1L 1OTTD 2DN7A 1HHGB 2R69L 2V5TA 3K72B 3PAUA 2CO4A 3WN5B 1ND0A 2FEDD 2WJ5A 1IARB 3DV4B 1W72B 2FT7A 3VNYA 4CMMB 2EUZA 2P26A 2M8XA 4U3HA 5J13B 3GKWH 5LAXA 5SWSD 1E9PB 2Q9OA 2Y72A 1A6AA 4AYSA 3OKNB 5KSBA 3NJXA 3O3BB 1IM9A 5JDSA 3MRRA 3VYNA 1ND0B 1VENA 3DXAB 1I3UA 3WTXA 5AVTB 4LL1A 1KG0B 3OQ3B 1F4WH 3QNYB 3TYGH 2ZP8A 4FG4A 1F56A 3DYMA 4OM0H 4KKCC 4D7BA 4NO2B 4R7XA 5FM8A 5DC2A 1F4YL 2DIBA 3OAUL 3MLWH 2VDKL 2YA0A 3DK2A 2J1XA 5D72L 3WFCL 3E1ZA 2Z31A 3DA0A 4L4TB 1QATA 4NQVB 4UZSA 1E5CA 3LRSB 3O4OC 3HG4A 4XCYB 4I87A 2WO4A 1C7SA 1EUUA 1FF5A 3ESVF 4QXGH 4ECNA 4QRRA 3M1BB 4JDEB 2FEJA 1IV8A 3FH7A 1AQKH 3L3GB 1SDDA 2F7OA 1OGTA 2YD3A 4K2UL 3PWPD 1WLHA 4U3CA 4J3OG 2VW6A 4PJBA 1H3VA 2K7QA 3M1BA 4KZ0A 1NC2B 1N4XL 2Q7NA 1RHHA 3IPEA 1IC4H 2P5WE 4W9FC 3VH8B 2XV0A 3VW3L 4DZBA 2LU5A 1LP9A 3WXWL 1I9RH 4NQDE 4ZD3L 3D06A 4XAKE 4XXCA 5TFSL 1KOAA 1XCTA 4IMLB 1O6SB 3F04A 4HWBH 3GMOB 4KMTL 3STZA 4X99A 5KS9B 4ZQKB 2EXWC 4XOEA 1NDGA 1QBBA 3Q44A 1FFRA 4MCZA 3SDDB 3SY0B 3RKDC 4DNLA 5CWSB 3Q8AA 5CM1A 3CE1A 2OS7A 4FULA 4PGDA 4OM0L 1I1FB 1YNLL 5T1MB 4UNVA 1HH6B 1MHPH 2H41A 5H37G 5E8DL 4HEPG 3CZUB 4GNKB 4NNXA 5D7LD 3H2QA 1T5WB 4NFCA 3L5XL 4OLWL 1S7RA 2LQRA 3I50H 4OGAC 2VDRL 4ABQA 1E4HA 4BFFA 3EADA 2WBWB 3VGDA 1A1MB 4Q0XH 5FOBA 4A6YB 1FE8H 4UINL 4GT0A 3SY6A 1TSRA 4MSWB 3WMQA 3DECA 5KSBE 4QXTB 1VKXB 3F12A 5I71B 4F15B 5FGRA 2ALWA 1MCSA 3BGMA 1DCEA 1USQA 3FB8B 5MEQA 2FIKA 3FT3A 5FOBB 3FRUA 4PJBB 1KCLA 2CLVB 2R0KL 3BDBA 4AOFA 3IETB 3HMXH 1CE6B 3D4YA 4YX2L 2V5MA 2CSPA 4PAZA 1XD0A 5A2BA 1I9RL 3DMMD 4AYGA 2BOCA 1KIUB 2B7DT 4Z7NB 4HYTB 4RFNC 3Q7JA 5I8EA 4G6JL 3SPIA 5CF3A 1NFDB 2MTPA 4BEIA 1C9SA 3IFLL 4MQSB 1XF5A 3VUAA 5TH2A 5D7SH 1FVDA 3VGGA 1LK2B 2G3NA 5JPMB 2X40A 1KB9K 2KPNA 1RJZB 3U1PA 2RFXB 1O6TA 4BXVA 1JAEA 2HA1A 2DWYA 2BP3A 4D9QD 4PP1D 3EYFA 4FAAB 2Q8BH 4N1EA 1OP3H 3FQRB 