3HG0A

Crystal structure of a darpin in complex with orf49 from lactococcal phage tp901-1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
137
Chain Sequence
GNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPIDHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and function of a DARPin neutralizing inhibitor of lactococcal phage TP901-1: comparison of DARPin and camelid VHH binding mode.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Protein binding
molecule keywords Baseplate protein
total genus 23
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hg0A01
3DA0A 2F0CA 3HG0A 2X53A 1ZRUA 3EJCA 4HEMA 2BSEA 4IOSA 2BSDA 3U6XA 4HEPA 3D8MA 2WZPA
chains in the Genus database with same CATH superfamily
3L9EA 4ADJA 2BIQA 3TO4A 3LYRA 3HI5L 3BVXA 4WWKA 5C0BB 1MREH 2RALA 1HL5A 2O6PA 4QOKA 3TEUA 1TTBA 3CDCA 1JN6A 1PTZA 3EJSA 1M2VA 3K3QA 5IMKA 1Q0XH 5HYJB 4PJBB 4Q9QH 4JREB 3DETD 1Q72L 3QUKB 3DROB 3HAEH 3LRHA 1FDLH 2I07A 4XX5A 3VFOB 3CDZA 2GJ6A 4Q58C 4MJ6B 2O61A 4HUWA 5SWSE 2W60B 3LZPA 4LCCB 4I0PD 3RWHA 3W5MA 2UWEE 2X4OA 3GRGA 5HGHA 2KZ1B 3QQDA 4Z76B 5C6WH 1AXSB 1VFAA 4HWZA 2OA9A 4NFBA 3RL1B 2XQ0A 1MFAL 1NINA 2W88A 4ELME 2FR4A 5FKAB 2VXSL 1R46A 4N90E 3LDBB 4QGYA 5DYFA 3LRLA 1YECH 5KBLA 1DR9A 1OP4A 3PWJB 2JKTM 1UGNA 3IFLL 5JQHC 3A47A 1S2EA 1N2RB 4RMQA 2VABA 4GW5B 4I48A 4N8UA 2XWBA 2XHNA 2JMRA 2XBZA 1R5IA 1HEZA 4JFWA 3VWKA 4LLQA 4IBUA 4BA0A 1T0NA 2I24N 1D7BA 5BQ7A 3T4YA 1YEFL 2KQNA 3GSNA 5GISL 1NCNA 2X0VA 3EJRA 5FOBB 4AYBA 2X4SA 4AQEB 1JK8A 4RQQA 2V33A 1A9EB 2C7FA 4X4XB 5EOTA 5FB8A 2AQPA 4BUHA 2H32H 3KBEA 5CLYA 4M02A 4XPBL 1U8MA 5CP3A 3DECA 4JQVA 4WNJA 5EORH 4IIQB 3NSYA 3F7VA 1UACH 1D7DA 1Y6NR 3U4BH 2FJSA 3MACH 1PEZA 4JFDA 5F7BA 5GGSB 3WIHH 2BHUA 3SDCA 5F8RC 1MI5A 3LXAA 3WELA 4L48A 2UXTA 2AANA 2R2EB 3AT0A 1T3FB 1OQXA 2PP9A 1DQQA 3P4NA 2JJTA 3D25B 2ITDB 3O6ML 5HI3C 3UAJD 3UBXI 5D6CA 3WIFA 3UTPE 2BXYA 2PNDA 4N9GB 4V1DE 4KDVA 2G3MA 2ENJA 4P8QA 4L4TA 2VDOL 2LU7A 3ZYIA 3TTSA 3FRUB 4HJ1A 3QJFB 1A6VL 2FD6H 1GZQB 4Y7MA 1TJGL 5DVNA 5EZPA 2I60H 2EDLA 5FWQA 1E5ZA 1D5IL 2J88L 4ODXB 4FNUA 2Y1ZA 1MFMA 3FO2A 2WQ8A 4NKMB 3GSWA 3V4PB 4R84A 4XBGA 4EIBA 4P49A 4X5LA 4M61B 1WISA 4OD2A 1EHLL 1ZCRA 3MDJA 5KBDA 1NCJA 1EEQA 3H54A 4HK0B 4OUOA 1AQDA 3VI4A 3IMBA 1RURL 3ZBMA 1FAIL 4U1KA 3VFMA 4YPGA 1DQDH 4M7JH 3QWOB 4HBCL 4WK4B 2AJVH 