3HG0A

Crystal structure of a darpin in complex with orf49 from lactococcal phage tp901-1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
137
Chain Sequence
GNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPIDHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baseplate protein
publication title Crystal structure and function of a DARPin neutralizing inhibitor of lactococcal phage TP901-1: comparison of DARPin and camelid VHH binding mode.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Protein binding
total genus 23
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hg0A01
4HEPA 2BSDA 4IOSA 1ZRUA 3U6XA 2F0CA 3HG0A 3DA0A 3EJCA 2WZPA 2BSEA 4HEMA 3D8MA 2X53A
chains in the Genus database with same CATH superfamily
3ULSA 4Y89A 1SY6A 2EE9A 3QP3A 2O1AA 3NA9H 1PDKB 4KQ3L 3TO4B 3ULUF 1DR9A 1MKFA 3DX2A 1NLDH 1QG3A 4EZJA 4I0PA 4O02A 2W88A 2V7HB 2CMRL 1BJMA 4OF6A 1I75A 1HKLH 4CVZA 4F33A 4OCYL 1MXGA 4NKDA 4AEIH 2PO6D 3HG1D 4L4VD 4Z18A 2Y2WA 5FFOA 3QGVA 5FYKE 2EXWD 3RWEA 1NL0H 4L1DA 5IBLD 1AXTL 3UERA 4RIRA 1IFHL 1R19A 4MXVF 4Q6KA 3STLB 3MFFA 4PM1A 35C8H 4H88L 1YAZA 5FKPB 2F7IA 4U3SA 4X6EB 4TRPH 4PRIB 3HN5A 3QUYC 3UBXB 1J0YA 1CD9B 3HFMH 1XGRA 3NIDE 4HMEA 4WW2C 5D2LA 4ZUUB 3UYPB 1IL1B 4HLZG 4X6BA 5CKGA 4YDKH 4JFDA 1SBBA 3MRPA 3LHPH 3SDCA 1GOFA 2HN7B 3DVFA 5A43C 2YXFA 3F6JA 2A4CA 4XVJL 2Y7MA 5GGVY 1PQZA 1JF1B 4JG5A 4K3GA 3PL6A 4U6HA 5FO8A 1HIML 1UENA 1NM9A 3HR5B 1U3HC 5CGTA 3L6FA 3FT9A 1QKZL 1UD8A 2KH2B 2Y7QB 3IDIB 1S8DB 5F70A 4PJBE 4X4ME 4S1RH 3TEYA 4PYHA 4MSWA 1ZPLA 3SY0A 4UTBH 1F6AA 4GUCA 1TCRA 4KV5E 1JPSL 3V95A 1IU1A 3D69B 4BA8A 1AD0B 4KROB 4OLYH 1YNTF 3NRQA 1IJ9A 4GIPD 4HX1B 2XWXA 4LSSH 4Y5VB 3PABA 4QRQA 5ID0B 1SXAA 4FXGC 3DX3A 4MNQB 1XIWD 3CZSA 3L5WA 5D2NA 5MEQA 1V7MH 1B88A 5KAQF 2E7DA 1TQBB 5CIPB 4TOYL 4MJHA 4E9WA 4L4TB 3R18A 1SBSL 1Q4NX 3MRJB 3QXVA 5AYQA 4YUEL 4DPAX 3UCRA 1B2YA 4UQ3B 3KNBB 5EUOB 1DP0A 2DD8L 2H26A 3CTTA 3IM1A 3LRSA 4UYQA 5L4IA 4UM9B 2C3HA 2V2XB 1MI5D 3GT6A 3KE0A 4N28A 4X5XA 2B15A 2CJ3A 2HUEA 1AO7D 3D34A 1S7XA 1ZTXH 1XXDC 2AZAA 3GJEA 1CL7I 2AXJA 2IH9A 1MFBL 1J8RA 4AE0A 2KZKA 3GNML 4AYEC 5C0GB 3EGSB 3IU3B 2WTOA 1A6UH 5A16A 3AS2A 5CM1A 1IC7L 3RL1B 1FDLH 4JREC 4MXQC 1UQSB 4Q4IA 6CGTA 3HI5H 1IGJB 5G2NA 1LYQA 3IJ9A 3LTVA 1P7QA 4ZFOL 3W9EA 4QT5A 1CMOA 1RP8A 5LVEA 2AVFA 3APNA 4BQ6A 4GI9A 4UCFA 1E4WH 1C1EH 4APQA 3H9SA 3HCVA 3V6ZB 2AK4B 1EEYA 1VSCA 2W59A 2X4PA 3WSQL 3WDHA 1QI5A 2X1OA 4R0LA 2TAAA 2R0ZL 3PQYB 2L3BA 3G5ZB 4WNSA 3ULUE 1RU9L 2RTTA 5GGQH 1DSFH 4CU7A 2VLJE 3HG4A 5C9JA 1NZRA 1QLFA 2R2HB 1X5IA 1ZHNA 1YECH 2IXQB 3FN0L 5IVOA 1UM5L 1S7SA 4P5TC 5DEFA 5E5LA 3VGDA 1I9JH 2J88H 3TGXA 1J8HD 4NBYB 4IJ3B 1C16A 3UTTE 3OLGA 4YOKA 1U95B 1N3NB 4NS0A 1R3JB 2X3AA 3KAAA 5FA4A 5GQBA 2AAVA 3X12B 4LCWD 4Z3HA 1V55B 2OPCA 1FORH 3O9WB 4LHUA 4YSEA 5HYFA 4J8RA 2CKBL 3LZPA 3KPSA 3MV8B 4HUVB 1ZJAA 3V4PL 4WUUE 3MJ8B 1QLEB 3NA4A 5ICYA 1YLBB 1P4BL 5K69A 4TQEH 2PCPB 4HU8A 1G7QB 1BBJA 2VXUH 4PAZA 1MG3C 2FSEA 1GC1C 2Z31C 4K8RL 2ZYRA 4WSKA 2YZ8A 3PS6A 4K3DH 2MCAA 1BX2A 2J8UA 4AI7A 2LTQB 1VFAB 3P4MB 3PGCB 1ZXKA 3TBSB 3EXJA 1HVXA 3W11C 1DHKA 1TEYA 3DRTB 1DLHA 3PP4H 2X70A 2A6JA 4XVUC 3UBXG 1A1OB 4AUYA 4BXVA 1JJUA 2IALB 3MNVB 1JFQL 1JZ3A 2HJFA 2ZCHH 1HAWA 3HS0B 1UUSA 3TCLB 3KLAB 3ARZA 4L1LA 2PWHA 5I6XC 3QI9A 2F53E 3PWUB 2JNZA 5BRZE 3UBGA 1CTOA 4YDZA 3U6XA 1L7IL 4JM2A 2DIBA 5HDLA 1PFOA 2R51A 5I15H 2MQCA 4Y9BA 1YJDC 3VO0A 2AV7A 5EBLB 3FUKA 3DSNB 5DR5L 5BV7L 1MH5B 4M61B 5GGSA 1DE4B 4GKLA 3GXNA 3O6FA 4PHXA 5FA3A 4XOBA 2G2PA 2YFOA 3OR6A 5DFWH 2EE3A 4EZLA 3SGEH 4ZOAA 3S5LA 5IFHH 2QHLA 3GSWA 2HT4C 5GRYA 1GH7A 4IBQA 4IS6A 2JB6B 3FS9A 1ZHKB 4WFFE 3EDJA 3ZGIA 1XO8A 1LO3L 2Y7SA 2ZG1A 4NBZB 3L3HA 3AAZA 3GBML 1ZOXA 4F57H 5FW8A 3HAEG 1MAML 2XIBA 4Z6AT 4YDIL 3I9PA 5DMJB 1HZKA 3CDZA 4NWTH 4YWGH 2NY2C 4B60A 3CZFA 3EFDL 4IEFB 1F42A 1Q9KB 2GBVA 4XCCH 2EDHA 5C09A 4DUXA 3E38A 5FB8A 2WNXA 4KK8D 1UASA 1FL5B 3D4GA 4JGUA 3PNWA 1KV3A 5ESVA 5I8KL 3NN8A 3O4LA 4AWJC 2Z93A 1ZSDA 4F20A 2J7LA 1TZIA 3LKNA 5A40E 4GRWE 4W4OC 5C6TL 4E36A 4MQXD 4J39A 4EI0A 3FRPA 4BZ1L 4PS7A 3ZTJH 4NSKA 3FT2A 1F1GA 4YLBA 2DQDL 2P5WA 4BK4A 3X3FH 1SDAB 4FLSA 4YPGA 2OYKA 3LN4B 4HULB 1KB5B 5IQ7L 5JLZA 3QE5A 1PD1A 4TNVF 1ZCRA 4XZ4A 2EVGA 3NSXA 2X9ZA 2YZ1A 2Z3FA 1VB9A 1AQKL 3FONA 4GXFA 4K3HA 3V7AE 1A9VA 4YDMA 5KVGE 4JFXA 4Z0BH 1NFKA 1TSHA 1MHHA 5HHOA 5BUGA 1UOVA 2YOAA 1MCBA 2ZX8A 5AOLA 2GJZA 3L1GA 2W8CA 3RL2B 1D7CA 4JPVH 4UV4L 3DX7B 1FL3A 2BWDA 3DX1A 2K6WA 3FZUD 4HS6A 4POZC 5DJ6A 5B1BB 4JO3L 1DVTA 4HQQL 4G8IB 4Q52A 3Q8FA 3QUYB 2YKLL 3VTAA 5A2FA 5TF1H 3VXUE 1JXDA 2B5IC 4WW2B 1FZOB 3KM2A 4L4JA 4QXVA 4L37B 3QUZB 3ESNA 3VFTA 2IOOA 2YBRA 1KT2A 3R8BB 3PHOB 4H2CA 4XBEL 1TZGH 5GJTH 3T4AA 5J3HD 3O6ML 1IM3D 1OT4A 2CHNA 4KI5C 5EN2A 1PY0A 1SJHA 3C5JB 5J13C 1NFDB 4K94L 3V55A 3KPOA 5I76A 3S8GB 4YJZL 3GHBL 3D85B 5AVQB 3PDGA 1U3HB 4QAMB 3V0VB 1UZ6E 1CYXA 3F7VB 3U48A 4QHUA 3ENEA 4FNPA 4UB0L 3B37A 1RJLA 1UGNA 5IB2B 4ODXA 2YD1A 3BUPA 4ZQKB 3MUHL 4JFOA 4H8QA 4G11A 3BZ4A 1A2YA 4IU3B 3QFJD 2DMCA 2DLTA 4NPYB 3DYOA 4FXGB 1JF6A 4Y4KA 