4K7PH 2WXQA 2J56A 5E6IB 1U8HB 4KRPB 2PR9A 1N8ZB 4HJJH 4HDIA 4MMXA 4NDMA 1TTUA 1T1YB 2KC0A 3NGBB 3DSNB 2F74B 3LEVL 4YZWA 1OSPH 4PRIA 4ZDHB 4Y2DD 1F5WA 1QSEA 1IKNA 5T33L 4FNQA 5EDSA 3MLWL 3IM1A 2X6VA 3T8MA 3A3YB 4OF6A 3U0PB 2IF7A 4QXUH 5DUMH 5DEJA 3ZDXF 3KYNA 4LCVA 5SWZE 4A68A 1QTYT 4LPCA 1EIBA 3IAGC 1QFWH 2IADB 5KYXB 4X0NA 1MCNA 2VYRE 4ZI8A 1XH1A 4YHOL 5IEKB 5K39B 4R7LA 3H85A 1MFMA 2AQ3A 2ZUXA 3IFLH 2EE0A 1QW9A 3MCYA 5G55A 1AS6A 3V0JA 4KI5E 1CGTA 1OP4A 1SEBA 4NUPA 3WXWH 1D5ZA 3WU1A 2ZCLH 3EH3B 3KYOA 4ZMLA 1PGRB 4JFEA 2CJSA 4K8RH 3EAKA 2HJKB 4KVPA 5JPNB 3MUJA 5D70H 3HZVA 1P6AB 2ESVE 3OKKB 4TMPA 5D1QB 4CVXB 1OP5H 1CN4A 2ZUWA 2I24N 2VW7A 4YFLF 4E9YA 3T0DA 1RZKC 4I9WD 3QCUH 1CXKA 3PL6D 4XXWC 2CQVA 4YHKH 5IFHH 3I6GB 2YO3A 3GMQB 5EC2B 3AS2A 4ZS7H 4OQ1A 4L8SC 3BZ5A 4JGUA 1B2WL 4H20H 1FYTD 3LQAC 3G6DH 4P2RA 4BKTC 3Q05A 1CT8A 1OGAB 1VFBA 3LQMA 2H9GB 3VDBA 1BOGB 5C2BL 5EU6A 2JWYA 5IVXE 2DQFA 4LP8A 1EHKB 2MCAA 2HLFD 1WYJA 1MFDH 1TZGL 3S3BB 3RY6A 4WY7L 3QQ3A 2UWEE 5ADPL 3GO1L 3COOA 4N0FA 4YDVB 3H9YA 4HEME 3OZLA 4Y2NA 4O00A 5GGSB 2NNFA 2HT4C 2YC1A 1Z3RA 3BN3B 5JHLL 4PTTA 3V95A 3ISYA 5IW1B 3WKML 3VXSA 2ZP0T 3DVNA 3WLWC 4OLVH 5D6DC 2G0LA 3HNVH 3FQTB 4N9GB 4J39A 5HSFA 5JA9A 3U4EB 4K7FB 1XZ0A 2V2XA 4NZTL 4NXSA 1IGFH 5DTFB 2X38A 1SMOA 2KBGA 3KYMB 3TH2T 3H53A 1RHFA 1DTUA 3EJPA 4JZOA 4M7ZC 5IHUL 1AS7A 2BVTA 2ZX8A 3NQKA 1A4BA 4M02A 1TG8A 4LESA 3ZE0E 1AR2A 5EZJB 5I24A 5CSZB 1P84K 5AVXB 3FHEA 3V0EA 4LZKA 2ZTBA 5CINH 3IRZA 3GTNA 5AW0B 4U3XA 1IL1B 2DQIH 1N9PA 2DIAA 3CBRA 3FZUD 1KDJA 3BPOC 3FU7B 4IRJD 3N9GL 4UAHA 5FM4A 2ZOOA 4KKBD 2BSSA 1F3JA 5IBUB 4OGQC 5T33H 4GRLD 4B5ZA 4I0KA 2UX6A 1BYNA 5C0JB 3SKUD 4PJXF 3KXFE 4PGEA 3EZ8A 4XMKL 2IDUA 4HD5A 2GSGA 3LPOA 1K85A 1HIMH 3K6SA 2XUWA 3SPGA 3O81A 3UTPE 4Y8DC 4X5XA 4PGZA 2VDRH 1TQCB 2W0FB 5FHBL 4R2GC 2PW1A 4YDNA 