3KR3H 4TNVF 2HFGL 1KUMA 1SYVA 5CS7A 2UWEA 4M00A 5HYEA 1TJXA 4WW1B 4N22A 4EIGB 4RZCA 4LVHC 4WTQA 3PGDB 2BCKB 5HDWA 4AK1A 3ESNA 2B4CC 2J20A 3ARFB 3VQLA 2EDBA 4OGZA 1ZHNA 2EE9A 4U3SB 4PLNC 5GGTA 3CFKA 1HWWA 5E2UH 5IROA 1ZJBA 3H3KA 1XCXA 1MEXH 4TPRL 5DFTA 4OLVL 1QEWA 4ZXBC 1XSIA 5D96C 2YD0A 3D1MC 5DRWB 2J71A 3PXHA 4XAWH 3BN9D 3TBTB 5AZEH 2X4NB 4G8GA 2B1OA 3QUXC 4L2YA 2D4DA 4C56D 4UQEA 3PV6A 5KS9E 1F8TH 4G7VH 2BNQE 2YC1A 3QJHB 3QDMD 4KFMA 4YXHL 4JM2F 3WTVA 3LVTA 2J8OA 3OJVC 3GXTA 3NJMA 4YHPA 4AMKH 3DHJA 4KK6C 1DCLA 1UZGA 3L16A 3V9CA 2ZTBA 4DNLA 2EO1A 4PJAA 2NY1B 1U41A 1UXLA 1CXIA 1EO7A 3LNFA 1ID2A 3PFUA 4PRAA 4PJFF 2J57A 1SQMA 2Z7ZA 3QFJB 5ANMB 1GYWA 2Y5TA 5EG6C 3DVNA 1D5RA 5LAXB 3RTQA 4JG9A 5LN4A 4HJJH 2WTOA 5C07A 3TO2B 3STBA 4HCRL 1INEH 5BRQA 3U9PL 2CM5A 2YA0A 3BZ4A 4HH9B 4OZFH 5HYJD 4X6EA 4QXUL 4JQIH 1UKTA 1HHGA 2FJHB 3ABZA 4PRBB 3RDTA 3MLYH 4IMLB 1R3HA 1OPGH 2VZVA 5DI8A 5AVVB 2Z31C 5EN2B 3NSJA 1E28B 3FFCD 4KKPA 3GMQB 2GEEA 3IS1X 3VXUA 4JKMA 4PJFA 2C9VA 3FN0L 4I3RL 3OSVA 4KROB 1W8OA 3BFWA 4RDQF 1JAEA 4MDJB 4NJ9L 4ERSL 4FTVA 1RH8A 4Z7UF 4S1RH 3VFMB 1A6PA 4JLRA 5TFSL 1AO7D 3WO3B 2VH5H 3QEQE 1JZ2A 1T7WA 1BEYL 2J4WL 2Y5QA 4YSOA 4YSRA 3CUPB 2DJ4A 2ZSWA 3F7LA 4FQQA 3ZE0E 4FABH 1SXSA 2YD2A 2KHAA 3F6IA 3KPRA 4I5BA 4OM1H 4YDKL 3S6CA 4HULB 1BQHG 1A6UL 2VAAB 3HBPA 3T3ME 3ROLB 4FFZA 5B8CA 5CBEB 1EQWA 2VRAA 3OKEB 1WYJA 4GY4A 4EO5A 1R9FA 4BKSC 2IWFA 4ELMB 3AWEA 4O02H 4MQ7B 3ZTJG 5L88L 2X2UA 4Y5YC 4E0RA 4UZGA 2Z31D 5JR1H 4RWHA 1XZ0B 1Q8MA 1I1FB 3QDJB 1A7QL 3WFBH 1VZIA 2DWEB 2O5ZL 2MOVA 1SHMA 3EO1B 2A9CA 3QARA 3PU7A 4LCWA 4Y5XA 4YDJB 5EBGA 5FOJA 5KYXA 5DZ9A 4WFFD 4OZIE 3OMNB 4EKJA 2FZ3B 2CGYA 6PCYA 4N8VG 2Y2YA 4TLUA 4OV5B 3ZX1A 3WN6A 1EXUB 5GSVB 3MNWA 3BN3B 3U83A 3SDCB 4OSUL 5HDLA 2XKSA 4K2UL 3VFVA 1X5IA 4DP5X 2AC0A 2V5YA 2JB6B 4U6XB 3P11H 2XIIA 3BD3A 3OB0K 5E2WL 2L0DA 4CN6A 1YHPA 1XHHA 3ARFD 4FHBD 4U6TA 4QLWA 4R0LA 4PJ5B 1FCGA 2CNZA 1FHNA 1H3XA 4X4MA 3KAAA 4N2GA 4XWOC 2AK4D 4R8WL 4KQ4L 2XWDA 35C8L 1RZ7H 1TG8A 4X4XA 1OAXH 1VEMA 4MMZC 4N68A 4WTZG 5E0FA 4FADA 2ZXGA 3DOSB 1UJ3A 1XSJA 5CWSB 3GBEA 1CFBA 4OLZH 4UT6A 1SLVA 5I8OL 2Z34A 3TU6A 4F7CB 3OJDA 3WNMA 4OSUH 3Q1SL 5KSAB 1QTPA 4FNSA 3F64A 4BRVA 2V5RA 4O5LL 1FBIL 5EOCJ 4GPVA 4MLSA 4L9LC 4ODWA 2A0LC 2YS4A 2EKSB 4G70B 1X9QA 1N18A 1BOGA 1TQCB 3KD4A 4FQCL 3VA2C 1WC7B 1FZJB 4DKFL 4X6FB 