3HG0A

Crystal structure of a darpin in complex with orf49 from lactococcal phage tp901-1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
137
Chain Sequence
b'GNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPIDHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baseplate protein
publication title Crystal structure and function of a DARPin neutralizing inhibitor of lactococcal phage TP901-1: comparison of DARPin and camelid VHH binding mode.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Protein binding
total genus 23
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hg0A01
2BSDA 3DA0A 4HEMA 1ZRUA 4IOSA 3HG0A 3D8MA 2F0CA 4HEPA 3EJCA 2WZPA 2BSEA 3U6XA 2X53A
chains in the Genus database with same CATH superfamily
3DX7A 2GIMA 3TPUB 3ISWA 3BFWA 1ROCA 2NUPB 3RIKA 5CHNB 4AV5A 4POUB 3O3EB 5EZOH 1FGNH 2H3NB 2Z64C 4NXKA 3EJYC 4ODHH 3C5SA 4P48A 4PJ9A 2NLJB 4EI5A 3L3HB 1I1AA 5BV7H 4P2CG 1NIAA 3ARGA 1DQDL 3CIQA 4M7ZB 1MFBL 3HC4H 1JDCA 5DLLA 1DVFA 1MCOH 2KUTA 3MRRA 4MFHA 1K4DA 1VACB 3WNLA 5B21A 2ZJSL 4JFYA 1SVZA 2BNQD 5GGUA 2AJVH 1L9QA 1A9VA 5FV1L 3VX1A 1JD9A 2V9UA 1TCRB 3MLWL 1IGJB 1WAEA 4HEPG 5FUOH 2ZICA 1KPVA 4QRTA 1C9SA 3WTXA 3V5HB 4L37B 4FLSA 5GZNA 4CADB 2Y1VA 1SXCA 1UWXH 2AV1A 2YLHA 4GBXB 1I4FB 3IK2A 1YMMD 3GI8L 5FW7A 4F7MB 1EUUA 2VH5H 5EBWA 1MVYA 3MUGA 2HFEA 1N6VA 4DIXA 4X6DA 3KDMA 1GZPB 1PLGL 2MHAA 3L54A 5CLZA 5F71A 3BPOC 3D0VA 5DRNA 5D7SL 3HI5H 1XB8A 5K9OA 3HI1B 2H6UA 4PR5B 3GKWL 2O1AA 2YAHA 5JHLH 3WEOA 5FCUH 4RAUA 3TX4A 2DD8H 5E8NB 5CINH 5AQ0A 5E03A 3IXAA 2WJ5A 3A23A 4UQDA 1TZHB 3FOMA 5KS9F 4N20A 5I71C 1YNLH 1OT2A 2BSED 1EBAA 2YGVA 3EH5B 4BKLB 2HJFB 4OGXH 1DQJA 1E5YA 1OSPH 2OTWB 1HCFX 5GRWA 2A38A 3H3PH 3FF8A 4IMKA 1F1GA 3O8XA 4KKRA 3JV4B 4ZFGL 3CGTA 3WIHA 2YPVA 2H2PD 1JHKH 3WXWL 3CZFB 2P9RA 3S35X 1JZ2A 3SDAD 2O5XH 3QI9D 3UTOA 1KCUH 2DW5A 1A7RL 1BJ1J 4LLYB 4UDTB 3PWJB 1YC7A 4MNQE 1K6QH 4LEBA 5E2WL 3T3MB 2ESVD 2Q8BH 4N2MA 1E9QA 5EIIB 2B14A 2CO6A 1NLDH 2EYSB 4PGEB 3I3DA 4HLJA 4X4ME 3UO1L 5IJKC 2ZYHA 5E9DE 2Y1AA 2ZX7A 4WU7A 3TN0C 1EFQA 1MHCA 4OB5H 3GMPA 4ZPTB 4HA1A 5A3IC 5I73C 3EYVB 1TZIA 1OE3A 2QR0A 1R34A 4UM8A 1WZMA 3BAXA 4GS7C 4PJHA 2W65A 3HC3L 5IWLA 4E5XA 2AXGB 5DHYA 3ZRFC 2ED6A 3MLSH 1EUTA 2P26A 1VIWA 3VWJB 1HEZA 2KQMA 2X4SB 4V1DA 4ELMA 3QJFB 4JZJB 1WTGT 3KPPA 3MNWA 3GRWL 4XNXH 5IKCB 4IRSD 4LCWB 1P4LA 1MVFA 3GNML 4CU7A 5ACZB 1IKFH 5CFAA 5FGCE 1Y1DA 1T5WA 2PPEA 4OLVL 5C07B 4S1QL 3MRFA 3VACA 2WV3A 4JG0H 3AMKA 3U6XS 5KANG 1KGUA 2NY1D 3Q5TA 5DVOA 3QRLA 2GCYB 2HZHA 2EDYA 2QLVB 2ZCLL 1KN2H 5FXCH 3STBA 3OAYH 5F7UA 4L4VE 1YQVL 5CJXA 5JHAA 2R2HA 4U49A 3VFGL 4TVPL 1ITCA 4MDIB 1DVQA 1S7QA 4Y0GA 3UGUA 4XMLH 3MV11 4IIQC 5GGVL 2C4XA 2FJUB 1YEDA 5IEKA 4KI1A 1S7VA 2RFXB 2EE3A 2ZF9A 4LPCA 5IBUG 3D2UA 3C5ZB 4P9HC 3GJEB 5DT1H 5F1IA 5HYEA 4YFDB 3Q2LA 2F53A 1RUQL 5AKRA 1IGFL 4YK4B 3T3MF 2VDLH 4BJLA 2C7UA 1K3ZA 2CDEA 1HINL 1IILE 4BRVA 3WTUA 2F8XC 2Y72A 3WYRA 4APQA 1KPRA 4FGMA 2Y6TE 4A7GA 2VQ1B 2WLNA 5HVHC 1LEIB 5I5JA 2GFBA 2IALA 2OMBA 3K0WA 5C0BD 1BVNT 2YC1B 3A4EA 1DBAL 1J8HB 1LE9B 4GFTB 1EZUA 2FIKB 2VT0A 1TVBA 4NKQB 3T4YB 2YPLB 3S3SA 1AJ7H 2BSBA 5C97A 3ATEA 4PG2A 1U8MA 1X5MA 3UYOD 3MRNB 2GEQA 3NFNB 3CVHB 1QOKA 2AXFA 4UOZA 1NCWL 1YY9C 1JI1A 3ARXA 1UENA 1BOYA 1SUHA 1MJ8L 3QJXA 3GB7B 3DJSA 1ZHBA 1E3XA 3F5WB 4PHXA 4RFOL 2NW3A 4NEHB 4PRAA 1JE6A 5HHOD 4Z78B 3UBXA 2QLYA 1RUKL 3KLHD 3RHWF 1OSEA 3MRIB 3QYNA 3CVIL 2NY4B 3GHEL 3HLKA 3QUXA 4HIIB 4U2YA 4Z7OB 4GG8B 2AK4D 4HHWA 3K81A 4U3XA 3ULUC 3E6HA 3L3DA 2UY7B 1ONQB 3EO9H 2DIJA 1LWRA 3AGWA 3ML9A 1I3VA 3DJ9A 3ROOB 2ZWSA 3IFNL 4HPOL 4NNPL 1OP3H 5H2BB 1JP5A 4UNTA 1OV8A 5HSFA 1JXJA 4I4WB 5GGSY 4C8XA 1KC5H 2DKSA 1ZOXA 3DO4A 1MY7A 1NEZG 2QADD 3BP6A 1OF2B 4M48L 1A4KB 4NM4L 1KUMA 4WVRA 5GJSL 5EFIB 1IGML 1ZIBA 1A25A 1PQZA 3L4UA 3MLTA 4L4TA 4PS3A 2UV3A 4QHKJ 2FH8A 4AZ8B 5JUEH 1J9TA 1CICB 2EAEA 1IFRA 2JNZA 3GBNH 5EF3A 3KG5A 1I8LA 2CKNA 1KTRL 4P2RD 2QGBA 3UC0L 2R29L 4U6XA 4ODXA 4JX0A 2NXZD 2ZPKH 1UA3A 2DF3A 2WANA 3PHOB 4YHPA 2HTLC 5FYLD 3SBWA 3FQWB 3X12A 1U21A 1H3VA 5GHWL 1BYNA 4TMPA 2LE9A 3V0EA 3B5GA 1W91A 2RMNA 1WCBA 1BVZA 3MXVL 3X3GH 2ZYIA 2Y1ZA 3C6LC 4OZFB 4V2BA 4N0UE 2CR0A 2OI9B 3CBKB 1U8NA 3TBYB 3SE4C 1HKLH 4LPVA 2K45A 4QY8B 2FJHB 3BP7B 1BIIA 3POHA 4ONGL 3TH4T 3SE6A 1A6WL 3WJLC 4LCCA 4JZNA 2C8NA 1MCDA 4LPXA 3CDGB 2CPUA 4FEMA 3T8XA 2XWBB 3LQZB 3V79C 2VDNL 5I76A 3SKOB 5DHEA 3WN5C 1U8JB 3MACH 1JAEA 2ENYA 12E8L 1CFSA 4Y88A 3HZMA 1TYRA 3FN0L 4ALAC 4DP5X 4UU9A 3L3GA 4NKDA 4YQXH 1FPTL 3QQDB 2F58L 1OP5K 4LP4A 4P4KC 5F1OB 1D7CA 1GKOA 2DM4A 1RFDH 4P46A 4G1MA 1OD9A 3SCMD 1JZ5A 2JJWA 4ZDHA 1NFAA 2KLTA 2ZXWB 4Z7OF 1AHWC 5FA4B 1HH9A 1QA9A 4G71B 3V4LA 3T5WA 4DTGH 3GMMB 1S3KH 3NSXA 5SWZA 4N0FA 2CE6A 4NZRL 4XOCA 1NICA 2R27A 3RWEA 2XRAL 4AUJA 1XHHA 1AY1H 2WLIB 4JPIA 4XBPA 5D96B 5L0QC 5FO9A 5SWSE 1R3IL 5HTSA 1U8PA 1NGWB 1NFDE 2JH2A 3WEBA 4A39A 4MVBD 2XG4B 4EKJA 4OFYD 4TLKA 2ZUYA 15C8H 1N26A 4U1KA 5EZIL 3VGAB 4WGKA 4Y5YC 1EEZB 4ZOEA 1VFAB 3CFNA 4C4KO 4J28A 4KHXL 4BK5A 3EBGA 5CD5C 4YHMH 3K2KA 8CGTA 4BH8A 2VZTA 5D5ME 5T1JA 