4P46D 1KN2L 1MHEB 2VM9A 4KUCF 5KSAC 1JZ6A 4JY5L 4IEFA 3Q8FA 2VZ1A 3TJPA 1EHAA 1G0XA 4M43L 1S9KC 1JZDC 5I8CB 4HEMA 3GF8A 4CAGA 1CQKA 5IJVB 2YQ2A 2UUDH 3NIFE 2XTJD 4UT9A 4UT9H 3RVUD 1CDGA 4TUJA 3FTGA 4G70B 2VT0A 3Q13A 3QDMB 4OUUA 2V5SA 4H25B 3BRDA 1KCVL 1J8HA 1CICC 2IAMB 4AIZA 1GGTA 3CHQA 4WWID 3U0TA 2Z93A 3UYOD 4A7GA 4FI8A 2H9GA 5TK2A 4BK8A 1D9KD 1ZT4A 3HRZC 4H8PA 5DJCB 2JB6B 1RSFA 1QRNE 4QCIB 2EDHA 5IWLC 3GYRA 2NZ9D 1KB5A 4JFQA 4DQOL 4ZRGA 4RMTA 3L3IA 5C09D 4AT6A 3QZBA 4JFED 2JB6A 3RURA 1ZGLA 1C1EH 2I9LA 2ZQKA 3QDME 3EH4B 1JF1B 2XX0A 4HK0B 2LT9A 4ODWA 2EH8L 5H35B 1CE1L 3QXUA 5D1ZD 3GO1H 3C6LC 3MZGB 3NSJA 1SZNA 1UEMA 4XHJC 3WIAA 3BP5A 3BLPX 4ORGB 1JPFA 4KV5E 2JKLA 2WTRA 2VWEE 2R1WB 4UYPA 4YH6A 5CD5D 2KPWA 2CBTA 5DTFA 4G7VH 4P46C 4DP9X 2N56A 5F1SA 1KBKA 4XNDA 2X4SB 2FUTA 4F8NA 2VDLB 2KMWA 2J5LC 4ZSOE 2ARJA 2WAHA 5IESH 3EHBC 4N0UB 5TFSH 3TIEA 3CCHB 1NCWL 4HUCA 2CBQA 4HJGA 4JRYD 2BIHA 4EDXB 2TSAA 1L9MA 1RHHB 4X7EC 5I66B 1N59A 4B9CA 1K6QH 2W65A 3O2WL 4F5CA 2O61B 1L7TL 1P9MC 5JHAA 3DKHA 3T2NH 4NS0A 2HRPH 2J25A 4RFOL 1AQHA 4M8QA 1P6WA 4YDLC 4F3FA 1AGEB 5K9OB 4OZFB 3ZDYB 1HX0A 1RERA 1QTPA 4NZJA 4CNIA 1AG6A 1QR1A 1A6WH 1PZSA 1ZJBA 3BWUC 4WI7A 5E00B 4QT5A 1AYOA 1U8IB 4FQ2H 3W9EB 4DN4L 1KTCA 1DL7H 3ILPB 3TXAA 2EDNA 1JK9B 1FFOA 5JW5B 1QHQA 1BEYL 1Z66A 3OJVC 3Q8BA 2AXFB 4PJFE 4YR6B 4MBRA 4L4JA 3UTQA 4QGTA 2VDQL 1P0SE 2OSXA 4MQ7A 2W9DH 1MHEA 1T1ZB 3FN0H 3WY3A 3G5XA 3H3KA 2DMCA 1G7QB 4LU5L 1QRNA 2VZUA 2BLFA 2AI0L 2QDWA 2BNQD 3WGUB 3QPXH 4BBWA 1KCRL 2EKSB 3B9KA 5C2BH 5JW4R 3BGMB 2G5BB 1L9QA 2D3NA 3G6AB 2YPLE 3VFNB 4YSEA 3GMMB 4R4ND 1I1AC 3WIHH 4X6EB 5E6ZA 1NL0L 4JDVA 3PABA 5KUMA 1U36A 3QJHB 1ERNA 1P5UA 2B9BA 4IRJA 4Z7WA 1WGVA 4PS4H 4O2EB 1DLHB 3BP7B 2QTVA 3D9AL 2ITDB 3HRZB 5I1HH 5EF2A 4HKJB 1TR7A 1CZ8H 3S6CA 1TZHA 2BHYA 3UDWA 1URLA 1IQWH 1NFIB 1RJLA 