4NZTH 3O9WD 4QDGA 3KPLA 1J1XH 4FTVE 4NUQA 1YJDC 4C56B 1FFQA 3MV7E 4WCYL 3LXCA 3QJSB 4BQ8A 3HNSH 1Z3GL 3N91A 4L3AA 3TPKA 3ALWA 3HAEG 1IX2A 3UAAA 3NK3A 3S2CA 4NXKA 3VYPA 3OKNB 1U8PA 4P48A 4IOSA 2OMBA 1OP5H 1LO5A 3MR9A 1A3LH 3HZVB 4BUQA 4NN6C 1ZE3H 4DKFH 3EJZD 3JWNC 5IF0B 3QI9B 4GUQA 3QCTL 3VGHA 4IRSD 3IXAB 5AKVA 1BF5A 2V9QA 3N85L 3RB7A 5G4OA 3FO9A 4CADA 2VAAA 4PJ8C 1GYUA 3R1GH 5F1OB 4H8HA 1VFBB 2F54A 4NQEA 2EEDA 3SDAA 3VWJD 5KG9A 4OW6A 4PP1C 4XMVA 5KSBA 4KXZI 2HH0L 2WCGA 4HEPA 4TNWK 4XCFH 2BVQA 1CDHA 1INEL 4HCRH 4IBSA 4YIQA 1RZJL 1UZ8A 3EGDB 3QAQA 1IIKA 3GS4A 1VEOA 3WUZA 2VXQL 2X4TB 5J06A 5L2JB 4DN4H 3L3DA 5INCA 12E8L 2E76C 4DGVH 4R90H 2EKJA 3LCYA 2DQIL 1AGBB 4KXDA 4D0DA 2F7OA 1X5JA 1R5WA 4BCZA 4DAGH 3O6MH 3U2SB 3A67L 3MO1B 5GGRA 4TNWF 4XWGH 3V6ZB 5GGTL 4CBZA 3DO3A 5I1CL 2WLHA 4Z7AA 3PAZA 4OBSA 5BMFH 2F53E 4PM1A 5EEXA 5H2BA 1NBCA 4NKOB 4X6EB 2HCZX 1R17A 2XKNA 3ESUF 3HHSA 1SMOA 2QFPA 5C0AD 2XNAB 4S1DD 3B43A 3GRWH 3MACL 2H32B 4LARH 3MA7B 1YNKL 3DXAA 4ZPTB 1I1AD 1N3NA 2H6UA 3NA9L 4NWTL 1G43A 2H3NA 3F58L 4U33A 4X8GA 5ITBL 4L18A 4TPRH 1ZV9A 3UAJC 5FGSA 1D5ZA 5E6UB 3FQ4A 4R2GD 3L5HA 1A4AA 4ZNCD 3HG1E 4ECNA 2J43A 3DX9A 4DP6X 1ID5I 1Y18B 3L4TA 4ZMNA 4N87A 4HUCA 4IRZA 1IC7H 1A3QA 3KDMB 3PE9A 2VE6B 3GNMH 5KSUB 2AJ3A 3LQZA 5L7XL 4G9FB 3KYMA 4X7SH 3UBXG 4PJAE 3EBHA 5ISZA 3UO8B 4EI0A 3BWAB 3UTOA 2JK5B 4ONOA 4YS4A 2D7TH 4ANXA 2UY7B 1HHJA 1KB5B 5ID0A 1W9XA 3HJ0A 1IBFA 2A2QT 4P5KA 5JXED 5JIHA 1HOEA 1I8IB 1E5BA 5K9OB 4NO5B 4BKTC 5MENB 4YDLB 5I23A 1E5UI 1F4AA 2F8OA 1WFJA 1U8QA 4JDTH 4Z95L 1CFVH 3QDJD 3FT3A 3ZYOA 3DX6A 4GW4B 3EZJB 4BZ1L 3HAEB 3QS3A 3S8GB 4G6FB 3MLYL 1A6VH 4OU3A 4HG4J 4L37B 3TT3H 4P9HL 5FYJH 1NGWB 2GJZB 4HK3N 1RZQA 3SQOH 4AKQA 3CBKB 5T1DH 2FIRT 5EZLB 1GMIA 4YHIA 1EX0A 3QZOA 3JT0A 3N44B 3MTXA 5CZKA 5DEZA 1LO3L 1N3NB 3C60D 2FO4B 3FF7A 5GGQL 3BKYH 1HE8A 1NTDA 3OGCA 1EZUA 1BWWA 2NTFA 4I18B 1A1MB 1U95A 5T5NG 4OBRA 4UMSA 1NCTA 5F97E 2IQ9H 2X53A 3HRZC 3LXBA 4DP1X 3IJHA 1NZRA 4NBZB 2HJLB 1RLBA 3D18B 2J6WA 3TT1L 3EADA 1TPXC 3HE7B 3LRSB 5HGGS 3MJ9L 3I6KB 2FWSA 1UWYA 3U4BL 1KIUA 3OKKB 3QZWA 3LV3A 2NY5C 1KJVB 4L4TD 4NENA 3PNRB 3B2MA 2VZ1A 2EDRA 1N64L 3GFUA 5F7EL 3TBBA 3SE9L 1FVEB 3SD5A 3T3PF 4EUPG 2EXYC 3ZE2E 1EJOL 3MRQA 1P7QD 2H0PA 2V2WA 4XE0A 5F9JA 3ZYZA 3H42L 4QRQA 2QSTA 1NSNL 2VLRB 1YZZA 2EYSB 2JKIS 3B5HA 5DO2C 4YXKH 