3BZ4B 5KOVC 1H3TA 2J20A 3DPBA 2K6YA 3HVNA 4LBEB 5LG1A 4LHUB 1DBMH 4F15C 4NQCD 4TNFA 3V7AE 4D9RE 2D7PA 4OV5B 3TU6A 3SE3A 5HDBE 2UVFA 3EUDA 1QUPA 3D0LA 3KPSD 3QPQC 4UNVA 5KSAA 3DETC 1JZ7A 4DVBB 4HULB 4TULH 5EEXA 2UZYB 3KCPA 3NJLA 4L2YA 3F2LA 3VSVA 2R1WB 5FYKL 5T1KB 3MRBB 43C9B 1CE1L 3Q43A 1UOVA 3PY9A 3NN8A 4NPYA 4PLNC 3ECVA 3NP3A 3SGJC 4LEEA 1RPKA 1RIHL 1UJ3B 4GJTB 5AZEH 5JW4Q 2ZCKH 1MWAB 4F2ME 4S2SB 4YHYB 5ID0A 3KPNB 5DJ6A 2WVVA 3IJ7A 4XNBA 3NIGB 5EU3A 3QXDA 2K4AA 1FYTA 5ERWA 4OLEA 1M2VA 2JKLA 2VIRB 2CNYA 4KY2A 3OWRA 3FTVA 4FCAA 4G43A 4I0PA 2RGSA 4YGAB 4ZW5A 3A22A 4CMMA 1R33A 2H9GA 4ZMPA 1IM9A 3PP3H 2X70A 2CQVA 1I3UA 3JVGA 2YKLL 3SJVD 4GXUM 4XN4A 3N2JA 5I74B 3EOBB 3KYKL 1YZZA 3F7LA 3BP5A 1AZRA 4LLUB 4J3XA 2Z8SA 3FT1A 4Y4HA 2DRUA 1FNLA 4AJWA 3IJ9A 3PREA 3PLYA 4RBPK 4N6RB 3BAYA 1II4E 3B9KA 3ZYIA 3ULVC 1YYLH 1H5BB 4G6AC 3RLSA 4KGLA 1JXFA 4WGVB 3AC0A 5ABDE 3IDYB 5I15H 1IBDA 3D85D 2KH2B 2V3FA 1OARH 3FYIB 4JMNA 5IF0B 2F15A 2K9UA 2OZ4H 3BVNA 1NC4D 3PAYA 5F6HI 4KO7A 5CEXA 4AV4A 1AG6A 3MNZB 3LQMA 3NYKA 3RDTD 4FHJA 5FDYA 3TT3H 1S9XA 4OUUA 5E9NA 3VD3A 5AW2B 1MEXH 4WFGE 4JZOA 4Y2DA 3UZVB 5F9OL 3A6CL 2XXGA 2B59B 4J8RA 4BUHA 1L9PA 1MIEL 4PGDA 1SDYA 4AXWB 4WJG3 2WZ5A 3QQ9C 5G5DB 3F7YB 5I6OA 3F7QA 1MHPH 3UERA 5KG9B 2MKWA 1FN4A 4Z3EA 3MTRA 4PJ5D 1PPIA 2X6AA 1JNHA 3B9DA 4XOBA 3GD1C 3UZEC 2AANA 3BIBX 3C8KB 3L95A 2AQRA 4DK3A 4LLDA 4QTIL 2R1YA 2NYYD 4K9EH 1DBJH 3QYMA 1TQWA 4R5VA 5EUKA 2AZUA 2VWEE 3VMPA 3W56A 3NIGF 1LHZA 4NJAH 1TT6A 3SO5A 5A3ID 4Y4KA 1YEEL 2OCJA 2QZ5A 2G2RB 5I66B 2YS4A 5MERA 2VN7A 3U9PH 3ZK0A 3BXNA 1AD0A 5I8EB 3CFDB 4JFFB 4FFTA 2FX7H 4LZKA 1TQSA 4OZGE 2R56H 4RMQA 1USZA 3QDGE 5E8DH 3G5VB 1WAAA 1XR8A 2DS4A 5DJDB 4BWTA 5KBPA 2AQTA 5EU7E 5C0EB 4N1EA 3CLEH 3RFZC 2XUWA 5KJRL 3PFUA 1PD1A 2XV3A 4KITB 2M8XA 4G3YH 4M61B 4U31A 2XTJE 5DFWH 4AYID 3CCHB 4C56A 2K78A 4Z7VE 1IVTA 4YH6A 3VD5A 3W11D 2MQ3A 2W88A 2WNGA 4G6JL 4ZUVB 4RA0C 3US0A 5HD8C 2CDGB 2WAQA 1PG7H 2WXMA 2WXFA 1FQ9C 3IFOA 3OR6B 2HKHL 5D4QA 2WTRB 3NABH 5ANME 1SY6H 3X13A 2NR6D 1P7QA 2OMVB 2WMPB 1IJNA 3DURB 4QHNB 2B5IB 3V5KB 3NH7H 3P0YL 1K5WA 2FWOA 4UT7L 4XP5H 4NKIH 1HXMA 3BQUC 5FOBA 3VG9C 1R3JA 2B20A 3BWSA 3HE7D 2R0WH 4XP9L 2OA9A 4BINA 3BZDA 5B1JC 1L7TH 1UXMA 1X3DA 3T8VA 1QI5A 2K7PA 4FNSA 2IIJA 3OXRB 4GP4B 4O4YL 3E7JA 3KLDA 5CLXA 5I6XC 3KPTA 4JRYA 3GO1H 1HHJB 4MJ2A 1U8KA 3CFCH 2RTTA 1FDLH 5EZJA 2A1WH 3RIFK 2CZNA 2G3MA 2RB8A 3IDXL 3MLZH 1TETL 3IMRA 1TXKA 5HDQH 1F2QA 3L1GA 3DI3B 4WWKC 4GOSA 5IHZB 1WT5A 5JHDE 1NDGB 2BP8B 2A5UA 2MOVA 4JQXA 2BHFA 1DJXA 2E9JA 1RZJC 3NSJA 5AVUB 4QGYA 2OMNA 3N06B 4QLWA 4F27A 1CWVA 4UUJB 2H47C 1BVKA 2C4FT 3FFDB 3ILPA 2GJ6A 3QRFM 2PW2A 3QJQB 2VTFA 4F80A 4JDZA 5IQOA 1B4TA 1SEBB 4M6OH 4N8VG 1UT1A 4B9FA 2PCXA 3SQBA 5A2KH 5BNXD 4FEIA 3GT6A 1SJHA 2BINA 5JNYA 3VCLA 2FBJL 2H32H 4KQ3L 5IQNA 4FOMA 3MDJA 5FUCC 2YA0A 4N6QA 5EU4A 4LASH 2WWKO 5C2BL 2DQFB 2OKMA 2ZSVA 1X7QB 2IH3A 1M7DA 2F5AL 1FL6A 4TUJA 1S7UB 5CEZL 5TE7L 3V0IA 3F7RA 1UWYA 3H42H 5TK2A 1RHHB 2P80A 3LSOB 1GSMA 4UZSA 2Q87A 3N9GH 4D9LH 1HSBA 4NLAA 1E2ZA 4P3DA 3HAEH 4XNMA 1R3KB 3HCVB 4HVBA 2C9PA 2DLIA 1E4JA 5FV2A 1KJ3L 1MKFA 4M6NL 3IU3A 4P5KB 4LL9A 2P48B 4A6YB 4KK6C 1JD7A 2VKWA 4XH2A 1VDGA 3C6LD 5LXGL 4AV0A 4Z5RA 1DLFL 1V27A 2FHBA 5DZOA 4M4RA 3RTLA 1WVZA 3TFBA 5E08L 2R8SL 1D9KC 4JFQB 3G5YB 4GUPA 4JHBA 1ET7A 4X7TB 5IIEB 4DGIL 4K3EL 4ZTOH 2HJKB 1YMMA 2VZVA 2DKMA 2Z7UA 1Q0YH 4BWWA 4W4OC 3VD2A 5CNHA 3OGCA 4HCFA 4NO0A 1OCCB 1SUJA 3KWWA 1KN4H 3LZFH 3D39E 4F37F 1RHFA 3Q48A 3L4VA 4Q9RH 3BWAB 1NAMA 1MLBA 4R2GD 5C3LD 3T6ZA 1D6VH 1E5UI 5BVPL 4ECNA 2HT4D 1X44A 3GXNA 5ESVB 3K74B 3C08L 3OJVC 4WUUA 3FONB 1IAIL 2A74B 3MX0B 3MOAL 1URZA 2BSEA 2DYSB 4YBQC 4PJXA 3HBQA 1PW3A 1ZY9A 4QUOA 1G1KA 3AY2A 4EI6A 5A2CA 1F4XH 5C0AD 4WKXA 2BNRA 1A7QH 1X9QA 2I07A 4HH9A 5IG7A 1KWKA 4J3TA 3O6LL 4MXQD 3VA6A 3WNMA 2JKSA 3WTSA 3NVQA 3QAQA 1CK0H 4FQCH 3BC9A 1O5DT 5IHUL 1BD2A 4BXSV 1WEJL 2FEDC 3RP1A 4U1HA 2IAMC 5DYFA 4GP8B 3OKLA 1YJDL 2IWGA 4WRLA 2P5PA 3QI9A 2AJSH 4HQQH 2QL1A 3RX7A 4Z7QB 1ZE3C 3CTTA 4AGOA 1MWOA 2XV2A 3ZZLA 3HNTH 4HKXB 2XKNB 1OAYH 3GZOA 1AP2B 3P54A 4NBZB 3VXRE 4MD5A 1Q0XH 1XGQA 2FGZA 2AK1L 4QT5A 2IFGA 3ZE1E 3INUH 2IDSA 1RY7B 3D69B 3VW3L 4RZCA 4D3CH 1HI6A 3QPQD 1S5IL 2E9WA 3DETD 4OJAA 4YSTA 1BXUA 1QHOA 2PPFA 4XVSH 1T83A 3S4SB 3O2WH 3UEQA 1XF5A 4WCYH 3DUSB 4YR6A 1XSJA 4G82A 4U1NA 1HYSC 1RZFL 3CHQA 1JJUA 3MOBL 4QHPA 4QTHB 4BE5A 1JCVA 3U4KA 1DBBL 1U4FA 3MODH 4I3SH 2A77L 4Q2ZA 4GW1A 1MCJA 4LCIH 5ICUA 5BQ7A 2Z4TA 3RX5A 1BZEA 3RKDC 3ZMNA 1HFUA 3IN2A 4DGYH 1IEHA 4KUCF 2QVTA 2O5YH 3B7TA 1UA6H 4LMQI 3TV3H 5LBVA 1XVSA 1P53A 1K5NB 3REVA 3I85A 3WIHH 3AT0A 2YPVH 3FJTA 4RQQA 1UFGA 1RJZB 4L2LA 4QOKD 4BSWA 4W9ZA 1ZA6B 2MCPH 3FO0H 1CFNA 4XVUD 3TLRA 1G1OA 2WUBH 3GINA 5KVDL 2E47A 5I30L 2OV0A 1NJ9A 2WCPA 2DYPB 5DFVD 5EHFA 3RWIB 1S78D 3Q9QA 4TVPD 1NAKL 1B9ZA 4U3CA 3WENA 3U7WH 1C08A 3R8QA 4LIQL 2ZP0T 1A6TA 1N5AB 2AJXH 2QVFB 4KVPA 1XF2B 1TO4A 3KYMB 2A0LD 4I48A 3S5YA 2GT9A 4E9XA 2V0AA 2EEFA 2XWXA 3DRTA 1P1ZA 4HPYH 2V5TA 4HUWA 2FX8L 2G3XA 3EHBC 2CBPA 2LLNA 4GPVA 4C57C 4Z7QF 