1AQDB 3CFEB 5F7FA 4U1NA 3RLSA 4A7TA 2CLVA 3T8XB 2WQAA 1YMMD 5SX4H 1EEZB 3MJ6A 1DEEA 4Z3FA 1HZLA 4GAGH 1ACYH 4U1JB 1OP3K 4XMVA 5EO9A 3IXTA 5JNYA 1XR9B 2I26N 5EC2B 2HXAA 3THMH 2X87A 2ZUQC 1QO3B 2DOCA 1RZGA 1BQ5A 2JLLA 3G9VA 5HYIA 4N2KA 4UTAA 2OX5A 3L3GB 3OX8A 5B4MC 2P26A 1DJWA 1D5IH 2FZ3A 2FNBA 3KCPA 4F9PA 4PLKD 3HMWL 1ZDQA 4M6OL 5E6IC 2YEVB 3CLWA 2RALA 3KS0J 3MRLB 3BKYL 5IVXA 2DKMA 2X4OA 3BLKA 2Q3AA 1AYOA 4JREB 5D7SH 1HFUA 3OLEA 3NGBB 1MJJB 1MLCB 4KHTH 5KBMA 2HLAA 2WGNB 4WEBH 1QRNB 1QAWA 3RTQA 1GS7A 2IPTH 4JFFB 4OLVH 4EN3C 1T6WA 3G5VA 5D7IA 3G7TA 3VI3E 1NAKH 4E9RA 2MTAA 2CLZA 4PVNA 1HYSC 1L9SA 5E03A 3RY5A 1YRKA 4P2YA 15C8L 3ZN6A 3RA7H 1NGQH 4HF5L 3RIAK 2DQFA 2B2XH 5EIIA 2VXQA 4R7XA 4A2GA 2ZF9A 1KGJA 1I9IH 4I0PC 5EZLB 1WFOA 3D2UD 4QNPF 2ZZUT 4N2AA 4MAYD 4PJIA 3K2UL 3KW7A 4PY7B 2X88A 5J1AA 1OK0A 3D1MC 4P5TB 2IAMA 2EDWA 1P2CB 1JZGA 5KVMC 1OPOA 5EEXA 5CEZE 2IANE 2CRMA 5T33H 1HQRB 1II4E 3U2JA 3CVHH 1GZHA 3MBEA 3MV11 1DUZA 1HI6B 3O6FD 1IM9D 2QMKA 1DBMH 4YBQD 2G0KA 2YUWA 4AV5A 1J9RA 2QQKH 4XPHH 2WWMC 3KMDA 3IXAB 1BWMA 4DP6X 3G6AA 3UTPE 4H20H 2ZKHL 5J11C 2JQZA 1GY1A 3S48A 2DQUH 2Y7NA 4DP9X 4V33A 1TJHH 2Z31B 1XCXA 1IC1A 5D7HA 1J1OL 3MOBL 3SDCC 3ULAB 4UNTA 4DETA 3T0EA 2B7DT 2C7UB 3L7FB 2ZXCA 2ZD0A 3LKOA 4ODVH 3PL6C 3PJLA 4IRJD 1BLNB 4M7KH 5ITFA 1HEHC 1WK0A 2XTJE 1DSYA 2E9IA 2DS4A 3TFKC 5HY9B 1KCVH 3A22A 1K3ZA 3M8OH 2QHRL 3JVFC 2C5DC 2ZPKH 1OP4A 1SUJA 3MACH 3UACA 4AOFA 5FHAL 2C3XA 1P6WA 3KHOA 2V7NB 5I6XB 3O4LD 4AYFA 1YEIH 1ZPUA 1CVRA 5I2IB 1I3RB 1K85A 1KOAA 4JRXB 3LEYH 1R6VA 1IGML 1D5MA 1QSFD 5DWUH 1X6NA 4HC1L 3UIZA 4N0YH 5AG9A 4K55A 3GSNB 2AXWA 4U1MB 4XVSL 2V37A 2WY3B 4DKDC 2VQTA 3GK8H 1QOKA 2OXGA 4XOCA 3BP5B 4PRPE 5EUOF 1OCWH 3DPBA 1WZ1L 4OD3H 5CBEB 4CSPA 2E6QA 3T5WA 3JV4B 2IDQA 3T6ZA 3ULVD 3CDFA 3O2DA 4NKIH 3MNMA 3BUTA 4LB8A 2RJMA 1T2QL 1OSYA 1VIWA 2H9GB 3IRPX 5FWRA 3QJXA 5DT1L 3QDGB 2EIJB 2QEJA 4YHML 2DQTH 3VXSA 1BEYH 5DQDH 4MDRA 1GYCA 4JHZA 3RX9A 4ACTA 1MZZA 3F00A 3NT0A 3UJTH 5TQ2H 3KWTA 2A9BA 5K5YA 3WGVB 2NY2B 3LS4L 3U9WA 1ASPA 4OKVB 5FKAA 5C7XH 2FGWH 3MUZ1 2MH4A 3PHSA 5FO9A 2K4WA 4UQ2B 2AMUA 3M46A 3SKOA 1KXVA 9PCYA 5HDRA 1DANT 2GSIA 3TJHD 4U31A 1Y18B 2YJLA 4L3EE 4APQC 2D2OA 5E2WL 1XZ0B 3APMA 4NO5A 5TGBA 2X0UA 1QZNA 2WINA 5HHMD 4HBQA 4NZTH 4R0LC 1MNUL 3KPLB 3FTXA 1BQKA 1C8QA 3RBGA 1M9WA 1NGXB 4AEHH 3R1GH 3UAEA 5KYUB 1JZ7A 1EMTH 3MPCA 2DM4A 4WDIA 2FO4B 3EG9B 3L4XA 4QNPE 3AWEA 4ZMNA 1WA1X 3QO1B 3SDXB 5K9KB 1OHQA 3SKJH 3NG5A 3VMNA 1S9XB 4JBSA 4ZAKB 1BAFH 1YEFL 1E9OB 1GZQB 1M7DA 3CK0L 4DVRH 4MA8L 1PZ3A 1Q72L 3K6SA 5DVNA 4XP1H 2YEQA 4ZFGH 2IDCA 3BFOA 1OIOA 5CWSA 1RZKL 4AG4H 4L9LA 1XSIA 4QXUL 1NDGA 3GRWH 3J7HA 4A2EA 1BM3L 3D06A 3QUKA 2ITEA 4PRIE 2X4QB 4PUBH 1MCPL 3F7PC 1SDYA 2GTWA 3D4CA 2DJSA 3ZZ1A 3MV7A 3OLDA 5GHWL 3LD8C 4GAAA 5LAXA 3MLPA 3U9PH 1S78C 2B5IB 2WANA 2P8LB 4BJLA 4HEPA 3MX0A 4XMKH 4B9IA 3HC4L 5A7BA 5J0BA 1QYGL 3P11L 1FRGH 4HKJB 5CHNB 3JWDL 4YZFF 5J13B 4KKQA 1LO4H 2JKJA 1G0YR 5EIQA 3CZJA 4NPJA 4ZUWB 4S1DC 2ENYA 2FD6H 3E0GA 1MIML 1BZ8A 3EYSH 5IJKA 2VDKH 1JN6A 2NZ9D 4JPKH 4XNQB 1U93B 4HGWA 4D8OA 1C9SA 3FFCB 3QG6A 4GQ9H 5HTSA 2JH2A 4PH8A 5BZDA 3VFMB 5EU3A 3QI9C 4MAUL 2HFEB 2VLRB 4FXLA 3U2IA 3OKOA 3AUVA 4FA6A 2IG2L 5DHDA 4JM2C 3QNFA 2NNFA 3ME0A 4MJ6B 2H3NB 4H0GA 1GCFA 2DYPA 5DHVB 4MNQE 1NAMH 1KDJA 1S7WA 2UWEB 3B8YA 5HI4D 4L4TE 2DEXX 2NNXA 2PYFA 3BKMH 9CGTA 3QFDA 2W9DH 4FQQA 2HJKB 2EXSA 5EUOE 1SZNA 2JXMA 1CDIA 4UT7H 4XI5C 3STZA 1HILA 1JV5A 3MO1B 4UNIA 5EU6A 5KTEH 1ED3A 3CCHB 2ZUQB 2WXMA 2JKNA 3IJHA 3ARSA 4K2UH 2WWKO 1J11A 4ZOBA 2JCWA 2C9RA 3QUMH 5JORA 2QQLL 4ZMTA 1CLCA 4QRTA 1HC1A 4RBPK 4MD5B 3GSOB 5E6IB 4YXLL 2UY6B 1QQDB 4PJ6A 5JPMA 5L6YH 5EH1A 1PYWB 4KMTL 3TU6A 3V9FA 5IKCB 3MA9L 4DZ8B 1CICA 2VDQL 3C5ZD 1AG0A 4JFHE 3D50A 1E6JL 4EE2A 4PCTA 4Y9EA 2GK0B 2X4TA 2FJUB 2KZWA 1T1WB 5TDOB 3QAZB 5E08L 3EH1A 2FQEA 3W2DH 4UOW1 1CK0H 1T0MA 5C0AD 5IW6B 4R96A 1S4IA 3SBWA 3FQ2A 1I82A 2AK4E 1NOLA 3QFGA 4MXWL 4W9DC 4KITB 4ELMA 4TNEA 2VZTA 5DJDA 1RI8A 1UWYA 3IK2A 1X5YA 4N2DA 3PQYE 3ULSB 4ZDHA 2WW8A 3ESVF 4BFNA 3SYAA 1LEKB 3ZT7A 2I5YL 3UG4A 1AC0A 3SE9L 4HWBA 3FQTA 1X5AA 1OF0A 2BVPA 3IT8D 2Y5EA 1H6TA 2DWYA 3S36X 2FQGA 3N41B 3QK0A 3SO5A 4CVZB 3BGAA 2YAQA 1V54B 3ZVVA 4F33B 4FNTA 3LMJH 4NKDB 3KZ8A 1PMYA 2FJGA 2AJ3B 3EJZC 4LAQH 4M56A 5D1XD 4Y2LA 5DGRA 4E2OA 2M8XA 3C09C 4FQCL 2RCSH 2CLRA 3Q3GA 3AXLA 5F9JA 5E1QA 4RIRB 1MEXL 4LPWA 4F92B 3C6LA 4K3JH 4HIJA 3MRMA 3RKDD 2WC7A 2XTSA 3AY2A 3OD3A 4CVXA 1AG6A 1QUPA 2B9AA 3KYMB 1KBGL 4WW2F 5D2LB 2VTFA 1AZCA 3RWFA 3ZRFC 3PWJB 4UWQB 4TPRH 2DLFH 4LL1A 4JFDB 2IPKB 3MRPB 5CLZA 2BNQA 2GC4C 1DQLL 3CN0A 1DBBL 4YZFE 3SDCB 1WC7B 3B5TA 4P07A 3T4AC 3TS8A 3IGKA 4KKCD 2HJLA 3EOAA 1NFDF 2OW7A 3Q2NA 5JHLL 3H4FA 3GDBA 1UEYA 3PL6B 1QSEA 4MB3A 4U6HB 5FO8B 1R24A 4UOZA 4JDTL 5EU5A 4PS3A 1OV8A 3L6FB 2DWEA 3KWXA 2DRUA 4KY2A 1UFUA 3PGFL 2HCZX 1DVXA 4G5AA 4MSWB 5CJQH 3EJQA 3SY0B 1YEJL 3SB3A 1L9TA 3GBNL 4IK6A 1O5DT 4FHBD 2ED7A 4LCUA 4MBRA 3O3EA 2FT8A 4O2CA 3AWFA 1WIPA 4ZX3A 1A65A 4RGND 3CZGA 1ZY9A 4BEIA 5BMFL 4QRQB 2VSCA 2FBJL 4WNQA 4Y4KC 3L5WB 2X0VA 