3QEHA 4UILL 4HUXB 2DMKA 4P2OC 4P2QA 2K6WA 2CHDA 1T0OA 1QI4A 2VN5A 3MLTA 3CFNA 4DK6A 2VERA 3EUUA 2RQ8A 3OAZH 1FG2B 1J88A 2ATAA 2C7UA 1OV8A 3X13A 3D0VB 4ZJ9A 5HHVH 4PUBH 2OTWA 1CQKA 4M7ZB 1ECYA 1OB1A 4XMXA 1E90A 1WFMA 4LCCC 1OSEA 4NJAL 4HDIA 4YE4H 5BZXA 4KU1A 2KLSA 3PHAA 1LO5B 1ZT7B 3VXSE 2IGTA 3GRWL 3VXRB 5IJKC 1T2QL 2ZONA 2GIXA 3OWRA 3EOAA 4PY8J 3QI9D 4KO6A 2GCYA 2M1KA 2G5BA 4ODHL 2YAEA 3GK8H 2PABA 3D52A 3NJIA 5E7FA 4XPHH 4HXAH 1V7MH 5F7WC 1R3IH 5J1AA 4C56A 3KPMA 3NIDF 1AXTL 2WYHA 2F1BA 2BFVH 2VDOH 4E41E 4XXDA 2OI9C 3GMOB 1RHHA 4KQ0A 5TF1H 4LCCA 3U1PA 1GIGL 32C2B 5CFHA 2YEVB 3QEUA 5A2AA 5M7QA 4HIJB 4MJ6A 4M29A 1PJ9A 2QGBA 4H20L 2WLYA 4XC3H 1T83A 2WLMA 4P46B 3RKDD 5F1KC 2WN3A 5KYWB 5LNGA 3MV7A 4HPYH 3LIZH 1KDJA 4N4YB 5AOZA 2XQYG 5DR5H 5IM7B 1J0KA 1FO0A 1HESA 1XO8A 3RWCA 3P4MB 1RD6A 2C3HA 3HPJA 3HS0A 4F7CA 3MRCA 5EDSA 4RAHA 4WUKH 2I7SA 4Y8DC 3CVCA 1S9YB 1E4XI 3T2PA 3SOBH 2N59A 5CIPH 3RWDA 1GKOA 4IM8A 4PQXA 4Z7QE 1R24A 3KLAA 4QPEA 2FGWH 4YAQB 4JM2B 4FKKA 4WHDA 4MB5A 1F42A 3N40F 3O9WC 5CSGA 3W38A 3D85A 3JYBA 4A2DA 3H9ZA 3EJCA 3T0EA 2A38A 1F0LA 3NPSB 4NQVB 1AQHA 4LVNC 2YXVA 3EH5B 3C60A 5KSUA 3FCSA 2XC8A 3SOTA 1B0GA 1L5GA 3CD4A 1BAFH 3O8XB 3KPOA 2PCPA 3CFEB 1OP5K 2TAAA 5CLZA 5I8CA 1AHWB 1MIEH 3DI2B 3QPXH 4CSZA 4K3JL 1JZEA 5MEPA 5E6ZA 3CXDL 4EUPB 3GHEH 4KUCD 4DP7X 1YN6B 3PY9A 3HJEA 3QFGA 5AW5B 1Z9OA 5JORA 4LLYB 5J3HC 1L7IH 4HIEA 1RMFH 3EO1A 4XI5D 4ZFZA 3D0LA 1Z3RA 1BQUA 1F41A 3U30C 5FUZL 5IWLA 2B3IA 1ED3A 1RQ5A 3SDXE 3JYCA 3DSFH 1MELA 3D05A 4K5OA 3VGAC 5A6IA 3CPUA 1V5JA 1INQB 1C16A 1IBZA 2YBRA 3DBSA 1QRNA 5J4MA 4JHAH 3VWKD 1G6RB 4PJHF 2W9LA 1ETJA 4PJ7A 3L9YA 5AVWB 1TVBA 3UADA 3T4AC 1WVZA 1WCBA 4IOIB 1WITA 4HC1H 4MD5A 3RZCB 2QT6A 3CVIH 1HWGB 4K8RL 4P2QD 7CGTA 5IBLD 1GS8A 3DOIA 4NDMA 2X44D 1JGDB 2VOTA 3OR7A 1YRKA 1RK0B 1JRHL 2UZIH 3GB7A 4UT7H 1SVZA 2PWGA 5C0JA 4NBYB 3GMMB 3O2WH 3RPKA 4KQ4H 4LSSH 4PJHA 1QNIA 2D03L 2XA3A 1VFBA 5C70A 4P2AA 4UAHA 4UINL 3UABA 1KTLA 4PTTB 4F7MB 4Y1AB 5E2WH 4KDTC 2Y24A 3MLSL 3C5XA 1D9KD 4DK3A 4A2FA 3FU3A 2QSVA 1UD5A 1ASOA 3DWTA 2DKMA 2QBWA 3N0PB 3MUY1 2OBGA 4HWNA 3O4LD 3TJEL 1IC1A 1H15A 1U42A 2BNRE 2YEZB 3MJ6A 1DHKA 2DN7A 3V7AG 3ZKMC 5CEZL 3BP4B 3BQUD 4GG6E 1DQMH 4P3CH 4XBEL 5E94B 1MCNA 3V6FA 3MBWA 2LVEA 3IS0X 4P3DB 4PRIB 1NFIB 5JHDB 4N0UE 4L29B 4G6ML 4XZ4A 1GMEA 1R3IL 3P4LA 4FI7A 1P4LA 5BZDB 