1EO8L 3ETBF 5HI5C 5K9JL 4MB4A 1G4RA 3TN0B 4N8CH 2CLZB 2FNWA 2XPYA 3Q2NA 4AVIA 5KN5A 5I73B 2AKRB 4JO1H 1MI5D 3Q7JA 4FMKA 5D2NC 1OGSA 1S46A 3FO9B 2YRLA 2IPUG 4HUUA 5BMFL 3NSFA 3DYMA 4WSJA 1JV2B 1FO0B 2N59A 3O3UN 2JQMA 3QQ9D 4GS7B 3VXPA 4FQQB 3ATAA 4D0DA 5C0CD 5GS0C 3RUGE 3VWKC 1F4HA 2A4ZA 4LSUH 3OLGA 1W6LA 4XNZC 2JCCE 2GKIA 4HZ1A 1N64H 4Z0XB 2YBRA 1J0HA 2FBOJ 4OGYH 5E56A 3OZLA 4AGLA 2GSMB 3ZYOA 3CG8A 4OIIL 4BHUI 2AABH 2NNCA 3LRHA 5HHOA 3MO1A 1CPUA 2VR3A 3BE1H 1Q9LB 2J8UE 3F58H 4WEBL 1AQ8A 3WDIA 1MFEH 1NUFA 3L8QA 2LAAA 1G9MH 3EYQD 4IK6A 4MD4A 1BA9A 3FQTA 2AK4A 2I5YL 2VLME 5EZLB 5B38B 5EEWA 1QFUL 1YDPA 1RMFL 3FT4A 1P84J 3G5WA 4WW1A 4JM2C 4ZUWB 4HIPA 3LDBC 3RILA 3QG6A 5JIKA 2F7OA 3G9VA 3CH1A 4I18C 3OKKB 3LEXA 4IRZA 4ZFOA 4M6MH 1TLMA 1EAOA 2Y1YA 2JB5L 4Q6IC 4FJYA 1BQHB 5LAXB 3DXAB 4HCRL 3OKDA 3BPCB 3HBZA 1NC2B 1WBZB 2FNBA 4Q14A 4QRPE 4TL4A 3WIFB 4BQCA 2D7OA 3ARVA 4DKTA 3ESVF 3C2AH 4CDGC 2O4EA 1DQKA 4XPTH 1RJLB 4X8CA 2F54A 3VDCA 4P2RA 1YUHA 2P24A 4JFPB 2L7EA 4FABH 5HD8D 4MB5A 3FUDA 1CT8B 3HR5B 4HS8H 3C09C 4XC3L 2WLLB 4PP2B 1CGYA 1UYWL 1DJIA 4XAWL 4MQTB 2XSKA 1M3IA 3H54A 3L7EA 3MJ7A 4I1RA 2X6VA 1EAPA 1AE6H 1YYCA 2P5EA 2PETA 1Y6NR 3APDA 4MA7L 4X6CB 1ZHKA 2WSPA 1KLUA 3C60D 3PJNA 5B4MC 4AE0A 4AT6A 1UC6A 4ICWA 1CE6B 5BJTB 2WOYA 3I84A 3IAQA 2XPZA 2ARJA 1H0DA 4QPEA 2WWNA 4CN4A 4PS8A 3LV3B 1UD3A 1UOKA 1FGVL 2F19L 4HWZA 4XNQB 3V9FA 4XWOC 3ZTJH 2ZOLA 3D3VA 4KKAC 3FMGL 5D1ZD 3S2AA 2CCLA 3DC0A 5E6ZA 2D7TL 4KMTL 4NI6A 2ED9A 2AI0L 3DYOA 3ESMA 5FB8B 4F2EA 2A4EA 1CLCA 3BYTA 5D7IB 2E7LC 1JN6B 2PTTA 1JSYA 3IN0A 5E7FA 1R3HB 5D93B 3VXTB 3SCMA 2ZF8A 1DBKL 3Q8FA 3BD3A 4JKKA 4KK9C 4WWKD 4U6HA 3IJ8A 1JNLH 2P5WB 5F3BA 3S8GB 4P5TD 4FG4A 4N1CA 4LSSL 4ZUUA 4AQ8A 5TF1L 5BUPA 2WKGA 1KENL 5HPOA 1RK0B 3GJFH 2V9RA 4Z76A 3MN8A 4I88A 3L4WA 3AMLA 1WFNA 2C9XA 4Q89A 2VXUL 1JHLL 1ZT1A 1Q8MA 1SF3A 4OFYA 3QFJB 3SO3B 2R23A 1DVUA 3UDWA 1S9YB 2NY2B 3PFQA 4XE0A 2W0LA 3E8VA 1F97A 1RZGB 1D2PA 3O45A 4JN2A 5L6YL 4JN1L 3T0EC 4EN3D 5LUMA 3CN4A 4PJGA 4X6DE 3HS0C 3U0TA 1NUDA 5D6DA 3VI3A 4Z3HA 4Z77A 4Y19D 5I0WA 1TIUA 4L0PB 4NQCA 1Z1WA 4LEOB 3VFSA 4R7XA 3Q13A 3BWZA 5TGBA 1MAMH 3QCVL 1L4IA 4MAUL 4PAZA 3WN5B 4X6CF 1LD9A 1M42A 3QIUA 4A6YL 4F93B 1DFBL 1J8KA 3AAZB 5CP3A 1XX9C 1PZDA 1F02I 1XO8A 3HN3A 5FYKD 4LVHB 5HHVL 2P8LB 3EDFA 4P4KB 3VFOA 2BK8A 5BW7C 4GBXD 1U9KA 3KPLA 1RJYB 1N0XL 3M6DA 4W68A 2A6KB 2Z92B 1UADC 4YSDA 3K4DA 5BRZA 3R4DA 1AHWB 1P2CA 1KXVC 1S7SB 1D9KD 5IGXL 1AD9A 3CXDL 1QO3B 1DEEB 5DSCA 2QQKH 1AO7B 3AADB 3KXFB 5D7IF 2IQAB 2DQTH 3FFCA 1MREL 3N85H 5AAMC 1JXGA 3UPCA 1A4AA 3VSTA 2YAEA 2YFNA 3CZLA 3HLAA 2VXQA 4N22A 3FU5A 4GAAA 4MJ5B 3ZDZE 4PLJD 4OZHA 5T1DH 2KZKA 4X7DC 4HGWA 5L0QB 2NY7L 4IIZA 5BOJA 4TOYH 2V6HA 3OTTA 2C9SA 1Z5LB 2PYEB 3JWOH 5ADPL 4DQAA 3OB0H 4E9TA 4UT6L 2ZXEB 1D6EB 5H94B 3WS3B 1OGTA 1MCNA 2X05A 3PJSA 1JGUL 2MNJB 5AB2A 3NCJH 4GUOA 7FABH 1OZUA 4R83A 4M7JL 1JPTL 3PGFL 3UG4A 3K6SA 4PJFA 1A3LL 1ADQL 4HLZH 4XZ4A 3D85A 4F15B 1FVCA 1VADB 2CO1A 1NC4A 4I1PA 1XV8A 4PJHE 1WA2X 4XP4H 1V3LA 3NZ8A 4JQIL 4KX7A 3L1FA 3EKCA 2IPUK 3FZUD 2KI6A 5J5EA 2OCCB 4V1DE 3UBFA 2H0FA 1MVUA 4ZQKA 4ELME 2DB8A 3SDXA 4MAYC 1TJGL 1XEUA 1ZPLA 3VGFA 5DMGD 2QGDA 2EDEA 1TFPA 1ZLWK 3V4PB 1FNSH 1JHTB 4IJ3C 4KKZA 4GKSA 1HZHH 3PABB 1F45A 1MCPL 3ARQA 1EZVX 3RWDB 1JPGA 4GRWH 4PJ5A 5FX3A 3D51A 1CXIA 3LQAC 5FA3B 5DFAA 1GVIA 3MLPA 2FCBA 3EGSA 4JFOA 1ZGLM 1LO0H 25C8L 1JZHA 3Q8CA 3SYCA 2QPEB 2JI1A 3BHBB 4G9DB 2HN7B 4PJCB 1H3PL 1YEHL 2B2XH 1PYWB 2DWDA 4S0TD 2XICA 3TL5A 1QKZH 3QRGH 5DUML 3AG1B 3VWJD 2DTMH 5IQ9B 5EU6D 3L16A 3WUZA 4RDBA 3MKGA 2F53E 1JPEA 1BBDH 3BVWA 3QDJB 1EHNA 4LNVA 2Q6WB 2WXIA 4NOFA 4FI6A 4HG4J 2Y23A 4G5AA 4UILL 5C07D 1SYSA 2O5NA 1CB4A 1AGFB 2HXAA 2I9TB 1JK9A 2I25N 4HFWB 4HKJA 3Q06A 4AK2A 4OQTL 3IS0X 1LP9F 4X6FA 3B2UC 3TBWB 1P69B 2XA3A 1SJXA 2PP9A 3MRPA 1OY3B 3MRKB 2XN9B 2A6DA 3Q5OA 1PZ5A 1KEGH 2QMJA 5I6MA 4U1JA 2BW4A 5AAPA 1R75A 5I2IA 3NQKA 3LJ3A 2GTZA 4PJAA 1X4YA 1M56B 4WW2C 3ATBA 1IO4C 4C54A 5JDJA 4X8XA 5F0LB 3P1VA 2G2PA 2GIYA 5J9PB 2V2XA 1IAII 2H0EA 3NESA 1RSYA 4OY9A 3MGTB 3QEQB 4JFEA 4ZW7A 1NMCC 1SHWA 3L3JB 4FNLH 1Z32X 4N0YL 2YK1H 2QMKA 2KDYA 4HAKA 5D2LE 2ERJC 4CVZA 2YEZA 2Q8AL 3HE7A 3MJ9H 4M7KH 1A02N 2KL6A 2NXYC 3UTSB 1E30A 1F90L 3T2OA 1EZSA 4ODWA 2RACA 3ZUCA 5E2VL 2NUTA 5C08E 2YPLD 2OSXA 4K2UL 5L2KD 1TEFA 5FGRA 4PJCF 3SODB 5FPIA 2J4WH 3JSSA 3K1KC 2HVKA 2FR4A 4NO3A 4KJPC 4L4TE 3Q01A 1MIML 2XZAL 4X0KA 3RTQB 2HSIA 3ETBJ 3QUMA 4QHUB 4TUUA 5DD3L 5A6IA 4OCYH 1JGDB 3A67L 2BXYA 3ULSB 2MTPA 1Q9WB 5K1NA 2WQSA 3FFOA 4M5ZH 5M7QA 3BMWA 2V9QA 2DQEH 2NY4D 2ZUXA 2R0ZL 1KXHA 3GRGA 3JXAA 4FI7A 3TNNB 2ATPB 2NY0C 1NCHA 1L3NA 4QHLA 1C16B 3CHSA 5KW9L 3KD4A 1FNHA 4X5WA 1B0RA 1S7TA 1WC7A 2EDLA 5B39B 5F7DA 1UH2A 3DUUB 1NPNA 2WBJC 2YXWA 2HRGA 3HVDA 3W0WB 4JM2D 2ZSWB 5FK9B 1I7RA 5GS3A 4F9LC 5DDHB 2WP3T 3BSZL 4GLRI 5AZUA 2CLVA 2WKLA 4ZS6C 3IF1B 4JANB 2IG2H 1NCJA 1W72B 4K5MA 5DS2A 5TDOA 4GG6E 2CR6A 4NHUA 3SKNB 1CBVL 5CEZD 4BK8A 2VN6A 3WKQA 2Q3XA 5FIEA 3SPVA 1RUMH 4HU8A 4HK3N 43CAB 1E4XH 1WH0A 2LLLA 3IJSA 3TFKC 3EJTA 3O3AA 1MDAA 4R0LA 