3CH1A 4WCYL 2RH0A 1FYHB 3MJGX 4V1DD 4FQIL 1KNOA 3OAUL 2Y24A 4AQ1B 2XWTA 4GRMA 3LHAA 4FQ2L 1MFEH 5DHYB 4JFZL 4MB4A 1GS6X 1TLMA 4XNXH 1SFDA 4PJ5E 2H26B 4V2BA 3LRSB 4X0KB 5D7LA 4NJAH 2EXYD 4X5XB 1EGJH 1VZGA 1F8TH 1P9MC 3QZMA 4OZFA 4PWFA 5I71C 2NYKA 2O61A 2R69A 3ARDA 3LYRA 4F9PC 1GKEA 3GJEB 2O5YH 4B9KC 5K9JH 5E2UL 5T1KD 4IU2A 3S3PA 1FAIL 1NM4A 2Q76A 2H2SC 3ORJA 1YEEH 3DUHA 4Z95H 5C3TA 2VMCA 3RY6A 3DV6B 3FFOA 2DWXA 2WVVA 4M5ZH 1P7QB 2EDTA 3BPOC 1UT9A 4QT5B 3HC0A 4JHUA 4YUEH 5DI8A 3KPMA 4WU5A 3RTQC 2IWEA 3IFLH 1KEGH 3MLWH 5JHBA 3NEEA 1NBVL 3HG3A 4AM0A 4G8FA 2I69A 1U8JA 2W9EH 1UFGA 3H9SB 5CBAA 1W6LA 3I6KA 3GZOA 3D87B 1EEYB 2HX9A 1CUOA 5D5MA 3AMLA 4F3FA 4N2NA 4R0LB 1TZAA 3F05A 3VWKC 1NEZA 1BLIA 1TVDA 3BVVA 3MAWA 4KO5A 5BW7A 3P0VL 3AS0A 3AS3A 1M3JA 5C9JB 2WVTA 1QLFB 1V7NH 3CMOH 1ZHNB 1F45A 3P3YA 1S7SB 3Q44A 2IAMC 2P5EA 1RZPA 3MOQA 3L4ZA 1C16B 3Q8EA 4FTVD 1GZHC 1WT5A 2VC2B 3MBEC 5EOTA 2XETA 1XMEB 1WE5A 4JFQA 1PKQA 4LHUB 1FGNH 3UCQA 4EPSA 4OM1H 3KPSB 5GZNA 2FJHB 4M48H 2YRPA 1LEGB 3WKYA 2OMYA 4FFYH 2NZIA 3BWSA 4P3WA 4S0SD 3ZTNL 3LD8B 4JO4L 2AQRA 1KWGA 3GF8A 4OJCA 1BBJB 4OIFA 4YH6A 5BO1L 4FNQA 2HUHA 3GGWA 2FWUA 2FSEB 1O0VA 2FGZA 3DO4A 43C9B 4B96A 2YAMA 2XWDA 4E9SA 2EYRA 2ADFH 2F5BH 3E9UA 3T0EC 5FYLH 1BX2B 2J8UB 1EO7A 1NFDE 5AVWB 4XTRD 5FFGA 1DLHB 2A6JB 2JKWA 5KVGH 4MQ7A 4NRZA 1J9CT 1MY7A 2HJFB 2Z8RA 3I6SA 1MFMA 4S2SA 3V0WH 2QVIA 3F3HA 2XN1A 4PJAA 5GRUH 5HPMB 4KKNA 1XGZA 3S34H 3W0WB 1BMZA 1ACZA 1A6AA 5FYJE 1B90A 1XFPA 5BQDA 3SJVD 3WG7B 4ZNEA 4UQEA 4GW1B 3P2DA 1NCWH 2YHGA 4JM2B 2Y6SC 4UIMA 2BS71 2LQRA 5KOVC 2VDPL 3MRDA 2AV7B 4GQZA 5HI5C 2QZ5A 1YNKL 1OPGL 2FEJA 1YNLL 2YAHA 1UH2A 1OAUL 4CSTA 4TLSA 4NKQB 5GGSB 2HRLA 1JTTA 1NCBL 1S7TA 5DC2A 4ZT1A 4LSQL 5FA3B 2HFFB 3C08L 3CSYB 3WE6A 3A67L 3MROB 4MS6A 3OR6B 1VEMA 4PV1C 3S5LB 2VSKB 3F6IA 3GSWB 4J3OC 2BIIA 3Q8AA 4IS6B 3WLBA 5J9PB 3FF8A 1F11A 3TPUA 4GP4B 4NM8H 1J5HA 1E3ZA 4GSDH 4XCEA 1MCNA 3L3HB 5IFJB 2ADGA 4JR9H 4Z7WB 4BDVB 2WBXA 4PHZA 3FT3B 2EAEA 3CDZB 1G9NL 4Q6IA 3HRZC 1V3MA 3CZFB 2HFTA 2J43A 3MRFA 1OHZA 3BEWA 4M7LT 4DEPC 5GSVB 3FN3A 3NFNA 4M93C 5F1IA 3NFPB 1QRNE 4JZJB 5FB8B 4JFFE 5KSVA 1G7JA 2IJ0C 3B9KD 2VR5A 3QVAA 1KXVC 3DRQA 2ZOLA 3H85A 3PNWB 4LFHG 5ESVB 5D1ZI 3NDZE 1ORQA 4LGSB 4AM0Q 3VB8A 3IMTA 1Q9WA 2C9SA 2GIMA 2HRPH 1RK1B 5L7XL 1TZIB 3LKNB 4GB9A 4JCWA 5F3HB 1BG9A 5GGRY 5T3XL 1JPGA 3QXDA 4OGXH 5IHWA 1DN0A 4FQXD 1K72A 3BC9A 4AKOA 2E27H 2K45A 2OFQA 3VXMD 3FRPB 1QFOA 3FT2B 2ZG3A 3O81A 4NSKB 1GS8A 3SDXF 2P5WB 3CBKB 4L8DA 1E2ZA 2YOCA 2B0SH 2QELA 1NEUA 3ILQD 4X99A 1CJYA 3QHZL 3ZDZB 5C0EB 5JW4Q 3MREA 5JLZB 5D96B 5ALCL 3VMOA 2KT6A 3W5MA 3F85A 4JNXA 3FONB 1CGSH 1G1KA 3B3IB 3OTTA 4U6XA 4XRCA 4JFXB 1DJZA 3OJ2C 4IOFC 1FH5L 5HHOB 4O2FA 4PJGB 4L9LC 4FA7B 2GJZB 2DEYX 4O51A 1CFTA 2F18A 3ZBMA 2K6YA 5DJ6B 5IGXL 2JF1A 3C8HA 1A3ZA 4RISH 2GUOB 2K3HA 4KJQD 4Q8BA 3S3SA 3PXHA 1HZHL 3VFTB 2BSED 4ANUA 2YBRB 2VDRH 4WJG3 4LHUG 3EADA 3CBJB 3T4AB 2W07A 4UU9A 2D7MA 3AM8A 1QWHA 4KI5F 3WI9A 5EN2B 1SJHB 1BPLB 3KPOB 4UT6A 5I76B 3KVPA 5ADOL 5IJKC 2NXZB 4RDQG 3LQZB 4BH8A 6PCYA 2VKXA 1EAPA 2P3YA 2YKKA 4FF9A 4HOZA 2QDVA 2VKWA 4RZKA 2WSKA 4GO9A 4OLZH 5K9QI 1H3PH 1D6EA 2ICWJ 2VR4A 4JFOB 5IUCA 4JK0D 5LLIC 4Y16C 1EANA 1SLXA 4ATTA 1MCQA 3WO4C 3BZ4B 5LDSA 3QNZA 2YSSA 4Y4KB 3TTYA 4OR1A 4U1NB 2QLVB 2CLVB 4B27A 2BVQB 1DEEB 3IU4L 3L5XH 5LG6A 5D6CA 1C7SA 3HC3L 1AJ7H 3OR7A 4HJIA 1XGYL 2OXHA 5B21A 4BD4A 4C47A 3ETSA 4IBVA 1QWNA 5JNYB 3IGUA 4NNPH 3NCYP 1RZGB 4XE5B 2OX5B 3B9DA 3QDGE 3OX8B 1BXXA 5GZND 2Y07L 5I71B 3D39B 4LXFA 2V17H 2FZ3B 3Q2CA 1N0LA 1Q0EA 3VG0L 2ORBH 2KI6A 5F7UA 3G5YA 3MUJA 3QQ3B 5IVXB 3OC5A 3EAKA 3S5LG 3VFVA 4DPRA 2W0FA 1CICC 1MLBB 2N7BA 3HHRB 4BZ1A 1BPVA 4L1TA 2UXTA 3EXLA 4BKTC 2VCOA 3FPYA 2JVUA 3CX5K 3BPOB 2DICA 2H0FA 3P3UA 3GUTA 2UZXA 1F1DA 3SBWC 1OGAA 4NM4L 4UNUA 4XO4A 1MJUH 5D7IB 1G9HA 4CADA 2CLZB 2AP2A 4WI0A 1ZKAA 1NFIA 4OZGA 4BSVA 2WD0A 1JGVL 2DQFB 2E9JA 5EIIB 5I0WA 1K2DA 4Z7UA 3VWKB 2BRRH 4OM0L 3WFBL 3K2KA 1OLZA 4HS8L 5FW7A 3SDXE 4F7MA 4Z3TA 4OCRH 4QCIA 1P4IH 4O9HH 1CFQB 1OAQH 4PJIB 3ZKMC 3N41F 5J1AB 4XMLL 4NUPA 2IAMB 1X5JA 1UYWH 5FYKL 4EXPX 4HPOL 2JJTA 5E4AA 4LLWB 5GISH 2V5TA 1W6WA 3MBEB 4HS3A 1DUZB 1E6OH 1N18A 4CJ0A 3FRPG 5KUKA 4I2XA 2E4TA 2GHWB 1D5RA 4FZEH 2OJEB 5IROC 3C6LC 3US9A 2GQHA 3QIUA 4J6RH 3TZVA 3G6AB 4UZGA 1TQUA 1PY9A 4HIIA 3D5OF 5D2LF 1R3KA 1SN0A 1LM8V 3QCTL 3VDAA 1E4XL 3WJLA 3VD4A 4OD2B 4KI5E 1DL7L 2XG4B 1C7TA 4NC2B 3D9AH 4PIBA 3EO0A 2AABL 1ZA3B 3LKOB 3B2VL 3UC0H 2XX0A 1NTDA 5ITFB 2OCJA 2VN5A 2NX5D 1I8UA 3HIZA 1PLAA 4X5QA 1TF4A 3FFCE 3FO0L 5AVTB 4ESKA 2Y5QA 2VLRE 3VGGA 2QVMA 2R0LH 1IGFL 2YEZA 3B2UC 5A1AA 3P30H 1UACH 4NP4L 5E0QA 2PTUA 2ZXAA 2VIRA 3EZJB 1YEWA 1SGKA 3RDTA 1FV1A 1URIA 4P4KA 4WSGA 4G8AC 5I1IL 2X05A 3OPZH 4LLVA 2UWEE 1D5MB 4YPJA 3MRQA 3KL5A 3IGLA 5GRJH 3WD5L 4YO0A 1F97A 4PWKA 3EYOA 5GGVH 3RZWA 2X1QA 3HS9A 4YGVA 1CZ8H 2FBRA 4IKIA 3K91A 3T2QA 2OXGB 3CFJA 2EIDA 3DI3B 4YE4H 4K8RD 3DPBB 1RZQA 2Z9TA 1D9KD 3VGBA 4HJ1A 3PFUA 5SWZA 3QZPA 4TN9A 2CH8A 3ILDA 4NIKB 4W9CC 2E7MA 1ZIAA 4R97B 2OS7A 1QW9A 3H42H 3WNKA 