1IGTB 1W0WA 1GY1A 5DZPA 4GSDH 4XN7A 3C09C 2RIKA 5I8KH 4JQXA 3F83A 2ZICA 4L0ZA 4F7KA 4RISL 2R83A 5D1ZI 2YLHA 2ZXEB 5DJ6B 1BZ8A 2ZOKB 1BZ9B 4V1DD 1E7UA 2BVYA 4RGNC 5GGVY 2EO7A 3FBKA 4DKDC 1HL8A 3R19A 4DPBX 4XMPH 4DO4A 1X5ZA 4MDIA 3O3BB 3UJJL 4Z78B 5KSAA 3L13A 4JX0A 5A2CA 4MTMA 4R0LC 2JELH 4JZJA 4NRZB 4DN3L 2MCPL 2OQJA 3JUZA 4WW1A 4WGKA 2A83B 2XN2A 3UYRL 4HCGA 4W9ZA 4Y4KA 4BFNA 4H4NA 4XCEA 4YXKL 4LVOB 2ROYA 3KL3A 5FS5A 5D7LD 1CK0L 1OB1B 1CO1A 4TUJA 4LLVA 2X88A 4G6KH 2Y7SA 4BV1A 3N3EA 4G3YL 2BDNH 4A7UA 4B9ZA 4D2NA 2X1QA 3ELAT 3GGWA 1CIDA 5JXEC 4JO1L 4TVUA 3O6KH 3F12B 3ZKNC 5KSVA 1VF5C 3LS5L 5I75B 4B95C 4XOBA 4U0QB 1E4XH 2DQGH 1IAII 2V7HA 1FIGH 2IBBA 5ERWB 2AI0L 4N2DA 4QEGA 3X11A 3ZT6A 1WFOA 5C0AB 4U1LB 1B0RB 3EOBA 3MODL 1ZLEA 4EI5C 3D34A 2R8SH 5DZLA 3BIKA 2EDQA 3OHXC 4AZ8B 1NH6A 1RP9A 4RAVA 4N9GA 2Y22A 3O2DL 1LQBC 1SGKA 3MRKA 4GP4B 4JPVL 4I1PA 5FGCE 1R3KB 2KI6A 3SDYL 5FLUA 3WIFB 5B4MC 2OZ4H 1KJVA 3DRTA 3ZDZB 9CGTA 4N28A 1LYQA 2DQDL 3LDBC 4GRWE 5DJ0A 5EU7E 5C0AA 1IAOA 3SYAA 4L4VE 1B3JA 7TAAA 3BUYB 1CK0H 3ULVL 4XMPL 1FVDB 3H1ZA 1QEXA 5GGSA 1H6FA 3PP4H 4GKZA 4X4ZA 1PFOA 1IB5A 3G6AA 4PJXF 2X1OA 3RDTC 4Z8FL 4JLRB 1IKOP 3D4GA 5F8QC 1CICB 1ZT4A 1AIZA 5HD8C 3OD3A 4N2FA 4NRYB 1KEGH 3HUJB 2ICEC 1HILA 1ZT1A 1UH2A 2DQHL 1VFMA 3CPLB 2Y1VA 4ZSOA 2CH8A 3VXUB 4JO2H 3WE1A 3D0AA 1HIMH 4ZS7H 1S3KL 2OJEB 2A83A 2XV6B 3I84A 2VUKA 4JFQA 5DEFA 1VCAA 3CZJA 3HE7D 3T65B 2NR6D 3MYJB 2FJHA 4PRBA 4TOYL 3O4LA 1I8AA 2HTLC 1OAZL 2YKKA 4NRZA 2KC0A 5A2BA 3P3SA 4AI7A 2Y7QA 1KJ3L 3ZE0F 1N2RA 2C34A 3FT4A 1YN7A 3QDJE 4MCNA 4Z7QF 5DU7A 5EV7A 3MTRA 4P5KB 1HSAA 1X6NA 5B7FA 3A6CH 5DHVH 3TCXA 3RGVC 1ASQA 1QPPA 2BPBA 3E2HC 3SKOB 5JW4M 2FL5A 3Q06A 2RFXB 3BVWA 1PCXA 4F1ZA 1EZSA 3QZPA 5HHMD 3MLSH 4HJ0D 1N59A 1QABA 1QI3A 3K81A 5IHZB 3EYSH 3AU1B 4XMLL 1U8NA 3X1NA 4LCIL 4OF0A 4X0KA 2VMJA 2X9YA 2YWZA 2ZE0A 4PGEB 3IFOA 5HYJA 1BFVL 1K4DB 2E6JA 3BYYA 3CSFA 4WKXA 2LE9A 3B2UC 1JRHH 1AFVH 3LPOA 5TQ0L 5BVJA 1I7RB 3SKMB 5JDJA 5DJAA 1A7BA 3W3BA 4JHUA 5EORL 4GQQA 5LWYH 3FAWA 3UYPB 2CWRA 3UPAA 3QDGB 3ECBB 4KXCA 5DS8A 4NUMA 4JPIB 5EOCL 4AQ8A 2XPGA 4V1DB 1A6AA 3O4LB 3SE4C 5F7UA 4WHTA 4MYWB 3E38A 3VXNA 1BLNA 2PW2A 4UTAA 4M48L 3FUFA 4H2AA 4OQTH 4Y89A 2HH0H 2CKBL 1PY4A 3VTMA 4AYSA 1T5XB 4JM4L 3IFLH 2Z91A 4F58H 1RUAL 4Z7VE 3PL6B 1G7PA 3V4PL 3ZL4L 1HXYA 1C8PA 3RTLA 4H8VA 1AQDB 