2E8YA 4LDEB 4X9HA 3T3PB 3VXUD 4XCEB 3BW9B 3II1A 5E95B 3VH8B 2V7HB 1WUZA 1M7UA 5GRVL 1ZVHA 1T6BX 1ZDSA 2K0RA 2DWSA 1A7OL 3H6AA 1T7YA 5SWZE 4WI5A 1E5ZA 3SKJL 1MFCH 1CFBA 3WFBH 4ZNEE 3QNZB 2R1XA 3NJGA 5DQJB 2G3ZA 5LN8A 2JSFA 4LF3A 3WEMA 1Z2KA 2IV9A 3ZKXB 2ICEC 4JPKH 1A1MB 3TA3A 3TBSB 1V8HA 1AQMA 4XMKL 2CKBL 3PWUA 2W0KA 4MMXC 2W59A 2JKNA 1KG0A 3FULA 1QSFB 5D9SA 3T2NH 3VXSE 4IOIB 1XT5A 3ESNA 3NG5A 3ELAT 5CSGA 1AXTH 5ISZE 2VW7A 1QYGH 2Z0BA 3FB6B 3RHWK 5F9JB 3PWPE 1Y6KR 5K39B 3P9LB 1YECH 4MA1B 5AB0A 3UPRB 4LLMB 2X5PA 4P2OD 4BUQA 4HS6A 4KK5D 2FL5B 3UC2A 4TTDC 4R4NC 5HI4C 4CC0A 3CFKA 3HRZB 3LD8B 4PS4H 4JY5H 4R96A 4JG5A 5C0AA 1V5JA 2NCMA 3LN5A 3DX6B 3ZU8A 3H4HA 1BVOA 1PZ3A 5C6WH 3U2SA 5PAZA 4WI8A 3TNMB 2N1TE 3G08A 3BH8B 3KPOB 1CTOA 4P2QB 4TYUA 1KYFA 2F74B 3IKCA 1YVLA 3OXSA 1JF1A 4YJZL 2MKLC 4J3OC 4RGOH 1GKEA 2FO8A 2BRRH 3FCTA 4L8SA 3MLVL 4LHUD 3OKMA 3TZVA 3ORJA 3GUTA 3T3PF 1WD8A 1MF2L 3OC5A 4AOFA 5F44A 4R9HA 3SDDB 1F86A 1YY8A 3PGCB 5SWQA 3BKCH 5KVGH 2YGPA 1FRGH 1BZDA 4HKBB 4PEEA 4JFXB 4KTGA 4H8WC 1E40A 2BDNL 5L7XH 2DTSA 3ME0B 4H8PA 3G7TA 3O6KH 3LKQB 3MBWB 1UVQA 1ZCRA 2BVPB 2ZAGA 4KI5E 2BP5M 3CK0H 3ESUF 1XGRB 1XSKA 4KBPA 1TO5A 3KGRA 2VL4A 3MV9E 4HU2A 2IDCA 4OCWL 4OLZH 2EDDA 1UOLA 3GPEA 1U93B 4EJ1C 1RK7A 5I5MA 3II2A 2CLRA 2FUTA 2X4NA 1N59A 1WQVT 1IGIH 3RWFB 4PREB 3CDZA 3NIDE 4A7SA 4PGCB 1KIRA 1U0QA 4JHWH 3U46A 3GRWA 2VQUA 1F0LA 1RUAH 2IANE 3P0VL 1MCSA 4RMBA 4Y16B 2IDTA 4YNYA 3O3BA 2A7BA 3RQ3A 4QOKA 5DS8A 3V6FB 5KSBB 4UMGA 1D5RA 4HZAA 2Y7MA 2EYRB 3BP4B 4MJHA 2AITA 2B1OA 4R7LA 4DK5A 5I8OL 4JKMA 2IAMB 3LOWA 3GXIA 1SXNA 5DJ0A 1PKQB 5J6GA 3P4OB 1JTTA 1BM3L 2AQSA 4U1LB 1TSRA 1ND0B 3PDOA 4GFXA 3EJZD 2K7QA 2BFVH 4LLQA 3QT2A 5DK0B 2XQ0A 3T4AA 3UTQB 1RZKC 2XY1A 2NT1A 5IV2A 3DX8B 1DDTA 1EFXD 4JJHA 3WNPA 3KEDA 5CN3A 3FB5B 1H8LA 1PX4A 3CXFA 3OD3A 3CHOA 2I60H 3KPRE 4DP0X 2ADFH 1QFPA 3QR2A 3V4PL 5C0IA 1OP5H 4OZIA 4A66A 1MI5A 4PI2A 4FG6C 4N2HA 2M1KA 2IH8A 2X87A 3APCA 2ZXQA 4P59H 1XCXA 4N9OB 4PMEA 2A6JB 4RRPA 5CF3A 3W39A 4ZSOB 4F33B 1U33A 2Y25A 3BIKB 1T4WA 4QXTA 3TYGH 2ZOTA 3LIZL 5C0CA 2DQGL 4GRLC 4M93B 3A4FA 5MENB 2PWDA 1IEAA 4OZ4B 3ARDC 4KKBD 4LPUA 4C56E 5HJDA 4NHCH 4FAAB 2HVJA 4V2CB 1G7LB 1KELL 1OTTD 5CR8A 2CK0L 3S3BB 5E8PA 4C59B 2CJUH 1F3DH 2W0FA 3L4CA 5DHVA 3RBSA 3IPBA 1MHHA 5TDNB 4X99B 3TO4D 5JPNC 4JFFD 2UZXA 2LR4A 2J43A 3AGVA 3BGFB 3FUNA 2LFGA 4JG1L 1ROWA 3BKYH 5JXAL 4B9YA 4BGDA 1SOKA 3MLYL 3L5IA 5HGGS 5DVKA 3CVDA 5DR5L 3NZHL 3RAJL 5KSBF 1K4CB 4K8RL 1BPLB 5FYJU 1AZVA 2UUDK 1I7TA 3IDIA 4IBYA 4DP4X 5DA0B 1C5DA 3MJ8B 1E8YA 4M62H 2HKFL 3DMMC 4OLWL 4RFNB 4H1LB 3KLAA 4JFDB 1ZIAA 4Q4IA 2X4PB 2R2BA 3MRMA 3SPJA 1DN0A 2ZUQB 1DQQB 3EHBB 1G5AA 5TE4L 3EYFB 4JRYE 3HI6L 4XE5B 4OVVA 4Y1TA 3B2UD 3EGXA 3MGAA 3K2MC 4PVBA 4NUMA 3KJ4B 2DQJH 1Z9SB 1NIBA 4P04A 2DQHL 3OKOA 2R29A 3COOA 4ORZC 4NNXA 2G3NA 2X9YA 2IOIA 5HGBB 5AG8A 5D1QC 1BQ5A 4QO1B 3LKNB 3GS0A 1AZBA 5D1XC 1H3GA 2D3JA 4NQSA 2VITA 2Y22A 4OM0H 5IR1B 2TSBA 3HZVB 2AJ3B 4L1DA 2RALA 3C60A 1HE8A 3VSUA 4HAFA 4BDVA 2UZIH 1IC1A 3HG1B 4PRIE 1VCAA 3CN3A 5GSRB 1WPCA 4YDZA 2I9LA 3DV6B 2VC2H 3WTWA 3PL6C 4OFQA 1VENA 1RCYA 1WBXB 2DZEA 3QIWC 3MUZ1 1P84K 4ZUTB 4NRXB 1WO2A 1KBPA 2PXYC 5DJAA 5EC1B 2XNAA 5H37A 4YSOA 4IU3B 4M8RA 2Q7YA 4RBPH 4H8UA 1CYXA 4IRZH 5GJTL 1GR7A 3TEXA 2YQGA 4EMZA 3NSYA 4A2MA 3CN1A 4K94L 2WNKA 4X5XB 4WV1A 2ZCZA 3LEVH 1A47A 5TQ0H 4POZC 3RBGA 3D4CA 3S3PA 3J7HA 3KGSA 1U2CA 2WXJA 3DLQR 3NK3A 2CHNA 4XMWA 4ZX6A 1INEH 2BNQE 4WHCA 5KS9A 2WNWA 1IX2A 1GY1A 1M57B 3UG3A 2X1OA 3FB7B 5FYLH 4L9LC 3O81A 1XSIA 4MKMA 2GK0A 4XPFH 3BFQG 1U8HA 2CUMA 3PDGA 4JO2L 3QNXB 4ZW3A 3TPUA 4AEHL 1NCNA 2NUPA 5CHNA 3C09B 3O3EA 3UOAB 5KVGE 1VB9A 3L1OL 4PV1C 1NWOA 2H3NA 1YMME 3UX9B 1CU4L 1NGZB 4YDKL 1P9MA 2NLJA 2I27N 3L3HA 4JY4B 1U8LB 1C12B 4ZODA 3VXQB 4L3EE 4WI2A 3TIEB 4KAQL 3KGUA 3QDME 3M7OA 4NQDB 3T2LA 5CAYB 1BFVH 3AUVA 1VACA 3KM1A 2K3HA 3NIFF 5FHBL 5D71L 4BHUA 4O02H 3LRLA 4AIOA 5JW4M 5CD3B 1HHKB 2VDQB 1O7DE 1TCRA 1R0AH 1TTAA 4JPVH 1IGJA 1USQA 4PJXE 3MA9H 4G7VH 4NT6B 4OF6A 4W9EC 1MSPA 2OL3L 4MJJA 2A9DA 3V5HA 2Z7ZA 4L37A 4CADA 2Q76B 5E5RB 4GBXA 4D0BB 2WTOA 3N04A 2XQYA 3TBVB 4DKAA 1I4FA 4J3OG 4AJYV 1ZLDA 3JUYA 3UTPD 2KPNA 4F7MA 3AG2B 4LDCA 1XBRA 4Y8DC 2F5BL 4FXTA 5EUOB 1GZPA 2VUOA 3DHUA 2GTWB 3VGEA 2CMRH 1CXKA 2HH0L 1D5ZB 3HI1A 3TEZA 1B0GB 4PR5A 3TURA 1WA1X 2ESVE 3D4ZA 3GBML 3PWLA 5E8NA 2BP0B 1X6NA 3SBRA 1TZHA 1Z9PA 4YHNB 1NPUA 1PX3A 4BKLA 1CLOH 4DQOL 3TONA 1NPJA 2OTWA 2BZCA 3LN4B 3T0EB 3N1GC 4WNJA 3DSFH 3JV4A 3BT2H 2HP4A 2I85A 2EXWD 2ZXAA 1A1OB 1D5MB 4FZ8L 3P30H 4X7SH 4GIPD 5HI4D 2XA8L 3D34A 3CZFA 4AG4L 3PHQB 4AEIL 1JUFB 3M45A 3PHAA 4NJ9L 5CP3H 3QCTL 3VXNB 1QWNA 3C12A 2Y36H 1COBA 3RVTD 5FECB 4LLYA 4UDTA 2QKIC 3PWJA 1ML0A 2UX7A 4UQIM 5AZ2H 3SDCB 3FCGA 4K7PY 4PG9B 4HBQA 2DLFH 2VLKE 4YLQT 3O6MH 5EIIA 2EYSA 5EH1A 4PGEA 1ID5I 3C2SA 3L2LA 4JFZH 2BOBB 1HDMB 1I8AA 4CILA 2K3TA 4YDVB 2XQBH 4E36A 4HEME 4FXGC 2A9NL 1IFHH 1Z5YD 2VXQH 4ZPTA 3EYVA 1OPGH 1FL3B 1M1SA 4OCSL 2A99A 4HW6A 4CJ1A 2XJKA 1O7VA 4XP1H 1W6WA 5DZ9A 1IBHA 1KGJA 4UWQB 4NWUL 3OAWA 3QORC 2AXGA 4Z8FH 