3D0LA 4PLJD 5E9DB 1F2QA 3TF4A 4RZCA 1V7NL 5C0FA 1AGFB 3V6FB 4DGVH 2R2CA 1KEGH 3EO0B 5IQNA 5L7XL 4S2SA 2B0SL 1G0DA 4B9JA 4Z7QE 3C9NB 5AEAA 3VG0H 5LCVA 4K15A 5CCJA 3B2VH 2A6DB 1BXUA 1L9PA 2MPAL 3DHPA 5FLUA 3MV8E 3F5WA 3QH3B 1SXSA 1SGKA 4B97A 3AZUA 3H3PL 2Z7UA 3K2UH 4NM8H 5I0WA 1X4XA 4MNHB 2X4QA 4DQOH 3A47A 3F7RA 4JFOB 2DKSA 2JSFA 1RP8A 5AAPA 5C3IA 1EHLH 4IK7A 4LPXA 2WP3O 3MRQA 3BP6B 2XN9D 3CU1A 2H3XC 1E43A 2HG5A 4PCTA 3B5GA 4F33B 5EF1A 4ONFL 4ES9A 1EJ6A 3PQYD 1D5XB 1RJZA 4OW6A 4GG8B 2A73B 3VTMA 2OSLB 2EIJB 1KBPA 3T0AA 1ZAGA 3CXDL 4ABVA 1UFUA 1R3JA 2EVJA 2DIJA 3CFEB 3JWOC 2JKIS 3MC0A 1A9EB 4FXKA 2X42A 5E8EA 2AV7A 3D25A 2IIJA 3HMWL 4S1RH 5C3TA 2NSXA 3TEUA 2CCWA 5AALA 4HIEB 1BFOA 1J12A 1RZJH 3KR3L 1N67A 4NZFA 1FL3B 1KPVA 1T22B 3RTQB 3BJ91 2GTWB 3S88L 1TTCA 4NPYB 3X11A 4TLTA 3MTRA 3VWJA 5PCYA 4FN0A 3VFTA 2XZCL 3BT2H 5IUCA 4PJHE 3OZ9H 3QXTA 4FQPA 1CWVA 4F92B 1TUPA 1PZUB 3EXJA 1OT2A 5E2JA 5EUOF 5DJ2B 2CMRH 3QFJD 2AK1H 4LLWB 2GG1A 3SDDA 5KEZA 2FT6A 4NCDA 3L54A 3QHZL 4KVCH 4P57A 1NGXA 1YUHA 3JYCA 5KYWB 1UD3A 1BAFH 3E2HB 1ZLSH 4NENB 1NIEA 4PJCE 3HN5A 2WM0A 2ZXDA 3KPPA 1GGCL 1N18A 5E6IA 2J88H 4M56A 4WHTA 2ZKHL 3GSNA 3S3SA 3SPVB 5I6XB 2LLNA 2WUCH 4YHOH 5DXWA 4AEIH 2CJTA 3WFHA 3BEWB 1I8IA 2NLJA 4HOWA 4M29A 2WWKT 5B4MD 3MBEB 1UA6H 3FQWB 1ZPLA 1XMWA 3GNML 5GS0C 3IU4L 35C8H 3M88A 4EN3D 2FYVA 4HMCA 1UD2A 4J5VA 1KDIA 4P3CH 4P07A 3VFUB 2A6JA 3LQZA 2GVYA 1QA9B 4HSCX 3LS5L 4NQCE 4KI5D 4PW3A 5KVDH 4HBCL 1QFPA 4N28A 1B0RB 2A7BA 5BV7B 5CEXB 4E9WA 3LZFH 3UBXB 1UWFA 2EDBA 3ZXAC 1UM6L 1H8SA 4XVTL 2DJSA 2QPDB 3EFDH 1ZLUK 3U2SB 2K3TA 3MRKA 4E41B 3GXTA 3QT2A 3QXWA 2UYLA 3T6QC 4QRPA 4I48A 3FCTA 3MNWB 1T0NA 2X4QB 1MCIA 3UZVA 4PJ8B 5A2CA 2WNKA 1S5HB 2OMTA 5CZXD 2JKTM 5CILL 2OJEA 4FQJH 5KYWA 1MIML 1NBVL 2A4CA 2VQ1B 2V4LA 3W39A 4NO2A 3CVHA 3QC5X 4WGVB 2QGDA 2J73A 