1ACZA 1OZUA 4Z7OE 3AY4C 5J8OA 1BBJA 3L48A 4L8CB 5LDUA 2A99A 2DWDB 4F93B 2AEQL 4ABUA 1CS6A 2YSSA 2EINB 2RHEA 1A64A 4EI5A 2Y2TA 3SGKA 5KYUB 3QG6B 5FF6A 1GH7A 5D9SB 3FSAA 4KTDL 2N7AA 1UVQA 3QUML 1AZZC 2DM7A 2CMRL 2YD5A 4R96B 3SQBA 2Y7OA 2EAEA 3BIBX 2VR8A 3UG3A 1MVFA 3T4AA 1SLWA 4FQLH 2FQDA 3B2VH 3MROB 3S34L 3KPQB 2RTTA 4MBRA 3VQ2C 4ZFZB 4HFWB 4LNRB 4PG2A 5SWZB 2AK1H 5FR3A 4W9LC 2F7PA 2PTVA 3BDYL 3IJYA 3PXLA 4JQVC 4XNXH 3QHFH 4YHZH 3VGDA 1KTCA 1L6PA 4BFGA 4U7KA 4AGQA 2CKBH 3QT2A 4NCC1 4N0UA 3MGTB 3PG2A 4UT6L 4Z23A 1B4JH 1E3ZA 1E65A 3EBAA 3FYIB 3VB9A 2C9RA 4M8RA 4AW7A 3INUL 4OAWA 3MRNA 3GMRA 3FCGA 2UX6A 1WC7A 2WLLB 3APCA 4R7DB 4G8GE 1R3JB 2NXYB 4OUUB 1WRFA 2H6OA 4BQCA 3LKSA 2ZJSH 5DUJA 3QFDB 3V6OC 1G9NH 1GPOL 2APFA 4U1IB 2FBJL 1PAZA 3ARDB 1OSYA 4LSTH 1QFWL 2AZAA 3WJMA 1BFSA 1V8HA 4XC3L 1PLGH 2IQAA 3OAYK 4E5XB 1KFAH 3B9KB 4X99A 2A6KB 3KJ4C 1MCIA 4XC1L 3T0EC 2I26N 4M6AA 3LZFH 4I1RA 1RLWA 4WU5A 2PYEA 2G4EA 3S37L 3SO3C 2DL9A 1BZ9A 4U2ZA 2D73A 2W38A 3MV9B 4DGYL 2A74A 5FO2A 2B9BA 3IRCA 4KZCA 3RWFA 4HKBB 2OSLA 3HG1A 1CI5A 1WQVT 5FCUH 1L9NA 4Y5YB 4HWZB 2FAUA 1UEMA 1ZV2A 3REWA 2Z0UA 2EXWC 2WINA 3NRFA 5D2NE 5E9DD 1HKLH 3E1ZA 2A1WH 3C8HA 1UD4A 5HGAB 3AS3A 4EDWH 2WWMD 1FZKB 3H8NA 4XOAA 3OM3B 4PRHB 2A74B 3FB5B 3T3MF 5KAQG 4UILH 1YJDH 2WLNA 4DP9X 1TYJA 2ED8A 2B20A 3RIKA 2P5EA 4L1HA 4PUBL 3SPVA 3NZHL 3H42H 3EOAB 2EZ0D 3BSHA 4U7MA 5ALBL 3I9GH 1UXWA 4Z7UE 3RI5F 3KYOB 3HE6B 2X3BA 1HINL 4FERA 1JE6A 2A6JB 4E9SA 4OLWH 4F9LA 2WXJA 4L4TE 5IEHB 4E0RB 2J21A 4IU3A 2D9QB 2K4WA 4QI3A 3TJHD 2NLJB 1AXIB 1KYFA 3LPGA 4IDJH 2FEEI 2QKIC 2QHRH 4G9FE 5JLZA 4HAGA 1KTLB 1BBDH 1XAKA 2MJWA 3FC8A 2GJ6E 4PTTA 3GMPB 5E8DH 3V55A 4CNIB 4ZZKA 1I9IL 4R7XA 1JGLH 2QR0B 2ZSWB 4XHJD 1S7XB 5KSAC 3P3UA 5IQ9A 3X12A 5LQBH 4FULA 3QJVB 5E2VL 5JXAH 2NY5H 1R3LB 2GHZA 2IQ9L 1KSRA 4FZEL 1MY7A 4RFNB 5KVGH 1ZGLP 2E75C 4GAGL 1F3DH 4LKXB 4OM0H 2YLKA 4W70A 4JPSA 4BFEA 1MQ8A 1KBPA 3BRFA 4JQXC 1AO7E 3TCLA 1TQCC 3BESR 4JG1L 1MI5D 3BXNB 4NO3B 3LJ3A 4R4ND 3TT3L 3NTCL 3ZW3A 4QCIB 4LLWA 3O11A 4A7QA 4MNGB 1F2QA 2QSCH 2F08A 1MFVA 3LKNA 4H0GA 4GSUA 5JOFA 2CO2A 2P8MA 1K9TA 4BZ1H 5I1IL 5I16A 3K0WA 2ID5A 3BAIA 1MIMH 4XN4A 4YZFF 1OGAD 3UBHA 2AQNA 2COQA 2HPOA 2DD8H 3GO1L 5EU5A 4PJEA 2F58L 4CU6A 3CBJB 1GAFH 2YA1A 5TK2A 1A1MA 1U95B 5CILH 4ZT1A 1NCGA 4ONHA 4OV6F 1LVEA 3P9MA 4OJFH 4MD0B 5CUSH 2FNBA 