1MFMA 4Y1AE 5EUOF 3VWJA 2X4SA 3RY6A 1BQLH 4QNPE 3QJFA 4G8IB 4JZJA 1RVFH 2G5UA 4P2AA 5BPPA 1AQKL 2Z0UA 1G6RB 2DLEA 2FLRT 4LCWA 4BCZA 2WZAA 1I3RB 5IKCA 1JGVL 4KKCC 5ACZA 4F37K 2VN5A 4U6VH 3AU1B 4P99A 5C07A 1CDHA 5IQ7L 3IYLW 1OAZL 1H3UA 3TM6A 1RH8A 4H40A 5C0BE 3IRZA 1YNTB 2GCYA 3OAUH 4DKDC 2D0HA 2DYPD 5DVPA 5T3ZL 3ZE0B 2F08A 2XVBA 4MDIA 4E41B 5DF0A 2PPCA 1ES0B 2RFXA 5EOQL 1PMYA 4IKNA 1BXVA 4BFIB 3C5ZA 3GJEA 1X9RA 1J9RA 2Q9OA 3QQ4B 3D30A 5HHOE 5ESAB 4NUQA 1I1YB 1E6JL 3P77B 3F84A 3N5AA 1AGDB 5AL8A 4NZUH 3RZCB 3JV6B 2EC9U 4GT7A 2AK4E 2VQ1A 5CJQL 4AIZB 5IMMB 1LEIA 4PWGA 1A65A 2YC1A 5FC9A 1J8HA 4NWTH 2C7FA 1LE9A 2FIKA 2HVBA 35C8L 4E9WA 3T4YA 1UWGH 4OFDA 2YPLA 3BKML 3Q9PA 3LHAA 1YUKB 3BVTA 4HG4K 4XI5C 4I3GA 3MRNA 1MCEA 3O9WC 4F2FA 3CVHA 5CSBA 4CMHC 4F1ZA 1M4KA 2X28A 4F8NA 4BWUA 2CGRL 2IH1B 3GB7A 3QAZC 3F5WA 4ZXBC 1BZ9B 2OXHB 3NCYP 5MEPB 4Z78A 2B15A 3ZHDA 4P2RE 6CGTA 1UACH 3V95A 1BGXL 2YD8A 4L1SA 4JHZA 1Y07A 4NLHA 3MRIA 5DUJA 5AOZA 1VGEH 5FYLE 4HIIA 1XTMA 4X4XB 4GG8A 2H1PL 2MPAH 4PRNB 2MCAA 1T21B 1WZ1L 2OXGB 2UY7A 1ONQA 1CD1A 5C7ZA 3KAAA 1P5VB 5DO2D 3ROOA 3HNVH 3BAKA 5H2BA 1XZ0B 3DV4B 1YNTF 4RETB 4I4WA 4WW2B 3A6BH 4FMVA 5JIDA 4XNYH 1A7BA 1OF2A 4XNUL 1A4KA 1TQUA 5I82A 3DXAD 3VE0B 3ZE0F 1V7NL 5IFJB 3EZ8A 5DZLA 1NC2D 3IXTB 4KY1L 1OTSD 4P9HH 2P3YA 5EFIA 3WIIH 3DMMD 1WWAX 4LVOC 3QHZL 4DPBX 1N6QH 2Y2TA 4WEEA 4AZ8A 1CICA 2MQGA 3E1ZA 5L88L 1PIGA 3KL0A 4QXUL 1NMCB 1N8OE 1LO3H 4ZUSB 4RWYL 4PJIB 4HX1B 1UFUA 4LRIC 2ERJB 3FU7B 2OR9L 1T0PB 1B3IA 3PHOA 3FQWA 3KM2A 2NXYB 3MRQA 3OKEB 4FFYH 1BWWA 4FTVD 4X5PA 3QZOA 2VWEC 5LDUA 2VUKA 4OZFA 4DEPC 1JMXA 1T4KB 5F7YC 4BFKA 5JIQA 2DQCH 1ZSDB 3TBYA 4IOSD 4QY8A 4RH4A 5D1XD 5C8JB 2FJHA 3BP7A 4X9IA 3I6GB 2FO4B 3ESPA 4QYAA 2G60H 1TZGL 5JXED 5BZDB 3L3OC 1ZK9A 4IKIA 1JPSH 1GOFA 3B2MA 3CDGA 2X89A 3LQZA 5CZRA 4YE4H 3VM7A 1BXAA 3U4BL 3IFLL 2BIPA 5LGHL 1A6VH 1U8JA 1NMAH 3LRGA 3LPFA 4KTEH 4HSCX 3WFCH 1CYGA 1MJUL 4X80H 2K6WA 4ZQTA 1BJ1H 1XGYL 5KTEL 5KSVB 2G0KA 1PLBA 4Q9QH 4GB9A 3QQDA 3RVXD 2H6PB 4LESA 3NCXA 2EDHA 5DWUH 3TBBA 4J1UB 4OFIA 5C09B 3T1FB 2XTJC 4U1MB 4PJGE 4UT9L 4MZRA 5BVJB 2WBJB 4UNUA 2V3EA 1R9FA 3ARRA 2Y5EA 4F57H 2DN7A 5FA4A 3AQYA 2O61B 2UX6A 4NQCE 3ZLQC 4YHKL 1G7MB 3GMMA 4XNDA 3KEHA 1R5WB 2V5SA 2GSIB 3KPSE 4AC2A 2NY3C 1JG9A 1S7RB 1XGPA 2Q2LA 2WLIA 3OHMB 1KBWA 2VQ4A 1H9DA 1PLCA 1NGWA 2F68X 3Q2CA 5B1CA 3LRKA 2XG4A 1MFBH 3AS1A 4OW6A 4YSUA 1CDJA 1OE1A 1EEZA 2NY2D 2XN1A 2ZJSH 4PLOB 1VFAA 5FDWB 3WFDL 2AC0A 1I85C 4AYDC 4N5UA 2YN5A 5I9QB 1KMGA 3ALXA 3MLWH 2B9AA 5DQ9B 2CA4A 4EQ2A 4GMTL 2AJUL 4JRXB 4CNIB 1HESA 2OFQA 5KUKA 3BZ4A 2DQ6A 4LBEA 1NBVL 4XN1A 4ZMXA 4LHUA 3GK8L 3IS1X 3ZHKA 4YC2B 5T5FH 4OV5A 1SQ2N 1A8ZA 5E0QA 4F20A 1MFVA 5D7LB 4MCYB 5HVGB 4MZ2A 3SJVE 3FCBA 3GI8H 5CZXC 4DVBA 3QJVB 4NP4L 2VDQL 2UZYA 2P8PB 1LLAA 3A3YB 4RGNB 3QUYC 2R1WA 5DXWA 5EOCL 2Y2WA 2BY2A 2JELL 1Q4NX 3MRBA 1PLGH 5T1KA 3WY1A 43C9A 3IDJA 4ES9A 5AYQA 2CR3A 5D7SH 3QNYB 1GA2A 1KEML 1UJ3A 2GQHA 3VNZA 3X11B 1MWAA 3FPXA 3GKWH 3X1FA 4S2SA 1H3WM 3B37A 3O6FC 2XBTA 4PJFE 4MB3A 3KPNA 1XXFC 1QHQA 2WQAA 3T2QA 2VR6A 3NRPA 4NQVB 2WWMC 5E1AB 1K85A 4DFHA 2VIRA 1SXZA 2APTA 3LB6C 3P69A 5L8JB 1V05A 3OJMB 4YHZH 3W3BA 4GYBA 1UCBL 2CD0A 3GZQA 1AHKA 3ZKND 4ANVA 3SDXE 1PD6A 1ZHNB 4G5ZL 4RNRB 4ZFGH 4N0RA 3O4OC 4HMCA 3OKNB 1B4RA 1EQWA 2EIJB 3WXWH 3VD1A 4LKCB 1FNEB 3I6LD 3EOBA 1IVLA 4LLUA 3V4VB 4IHOB 1HQRA 1XTLA 5GZOC 5I19H 5B8CB 1A7RH 4LQFL 4QKTA 2GB2A 5E2WH 4N6RA 3SGDH 2GHZA 3AROA 3U9WA 1H5BA 4DGVL 3SBPA 1BV8A 2VXSL 3LNGA 2QELA 2FZ3B 1F58H 3CSYB 3UTTB 5I75C 1KB9J 2B1HL 5IF0A 3BLBA 1F6FB 3GQFA 3MNZA 2CHXA 2ZKWA 3FUJA 4NKMB 2IFFL 4WUKL 3CZKA 2ODIA 1ZVNA 1MCKA 1FFRA 4OCNC 3UZVA 3LH2L 3ILQC 2NY5L 3VNYA 4MJIB 3T09A 2B59A 4K5PA 4AXWA 4R97C 1DP0A 1XIWB 3F8UB 3TVMB 3V7AG 1U4EA 4J3VA 2KS0A 5ALCH 5KG9A 3HC3H 1E3FA 4TPRL 1HCZA 1CC3A 2G30A 1J88A 4HJGB 5BZZA 5IMKA 1ZGLB 3C8KA 4UTBL 3RI5K 1GIGL 3S98A 4WAFA 3PHSA 5JW4R 3GRWH 2V7NB 1AC6A 1XL4A 5M95B 3J07A 2H8PB 2YZ8A 3GNMH 4XB3A 2D8KA 4BKTC 4AL8C 1UQSB 3N44B 4OLVH 4S1QH 5I66A 4PJAE 2G2RA 2BVQB 2X0VA 3NEOA 4Y9FA 4E2OA 4XR8C 5I8EA 3TO4A 1BYOA 3CFDA 4JFFA 2ZCLH 4HS3B 4OBRA 4KQ4L 5HY9B 1YQVH 4UOQA 4Z3TA 2BC4B 4HGMA 2Z31B 2GBUA 3VFGH 1RU9L 1G6RL 4TVPH 4UINH 3G5VA 4MJ6B 5DJDA 2HRHA 5GGVH 1HHIB 4DP8X 3E9TA 3F83A 1D5IL 5ADOL 4DT2A 3DX0A 4K8RD 5C0EA 3QJZA 2F7QA 3FTXA 2WZPD 2CO7B 2C4FU 1E4HA 4KKCD 3SHSA 5F9WB 3U79A 3QUZC 4N2EA 1G0DA 1UT9A 1RUQH 4M61A 1IGFH 5ID1B 4XO9A 1GGTA 4CJ0A 1J5OH 1ICTA 3CCHA 4HCRA 4L4JA 1XDTT 1SRDA 4K9EC 5E6YA 4LL1A 3UAAA 5GS1B 1WSST 5CIPH 4QYOB 4ZUVA 2RCSL 3LKRB 3GMQB 2OMZB 2CDGA 4M5TA 1AGCB 1BBJB 1NGQL 5BOZG 2A9AA 3BPNC 3SZ6A 1DBAH 4ABWA 3L9RB 3OR6A 2WTRA 4YVNA 1ZEAH 4M6AA 4JRLA 2OMVA 2WMPA 1OO2A 1PIFA 2N7BA 2NNAB 3DURA 4QHNA 3V5KA 3ZT7A 3D09A 7CGTA 5EZPA 3QEQD 3LX9A 2W95A 2EDKA 4AMKL 5GGRB 1SJEB 3IDUA 3HS9A 4GRLB 1X5HA 1RIVL 1FLTX 3O4LB 2MH4A 4DWHA 3CN2A 5DHVH 1KTCA 4RFOH 4HWBA 1BJMA 4WFED 4Z7UE 5HHPB 1RUKH 1A0QL 2WVUA 1PNDA 2KZ1B 3UMTA 3OXRA 1XH2A 4XPGL 1SLXA 1ZA3B 3CVIH 4PJDE 3GHEH 3VGDA 4UNIA 1GCYA 4WNQB 4XN7A 4DKFL 1HHJA 2BNUA 