1KYUA 4ETQA 1R3IH 3TA3D 4GSXA 3I02A 1A7OH 3ARDC 3D3VA 2DQJH 3WXWH 4PMFA 5TFSH 5KVDH 1VADA 4KNUA 3A6OA 1UWGH 2VLLB 3HRZB 1XGPA 1HX0A 5CIPH 3RY6C 4DEPB 3HAEH 1JE6A 5AVSB 3POCA 3LXCA 2BC4A 5FO9B 3QHFH 3GMQA 3O6KH 4F7EA 3EJCA 3ELAT 2GSIB 3NSCA 4X9IA 4FFWC 2Q7AA 3L1OH 3RWGA 4M7LH 1TO5A 4NO5B 3KXFB 4E41A 3ULUL 1ZLVK 3KWWA 3KLKA 2E75C 2YPLD 4D7PA 25C8H 5BW7C 5L4JA 1CU4H 4JB9L 2EIEA 2F7RA 4QGYA 2XQYK 4TS6A 3VH8A 4DAGL 2YC1A 4XNBA 2P43B 4PD4K 4R26H 3QJOA 2ZP0T 2ICEA 1M7DB 5AYUL 1XT5A 1EDQA 3WIHH 4KX9A 5FCUL 1U3YA 2AJUL 2TRYA 5EIIG 3RVXD 3K6SB 3TN0C 1WT5C 3A4EA 3CIAA 3P77A 2NY3C 1ETB1 5IF0A 5CWSB 4KKBC 4EZKA 4L9LB 2ZX6A 2YPVA 3OZLA 2JQMA 1CN4A 3QUKB 5F2FA 1OEZW 4PJXA 2H45A 3W81A 2GTWB 1S9VB 2RACA 1UKSA 1MFCH 5D2LE 2XT1B 1D7BA 1H6UA 1YY8A 5LAXB 1L0PA 2EILB 5DTFA 2OBGA 1HOCA 4RDQF 2ESVD 4JFDE 2XNAA 3RVVD 4F58H 1MELA 2XOTA 2A6KA 3BGMA 3MX0B 1JZIA 2J8UF 2JTYA 2XV2A 3NTCL 2WLMA 2PXYD 2A6IA 4Q89A 1G9ML 3DIFB 4HKZA 2GCYB 3JV5A 1F00I 5KZCB 4FFZL 4LRNL 1A02N 4EI5A 5JQIB 3BRDA 5ECGA 1RHHA 2ILLA 2HLFC 2J71A 1BSIA 5DHEA 2A77H 1JN6B 3TEWA 1QFHA 3QWOB 3MRKB 4HGWB 5E5MA 3S35H 3QG6B 5CILL 5DUJA 3CAFA 1PL3A 1RUPH 1XHHA 3OKOB 4KZDL 4JM2F 4AIZA 5I8OH 2KLSA 4Y16B 3WO4B 1CF8H 3U7WH 1KPUA 2DYPB 4P23A 3LIZL 2VLKD 2UUDK 1S7WB 3QG7H 1CPUA 4KJPC 4R4FL 4LVNB 4JHVA 2UXGA 3M1BB 1BIHA 1A0QL 2X42A 4O58L 3K72B 2MKLC 4I7ZC 3KS0H 4K07A 1ILUA 3QFDB 4FQQB 4FQJH 2BP0B 4Y7MA 4KRPD 2JXMB 4W9IC 3NABH 5EU6B 3V0JA 4KKLC 4R8WH 4MB1A 4EUPH 2ADJA 3WE1A 1JK9A 4QOKA 1KMGA 5ES4B 1JGUL 3ARWA 4KK5C 3QNXB 4Z7WF 3GMRA 5IESH 2V4LA 4OI8A 4U7MA 3C9NA 2XICA 1O5PA 1MF2H 4LSRH 3TL5A 4L18A 2FAUA 3A4DA 1E9PA 2XBZA 2CCVA 4Q6IC 2G2NA 3BQUA 3HI1B 3WIIL 2FNWA 5LCVL 4NQCA 1CICB 2E4FA 2GEEA 2WXHA 2BSRA 2X4TB 2ZOUA 3HNSH 1PLGL 4RESB 4N2GA 4QRSA 4KAQL 1T0MB 2FJFA 2MOVA 3IF1B 4R96B 3KGUA 3V5KA 1X5GA 1ES0A 3HHSA 3H9SE 3L16A 4GBXA 2H1LM 4GW5A 3FDWA 2LFEA 4PB9L 5DFAA 3H6AA 5HYSA 5DJDB 3FSOA 1RPQA 4AMXA 1MRFH 2PTTA 4UTBA 5DXWA 1XB3A 5LGHH 4UQDA 5HVGB 1OGPA 1U8QB 3FQTB 4AQAA 5HXMA 5DJYA 4JY5L 1B4TA 4G3YH 4M9PA 1HXKA 3ZDZF 3J07A 3JT0A 3ZT6A 1G9EA 4EBQL 2VDQH 3HC2A 1E4XI 3Q48A 1NC2A 4HOWA 2FJGB 4BUHA 4HK0A 3H1ZA 3UJJL 1LK3H 5CS7A 4FGMA 2MNJB 3IETA 2XBTA 4JKPL 4PJGF 3AXLB 1S7VA 5F9JB 1IBZA 1T80A 3I9AA 3KPSE 3DV4B 4JHAL 3F7LA 3TNMA 4XAWL 2W0PA 2DKSA 2HRHA 1K8DA 4M1GL 4L3AA 5C2BL 3KH4A 5C0CA 1EBAA 2EINB 3MRMB 4HIJB 1GGIL 1PVHA 2J57A 4CVXB 1B0WA 2IV8A 1IKNA 3IKCA 1L6PA 4HW6A 3CWGA 2Q6WA 4L0YA 4M6NL 3RWFB 2APFA 5IB3B 2AS5M 3LY6A 3OB0K 2J8UE 4DO5A 2BNQB 4ZUSA 4FMKA 3KL0A 3MJ9H 3TASA 1FLTX 3D12B 4X2UA 2ATPA 2HJLB 4WFGD 5K59F 3MLRL 3ZUCA 4LDEB 1QSEB 4XPTH 2AGJL 1R24B 4MWFA 4NQDA 1VFUA 5EU5B 2MRYA 1MCRA 2DWEB 4P2OD 4KZEL 2FEEI 5CGYD 1AD9B 1AQ8A 4OIIL 3RNKA 3G04B 1MEXH 1YEHH 1CE6B 1G7HA 3V0HA 5KBKA 4ZFFA 5KJRL 4RA0C 2R8SL 1XZWA 2XA3A 4GNKB 3SDAA 3KJ6L 1TTRA 1ZA6A 2NW2B 2A4EA 2WQUA 2HT3D 1RJCA 3LOWA 2D9CA 3ALXA 4JEGB 4OQTH 4MZ2A 4LPVA 2FR4A 1H15A 3J27A 4MBOA 1YYMH 3BKCH 1I1YA 4WNQB 1XXFC 2P48B 3BISA 1NANH 3CH1B 3MKKA 3W82A 1EHAA 5JIPA 3HZ3A 1BIIB 4KY1H 1KNOB 2K70A 5IBTH 3TCTA 2YD8A 3HUJA 1AR1D 2QL1A 1P5UA 2XWTB 1I85C 4GRMB 3WEAA 4WWOA 2AVGA 2A2QT 5JHDB 1WF5A 1N10A 2OP4H 2BVOB 5JQ6H 1EA9C 3LQAH 4BKLB 4WHTA 2ZOTA 1CTMA 4EJ1C 5ICXA 2MWCA 4PN6A 4L0ZA 2AQ3A 2FTAA 2HLEB 1SEQH 3FT4A 1JHKL 1NH6A 4J7RA 4OZFB 5AKVA 1RQ5A 5FYJH 4Z7WE 3VD7A 2QSCL 3RWIA 2O61B 2Y7LA 4KXBA 3ZMEA 4TNWK 3RE0A 2EEAA 1TNNA 2J55A 4X80H 4IU2B 1LEIB 4JVWA 5IVXF 2Q76B 3SBPA 5C09E 3TEZA 5C71A 2VN3A 4H1LB 2KQMA 3D0LB 3OAUH 3MN8A 3LS5H 1CS6A 5DUPL 2AJZB 3HC0B 3NCWA 3KPMB 4WU5B 1NPUA 3AFLA 2F19L 3CSTA 4N8UA 1UB6A 2D0GA 2YD4A 4LARL 4QRFA 3ZQ9A 4R7NB 1MHPL 1TJGH 3LH2H 4G8FB 2RQEA 2NY4C 4I1RA 3RVWD 5CBAB 3I6KB 5SWQB 4KJYB 4WFHE 2FYYB 2OJZH 5D5MB 4D0CA 4F3FB 5F96L 4Z7VB 2HA1A 4AY0A 3L3OA 1NEZB 4JCMA 5E6RB 2P5WE 4G7VL 5MHSD 3ZDZE 4Z5RA 3MBXL 3P3TA 3TT3H 4PJIF 2RR3A 4F7TB 5BVPH 4HJ0C 1BF8A 4ZJ9A 4IIQA 2P5EB 4Q9BA 4AJVA 2YD9A 5CEZL 3GQFA 2JIXA 4UT9L 4B5EA 2Y25A 2JJTC 5HHOE 1TQSA 2APVA 4PJGE 3TN0B 2OL3H 2JWYA 1U30A 1MJ7L 3PAUA 4JFQB 4Z7AA 1I7TB 1TZHA 4P2CG 1X9RA 2ICES 1EJOH 3LJ3A 1NICA 4X0NA 5IQNA 1HDMA 2RA1A 3QIUC 4KJWC 4W68A 2YWYA 3TZVC 2MCPH 4B9GA 3JWOH 2XVGA 5DZPA 2OI9C 3SYQA 2VXSL 3SPJA 1CQYA 4A2DA 2ZWNA 3BE1L 2DI8A 4BE6A 1WCBB 4KNQA 5CGBA 2HSIA 3ZIMA 3GGWB 3WJLC 2W92A 4JCLA 3FQWA 3QDMB 1SMDA 3C12A 3MXWH 4O4YL 4ZTPH 3F64A 4Y4FB 5IW3A 2EYRB 5I6MA 2EE6A 4WFEE 1U36A 5C0IA 4M4RA 1DQDL 1B2WL 1ZLDA 1TCMA 3IFNL 3OVUB 4TQHA 3H2WA 5CU9A 3QR1A 4UAHA 3L8QA 5J6HA 2BZ7A 2DTML 4BCYA 1RVFH 5TQ0L 4MQ7B 3DX0A 4OTXL 1NLBH 3CFBA 4P5SA 3RPKA 4JZOA 3KPPA 4S2SB 1AXSB 1RUKL 3N50A 4P46D 1FO0B 5CSGA 3TLRA 4PJAB 3MNWA 4MCNA 3N55A 5L4FA 4W70A 1LNUA 1C8PA 1U6AL 4FKKA 8CGTA 5T1MA 2FO8A 1OQOA 3MLSL 3ZTNH 4DK3A 1JD7A 4LSUL 4P4KC 1GC1H 3NH7L 4UIMB 5AQ0A 2VERA 2L8AA 1QA9B 4JKMA 3MRDB 2BSTA 4RFOH 2HTLC 3GTNA 2YK1H 1FFTB 2DQ6A 4JE4B 3WY4A 1CYWA 5CZVH 5CU5A 3TEUA 5L8KB 1AY1L 5F6HJ 2XN9D 4OAWA 2ROYA 5AOMA 3H7LA 3IEAA 1C5BL 1A6VH 1TQTA 3GPSA 1R3HA 4NUJB 3WLBB 1F11B 2OMZA 2Z8SA 4ORGA 4XCEB 4F2MA 4M5YL 5C0CD 1FIGH 