2Z4TA 3RPIA 4GAFB 5E5MA 3AREC 4JY6A 4YPGB 3ULVF 3SCMD 1RH8A 5C0NC 3MV7D 1EFXA 1OCOB 4YN3A 4GUPB 4K5LA 4LHUD 4NQVA 3SGJC 3L5WB 3RWIA 1EHLL 5HGGS 4PGJA 4TNEA 4RQQA 3DX3A 5E5MB 5LGKA 2J44A 4ONFH 3M7OA 3QJSB 1KEGL 3FT4B 3QIBC 2HVKA 4PWHA 1N6UA 2NY0C 1EVUA 3F83A 2IXQB 2X70A 43C9B 4F7CB 2OMXA 3PDDA 5LG6A 1D7FA 3R8QA 3L3KB 3SQBB 3VDAA 2G3MA 3BIKB 4E9SA 2IXQA 2X70B 1MEXL 1KXTB 3HS9A 4RGMB 4AQAB 3S2CA 3KPRE 4UBDC 2OULB 1DHKA 4AVHA 4RGMC 5DURD 5I1KH 1RZ8A 1R9FA 4ISVB 2E9GA 2BFGA 4JO3L 3KLAB 1RULH 2OMTB 4MLIA 3MR9A 4GSQA 1F18A 5KVEL 3QJOA 3CSYA 4H26A 3RNKB 4GG6B 4AYEC 4Z7VB 1HEJC 2CRZA 3AU1A 4V2BA 3WKQA 1NEUA 2Q86B 3N9GH 4PS4L 1SQ2N 4P2YA 3ETTA 4Z77A 4S0HA 3X1BA 1EZLA 1VFAA 3I3BA 3RVTD 2XVBA 1U3NA 4A38A 3U2IA 2R59A 4PCYA 4UMSA 2VDNB 1S7TB 3ARWA 2OBGA 4ZS6D 5CGYD 4AQOA 2I7SA 1HH9A 1NDMB 4GRWH 2EH8H 4PRPA 3H7LA 3SODB 1W2KT 4WHYG 1NUDA 2XN1A 4J12A 1JWMA 5IB4A 1R5WB 3O4OB 5DYOA 1R24A 5DSCA 2Y6SC 1KZYA 1UYWL 3NAAL 1SLUA 4NKDB 3FK3A 3OJMB 3QP3A 5D6CA 2XA3A 3AW5A 4MFHA 1IBYA 5T3ZH 5FO8A 1WICA 4J28A 2OYPA 3APDA 3WFDL 1QLFB 3V6FA 5JW4N 1JN6A 2EECA 2IFFH 4M93B 4JCWA 3UEQA 4NHCL 3QNZB 2A6DA 3AQXA 3CVIL 5CFAA 3ZRFC 4KK9D 4B9FA 3WDIA 4Z7UB 3GC3A 4W4OA 3B7SA 4WU5A 1M7XA 3IDJA 4H8QA 4RFOH 2DYPD 4XZ4A 4AQ1B 4HK0A 4NOFA 2OXGB 5D96C 1HCVA 3O3DA 3VFSB 1KC5H 2IDFA 4F37K 1IM9B 1BQHG 3FCBA 1BVNP 2DQUL 4DT2A 1E9OB 1V8HA 4I2XE 1EXHA 3EJZC 4HQQL 1MCFA 1S8DA 1Z5YD 2E7HA 3WLBA 2UWEB 2VXQA 1RY7B 3RWCB 3MV8A 4Q14A 5DI8A 2EP6A 4PD4K 3FSAA 3O11A 4W9IC 5EBLB 3R7QA 1Y6MR 2F54E 2UY6B 3HG3A 3ULVH 4A7VA 3KCPA 3U6RA 4JZJB 4U1HB 2CA4A 2RMNA 1A5FL 2DYSB 2Z7YA 3DLQR 3MCLL 1QFUH 3W5MA 3UGUA 3WAKA 2BVOA 1GAFH 3KPSA 4JFZH 2CGYA 3VRIA 3EDJA 1NAKL 3MOQA 1BBJB 1N7MH 2H1XA 2ZSWB 2P5ED 5EIIB 5EIIG 3NJHA 2FGZA 4TVUA 5LQBH 1CPUA 4AKQA 1WFNA 3FQ2A 3QUYC 3QISA 4QHNB 1FLRL 5HHXH 4I3SL 5BVJB 3VM5A 