3N44F 5HGHB 2VLRE 4HUCA 3QS3A 1QVOB 3TBCA 3RTQD 4KJQD 4UB0L 1FH5L 4ZAKB 1YN7B 4A7VA 4FQ2H 4J4PD 4HPOH 3VXOB 4OJFL 4AKQA 4IKJA 4KRPB 2X7LB 1YC8A 5IHZA 3DVGB 4LLWB 3QEGH 1NDGA 2EH7L 1I3GL 4M48H 4NM4H 2P44B 2VDPB 4LSVL 2BP8A 5LDSA 2NDFA 1IGMH 4TNEA 1OB1B 3OC8A 2Z7WA 3VD4A 4LAQL 4UUJA 2WJ7A 1DUYB 3OKYA 3FFDA 3UC0H 2R29H 3W0WD 5E9DB 1Z0MA 1SEBA 1ZLWH 5IW3A 1V3KA 3HE6C 3MROB 1ZVSB 3V6OC 5JZ7C 3MXVH 4LSTL 3G5ZB 2NCEA 5ITFB 2FT6A 4O2EB 2XPGB 2YD6A 4PGBB 2DQFA 3MRJB 1X7QA 4ONGH 4LOFA 2WXGA 1O9VA 4GO6B 1S7UA 3P4MB 1U3YA 3T0BA 4Y7MA 2R4SL 2VDNH 2ZWLT 1VZHA 3LSOA 4YHLL 4A2GA 4HJTA 3HCVA 4FQXB 3IEAA 1CFMA 1FI8C 5LG6A 1LEGB 1WLHA 3BZFB 3FN0H 3WNKA 4P5KA 5H37H 1FPTH 4A6YA 2F58H 5IJVB 4P9ML 3P3YA 5C0JB 2CO2A 1DO6A 1UURA 3K4AA 3MLUH 3NJFA 4FQ1L 2E9GA 2ICWB 4QRRE 2MTAA 3AJ7A 1ZLUH 2PLTA 3ATDA 2VXTL 4JFQA 3G5YA 4L4VB 3RL2B 2Y4SA 1L6ZA 1Q1JL 3T6WA 4X7TA 5JYMA 5IIEA 1J5DA 2HJKA 3FRPG 1KYOJ 5F93C 4ANXA 1J9QA 1RZJH 2NPLX 4FFVD 4NZRH 4E42B 3FB8B 1QSFD 1VLXA 2XRAH 5H35B 2UY6A 2X9ZA 4HJJL 2HPTA 1IM3B 4BUGA 4S11A 1R3IH 3BWAA 4JLRB 2XFXB 4Q74A 3DTDA 3IMWA 4QRAA 4W9DC 1MCQA 5EZIH 3ZDYB 3Q6FB 5ESVA 5HVFB 1ID2A 3FONA 2CWRA 2WLMA 3WE6B 5LBSL 4KHXH 2A74A 3MX0A 1AOZA 5G4NA 1GJIA 4JRWA 1TJIL 4IDJL 1CLVA 3A4AA 4S10A 4FC3E 3Q8BA 1A5FH 1T2QL 3D05A 3N1QC 4EIUA 1ADQA 1K8IB 2NX5D 3ZKMC 2XG5B 3MZTA 4FXKC 1XQ4A 1RKRA 4YN3A 3W5MA 3AT9A 4QRUB 5A2FA 2IADB 2VGLM 3FOLB 1BVLA 2OMUB 4JQIA 4NBXB 1G9NL 5FYKH 2Z9TA 1CE1H 4UF7C 1QW9A 3O2DL 4F9PC 2F8VA 2HG5B 4OI8A 1G9HA 3AXIA 4XHQA 2XKNA 3SDDD 2IBBA 2EO9A 3I2CH 1J05B 1AP2A 3VRLF 4F8PA 2IDUA 4P23B 4E9QA 4QOKE 2YEVB 3B9AA 5IVXE 2WBWB 1CN4A 1D5BB 1OCWL 3D69A 4PJ9C 1P7BA 2J8OA 2GAZB 4EI5C 5JO5B 1QLEB 4JO3H 3S4SA 2J5LC 3KJ6L 3WFHB 5ICYB 2W1NA 3ARGC 1JZ3A 1A3QA 5LB1A 4EIZC 2F2HA 3DUSA 4TVPE 3GKZA 1DVFC 5EBGA 4YPJA 5IP4A 2YKLH 3D08A 3FCSB 1UD6A 3LPWA 5BV7B 5FO8B 3G04B 4QTHA 5AVVB 3KYKH 1M7IB 1B88A 1RURL 3JWDC 4GSDL 4XPAL 4YEEA 3PRZA 4JKLA 1FIGL 1K2DB 3B3IB 5TPWL 2HFFB 1RZ7L 3Q3GA 4MNHB 1Z3GL 3MRHB 1K5NA 2AJZB 2B16A 4Y9CA 1JZ4A 1YRKA 3ZDYF 1RJZA 2D73A 4XN5A 5C0ND 1XD0A 1K72A 1E8WA 3LH8A 2WLHA 4TKWA 4OZIE 2BWDA 3TOPA 5DLML 3V4VL 2ROXA 1ZA6A 3RVUC 4GEJA 1FC2D 3KL5A 4OQTA 4WK0B 4EOWH 2DYPA 4KV5F 3RWIA 2WY3B 4KNQA 4TQIA 4F92B 5F9OH 3A6CH 1MIEH 1MH5B 5DVNA 1IKNA 3K4ZA 2X6CA 3NJXA 2NZ9D 4HXBL 5K5YA 1B0IA 1N5AA 1XF2A 4NPKA 4RSYA 1OWRM 3KYMA 1CL7I 4NKOB 2X53A 4C55A 4RAVB 2E7MA 1XH3B 4FNTA 1P4BH 3K71B 3NJJA 5AW4B 4IMKC 3O8XC 1WTLA 1NANH 2CLZA 5E99L 5CJOL 5AVSB 2CO3A 3NCMA 3QPXL 3MCLL 4FP8H 2AKRA 3VYOA 3FO9A 1YEEH 1YYMH 4PRDB 5IMOB 2EXSA 1JV2A 1FO0A 1T89A 3MAWA 2VR7A 4FQQA 3QORB 1E5CA 5DRXB 2W0PA 4J7RA 1NCBL 3DRQB 5MEND 3G6JE 1JOIA 5LHDA 4UQ9A 3ZQ9A 5SWSB 3L13A 4Z0XA 1NFDB 4J2QA 5I1GL 4FQHB 1A6AB 2D0FA 5GIRB 5KJRH 3Q44A 2KDGA 1F42A 2YGOA 1HC1A 2CGZA 2LGNA 4XCFH 1Q9LA 2BY3A 3BUBA 1GW0A 3TTYA 5L2JB 2LQRA 3E2HB 5D5MB 5B38A 4TNWK 5EZLA 4JVWA 3VXMD 3QXWA 5CXPA 4G6JH 4G83A 3D9AL 1QTPA 5IB3B 4ZUWA 5HDBB 5IWLC 3X3FL 2HKHH 4MSWB 3OKKA 4JB9L 5HI3D 1MRFL 2JIXB 3QS2A 3VTTA 1FFTB 1BM7A 1BQHA 5LAXA 3DXAA 4BA8A 4Z3IA 3P0YH 3BPCA 1BEXA 1QSEB 1ZVYA 2DDQH 1NC2A 1WBZA 2PR9A 3CMOL 3HTLX 4UT7H 3WIFA 3BSZA 2QFPA 2J6WA 2YPKB 2ADIB 1TVHB 1RJLA 4XP9H 1H6FA 1QRND 4JFPA 4OLYL 2HB0A 1UKSA 1S5HB 3LS5L 3RNQB 4O4YH 5CJXC 1CT8A 3HR5A 1NTDA 3BPLB 4I5BB 2WLLA 4HSQA 3WFZA 1ZS2A 5AVYB 4PP2A 3NMEA 3PJLA 1KFGA 1R19A 3B8SA 3BFOA 2BZ7A 3IDXH 3L4YA 2R15A 4X6CA 4CMHB 2X4UB 3RNKB 5BJTA 1CE6A 1WJ3A 5KS9E 3HG1D 1XGUB 4PV9B 4P07A 3LV3A 3MV8D 5D70L 5CBEB 4A7UA 4K07A 4XNQA 3L1EA 3K5RA 3A47A 2EDTA 4PRBB 4QWWD 1S9WB 4XT1C 4OIBA 4APQC 2VDLB 2J71A 5F7FA 1TZOA 3ECUA 3EO1B 3S3CB 5FF6B 3ETTA 2AFNA 4JGJA 3OZKA 4QRQB 3L81A 4WLCA 2IGLA 4ZMOA 5FB8A 3MKKA 4L3AA 5D7IA 1JN6A 3WY2A 4Y4FD 1R3HA 5ICXB 4KKLC 4LOEA 3VXTA 3GSVB 1UUNA 4PG2C 5EEZA 5D5MF 1KWGA 1X6LA 4KQ3H 4Y19E 3MNDA 2P5WA 2WM0A 3IKKA 4O5LL 3FT2B 4PB0L 3UAJD 2JCWA 2NT0A 2HFTA 2QGEA 2OJ1A 4KXCA 5HDBF 4LOUD 5C2BH 2EVGA 2J56A 4TNVF 2AVFA 3E3QE 1OSZB 3G6AB 2F5AH 1B6UA 1RK0A 1XZWA 5CEZH 5TE7H 3VDAA 5FYKE 4Z1PA 3AABA 1PY0A 2L3BA 1JIBA 1LDSA 3JTBA 4FA7B 3QUXC 2OK0L 2JVUA 1DJWA 4OZFH 2DQMA 3VX0A 1KJ3H 3HE6D 1S9YA 4M6NH 3WE1A 5CJ5A 3CLWA 3HAEG 1RZGA 3K6OA 1DLFH 1B4LA 1JV5B 4H2CA 2IVFC 3SE4A 3WUWG 5GGQH 3BUQA 5CFHA 2XN2A 1OW0A 1U8IB 5E08H 3L3OB 3GXDA 2R8SH 1DL7L 2X10A 2JKJA 4LEOA 4JGUA 3DSNB 3RVVC 2ZYSA 4OZGB 4DGIH 3QDGB 4K3EH 7TAAA 5A7EA 2DOCA 4OCXL 4WFFD 3CZSA 3WN5A 1G9EA 3SDYL 1AR1B 6PCYA 3AAZA 3CUPB 3LYRA 1I8LC 1MNNA 3GIVB 1UA7A 3PP3K 2P8LA 3ZOAA 1EMTL 3SBWC 5JIMA 4P4KA 2CJSA 2EEXA 5I24A 1K3IA 3RDJA 5F6IB 4WWNA 1QPPA 1RJYA 1ZK5A 2A6KA 2Z92A 3D6GA 3RWJB 2ZXGA 4RVBA 2UUDH 4Z7VB 5DGRA 3VG0L 1AHWA 1NKGA 5LAPA 2FH6A 3C08H 5DD1L 5KYXB 1QO3A 2CJTA 4MASA 4HV8B 2CM5A 2FEJA 1AO7A 2HLFC 3MOAH 5E5LA 4BRJA 2XWTB 2IQAA 2G9HB 3SB3A 4LCCC 5IOPB 1G7HB 1TEGA 2EIBA 4V11A 4A68A 2UXTA 3H9SB 3T3ME 4N2OA 4EBQL 2NY6C 4PUBL 2CDFB 2XT1B 5D4HA 5FM8A 1A4BA 3UFIA 3O6LH 3V5DB 3IMTA 1KYUA 3BZEB 2PTUA 3OLIA 4QI3A 2DMBA 2N01B 5IHUH 2PYEA 1Z5LA 2NNXA 1WEJH 2BS71 3CFUA 3K2UH 3VI4B 4D9QD 4DHLA 1TOXA 