4NNYB 4XGZA 4NN5C 3LZFL 2CJTA 5ISZA 3I6GA 5IVXE 5KANG 4XPBL 4PP1C 1F2QA 3E1ZA 4N87A 3W56A 5C0BD 1GOHA 4AV0A 3MRFB 1IIIA 1CBVH 3BEWB 2YAEA 5F1IB 4YN3A 1T03L 4QTIL 2H47C 5BS0A 4A37A 4OZFG 5KSVB 2EE2A 1G6RL 2QTEA 3DRQB 2QFPA 2ZOLB 5D7IE 1AFVL 1T1XA 2VRQA 3HMXH 3PPSA 3PYCA 1QFWH 1A5FH 2ALAA 1ORQB 4HCFA 2YO3A 1Q9WB 1PFCA 3GO1L 1Y1DA 2OKMA 1CFSA 3CVIH 4H1LG 1JPGB 3QXDB 2XKUA 3KLQA 1DN0B 4MRCA 4RWHA 2N4IA 4PG9A 4PJIE 1OY3B 4L8DB 4MJ5A 2FHFA 4FN0A 3MREB 3L2LA 3QAQA 3VD1A 2ICEC 2B3IA 2K9FB 4JFUA 3D51A 4LSVH 5FUOH 1JVLA 3X1EA 1ZANH 1CFVL 4MYWB 4XRCB 4U6XB 4GP5B 4KUZH 2WO3B 1XWVA 1NEZG 2HYMA 5GGUB 5CLTA 4O2FB 2CGRH 5FUZL 5G5DA 3KYOA 5EZOL 1BGXH 4XNUL 1U42A 1JWUB 4AC2A 3MRNB 4A6YH 2ZONA 2H1PL 3SBRA 5E2TL 1N9PA 2EC9U 3V0EA 5HP5A 3NJIA 4W9LC 2R1XA 4DTGL 3NZHL 1DZBA 2AANA 4XB8A 3T0EE 4FDWA 2FIKA 3RVTC 2XDHA 3K4ZA 3FT1A 1A4KB 2W07B 4UU9B 5JUEL 3S96A 3QORD 3UIYA 1EX0A 2NXYC 3C2AH 5EA0L 4KMQA 4ODSH 4PWHA 1K4CA 3QULA 3RFZA 1JWMA 1KC5H 4BZ2H 1CQKA 3VM7A 4XC1L 3L5IA 4KDVA 4BH8B 1WFTA 3B83A 2JKTM 1SVBA 4LNVA 1NC4D 1EAPB 3VWJD 1W91A 5F7DA 4GOSA 4X7SH 5D1ZD 3UO1H 2J8HA 5DLLA 1EJ8A 4L48A 1K3IA 2YPKA 1WBZB 7TAAA 4P23C 3I3BA 1EWHA 1TTUA 3QNZB 2KDYA 2BOLA 3MXVH 5IQ9A 2H2PD 4KOCA 4OFQA 1W72H 3DROA 1XBRA 4WK4B 3WEXA 4JHBA 4XNYH 2R15A 5HI3C 7CGTA 5D6CB 4XNDA 2IQ9L 2X3BA 1H8LA 2XZQH 3GMPA 1RZJH 2OXHB 4ZO7A 3RGBA 1GGCL 3CVHA 3O45A 3N0PB 4R4NC 2NYYD 4BZYA 3QQ4A 3FFDB 4N26A 4HUUA 1A4AA 3TEXA 1ZVHA 4YLCA 1FZKA 3O3DA 1BCIA 4RNRA 5AENA 3QJSB 3FRUA 2EDMA 2WTPA 3FYEB 1KPVA 1GJIA 3DO3A 1RZFH 4N8VA 2Z8VC 1FL6A 3G5YB 3BQUC 2ARJB 5DO8A 3RIFK 3VFVB 4EI6A 1S9KC 2W0FB 4JDVB 2ODHA 2AQ2A 4JKNA 1GOGA 2BLFA 2VO8A 5F1SA 3TBTA 3N1QC 2VDNB 4WI9A 5C2UB 3HC3H 3GUTB 2UZXB 5DQJA 4GBXC 4CL7A 3KXFE 1F4YL 1SUHA 1N5YL 3SOBH 2JCCA 2R9HC 3BEVA 1MZYA 4NKMA 3S2CA 4RLDA 1NFIB 4LQFL 2C9XA 4KZCA 4OZGB 4BSVB 4PGEA 4XP6H 2CNYA 4OBRA 1NIEA 1K2DB 4Z7UB 4FABL 3Q05A 3BP4A 4F7MB 1BD2A 2R0KH 4QCIB 1AS7A 2ZP8A 3L9YA 2QQNH 4GRLA 3WFDL 4AYDC 5JA9A 1YEDA 4K71B 4ONFL 1AZUA 1LTXA 1M7XA 4X4XA 2J6EL 3FBKA 4QPEA 3T0DA 4UBDD 2UZYB 4ZS7H 1LWRA 2ATKA 2VDLH 3QWRD 3IDNA 4K7PL 4ALAH 1QLEL 3HZKA 1FPTH 4YGAB 4ZK8A 1NBCA 4J3UA 3U46B 4LF3A 2VZ1A 3PP3H 1XF5B 1J5OL 3KPRA 4LU5L 2VDOL 1HH6A 3QIUB 5ERWA 5LBSH 1MCOL 2CXKA 1HHKA 1IKNC 3TZVB 4PJDA 3UTSD 4HIIB 2OI9B 2E5EA 3WFBH 4AK1A 1A7NL 2O6DA 2EO7A 5E8DH 1EFXA 2RBLA 4P2QD 4TXVB 2DIAA 3ZTCC 4DFHA 3WXVL 4ZMLA 3CLEH 1KLGA 1EO8L 1YEGL 4JY6A 2XBDA 4OFDA 1FLRL 2VOTA 1O9WA 4HYTB 4BGDA 4FLQA 3X13A 3UEQA 5T1LA 1FNSH 5JW4N 3KBPA 5AD0A 2C4XA 4AVIA 5BJTA 3APFA 4KPHL 2J6WA 1G0DA 1JVKA 3V6OA 3QIBA 1PAZA 3ESMA 1UTDA 3U1SL 2XUWA 1AE6L 1RXLA 2XA8H 1V10A 2UYLA 3FTGA 4OUUB 2BNRB 1C12B 1FG2A 2VIRB 4E9TA 3O11B 1FV1B 2E7BA 4P4KB 3LPPA 4LKCA 3HR6A 1J8HB 2E7LA 1SF3A 3N1PC 3GLDA 4LLMA 1DLFH 4LLVB 1JZ4A 4XN2A 4YO0B 2LE9A 3G6DL 1BVLA 5EZJA 1UEMA 2ZUWA 4YGVB 2BWQA 2VN6A 5SX5K 1P5UC 1BJ1H 5E24E 3W5NA 1KELL 1NKOA 3QUXD 5EU6E 4ZXBD 5JXAL 5IREA 2WSPA 2CO1A 5KYWA 5AW3B 3B9AA 5SWZB 1UZGA 1NDTA 2V5RA 3OKNA 3NYKA 5IHBA 3GRWA 3I6LE 4MCMA 4HPYH 2AJSL 2WCPA 4ETQB 3TXAA 1W8OA 3GSVB 4DN3H 5AW2B 5I18L 1IBGH 2M2DA 1RLWA 3D3VB 4NN5B 4N1EA 2UVEA 3L9RA 2H6OA 3KD4A 1VADB 1KCSH 3QEQD 4GO6B 4QJ5B 1I3VA 2CHXA 5CEYB 3SGDH 1XGPB 4KVCL 2HKHL 2YN3A 1AOHA 2Z8WC 4KQ4L 3L81A 4N2MA 5HHPA 4QRPA 2BC4B 5C0NC 3GMQB 4F7EB 2GBAA 3G08A 2F5AL 2D7NA 2GI0A 2NY0D 3KLHC 1SNRA 1XH0A 2GSGA 1NMAL 1JZHA 4YHIA 3KYNB 3UAJA 4EVNA 4J2XA 5D5MF 4E41B 5J1SC 4GH7B 3X2QB 1KG0A 4K5PA 1OSPL 4Z7VF 2ZAGA 1DVZA 3KWWB 5F1NA 3OKMA 4HFUL 3DX8A 4MQTB 3L4WA 1NEPA 3L3OC 5CINH 1CWVA 6FABH 1KB5L 1FFNA 3KBHE 4KXDA 3S3DB 3ECWA 4ZI8A 5T1DH 4NT6A 2X7LA 1RMFH 3CX5J 1BG1A 1WEJL 3VH8B 2YC1B 4ZPVA 4IIQC 1NAMA 4JG1H 3VRLF 1WBXA 3OSKA 4G6KL 3P4OA 1ZAGA 2ICEB 4QLRA 3KPQB 3F7QA 2PW1B 4TSCL 5IIEB 1H19A 3P77B 5IF0B 1B4JL 2DQCH 4TVPH 4YNYA 4CU8A 1BFOA 3NFSH 3JYBA 3GI8L 1R34A 3LPGA 5IB4A 3BCFA 1UXWA 1GW0A 4F7PA 4M6AA 1RIUH 1QNZH 4LLDA 2BJMH 3SCMD 1FE8L 2NLJA 3WEBA 3MCLH 3QUMA 1SRDA 4G7RB 2DLIA 3HG5A 1HOCB 3K3QA 4JPQA 1SJEA 2XNAB 4UV7L 5DTFB 3BGMB 2A6KB 2BNQE 1B0GA 2Z92A 4NLHA 3ETBJ 4DQOH 1CLZH 1R17A 4H25A 5B1AB 1NCDL 3L9EA 2LGNA 2MTPA 2A6IB 1WD8A 2OJ1A 3FB6A 5T3XD 2LLGA 1QSEE 4HKZB 3B7UX 4XNMA 2NXYB 3VXTA 1THAA 5KVEH 5FCUH 4HU2A 1JZ6A 5LXGL 1WIUA 1QSVA 2ZUYA 1RHHB 3DUUB 2PUQT 4U3XA 2A9CA 5DMGC 3QJHA 4ZUVB 4B0MM 3DSFL 4PJAF 5FPIA 5E5MB 4M03A 2O4EA 5DUML 1P53A 2W5PA 5KBDA 2AW2A 4F15C 4NO0A 4XXCC 2D03H 3WHE0 3VW3L 4FRWA 4IKNA 2W0KA 2FH6A 4QGTA 1XB6A 4AIZB 3IJEA 5CKAA 1OAKL 1JNNH 5IMMA 4XP4L 1WVZA 4WWNA 1KPUB 4P23B 4XP5L 1A3QA 4P5KA 1Z9SA 3D07A 2KLTA 2BZDA 1HWWA 5IJBC 1KCLA 2FECL 2WNGA 2XZCH 4PVMA 4BCXA 3DMMD 5JR1L 4Q9QL 2YQGA 2CM6A 5GRVL 1NIBA 1BYPA 5F0PB 5JHDE 2X89A 5DRNA 3FU9A 4PBXA 4TSBL 5FGCB 2YD7A 4PLJC 4AEEA 4XE0A 4OV5A 1I7UA 3EF7A 4K9EH 1PD0A 1I8KB 2WBJD 3MCYA 5D7LE 1RSFA 2Q20A 1MDAA 4M1DL 5FM8A 2CALA 5CZKA 2AEPH 3L7EB 3MRRA 2XPZA 4QOKB 5B7EA 5ADPL 2G5BB 4QEGA 1QBLH 4NO2A 5BZZA 4KZDH 1E5AA 2N3JA 3U0WL 5GS0L 5F1OB 4W9FC 3BVDB 1AACA 2D9QB 3GMRB 1IAMA 3A4AA 3SE3A 3C9NB 4YIQA 2IOIA 2WLZA 1E9PB 