1MW1A 4FMKA 2X3BA 1T1XA 1R3LB 5E0QA 4PWKA 3FOMB 2VDKH 3KL3A 3P9LB 4OD3L 2YBGA 4JFPA 4AJYV 4YX2H 2BWQA 2LAAA 4NZUH 2YD5A 5A3IC 4IRJB 3PWUA 3AGVA 1I3GH 3QIUC 5IMMA 3SDAD 4A63A 3F7VB 2HAZA 3MNZB 1HSAB 3RWHB 2C3HA 1MFEH 2F54B 1YNKH 3O6LH 5CEYA 4XAWL 1GSKA 3FQ1A 2Q20A 3ARBA 5D1ZC 4JY5H 4ZQTA 4OLZH 1MVYA 3C2SA 3RJDA 1MUJB 4IIQB 1J1PL 2K6YA 2ATKA 1YYML 1EHNA 3VYOA 5ICZA 4M43H 4HS8H 4NJAL 2A4EA 2R29H 2VLLB 3QIWA 1UQSB 1UWGH 1TKWA 3ZIMA 4IKNA 3QCTH 3GJFB 3F6LA 1T1WA 1OANA 1QD0A 4C83A 3QEQE 1NCBL 3IWVA 2WQRA 4Q97A 3WUZA 1I4FA 2IPKA 1M2VB 1U8QA 1SXBA 5CMAB 3NN8A 5BRZE 4GRWF 3NG5A 5KBPA 5ESVA 3QHFL 1JK9A 4AQEB 2FL5B 2QADD 2DTMH 2LLGA 4LVOC 5H35A 2JI1A 4Q9RH 2CO7B 4ZZKA 4N87A 2CPCA 1VGKA 4MQ7B 1P5UC 3IE9A 3EDEA 2ZXEB 4Z8FL 5E1GA 4NKMB 3SE8L 3GIZH 3IS0X 4R5TA 2IANE 4G5ZL 1KF9B 3ZGHA 3ZBMA 2TRHA 4O2FA 4XWGL 1LMKA 3KPQA 3WG7B 3P30L 1RAMA 4WJG3 4J4PA 3IJYB 2YQ3A 4YBQC 3SGDH 1F4HA 3DYOA 3AM8A 3I75A 4HOMA 4BK5C 1LDPL 2ENPA 5C0BE 1JVLA 1M6UA 1O5PA 2VLKD 4M1GH 2ED6A 1QO3A 1ZIBA 4PJCA 1EO8H 3DC0A 5IVZA 3HR6A 3SHSA 1JL8A 2X41A 4HKXA 3F7YA 1RZIA 5EOCL 1JTPA 3WDJA 4YVUA 4WEUD 1MI5E 4U2ZA 2YN5A 1TO4A 1ZWIB 2V2TB 1RULL 1OGAA 5KSBF 5J06A 4QRAA 2E7LA 1F4WL 1R5IA 1KCUH 2VSKB 3ZKQD 2HPTA 2WVVB 4F2EA 2JKSA 5D9SB 3PQYE 4WO4D 3WNIA 4PWEA 4P9HC 1LEGA 3K6SB 3EOBA 2H3NA 3VW3H 2OSYA 2Y6TE 5C86A 3RYMA 4PJEB 4UQAA 5CZKA 2FEEI 2QMKA 4XRCB 1VEMA 1OE2A 1DL7L 2AK4D 1JDAA 1U8KA 3D85D 3CZNA 1GIGL 1DVFA 4UUJB 2QKIB 4CADA 2PWEA 1V3MA 4Z78B 5CSZA 4I5BA 1XGZA 4MB3A 4NO3B 2ADJA 3A4DA 3H9HB 4RMVA 3UMTA 2A6IA 1JZ2A 1MNNA 2X4TB 4PJ7B 4MVBD 3VA2C 3V6BR 1WJ3A 1IB5A 2VQTA 5ESQA 3C6LB 15C8H 1PKQE 2BY2A 3I3DA 3RGVC 4AEHH 4OF8A 5CLXA 2DS4A 5AOKA 2Y7MA 1I8MA 5C7XL 3FTXA 3LEXB 5IVZB 1FIGL 3CK0H 2GI7A 2HN7A 4OLYL 3SKJH 3KJ4C 3EJCA 4MKMA 1H6UA 4OKVB 3WBDA 1MFNA 1X5ZA 1DBKL 2WBJD 3JXAA 4OGZA 