4EBQL 3O9WB 3K7UA 4XHQA 2XG5B 1WBYA 1XCWA 3W9EA 3LHPH 3O6FB 3HRZA 1FYTD 3VGFA 4L37A 1ROWA 3S3BB 2NXZB 2NY6B 5AW7B 1YEEH 3VXNB 2IALA 3GZOA 5LNEA 1C7SA 1ANUA 4G72B 5I1JH 1RZJC 3QBTB 5EBMB 3GD1C 4I0PC 5IJCC 3IKCA 5A2LH 1U8CB 4L3EB 1KCLA 3OF6A 5D9SA 5MERA 4IKLA 1KBGL 4KK5D 1BVNT 1MFUA 3C6LB 4UDTB 1HKLL 5F1IA 1AZNA 1OW0A 3L4UA 2X4UA 4GSDL 2XV3A 3WFCL 4F24A 2DWDA 5H4YA 5L8JB 4KMTH 2KLRA 3TN0C 5F7MC 4WO4D 4L3CB 4FG4A 3ELQA 1YNKH 3WKML 4L4VD 4S0TD 1NAML 2E7LA 3DUSB 5LGJA 2Y25A 1Y18A 2NY0C 3QUYC 4H40A 1NANH 3CVHB 2E9GA 3RLSA 1DVFC 3ZO9A 2Y3AA 2FD6L 1JZ8A 1CF1A 2I9LA 3BGFC 4J28A 3L7FB 5B1JA 2IV8A 3MX0A 1MFDH 3TM6A 3WHXA 1FPTH 3IETA 5I1AB 5L6YH 2FUTA 2EUVA 3NCYP 2YRBA 3RGVD 4YHLL 2L3BA 3P4OB 5I16B 4N8VA 3IDGA 3JVGA 2NRDA 4IEFB 2EECA 3HZKB 4P23C 4ZMTA 2EUZA 3UTPD 2GUOA 4RLDA 5GS1C 4OZGB 3N85H 2YD9A 3WY1A 1K8IA 1XVSA 4ZYKA 5E2TH 3IFPA 2HVKA 3L5WB 3MGOB 1FFNA 2HRGA 4XN9A 3ZGIA 5AALA 2Y07H 1GYCA 4OTXL 4Z18A 3IJEB 4XOEA 3WIHL 4DTGL 1MFBH 2Y7LA 8PAZA 1SY6A 3FUIA 2ZNXA 1PX8A 2VR6A 3A6BH 4I9WE 1WDAA 4MVBD 4HC1L 1UOVA 3CU1A 3QRLA 2VDQB 1MI5B 4DZBB 3US0A 1DDHB 1HAWA 5EO9A 1IGMH 3EJQA 1EERB 1ZSDB 1NEPA 4KJYB 4QRSA 4GP5B 3CMGA 2DJMA 1DE4A 2WTPA 4HLZH 3I50H 1ADWA 1I85A 4KVNH 4Y16D 3QQXA 1DVTA 4NCC2 3SCMC 2DEXX 3F00A 1DEDA 2F5BH 3QI9A 3C5ZD 1X5FA 3L4XA 1ORQB 1A3ZA 4DQOL 1OGAA 2HKAA 4WCYH 2AEPH 3ZMEA 3FO0H 4JRYE 1T1XB 3L08A 2JCCA 2OYMA 4LPVA 1KT2A 3BD5A 1L0YA 4MMXB 5HHPA 1PZUB 1CLYL 3P4OA 3N1QC 4K3JH 5HHOE 2GI0A 4OGXH 3QJZA 1MAMH 3VXMD 3MX0B 3MCLL 4XNZC 1MDAA 4ATWA 2Z65C 1JHLH 2HMIC 4YZWA 3INOA 3L4WA 3WFHA 1LO0L 4Q9RL 1OSPL 5GRXG 35C8H 5LG1A 1NGQH 4FZ8H 1JNJA 5D1ZB 3ULVC 4RGOL 1NCAL 3QYCA 1DUZA 1I8UA 4JZOA 2VMDA 4QJ5B 3KPSB 4K3EL 5CMAB 2I07B 1IV8A 1R34A 2G9KA 2OS7A 5DFVD 3SE6A 3QIUD 4W4OC 5BRZB 1IEHA 5C0EB 4O51A 1A7OH 5EOQH 1KTRL 4KJQC 3EDKA 3HBZA 1TJIL 1V3LA 1REIA 4U1JA 3OJDB 4WFGE 4PGDA 2Z7UA 3OXSB 1TSRA 3KBPA 4LFHG 4JBSA 1I8IA 1AIFB 2XSKA 4L4VB 4PJBF 5K9OA 3JVFC 1MCLA 2HJFA 1QKZH 2FCBA 2XTJB 3AC0A 3FOLB 3D7PA 4M7ZC 5I19L 2VMEA 3I02B 3MI6A 4I0CC 3HN3A 4UDUA 4FNRA 2WWMC 4KKZA 1LE5A 3GMRB 2ZWYA 4G9FA 4FLQA 1PD0A 3OPZL 3VFWA 4XNMA 1AXTH 4IW4C 4Q6YA 3O4OC 5JUEL 5IP4A 4N0UB 1YYLH 3ZR6A 2J44A 2J56A 3DJTA 1NM4A 1B0WA 3CHQA 3QIUC 4FABL 5JIIA 1URZA 3D9AH 4MD0A 1RI8A 2ED9A 1EJ6A 4WTXA 2VGLM 3ML9A 5J6SA 4HV8B 2FJUB 2E7CA 2V9UA 5CLWA 5G5DA 