4CBPA 3GMLA 3BQUB 1MW0A 2O93L 1YEKH 1HOEA 3MQIA 1ROCA 4NQCB 5IWLA 2VMJA 3ATFA 2V9TA 3OG4B 4LSTL 3CBRA 1VESA 2MCMA 4AK2A 1UZ8A 2FE0A 5I1GH 5FM5O 2YARA 3UTTA 3CFNA 3V5KB 3QRLA 1IE4A 1VAHA 3HHSB 3K0YA 4GBXB 5ENWA 4GW5B 2I85A 3RWDA 4AMWA 1OOWA 5D5ME 5HYSB 1YQ2A 3CHOA 5DRWB 2CM5A 3ZDXB 3JUYA 3QFJB 2PTTB 3ATAA 4G1EA 3US1A 1CXFA 2N7SA 2OTUA 5JOFA 4NQSA 4WUUA 3K4AA 1QPXA 2CCLA 3FCBA 3CLFL 3FXIC 3ZYIA 2BVYA 2QPDB 4AQAB 5DJYB 2A9AA 4KK9D 4L5FH 4XT1C 2E7CA 5AZEH 1Z5LA 3T3MB 4WEMB 2P5EE 4S1SH 3WN6A 4GAJH 5AW8B 3EYUH 4NWUH 2VW7A 1TENA 2APXA 4H8UA 1NC2B 1A1NB 2WK2A 4YDVA 3FUEA 4FHKA 5EU7C 5F8QC 2C4FU 3IETB 1QATA 3LKPA 1MFNA 3L3JA 4X7EC 1S7VB 4GXUN 3WLWD 5I75C 4XPFH 4JFYA 2WLLB 2Z64C 5KYYA 2P1YA 4K23L 4LLQA 3TNMB 3SPIA 4WY7L 1UT1A 1MRCL 3VH8G 2WJ5A 2CNZA 1EGJA 4ONOA 4PD4J 4I9WD 4WWKD 3BH9A 3LZNA 2Q6WB 3QDME 2F53A 4MLIA 5BRZA 1UM6L 4PRHA 2VM4A 4ZUSB 4MJIA 2ATAA 1C5CH 3KWVA 5CP7A 4EBQH 2ATPB 2WXJA 3IDGA 3P9WB 5DZNA 3S97C 1V8HA 2QSTA 1LXMA 2P80D 1FNFA 3GM8A 4OJFL 4MWFB 3RFZC 3S88L 5EC1A 3H7BA 1UH3A 4PJAE 1G7HB 2MPVA 4ZFFB 3BIAX 1UA3A 2FX7L 3D2UB 1ZA6B 1E5BA 5FYKD 3RFRA 4ZNEE 5J06A 1FSKC 4Y9FA 2W81C 1YJDL 4GUPA 3RZCA 4MDIB 5D6DA 3BN3B 2MSPA 2C8NA 3GJFB 3GSNL 4CMMA 1SMAA 5HYJA 4PS8A 1H15B 4EIUA 2FR4B 1LK2A 3N2JA 2ZUUA 1JHLL 1I1YB 1NGWA 1NMBL 1QHPA 5GGSY 4Y2DD 4EAEA 4U2YA 4J4PA 4NXSA 2X40A 1P5UB 3IE4A 1GW6A 1XBDA 3VXPB 2LT9A 2CHZA 2GAZA 1OP3H 5DD6A 4NCC2 4TULH 4WHTB 1I7ZA 3MRHA 4P2RA 5ICXB 3EOBA 5D7EA 4Z78A 4OD1L 5CCKH 3FT4B 4K7FA 1HL8A 2N1KA 4DK5A 3RWIB 3GINA 2WXFA 4FFYA 5JA8B 2YMXH 3BZDA 1E5YA 4NZUL 3H9YA 1B4LA 3PJNA 5E8NA 1U8NB 4DGVL 1PG7W 5EZIH 3QJUB 1ADQA 3CH8A 5AVVB 2BXYA 4JPWL 3VU1A 3Q2VA 3DK2A 4X6FA 3BIKA 4WKZB 2ROXA 1H5BB 1UB6B 3CFMA 4F7KA 3EYVA 4MKMA 2XWCA 5DS2A 4HT1L 5E70A 4AVKA 3LKRA 3UJIH 1SDDA 3VGEA 4OZGF 1IEAA 2Q86A 4FQLH 1H3UA 5EIVA 4Z7UF 4N6RB 3IGAA 4XBPA 5IR1B 4WTZG 2QSVA 2XRAH 3WFCH 2F2HA 4Z5RB 4A67A 3ML9A 4GRLC 4LBAA 5T5FL 4D3CL 2CK0L 2WXKA 4S0HA 2WB1A 2YD0A 4WW1B 4IK7A 4IIQB 1FFRA 4LAJH 1KCUL 4BQCA 5HYSG 2E9BA 1TQCB 2JIXB 4AT6A 1MCLA 2OMUA 3B34A 3LRLA 3BP7A 3DTUB 3I85A 3TWYA 2IGFL 1JP5A 5F3BA 5EEWA 2EKSA 4OKDA 3VFRA 1HDMB 3FTYA 1IGTB 1M1XA 3PGDA 2Y06L 3B1UA 1A6WH 5F96H 4MVBC 2GFBA 2IPUG 5JXEA 2ZAHA 3UG5A 2Q8BL 3FQWB 3P9LB 1KCWA 4LDOB 2CUMA 3GXFA 3QPKA 1EAJA 4U6VL 5I66A 2EUVA 1L7TH 2PWFA 4LOUD 2WO2B 3AB0C 5AL0A 3ULUD 2D7PA 3WCYA 3FHQA 3RILA 2VLJD 4FQHB 2YMTA 2FECI 1AIFB 3NCCB 3CFBB 5CUSL 3OZ9L 3V6OC 3QIBC 4JZOB 4FI6A 1YN7A 3RGVD 3ET9F 4O5LH 4E0RA 4J23A 3MNWB 1FZMA 3DBXB 3F62A 1MJ8H 4F15B 1LNUB 3L4CA 4OSUH 4FS0A 3WL9B 5FX3A 4CGUB 5AFAA 2VN4A 1JDCA 1NGZA 4FYRA 5CXPA 5BCAA 2ARWA 3U7YL 2E7LC 1EXGA 1UB5A 2C7FA 4TTDD 4WUUD 2CO2A 3E80A 4QKXB 2BSTB 5GZOA 2F1BA 1LE5A 1I1AA 4XPGH 4MKTA 1MCKA 2Z4QA 1TZ8A 3IFNH 4OY9A 3QZWA 3PIQA 3EYQC 4XPAH 5AWNL 1BREA 1CLYH 1AGEA 3F65A 4OAWB 5JIKA 2GITB 1Y6KR 4KTEL 5D4JA 3V4LA 1R3HB 4M62H 1E2VA 3O8XA 4F8NA 2OMZB 4PB0H 3RX8A 4BGLA 3CU1A 1KIQA 4ORGB 1K6QH 4F2MB 3MLZL 3B9EA 4HETA 4LSUH 4XGZB 3EO1A 4LLYA 1TETL 2X6BA 5ISZB 1BVKA 1NPJA 4S1QL 1ZV9A 1OE1A 5I1KH 3BIBX 4Y9CA 2YR3A 3VSTA 4F27A 1ZT1B 1BVNT 3NP3A 5INCA 3BLBA 5BS0B 5CR8A 2D3LA 4YVUA 4YFDB 1T1XB 3Q1SL 4DPCX 4QHNB 2WWKT 1NWPA 1SY6L 3UAJC 1ML0A 3ZU8A 2HX8A 4OZGE 4L1SA 1ZK9A 1YYLH 4Z7UE 5I1CL 1CFSB 1BM7A 2G9HA 2XY2A 1A6ZA 4O02L 4ABWA 1GXEA 5B3SB 2WAHA 4NB7A 1SOXA 4PG9B 4MNHA 4U3HA 4WFFD 2JI2A 1KUMA 3TIDA 1FYTA 1XSKA 4I48A 5HHQA 2R23B 2PR4L 3CHPA 4FULA 3CHQA 5T8IA 2DQGH 1OVZA 3GIZH 1S5IH 4GLRI 4DN4L 4UINL 3IKKA 3BN9C 2ADYA 3UGXA 4UMGA 4J4PD 5I75B 3V4VH 2VZUA 3D25B 5G5DB 3KYOB 2YS4A 2P24A 1OGTA 5BZWA 4AGQA 2AJXL 3WU1A 2HWZH 3T0VA 4HAKA 2QKSA 2R1XB 1PZDA 2WZPA 4XO5A 3SQRA 1Z6JT 3HJEA 4D9LH 3WAJA 1WGOA 2CJUH 4DGYL 4HUXA 3QCUH 4X7CC 4BUQA 1NIFA 3B2DC 3TYGL 3HTLX 2B77A 4LEXH 3S96B 5AW4B 3GXMA 4K15A 5FWQA 4RAHA 1RJZA 3CG8A 4GKSB 1ZEAL 2WMPA 2R4SL 4R90H 2B1AH 3QULB 3GLZA 3MLTA 1JWMB 3TV3L 4EN2A 1EV2E 1G5GA 5C07A 3UMTA 4XCFH 4OGYL 4A55A 1QFWI 3PHQB 3DHMA 2BNRE 3N43B 4WWPA 3VXRB 3ILQC 4HCIA 3NBNA 1FSKB 3NCJH 5D7JA 3NACL 4F37K 1J8HE 1WA2X 4U1KB 3TONA 3CFDA 1D5ZA 2LU3A 2YPKB 3I9IA 3OBAA 3LPFA 2AAAA 2PF6A 4N1HB 3C8KA 4N2IA 5F9WC 1CDHA 1WAPA 5HD8C 4CNIA 3DARA 1SJVA 5IQ9B 2Y69B 4XHQA 5JW3H 3DROB 3VXUD 3EDFA 4U1SB 5H37H 1FVEA 5EA0H 2IGTA 4G42A 2DTSA 3VMPA 3I74A 2OR7A 3FOLA 4KK6D 4DGIH 3BSZH 4JFTA 5E6SB 1THCA 3PWPA 3GMPB 5SWZE 1HE8A 1T89A 4IBZA 2WTRB 3NJFA 5A7EA 3CVHB 2EYSA 4OF0A 2X6VA 1BMWA 2ID5A 4M43L 4PWEA 4BHUI 5LO7A 4IGBA 2XV0A 3ZTJG 3V8CA 3ZQWA 1KIUA 1G7LA 3QQ4B 2VABA 4HUUB 4OT1L 2QADC 3CN3A 1FZKB 1AYRA 5KYXA 4RNRB 3D3VE 1MQ8A 4RVBA 1BQUA 1PDKA 1KPVB 4GQPH 4RBPH 1I9EA 4WHCA 5AZUA 3SE3C 3TO4A 1TR7A 3VX1A 5DLML 4N8VB 1G87A 1N68A 2V7HA 4EI6B 5IWLC 1TQWA 4HWUA 7PCYA 3OAZH 1L0QA 3EDKA 3BAIA 3LEXB 2ZXQA 4P59H 3TBTB 5FEBA 3F58H 4IRZH 3K71A 3D7PA 1HEJC 4PEEA 5LQBL 3BSGA 3Q6GL 5EEYA 2GY5A 5F8RC 5DQJB 1KCKA 2CXGA 4W9KC 2E9WA 4TUOA 3Q5OA 1OXYA 4E41E 2JCCB 3STLA 3BEVB 1KJMA 4NKMB 2AI0L 4XHJD 3ZDXF 4CJ1A 1U41A 4PGEB 3ARFA 3Q0HA 4X6EA 1BDYA 2QKIA 1EK3A 3ILEA 3QQXA 3UBXA 1KJVA 5JOEA 4V1DB 