2CWRA 1FGVH 5CJXC 4U1SA 4AYFB 2HMID 4LIQE 3U9PL 3GSOA 5L2KD 1Z9MA 1OPOA 2WXOA 1UWGL 1W6LA 1CGUA 3QVAA 4X5RA 2OMUA 2W07A 2WCSA 3AWGA 2R2HA 2W9EH 3FSWA 3FCSB 1F41A 1XGUA 1I7TB 1EBPA 4G9FB 1E8ZA 4RZKA 5AW5B 3BAWA 3BPCB 3DETC 4G42B 4Y5YB 3ASOB 5JTWA 1QHPA 3AY2A 1MFEL 3WO4B 5FIEA 4EVNB 1UOVA 3FO1A 1FUNA 4OBRA 5JPNA 4L8SB 4FCAA 2ENSA 4DP4X 4Y8AA 4DFHA 2FYYB 3GGWA 4G72B 2MJWA 4LSDA 1Q4NX 4MAYC 3OPUA 1JV2B 1J5CA 1VDGA 1F11B 1U91B 2E6QA 1UCTA 2F7QA 4JS7A 1NGWA 3V7AG 4ZMAT 1KJVB 5J8OA 2R0LL 3D3VA 4RNRA 1YA5A 1MVUB 2BW4A 4HCFA 4X6DF 4G9FD 4NQDB 4MDJB 1NZRA 4EI5A 3P54A 4RMWA 5CCKL 5DQDH 2YZ8A 4PG2A 4U1KA 1ZLVK 3RUGE 1CICB 2IAMC 2C3GA 1WITA 2EEAA 3X3FL 4HZLB 4TUOA 5F7AA 1JF1A 3DOSB 3H9SA 5BPPA 5FPIA 4Q52A 4IOSA 4NQTA 4BGDA 1D7CA 4L29A 1TENA 4R9HA 4A2GA 1CQYA 2J72A 5EU7E 3MJ7B 4I77H 1PLAA 2PCXA 4IOFD 1A8ZA 1ZXKA 5DS8A 5DJAB 4WWKC 4XNUL 1X9RA 4ES8A 4M61A 2VDLH 4R2GB 5M95B 2B4CH 1DVYA 1IAIM 1SJMA 4PJHB 1PLBA 3EJYD 1FE8L 5CN3A 4ICXA 1T1XB 2R4RH 2XWTA 3QDMA 3IRCA 5C08D 1ORSA 3EYVB 2E46A 1MI5D 1E40A 3DX9B 2R69H 3D4CA 5C6TH 2WLIA 2QFRA 4W4NA 3NCYP 5DJXB 4E9XA 3CSYB 4H26B 3RNKA 1I8LC 2IPTL 4OFKA 5AD0A 3Q48A 3KLQA 3QEGL 1YLBB 2MNWA 2OMZA 2PF6A 4BH8B 5CINL 4MD4B 3UZQA 3P0VL 4TNWK 3ZOAA 1JXKA 5KVEE 2K45A 4X9IA 1KWKA 4APXA 1G9NC 2GBVA 2DWSA 2WUCL 4E42B 4LAQH 3FT0A 4Y4FD 4XN4A 2O5NA 2L7EA 2NQDA 4P9ML 4JN2A 4KRLB 4EN3B 1JFQL 3H0TA 4GSDL 1T0PB 1QEXA 1WA2X 1FIGH 3CK0L 2AQSA 2VM4A 4OLYH 3VXSD 5DZAA 5CBAB 5GS1C 1TJGL 4PJEF 4JN2B 4WSKA 1A1OB 3QA3B 4QXGL 5DD1H 5F96L 3LX9A 1XXDC 4LOEA 1Z5HA 1A7RL 1XF5B 2FECI 4NRYA 4KNTA 5JXAL 2OW6A 3RL2A 5G5DB 4F5CE 3KNBB 1PS3A 4MAYD 1U42A 2A9NL 5DEGB 1ADQA 4CSSA 4G7RB 3ARSA 3QORA 1KGCE 4PJ5B 2QQLH 1NGZA 3SO5A 3CFJA 2EC8A 2JVUA 4A6YA 3DJZA 5A43C 3NJLA 1AR1B 2UWEA 5KG9B 4L3CB 5CJQL 2CMRL 4FFWC 3BIAX 3VCLB 4B3VA 4UT9L 1Q0EA 5I1JL 