1A64A 1SYVB 1D6EA 1YJDH 5H94A 3WS3A 3PXHA 5AW0B 3BD4A 1DLHB 1NCDL 3EBHA 2FGWL 5BRPA 2QFRA 3KVQA 2XI9A 3TT1L 3BRFA 4ZO7A 1JZFA 4XCYB 5T1MB 1VADA 3FRPB 4ODTL 1AC0A 1MAKA 2AK1H 5TDPA 3HG2A 3ARFD 1N10A 2LT9A 3L3KB 1C5CL 3SY0B 1S5IH 5EU6E 3SDCD 2ZUVA 1CBJA 1QNZL 2QZQA 3GSQB 5FHAL 5JHDB 4OZGF 3BH4A 3V4PA 1JHTA 4JREC 1RZFH 5D55A 1UWEL 3PABA 4ILDA 4FA8A 1T7XA 1DBBH 1GSKA 2LU3A 3JWOC 5CGYC 2ZKHL 2A77H 1IQDB 4HJIA 2GITB 1F18A 3HFML 5FA3A 2B8OT 1QLEL 1FHNA 3LIZA 1ZTMA 3QA3B 4GAGL 5J06A 3QIBB 1A4JB 4ODHL 1E43A 1BZ8A 1VSCA 3BHBA 2HN7A 4G9DA 2R59A 4PJCA 4U6YA 4X4KA 5IBTH 1HZLA 3SE3C 4Z7VF 5BV7L 1I1AD 4AK1A 5D7EA 4BSJA 3ARGD 3HC4L 1FNGA 1PYWA 4M8QB 5KSAC 1LK3L 3KPMB 3O4OB 4R7VA 4JFUA 5CSZB 5EF1A 3S8FB 1UM4H 5IQ9A 5E4IA 2AJVL 5KVDH 2UXGA 4L5FE 1ORQB 4PRPB 4FG0A 5I30H 4F5CA 3PG2A 1BMWA 1QP1A 3QDJA 2YWYA 5H8DA 2Q6WA 1X7SA 1KB9K 4YFEA 3OHXC 4U0RB 4LIQH 1XGTB 1VESA 3VI4F 1AGFA 5IEHB 4KPHL 5GZND 2I9TA 1FYHB 2N7AA 1ZTXL 3NJVA 4HFWA 2Y7SA 2WZPA 3VFTB 4AQZA 5I75B 3EJPA 2FX8H 2WLYA 4UV7L 4I0PC 5HYIA 2CRIA 3TBWA 1EO8H 2YPLE 1NIDA 4XXWA 5C3TA 4APXB 5K9JH 3MRKA 2XN9A 4E41D 1LK2B 3MI6A 4NN7B 5L2KE 1NH6A 1F11A 5K33A 2NW2B 3JVGC 4DZBB 1T6WA 3W1ZA 2HT2C 4YZFE 2X09A 5BMFH 1SBSL 5LLIC 1NAML 2BP3A 5FUZL 4R97B 2XTSA 4QTFA 1ESOA 2J6EL 1VPOL 1QI3A 4KI5C 5J9PA 4OM1L 3CFJB 4DFIA 4YDNA 4E5XG 1X5IA 2D0GA 2EC8A 4AZUA 3MGTA 3QEQA 3B9KC 1BZ7B 3MHZA 4LPTA 4I13B 3VJ6B 4YSCA 3OF6A 4Z7OE 3RZCD 4F7TB 2HT3D 1E4KA 3O8XD 4NCC1 3TIDB 3L5XL 1LO2H 5E6ID 3MR9B 4OIIH 5C0RH 2CSPA 2H26B 3LNEA 1TQBC 2EE0A 5D7JB 5HDOA 4G7QB 4WEBH 4Y2DC 2QPFA 2E4FA 4P4RB 2IC2A 5A2BA 5ACLA 4R84A 5DZPA 3VM5A 2MCMA 1E5BA 1YEKL 3GTTA 1K6QL 1QUNA 3IE4A 4FE9A 4AH2B 1DJZA 4YFLF 1RMFH 4YPGB 2EUXA 3RTQA 4QHUA 2HA1A 2V5YA 1JGDA 4J4PA 4KK8D 2MRYA 4L8CB 1Q9WA 1TTCA 4PJ8B 1MCLA 4ZO6A 4NYLB 4M00A 1NOAA 5CEZE 2JB5H 3G9AB 1EXUB 2DMHA 4K7FB 2OR8A 3NZSA 4ZD3L 4GXVH 2VMCA 4OB5L 3TNNA 2ATPA 5EDXA 3VXUE 3QWOB 1ET5A 3GMLB 1HOCB 3EDKA 3LZPA 1XGZA 4MCNA 4ZTPL 5B39A 1JZEA 4NRZB 3DUUA 3VXRB 2E7CA 2JJUA 4G6FD 5DVMA 2JKIS 4I77L 5CCHE 3W0WA 3H4FA 3ZE1B 4L8BB 1T20A 2ZSWA 2PUQT 5FK9A 4XC3H 1MCFA 2AEPL 3ASOB 5DDHA 5ENWB 5C3IA 4NN6B 1UYWH 3MRCB 4XAWH 3B1TA 1O5PA 3IF1A 2WYIA 3R1GH 4JANA 4MA3B 1GJUA 3KLKA 2ROYA 1W72A 3OX8A 4NIYE 4XNXL 4MA7H 5DEZA 3F12A 3SKNA 4DK6A 4NB7A 4M4PA 2OMXB 1CGTA 1INDL 1ZLEA 4U7SA 4JG0L 43CAA 5CEYB 5I1LB 1GOHA 1JWMB 1J0IA 3RIAK 3WJMB 4XCEA 3BW9A 3UBXG 3VH8A 2R0KL 1XR9B 4TVSa 3FMGH 1OGAE 5D4JA 1VGKB 4W9CC 2D7TH 4KMTH 4U0QB 4XN9A 2AI0H 3S37X 1L3WA 1VKXB 2XZQH 4N2KA 2PMZA 2EKJA 5A43C 2B4CL 3LN9A 3HC2A 3QC5X 3QNZA 5DQJA 5BO0D 1S6NA 5A6LA 1PY9A 3BWUC 1CQYA 1DBKH 1ZHLB 3SEPA 4XN2A 1M53A 2VDLL 4LHQB 5IM7B 3CZUB 3FTYA 4MXVE 3WKMH 4KZEL 4ZYKB 3DVFA 1QTSA 1A1MA 5TF1H 1I75A 3TBSA 1WFIA 1KENH 4APQD 4NCC2 4NC1C 4WI6A 1QSFA 3MUY1 5AKSA 3HPLB 4MMZB 4OD3L 1B2YA 4IOIA 3H2WA 1ZRUA 2VXUH 2R0LL 4G9FE 4Y5XA 5INCB 3NRFA 4FMFA 4IBTA 1YAIA 3FB6A 5DC9B 1AJ7L 4NSKB 2VMFA 3E38A 5F9JA 5K39A 2R4RL 3P9LA 3I3BA 3UPRA 1YHPA 3SE8L 4LLMA 5T1LD 1A4CA 2FL5A 5A6MA 1I53A 5E4EC 1S7WB 5L6YH 4JN1H 2GI7A 4TVUA 3ZE1F 3HRZA 1HL8A 1WT5C 5L8LB 4PW9A 3V8OA 3BSGA 3FT0A 1PFCA 3RWGB 1BG1A 4JQXC 3DX6A 3CC5B 4CU6A 3KYAA 2WC7A 2EDFA 3QCVH 1TZ8A 3IGAB 2JCCB 2AEIT 3NIGE 4MAUH 1KCKA 5AOLA 3TNMA 4DKEL 4A6YH 1DFBH 2QHRL 3FKUS 3KPOA 4P2QA 3J8F7 1T0NB 1QWHA 4FYRA 2F74A 4JRXD 2AV7B 4KNUA 4UIMB 5HHVH 1X5AA 3VQ2C 4PVMA 3HW7A 5JPMA 2J8UB 2OULB 4BH7B 5I1IL 4D0CB 1N0XH 3SDDA 5CWSB 5D7LD 3PGCA 1IC7L 1GHFH 1MRCL 1KYOK 4HKBA 5CCJA 3OPZL 4XPHL 4JFXA 5IGXH 3CXDH 2H32B 3AT8A 4RGND 1SMOA 3UROR 3ME0A 4MLIA 3LKQA 1MREH 3MBWA 5JUEL 3QG7L 2XLLA 3KGTA 4FHBD 2BVPA 5KVDE 1IARB 3DOSB 3B2DC 1XGRA 4F3FB 1FZKB 1KCSL 3UBHA 2EVHA 2ZPKL 4N2GA 2BOLA 2NY7H 1XXDC 2J12B 1U93A 4G8AC 4YAQB 4LIQE 3HAEB 3GSRB 3UMNA 5ADPH 6FABL 4UT6H 3IRCA 3RWFA 1J10A 3QJTB 4HSAC 5J12C 3KMDA 4PREA 3ILEA 1JGUH 4PGCA 4L1BA 3BVDB 5AG9A 2DEWX 1NBZA 4M7JH 1JPTH 3PGFH 4G70B 1A3LH 1ADQH 4Y16A 1PD0A 5B7MA 1LEKB 4M7LL 4RESB 3V6FA 3WV0A 5KSBA 2EYRA 3BP4A 2D31B 5MP6L 5CM1A 5AAWA 4JQIH 4HLZG 5JIIA 1KNOB 3VFRB 4YQXL 5IVZB 2IAMA 3T0AA 3I02B 3QZWG 1PKQA 3P4OA 1YO4A 4U1LA 4NUPA 4P46D 1PG7W 4J3OH 2RJMA 3TS8A 5DK0A 4XMZA 4UOW1 3UTQA 1MCPH 1O7DC 4F7KA 1KULA 3DX8A 1WWWX 3M86A 2KPWA 4KQ0A 4JFFE 3FB5A 5KAQF 4JFWA 1MJJB 2DWTA 1EVUA 2ICES 5EA0L 25C8H 4WHDA 3BLKA 4MJID 2EABA 3LRSB 5HVWA 4X5QA 1XIWD 3TVMD 4AE1A 3UACA 1H3PH 4X8GA 1ASPA 1NCTA 3P2BA 3S96B 2A6JA 4MKTA 3SDAC 1NCOA 5F0MB 5IB4B 1R24B 2J1YA 4ZSOA 3WKNA 4K23H 4F33A 3BIKA 5A1AA 2YXMA 3QI9C 3U1SL 5CGYD 4KROB 4CSSA 5HHNB 5MENA 4OZ4A 3D50A 2CIKB 4HT1L 3AZUA 1I7ZB 4UILH 1HEHC 1G7LA 2EXTA 3M88A 5DRWB 1DBML 1ZSHA 2CRYA 1MCHA 2V37A 4AQ1C 5TDNA 3H2QA 4X99A 2DH3A 4OQTH 3B4NA 3AACA 3EYUL 3W9EB 5AVWB 3W38A 1T83C 3PGDB 2BIOA 2VZOA 1HL4A 4EZKA 2R7EB 1S8DB 3EO0B 3CWGA 3VXMA 3FU0A 2GG1A 4X2UA 2IQ9H 3DHJA 1K4CA 3QH3B 4CVXB 1IC4L 4RAUB 3VO0A 2CGYA 1S4IA 2BSTA 3MJ8A 1E2WA 2WSKA 4H1LA 4O9HH 4JFDA 3FN3A 3H8NA 4JKWA 2X4PA 1FYTD 4XMPH 1BW8A 1W8NA 3LRMA 1AAJA 2Y7QB 1DQQA 2HMID 4IRSC 3EYFA 4M1CD 1ZWIB 1M9WA 4N0YH 3P4NB 3U30C 