2WHVA 1BD2B 4ZUUA 1P1ZB 2A9NL 1IL1A 3T3MF 4G80B 4WI7A 4ZS6C 4FTDA 4MCZA 4JN1H 4DKEL 2BINA 1YEDB 5EORL 1OARL 2HN7A 2LVEA 5IB1B 4N20A 2A38A 2I60L 4LCCA 4M6MH 5HHXL 1M6OA 3BXNB 4YL4A 2PWGA 1DBJL 1XF1A 2JE8A 3MODH 4NQEA 4GEIA 5AG8A 3IDNB 4HIEA 5IQMA 4EMZA 43CAA 1S8DA 1XB8A 2IFGA 3IFOB 4IOSA 4N0CC 3NZ8A 3KDPB 3IDXL 3H3PL 3KPRB 4TNFA 1YAIA 1HHKB 5JIDA 1HXMB 2YGVA 3MV9A 2PNDA 1A7QL 5DMIL 2F7OA 1SLVA 3D69A 1WWBX 3JXAA 2ED6A 2OCCB 4AL8L 2FB4L 1EFXB 2PCFA 4N90E 1PX4A 1MIEL 5CN3A 5G4MA 2DWTA 3RVUC 2V5MA 5CJXA 3BVTA 4Y5VA 5FS5A 4JY6B 5JHMA 4TUKH 3AB0B 3X13B 1E9QA 5IQOA 5T1LB 5CIPA 5AD0B 3HAEA 3MRJA 5DRZA 2H4EA 3WKPA 4W4NA 3JZ7A 2ENSA 2DDQL 3QIBB 2BIOA 4JG0H 2BW4A 2BMKA 2F54D 2R7EA 4UM9A 1ORSB 4D2NA 5CEZD 1XEDA 2IAND 2V2XA 4RQQB 3GI9H 2VDOH 3FTGB 1IX2A 4GXVL 4MCYA 3SPHA 1FG2B 4Y4HD 1KN4H 3T1WA 4JVPA 4HP5A 5D6DC 1QACA 3IDJA 1OAXL 1VERA 4PJEA 3O0RH 4LKCB 2JQAA 2WSDA 2EVHA 4LLMB 3FU3A 5CCGE 1I3GH 3UTPD 3TVMD 3BDYL 1MFAH 1VCAA 1HKFA 2OMBA 3RL1A 1BVLB 5EZJB 7FABH 1UQSA 5EU4A 2ZCLL 3QJFA 5FGCE 5AOIA 4XMPH 3WNLA 3REVA 1ZLUK 1KIPA 5IK3A 4YHLL 2ETWA 3WIHA 2CA4A 1BEXA 1IQWH 5FYKU 4OI7A 2L4OA 5KYWB 5ALBL 3KYAA 1UA7A 3WMQA 4QOKE 3E8UL 2FQFA 2DH2A 3FQUA 3G3LA 2JELL 2XTJD 3LB6D 3OKNB 5I1JH 2DN7A 3R0MA 2LV4A 1D6VH 3UMNA 3MGAA 1ETJA 1EFQA 4J1UB 3PQYA 2XQBL 3G5ZA 1T0NA 1GJUA 2HB0A 3O6LH 2OM5A 2VR6A 3L9RB 5DMKB 1ND0A 4NQCE 1EZVX 1HCYA 2R2HA 3K74B 2Z1PA 1PZSA 3S0PA 5J1TC 4DPBX 2Z7UA 2QV2A 3ARGD 3WY1A 2VERN 5HHPB 3IN2A 1PNDA 4RMSA 2WXQA 4UZUA 1R3JA 1XCTA 1OAZH 1UWEH 4DQAA 2A6DB 3ZDXE 2GSGB 3QFJE 4N8VG 3QJZA 2VDKB 1D5XB 3MV8A 4NAJA 5H94B 4EVNB 3ASWA 2OTPA 1KG0B 3MJ8A 3MVSA 5F1NB 4PRPD 2WXRA 3DX8B 4N8CH 4YSOA 2ZCKH 1BA9A 3T3ME 1FFNB 1O7SA 4XWOC 2EDOA 4NT6B 2EH7L 2X3CA 3CXDL 4P05A 5BQ7A 4ODTL 2XWBB 4H1LH 4ZPVB 1NAMB 1WBXB 4I88A 4R2GD 1ILSA 3ESOA 3P4OB 3U4BL 3TBSA 4QXGH 1CE1L 3X11B 2XXMB 5ID1A 3EJPA 4L23A 3DRTA 3GHEH 2H6PB 3MLYL 1KEML 1A1OA 1UHVA 4YNYB 3MNVA 1QD0A 1BFOB 3WKMH 3A47A 2AJVL 1KFAL 3HS0A 1G6VK 3TCLA 4Y8DC 2L04A 1UXWB 3UTQA 1INDH 3QQ9D 4F7PB 2VN7A 5C08B 4EUPA 2ZWSA 4HFUH 1IGCH 3HNTH 3WENA 4RWYL 4NZRH 2NLJB 2WUBL 4L3ED 5JXEC 1ZTXE 4ZMVA 1SJEB 5C8JB 1NUFA 1XL6A 5AVYB 2VITA 2IV9A 4Q9RL 1B0GB 1X5FA 2E7HA 5E2VL 4XVTH 2RB8A 2FQDA 2QGCA 4H25B 3DSNA 5DYOA 2VH5H 2FUTA 3I2CH 3DDFA 4XNMB 1MH5A 1FC2D 1VPOH 4M61A 1DE4A 3HG0A 4NQDE 4NN7C 3VXTB 3ZQXA 1OCCB 1WISA 3AG2B 2Z6FA 1IC4L 1UCBH 4PTUA 2ZICA 4FKEA 5ANMB 3VXMB 5AVUB 2VAJA 1F4WH 4UMSA 4LK4A 4B50A 2J4WL 1OANA 1ZHKA 4KTDL 4NO0B 4LCIL 1D5BB 2VE6A 2VXTH 3WTXA 3ZT5A 3BD4A 3V52L 1CFMA 3DETD 3IJEB 1YYCA 3UGEA 5IMMB 4PRID 4MA7H 5DC9B 4PW3A 4P5KB 2EDYA 1Z9SB 3E6FB 2V9UA 2OAAA 3ZO9A 1HSAA 1PAMA 3KGSA 3AGWA 3O2WH 2XKNB 4YDJA 1I9RL 3UGUA 4P04A 3MRBA 4OLXL 5DRNB 1E40A 4DW2H 1D7DA 1GGBH 1HQ4A 4MMYB 3EZ8A 3BAXA 3VTMA 1QBBA 1LO0L 3INUL 4TNGA 4UTAL 1FO0H 4FQ1H 1Q1JL 1DJIA 2KMWA 5ESAB 1F13A 5FGSA 1CD1A 3RVVC 4I5BA 3O8XC 4YHKH 2QADB 2RMNA 3H0TA 5ACZA 4L29A 2CHDA 4NO2B 2NTFA 5HHVH 1H9DA 2PXYC 3VUAA 4YSTA 1Z66A 5DDHB 3BKJL 4YIQB 1L3WA 2BVTA 2LHAA 3GMLB 1KDIA 4N22A 5ABAA 3T0AA 4KROD 3US0A 2XWEA 2FL5B 1JOIA 2APSA 5A2KH 2OZ4H 5MEOA 3NEOA 1G84A 3MJ9A 5BUPA 2YN5A 1NFAA 1MFDH 4MNQD 4TSBH 3HS8A 1JTOA 2VJXA 4ANXA 1F41A 4L4TD 3RWDB 5EWIH 1J0JA 3REWB 3RL2A 2QGDA 4ZFQA 1BVOA 2VXQL 3TM6A 5D8JH 4YMPA 4G1EB 3V10A 3WNJA 2QLYA 5DRXA 2OTUB 2QTVA 4G8IA 1KSRA 5HJ3B 1G0XA 3HNVL 3IWUA 5GS0H 5KW9L 5L88L 1TNMA 3BCDA 5IM7B 4WW2A 3NJLA 1FZOA 2GABA 3CFQA 3B56A 4I3RH 5CN1A 1Z5LB 3QUZA 4L37A 4OQTA 3QZOA 1N8OE 5D4QA 4G1MA 3T08A 1MCFA 3PHOA 3SHSA 3HN3A 4KKAC 5BNXD 1DJGA 1JZ8A 3C5JA 4YDVB 1PS3A 1MNNA 3LKPB 3D85A 5KSAD 4MD4A 3L3JB 4JKKA 4JFHD 4TV3A 4JFYB 4PV8A 5KYYB 4K7PX 4NGHH 3BAJA 1A4CA 3F7VA 1EBPA 2NNAA 1R1CA 1CLOH 5HVFB 1IEHA 2ZUVA 1A3LH 5TE7H 1YC8A 2AK4D 4RSYA 1AZBA 1FH2A 3CLFH 3OSVA 4YXHL 3IDMB 1KTLA 2WQ8A 4FNRA 1UD2A 3B7TA 3BI9X 3B2XA 4PRHB 2XX1A 3U36A 4MJIB 1QHOA 2R56L 3OPUA 2PPCA 2FX8L 4M8UA 3OMAB 5IMLA 1U8OA 1A22B 3CFEA 2HTKD 1ET5A 3MC0A 3ALWA 3LAFA 4H4NA 5C9KA 1U8IB 4PR5B 5EC1B 3H7BB 4EQ3A 5A2BA 4PIRF 3VI4A 1FQ9C 1CGYA 4I77H 2HMIC 3N43F 5DK2A 4OJDH 5I0DA 3ARBA 3O9WD 1RULH 5D7JC 4LQ1A 4N8PA 3L3GA 1HE7A 4GUPB 1IE5A 1OE2A 5T3ZH 3GFUA 3HVDA 4ZO9A 5D71L 1UM6H 2EDFA 1IAIL 2D7QA 3IFPA 4YVNA 2R2CA 4BH7A 4CMMB 4HCGA 5GXBB 1WTLA 1NGWB 1YZZA 2JB5L 5TF0A 1VF5C 2YAPA 2WCSA 5BOJA 1ASQA 5FOJA 3O2DL 4ZFOB 1T89C 2AJYL 5DD6B 2OL3A 4P2RB 1DQIA 2HG5A 2CSPA 4RMTA 5E9DD 4AQ8A 3EOBB 4IGBC 2AQPA 4Z78B 2UZIL 4GIAA 4WVRA 4F2ME 4BFGA 4K7FB 5F7LB 1P84K 4P48A 4M7JH 3TWCH 5ISZE 4YHZH 3TO4C 4N0FA 5EZLA 2P28B 4RFEB 2NX5B 4FQPA 5D4IA 4NQXB 1I8IA 5E8NB 5FOBA 4HKXB 2BCMA 1DBAL 2O6CA 3LX9A 2TSAA 4QRUB 2EABA 4ZMQA 4Z7IA 1P7KB 5BS0E 4GEJA 5AW5B 2J2ZA 4ZW8A 1DBKH 3TBBA 3BIKB 5F7NC 1WUZA 4UYPA 3K7UA 1E8WA 4MZ3A 3SPVB 4KHXH 2JCCF 4W9GC 3RWJA 1ZIBA 5AW9B 2HH0L 3O3AB 1IFGA 1Z3RA 3LKRB 3NZUA 1SDDB 4JO8A 1GHFL 1IEAB 1AZZC 2Q86B 3ARFC 3V4PB 4ONGL 3SE4A 2QKIC 2FRGP 2I9LB 3HE6D 4AX3A 4PJ5D 5BXFA 5ILTH 5LNEA 4XBPB 2OK0H 3AXIA 3GZKA 3FMGL 4NO3A 3D33A 5DFVC 1AKJA 4KNSA 5EU7E 4LCCC 5F7YC 3VGHA 4GI8A 3VD9A 1A7PL 