1ONQB 3MOBL 5MEQB 1X5IA 2IDTA 1X5FA 1JCVA 2HCZX 1AKJB 4FTVB 1ZLVH 2H2PC 2AZUA 3PFQA 3PL6A 4F7EB 1JBJA 1HWGB 3NP3A 4AENB 4RISH 4N0YL 2HKAA 4GAYA 2DLFH 4P9HH 4MA8L 1O7DC 2V9RA 4PMEA 4ALAH 1D5MA 2ATPA 2FWOA 4PJDE 3V0AC 2X3AA 3L3GA 2CHNA 3TS8A 2CKBH 2CM5A 4AK1A 3QRGH 5KBNC 4ZO7A 4QHNA 3NBNA 4XP6H 2HVJB 4Y2DC 2GBAA 2F1EA 3UJTH 4LPTA 4FMFA 1ODAA 2XXCB 5DZPA 3MLYH 1JP5A 2UZYB 5E8PB 2N59A 5EZLB 1OL0A 1P1VA 4WSJA 2BVOB 3KPSB 3VFVB 1H5BB 2XN9B 1IKNC 4JG0H 3GBDA 4FEMA 1I3VA 3CLWA 3QIUD 2FJGA 1QLRA 5CN1A 1NANH 3ULVL 1IVTA 5EA0H 3MROB 3WMPA 4NIYE 2VN4A 2P5WB 4IJ3B 5T3XE 1K5NB 4HUXA 1M9WA 3F12B 3FF8A 3KLKA 1HL9A 3S5ZA 2AJUH 3QW9A 3HCVA 4P4KB 3OGCB 1C5DA 4WCYH 4FLQA 2K9UA 4KKLD 3ETBF 4QRUB 5CD3B 4W1TA 3BEVA 5EBMA 4Q9RL 1S7RB 2Y2YA 4POYA 1CBVH 2JCCF 3DMMC 1FL5B 3KGUA 5JOEA 4P9HL 3ZRCC 5C6TL 1FLTX 2RALA 4PLJC 5JHLH 4PJ5D 4M9PA 2AQPA 5T1LA 3FCUB 5TF1L 3R4DA 4OJDH 4KJQD 5HDBF 2QR0A 2G2PA 4MASA 3QUZC 2VAJA 5F9OH 3ULSB 3W2DL 4BFIA 1RJYB 4HJJL 1YNKL 1D6EA 2F7IA 1OAYH 4WVRA 3NJVA 3WFZA 4FS0A 1M05A 5T1KB 4FQ1H 3GXDA 2VR5A 4H4NA 1NCNA 1AC6A 3VWKD 2JKNA 3HBPA 4GKLA 4JFHD 2YWYA 2C9QA 2FJGB 4XWOC 1N0LB 1XF3B 1Q9OA 3EW3B 4L1HA 5F44A 4G3YH 1AO7B 1IGJA 1LO3H 5BZWA 3IGUA 3LKSA 4IS6A 4YHNA 4QRPD 5ID1A 1M1XB 5FFLA 4Y4KC 3W81A 3JTTA 2ZIDA 2OJZL 3KD4A 5MEOA 4PGBA 1NGWB 1CJYA 5F7EH 5A2KH 5TTRA 5EBMB 1ZV5A 3CMGA 4I0PA 2ZUYA 1BG9A 4NLHA 3W5NA 1INQA 1EFQA 3M7FB 2EH7L 1E27B 4JFEE 3V9FA 1NBZB 4HJIA 3OLEA 4FRWA 4R3SA 1JK8A 3RJOA 1IQWL 3Q9QA 4FI7A 5F9JA 4B9PA 2GJJA 3UBHA 3PWVB 1TEFA 5E1IA 1NC4B 4K5NA 1T03H 4KH2A 1VA9A 4B9KC 2NYZA 2WB1A 4PRHA 5HHMD 2PWHA 1GW0A 3NCWA 3FYIB 2PYEE 1BQKA 4Q6IC 1FL6A 3ESUF 4BSVB 4E0RB 3L81A 3QDGD 3FT9A 4UOW0 3TA4D 3V0VA 2CM6A 1QRKA 4AVIA 4U1NA 5JHDD 1IBZA 3DX7A 5F0JB 3MOBH 3DXAA 3TNNB 2WYHA 1AZRA 1WCBA 3K6OA 4ONOA 3WEBA 4NQXB 3BGAA 4WI8A 1KPRA 4HOZA