1UWFA 1Z9SA 2Q8AH 1TMCB 1TENA 2A9CA 1F90H 1I8KA 2NY1C 4N2CA 3WMQA 4UTAA 5E2VH 5D4IA 2HT2D 5HGBA 2DMGA 1FCGA 4QO1A 1GC1L 3LKNA 4WFHD 4K2UH 5HJ3B 4Y4HD 2YUVA 1CYWA 5IR1A 3FRUA 3O4LD 1MIMH 2XZAH 1YYLL 3HZVA 5DD3H 2AJ3A 1GMEA 3GMOB 1JZIA 3A67H 4PJ6A 3NCWA 5I15L 1HCYA 1OARL 1JGLL 1DQVA 1RUPH 3HG1A 1JL8A 3ZSTA 5GSRA 3DV6A 2R0ZH 4GUQA 4XOEA 1N8ZB 1A7PH 1WBXA 1I7UB 2Z8WC 4NRXA 1MEXL 1WCQA 1IC5H 2H3KA 4ZUTA 4ZAKD 3IPEA 5EC1A 3IGFA 1RV6X 4R26L 4IU3A 4KRPD 3MC0A 4XN8A 5A40E 1ETB1 1CGXA 2FX9L 3FQ1A 2X4OB 3OG6B 3VD9A 3NJHA 2PO6D 4MQ7B 3Q05A 1AS8A 1GZQB 1SGKA 4P3WA 4X5XA 4N0CD 3GPSA 5AB1A 4D8PB 2C9UA 3IB4A 5A2IH 1PAZA 3GSWB 4LSRL 3BSZH 2LFEA 2BXZA 3UAJA 4EUPB 5ICZB 1FZOB 4S1RL 2W91A 2LTQB 4LL4A 4ZT1A 3DDGA 1CBVH 3FB7A 3OB8A 4TSAL 2HX8A 4Y4KD 3PUUA 3ZUNC 4OH2A 3ZL1A 3KLHC 1AFVL 4YHOL 2Q10A 2PKDA 3LXCA 3RGVB 3QNXA 4PJ7B 4S0HA 1J11A 5IB5B 3OZ9L 2I7SA 1DE4B 1A7OH 1BREA 1DSYA 2XYCA 3I9IA 3SKJH 3UTPE 3X1NA 1NGZA 3AY4A 1J1PL 2UWEB 2VDKB 5GRYA 4JY4A 4N2NA 4NFBA 1U8LA 1YEGL 1C12A 3VXQA 2QADC 3TIEA 1KIQB 4UAOB 4NQDA 4FQXD 3OMAB 2F53B 4JGNA 4OD2B 2FYYB 4NUJB 2HX7A 3WJJA 1N5YL 3QK0A 5J57B 2XZCH 2VR4A 1UD5A 3EFOB 4OSUL 2HX9A 1HHKA 2CKBH 4RGMC 1YSOA 3STLA 4W9GC 4NT6A 2NXZC 3EYSL 2BHUA 3NABL 1BMZA 2FD6L 2Q76A 2ZNXA 1IAKB 4D0BA 2X38A 2WUCL 3TBVA 2EDXA 3U83A 1YCSA 4WIQA 1OPOA 3OB0K 4NO5B 1JS4A 4KDWA 2XDHA 2VDRB 4KZDH 2VMDA 5EUOA 2JJSC 2ZAHA 4F8LA 3V6ZB 2GTWA 5ETUB 1YEFH 3HOGA 4OGAD 3LEYL 1D5ZA 1IBBA 3MRLB 1L7TL 3TCTA 1B0GA 4ICXA 3K6DA 4FQIL 4FS0A 1T1ZB 2BP0A 4LDOB 3WO4C 1UM6H 2AEWA 2CXKA 1T6VN 4HIJB 4YHNA 2D9CA 3WI9A 3BDBA 5D2LB 1P5UC 1CXEA 3MBEB 1EO5A 3QCUL 3EYOB 3LN4A 4BEIA 3QUML 4NN5C 4IBSA 5C1MB 2CH8A 3SCMC 5C08B 3KHQA 2PWGA 1A1OA 1D5MA 3X1BA 4PJ7F 2A83B 3B8YA 3GYRA 1ZT7B 2GHWB 4WGWB 3PHQA 4AQ8C 1JUFA 4MHHG 2BDNH 5T3XL 3VXNA 2UWEF 2OMWB 2YLKA 4FYTA 5FECA 2WKOF 4ZMLA 1P7HL 3SDCA 2JKWA 4FLHA 4Z0BL 5HYSB 2GJ6D 3GJFB 4P49A 3IAGC 4NQEE 4PG9A 1TU2B 4MVBC 4OCWH 4URTB 1H8OA 4M6OL 3STZB 1MFNA 4DP7X 2DMKA 5BW7A 4P23D 2BOBA 3UDWC 5AEAA 1HDMA 3V7MA 4CKQA 4YDVA 2W9EL 2FATL 3MRDB 4X4ZA 4UTBA 3KHOA 4WTQA 2FIRT 5I0ZA 5IJBC 4K7PX 3W81A 2BCKA 1FL3A 2KLSA 3DJZA 4PFEA 1TPXC 1JMZA 5D6DC 3RWHB 1MRDH 3P0VH 3SE9L 4JG9A 3L45A 2P80D 4XO8A 4I9XA 1NMBH 5AKTA 4Z7IA 3QIUC 5K9KB 1RULL 2XIDA 1FAKT 1LE5B 4GG6B 1EPFA 4AYFB 4UU9B 5I8OH 4G8IA 2VAAB 4ENED 1G6RA 4TQ8A 1JPFB 1I3RA 4Y5VA 1BM3H 3NGBC 3TBTB 1QZ1A 4WI0B 1X5XA 3AU1A 4ORGB 2VUYA 5CGTA 4XVJL 1CI5A 2PCFB 5E23A 5D2LF 4M1DL 2XX1A 1YNTA 4ZTOL 2ED7A 3HS8A 1Q0YL 4Z3GA 1AKPA 4GO9A 5LCVL 3H6JA 4NO0D 4E41A 1KN4L 3Q6GH 2ZG3A 2HRLA 3GMRB 4JL2A 3HUJB 3L6FB 1ES0A 4LLVB 3V4PH 4Q9RL 3IMBA 5C6PB 4CBZA 2FRGP 4BFIA 2YRPA 3NFSL 4U1KB 3QQ4A 1CIUA 1G87A 1HN1A 5HDWA 2DQGH 1L9OA 3PNWA 1I1YA 3AREB 3B5HA 3P77A 4LCVA 3PXLA 4WUUD 3EH4B 1L5GB 4DP6X 5JW3H 2MNUA 1AGDA 3TJHD 3RZCA 1VAHA 3JV6A 3VXSB 5E8OB 3B2XA 4J12A 3ZDXB 4AIZA 5F96H 5IMMA 1A7QL 2CK0H 2QPSA 1NEPA 5ISZB 2BNRD 1MY5A 3P3SA 4ZTEA 4A2FA 4AUYA 3PWPB 5E6IA 3U4AA 5B3SB 2C9RA 2XIIA 3RDTC 4JG1H 1ZS8B 1DSFL 3HN5A 4ANKA 4JAMB 1BD2D 1WS8A 5JXAH 1B4JH 3QZWB 5IFHH 2CK2A 3D4GA 3DXAE 4HJEA 3MLYH 1MCRA 4HQQL 2ZUSA 4J3SA 5DR5H 3NZHH 3RAJH 4OCRH 4K8RH 2IH1A 3OHXB 2OXHA 3ZL2A 2FTAA 5MEPA 2H41A 3CVCA 4OLWH 3D4YA 3OLEA 5EO1B 5BUAA 1N2RB 1Z66A 1IT9H 2QGCA 1VEOA 2B77A 4RMVA 4X4XA 3ZKQD 5LQBH 1E9PB 2NYYC 4PRNA 1T21A 4FTVE 3WNIA 2PABA 2OXGA 1KLFB 3HI6H 3VRIB 5LNEA 1J8RA 2R9HD 4BGLA 2HLAB 5J13B 4I89A 4LVNC 1P5VA 1OB0A 3O2WL 5D1QE 2OYPA 4ZFZB 3TPKA 2DQHH 5F3HB 3V8CA 1XZ0A 3DV4A 4P8QA 4RDQF 3L5JA 4RIRB 4X6CE 5D1XE 5DO8A 5FKAB 5J6HB 2JIXD 4WW2A 5IQLA 4KRMB 1KCBA 3MODL 4I3SL 3VE0A 3NPSC 3IGUA 5IFJA 4BQ9A 1QSED 1X5YA 2WCGA 1F6LL 2Z93B 3IXTA 5D6CB 1U3HB 1VRSA 1S7XB 3NAAH 3HUJF 3GC3A 4KMLB 1PU0A 4DGYL 1O6VA 4N28A 1RPUA 5JR1L 3DIDA 2IWFA 3K72B 3WDJA 3QZPA 3MV9B 1UXSB 4PCKA 2DLGA 3S36L 4ZUSA 1TITA 1NCAL 1OGPA 1KGYE 3IU4L 4HX1A 4G11A 3FU7A 5DK3A 1LO4L 2YD0A 3LKOB 1MNUL 5EWIL 3BGAA 2MCPL 3KWTA 1AZUA 3NIDB 4WO4D 4YDLC 1MG3C 3D33A 3VFPB 1M05B 3UADA 3ZDXF 3LKSB 2YAFA 3W11C 1ZSDA 4M1GL 2IANB 4N2IA 3W2DL 5C8JA 4ZMYA 3I6GA 2FO4A 5BZDA 1OQOA 3HMWL 1KJVB 2AJXL 5GJTH 3N91A 5AOKA 5H4YA 3HN8A 2NR6C 3WO3B 1I9JL 1XF4B 4IJTA 2XHNA 2CHDA 2YA2A 4AEEA 3DVNB 1PDKB 2KC0A 1G1YA 4X0NA 5KSVA 2QDWA 1DVSA 2OPCA 1MW0A 1DZBA 3HE7C 5F0JB 2H6PA 4JO1L 3LAFA 1T5KA 3MNVB 4WU5B 3U4EB 3OWEA 5EDSA 1WBYB 2E59A 4IS6B 4J1UA 4PLKD 5C09A 3T1FA 4U1MA 1EJ6A 4CN6A 5BVJA 5EO0B 5I6KA 2WBJA 3BH9B 1N0LB 1OKEA 4NC0B 2RD0A 2NTFB 2O61A 4JO2H 1GS7A 4A7QA 2J1ZA 3FT9A 2AXHA 1G7MA 3KPRB 3OAZH 4F9LA 4BCYA 1R5WA 3L1OH 2GSIA 2DI9A 4G7YL 2KLRA 5T1LA 5LBSA 3S5LB 4FJZA 4YXLL 1S7RA 1CU4H 1FVDB 2IO5A 4YFLI 2CIIB 3RWCB 4YDKH 1BECA 5BZWB 4OVUA 1FP5A 4NQXB 4EF3A 3MCYA 4FA6A 1NM4A 4KAQH 3K2IA 2YUXA 3ZT6A 5ES4B 4Q0XL 2E6PA 4J27A 4R8WL 3R06B 3ZYJA 2DBJA 5FHBH 2GW5A 3H3KA 5FDWA 4J5VA 5I1CL 1CTMA 1G9ML 4OF3A 3TV8A 4Z6AT 4H0HB 4WQOA 1TQCC 5DQ9A 2VDKL 4JRXA 5DK2B 4CNIA 5CKAA 3O2DA 2OL3H 3IFOB 1X4XA 1F4YH 4K71B 5CN1A 1QPKA 2VMJA 5KUMA 2H2SC 1QPXA 2DWXA 3NCEB 5D7LA 4MCYA 2VN4A 1AR1D 4Y9EA 3EFFA 3I6LE 3ARBB 1FW