3V5HA 3U30C 2OMUB 1BLNA 3BP7B 2E8ZA 3U1QA 2R4RH 1YSOA 2ZXEB 3ARED 3K81A 4D9RD 2E56A 5I1EH 1Q8MA 3LEVH 5FDWA 3VFRB 2CBPA 2AQQA 2J5LC 1M1XB 2UVFA 3PGDB 2YBGA 2ITCA 5DSCB 3L5JA 2V7NA 2NY7L 5I2IA 3PWLA 1SQ2N 4JRXA 4JY4B 4DESA 1IBYA 3X3GH 5CJXC 4YHNB 5I66B 2CK0H 4RAUA 2VM9A 4X9FA 4EDWL 4KFZC 1DQML 1OM9A 3CSFA 1IC5H 1TXKA 4TM9A 1TQBC 4X8XA 4HCRH 4NN7B 1SMOA 1CI5A 3VRJA 1J1XL 1F3RB 2Q8AL 2PR9A 2Q7NA 2B9BA 4KGLA 4UZSA 2CIKA 4PS4L 1BBDH 3HMXA 3VXRE 2D73A 1LO5A 4HXAH 4Z8FH 2BDNH 2EEFA 2CO6A 1AI1L 4Z23A 3ZSSA 1TVBA 1UB5B 1TKWA 3QUYD 1FNHA 4PRNA 1UXLA 2QSQA 2ZT9C 4ZTEA 5FR3A 1LE5B 2Z4QB 5F88A 2NRDA 2L0DA 2B8OT 2QMJA 4JO1L 2O5ZL 3QZWB 3PIQB 5DURD 2XFXB 1U8HB 4FJYA 4YSUA 3EH4B 1U8LA 1IBHA 4EKXA 1HJBC 3ESPA 1IV8A 1AGCB 1Y18A 1MREL 1KJ3L 1O7DC 2ESVB 4HPHA 1U3HD 1XZ0A 4UIKH 4ERSH 3VU2A 1KIQB 2OMXA 3QBTB 5MP6H 3V9EA 4A6YA 4FZ8H 2ZCZA 2WQRA 2ZXDA 3FB7B 2JMRA 2PXYB 1YQVL 4LLYB 3N40P 3OV6A 4WUKH 1NGXA 5KYUA 1R0AL 3HFFA 2ZNWA 4Y19D 2R59A 2FO4A 4JQIL 4Q0XL 4NUGH 1Z5HA 2V8MA 3WJMB 2OSWA 4OCMC 2WJ7A 3NRFA 5HDQH 2YXMA 3BPLB 4MFHA 4ONHB 4HEME 4OFYD 4P9MH 4QF1A 5MEND 3F7YA 3GTTA 4ZAKA 1CXEA 3ZZQA 1E9OA 1GZQA 5T5FA 5C0JB 4APXA 1IQDA 3QCVH 3QQNA 1CC3A 3CQPA 3LNEA 1M42A 2JCCE 2BO0A 4NRYA 1YY9C 1OM3L 4BZ2A 4NDMA 4YHYC 4GINA 5DHXB 4ICWA 4KDWA 2ZUXA 2VLKB 5DJ0B 4HWBL 4H0LC 1ZLVH 4LP5A 2WM0A 5B7MA 4V1DE 3BAEL 4YBLB 4PJCB 1BD2E 2LAAA 1RIHH 3Q06A 1L9NA 1GAFL 4MNHB 1CT8A 1OCRB 2P8LA 3K5SA 1I3UA 1FYTB 1KENH 2JJSA 5F72S 2YJQA 3ZIYA 1RJYB 3GKWL 4LPXA 1OAYH 3FT0A 2QGEA 4DO4A 5IQLA 2WNWA 1W72A 5GS0D 1HL9A 3KEDA 1S3KL 2VDMH 3D09A 4LIQH 4ZUWA 4MXQD 4P5RA 1UKTA 1KGIA 1B0RA 1PSKL 1A7RH 3BZ5A 1FVDA 3KPRE 2YQ2A 4U1HA 1QRND 1OGTB 4JFFD 5D70L 5BZWB 1A25A 4HZAA 1ZT7A 3VFMA 2VLRA 5F7KC 4BQ9A 3NSFA 1A14L 5I6PA 3KLLA 2ZSWA 3BVNB 4HUXB 3RI5K 1T5KA 3ZE1B 2R29H 4N5UA 5IV2B 2DQHL 2BM3A 5FXCH 1RJZB 3CSPA 1J1PH 1M7IB 2WMPB 3QEGH 4AQZA 5DJXA 4ZODA 3V6OE 4P5TD 2B59B 2CBOA 1Z0NA 4O00A 5C07B 4ZD3H 2OR9L 1UA6L 1HEZA 1NKRA 2GTQA 3MO1A 1E27A 2R0WH 4IMLB 4PJHA 4K5NA 2B14A 5CCHE 1ZD6A 2PW2A 3P0GB 3Q43A 3U79A 5D7JB 2D4FA 4K3EL 4ZRGA 5JW4R 4MLSA 1MCCA 3CFDB 2MPAH 1SM3L 6PAZA 1A3RL 3GSOA 3MGOA 5IFAH 4WV1A 3QZLA 2CKNA 2UUDH 1L6XA 2UY6A 3RU8L 4C56B 4HWZA 1PYWA 4YXKL 3RB5A 4DZ8A 1MCWM 1EH9A 2Z31D 1FVEB 1EHXA 3IYLW 4G42B 3PHAA 4JHWH 1ZEAH 2WKLA 2GK0A 3FOLB 3KH3A 1UM4L 1UUNA 4U0RC 5HSFA 4EIBA 3PWPB 2IH3A 1PKOA 3W11D 4RGOH 5IW6A 3MFGB 5CEXA 2EYSB 2P52A 4XVUD 1SVCP 3EF4A 3TOPA 1KIUB 2PPAA 1G7LB 2R69L 3M7FB 3UAFA 5AB9A 5KYXB 2FX9L 5LBSA 1JRHL 1N8ZB 3QZWG 4BWWA 4W9HC 1S7RA 1JXJA 2ZF8A 1LEKA 1RUQH 3X1GA 3CZKA 5HPOA 4FEMA 2K4AA 1I7RA 1H3TA 4G9FA 4Q6YA 5D93C 4JFEA 2PP9A 3OKLA 4FNLH 3CXHJ 1IFRA 1ID2A 1J12A 3GLEA 4WKXA 4P2OB 5D4HA 1MFUA 4QRPE 2IFFL 1DO6A 4MTMA 2L7EA 4I1NB 2AJ3A 4J5VA 1BXVA 3K71B 4CDHA 1DVUA 2H3KA 1G1CA 3ZL4L 4KDTA 3SYOA 2GJ6A 1MW2A 4TUOB 4X9BA 1KJMB 1E43A 1NJ9A 4KXZI 2CDFA 4ZBJA 2B1HL 1N7ML 4ZUTA 3ARFB 2HT4D 2QKIB 5DUBA 3KYMA 1KJVB 1FN4A 4DKFH 3JTTB 2J20A 3PWJA 5DLMH 4MCZB 3QUZC 5HDOA 3VM5A 4AUUA 3QDGD 2IPKA 4FG6C 2NTSP 3ABGA 3N85L 1DJSA 1WC7A 3HZMA 1KYOK 4LOVA 2D7TL 4LCCB 4G5ZH 3OQRA 3ARQA 1M6OB 3IBOA 1QTSA 1RUMH 2IOMA 3U30B 2NY2D 4NQEB 4XMTA 3KPNB 2FHBA 1MQKH 5LDUA 5LQBH 4HIEB 4EO5A 4GAYA 2BERA 43CAB 3LQAC 4G8GA 4D0DB 3NZ8B 5EHFA 5C08E 3BZFB 3O4OC 2J5LB 1DFBL 1P7BA 3MV9B 4AJ0A 4M3JA 3TFBA 3WTYA 1JNHB 2NQ3A 3U4AA 2PCFB 4FP8H 3KDMA 3OB0H 4URTB 4PPTA 1HHGA 3HBQA 1TJXA 4CC0A 1E9QB 1AGDA 2VQUA 3HAEB 2EEDA 5DRZB 4AQ1A 1MPAH 3JVGC 4Q74A 5ANME 1OO2A 5DHYA 4PGCB 4UOQA 5I1HL 1ID5I 12E8H 4X0KA 2BMKB 2R7EB 2H5UA 4N5EC 4QRBA 2F8XC 2VW6A 3ARBC 4MCYB 3H3KA 4YDLC 3TJEH 1N4XH 4PJEB 3IDJB 4POZD 4M3KB 4OB5H 4AL8H 3EOTH 3VSUA 2CWRA 5JQHC 1ONQA 3GSXA 4XX1G 1HWGB 1NCCH 1NCAL 2HKFH 3PCYA 4XMWA 5E99H 3MZTA 1RL1A 1SEBB 3KLDA 5EU4B 3NGBC 3QJFB 3ZR5A 3DV6A 5C6PB 3QDAA 5I1DB 4BFRA 3REVB 1KIPB 5IK3B 4DEWA 1QVOB 2FEDC 4KI5D 3SQOL 4P49A 3POHA 4PJFB 4XB7A 1OZUA 4AQ8C 1I8LA 3BDXA 1BQHA 3CU7A 2B4CH 3FQUB 4OCLC 1WV7T 1DO5A 2G5UA 4KMLB 2ICCA 1E8YA 3RRQA 3TT1L 3FFCD 2E9GA 3JWOC 1KTBA 3GJFH 1T0NB 3RQ3A 3GXPA 1KIRA 2X5PA 1QWUA 2VLRD 3OF6A 3T3PB 1SVZA 1ND0B 2OMTB 4IMKA 3S3BB 4NQVA 1WAAA 2WUCL 1JV2A 5FGBA 2EUXA 1W0WA 2ICWA 1G7PA 3IMUA 2O5XL 4X50A 2X1WL 1JPTL 2XIIA 4J3VA 3U0PA 1E5CA 5IT2H 2DQEL 4MMZB 1XCTB 1ROWA 3EJSA 4MXVE 1I31A 1ADWA 1GVIA 2C1OB 4YHYB 4ZZFA 1A6PA 2KC0A 2FJHA 4JN2A 1INEL 1T1ZA 5F6HI 3SE4C 2DEWX 1LEGA 3VXQA 2VISA 3T2OA 2Z35A 3F04A 1RUAL 5HGHA 1MCIA 1QP1A 3DOSB 5AKTA 5A2AA 5A2CA 2MEJB 1VZIA 5B4MD 5KS9B 4GSQA 43C9A 2WXNA 5AUMA 2XN9B 5BQ7B 3O2VH 2PETA 5IP4A 5FO7B 4PFEA 4WI2A 2EZ0C 5E6ID 5SWSA 5ID1B 3HZVB 3L17A 1FA4A 3QHTC 3NSJA 3S37L 3T8VA 1LO2L 5DS1A 3BUIA 4RX4A 2AQNA 4J3BA 5EOCL 1U2HA 4G7YH 4A2MA 5DK0A 5HPMA 3UTQB 1QBMH 2BHFA 2N7AA 4MA3B 4RMUA 4PJ8C 3W0WA 4EN3D 4EUPB 1KZYA 3FOMA 3FQ1A 1HYSD 3OJDB 5EO1B 3GMNA 4GW1A 4PRHE 4PWGA 4QRRA 2VXVH 4OH2A 2VITB 4MJIE 3UDWA 3AUWB 4OCXH 4UT6L 2YQBA 1TTGA 5DYOB 3WBDA 4I0PD 4X83A 3ULVH 5K1VA 1T6VN 1CE1H 2EH8L 3MSPA 4HJEA 3NIFB 3SSGA 4CAGA 5DD0H 5EBMB 1J86A 3CPLA 2CU9A 2HFFA 3CSYA 5KANI 4PTUB</