3LN9A 1QSFE 4LNRA 1E4KA 1F3JB 2BNUA 2COVD 3H9SB 5TFSH 1JGUH 2DTSA 3KLSA 1RJLA 3IMRA 1F5WA 1GGUA 3VSVA 1GGYA 1MNUL 3ARVA 2PUQT 4L8DB 4P46D 1I4FA 4XNQA 4Z1PA 4QYOA 3FQ1A 4HWUA 3SDDB 4FFYL 4ZW3A 1FWXA 3BEWA 3DHPA 1TEFA 4Y1AA 2VH5L 2VITA 2ADGB 1G9MC 2FH8A 1R4XA 3CZEA 3QG6A 5CJBA 5FF6B 2CHXA 1ZHBA 5F9AC 2DLHA 2VDLB 3ES6A 4HQQL 5IHHA 4XVOA 1BMWA 4G7RB 3CUPA 1PGRB 1CDJA 3THMH 4BFIA 5J6HB 1XH3A 2X4TA 2FRGP 3GRBA 2NW3A 3O6LH 4OFPA 4X9YA 1T04B 1UWXK 4FD0A 2A9DA 2CUMA 3AQXA 5L9DL 5BS0D 4O58L 3SGKC 1UCTA 1WCBB 3N42B 1ACYL 2DDQL 4IOIA 4MDJA 3IU3A 4MD5B 4DFHA 4WV1B 1GY2A 2F54B 2YKLL 4JKLA 1GGCH 2EE2A 1BQKA 3NPSC 1A14H 4R9HA 5CGTA 4QRFA 2PW2B 1LLAA 2GY5A 5D1QD 5EN2A 4YGAB 1CPUA 4GRLC 1INQA 3CIAA 3RX9A 2NLJA 1THCA 2P42B 1A1NA 3CDFA 5E7BA 4IOFD 3MBEA 4NNXA 5HGBB 2LTQB 4H8QA 1MCOH 2IPTL 3EFOB 1RPKA 3L3IB 2E56A 3TF7C 3HMWH 2QVFB 3BAJA 3P0YH 4F7PA 4ONFH 5F7LB 2JI3A 1JK9A 5I5MA 2P49B 4FN0A 4J4PC 3VG0H 3BWUC 2MQCA 4UBDC 3F05A 2XBDA 5F9OH 2LVCA 1RERA 5F89B 5D7JD 4UB0L 5CJXA 4JY5H 2N3JA 2QADB 2W94A 2AERT 4H1LG 4PJHB 3U30B 4KNQA 2BC4B 4ACPA 4I4WA 3EDJA 4JDZA 3U9WA 2YQ2A 5C0JB 4P9HH 2JWYA 5GRUL 5E1QA 4GRLA 2G9HA 1UM6H 3HR6A 3ULVF 3POCA 5F96L 3VRLE 1RZFH 4DEPB 5F3HA 3QXDB 2VZOA 3CZUB 4WNQA 4ZW6A 4DGUA 1QR4A 4LLAA 1CR9L 1M53A 5I18L 4GW1A 3BPLB 2EVHA 2ORBH 2WZ6A 2FDBP 1ZEAH 5CJOH 1RURH 2APBA 3U46A 1NLBH 2YMXL 3RWDB 4NM4L 2IDQA 4XPAL 3WNPA 4F58L 3OR6B 3VM7A 4DTGH 1Z9SB 4KKAD 4HVBA 2X3CA 4G8FB 3U4EA 5CGMA 1ZGLM 3UTSA 5JXEA 2CHZA 3S8WA 4ZUVA 3HKZA 1YQVL 3JWNG 5TF0A 3MV7B 3QO0A 1OOAA 2HLFD 2DF3A 4HV8A 2Q3XA 4XNAA 5KOMC 1P7HL 1TZ8A 4HIJA 4LMQI 4R26L 1DUYA 4ZSOB 4FGMA 4TULL 2JJSC 3C2AH 3FT0A 1RZKH 3MRNB 5LJYH 2HP4A 1YY9C 5JW4Q 1NBQA 3T6QC 5JNYB 3FCSB 4GEJA 2WQSA 4LARL 4P2RA 3Q3GB 3K2KA 3K72A 1Q9LA 1DN0A 1R6VA 1HAUA 2Z3FA 3K8LA 2ALAA 2FLMA 3ZJAA 3WN5A 2BS71 4I8DA 1NMCB 4XP1L 2EVIA 5FYJE 1PIGA 2JJVA 3D2TA 3EHBC 4UM8B 3VRIB 3P9WB 2VJ0A 5B8CC 1AIFA 3EH2A 4L4VA 1AS7A 1MRCH 3K80A 4I87A 3FCUB 4JUTA 4YDJA 3SKJH 1QVOA 5DQDL 5ABAA 3TH3T 5HHXH 4PS4L 2NUPB 2VW7A 1Q9OA 4HDIB 1JGEB 1T4KA 3W5NA 4DN4L 3NCJH 2A4EA 4Q52A 4Z3IA 3QUYD 3W11C 5AENA 3QP3A 5F7HA 5DLML 1AZCA 2CIKA 3IBEA 4LK4A 4RGNB 1Z9MA 5E70A 2UZXB 5KS9B 2B77A 1I1AB 2BHYA 4ZXBD 3F12A 3WGVB 3MLXL 1T6BX 3GZQA 1KYUA 3GQFA 4NQDA 5JNYA 1QYGL 1G7PB 2YPLA 1T0PB 2X0WA 1O7SA 4QRUB 4KUCF 3HI6L 2Z92A 5AAPA 4Q74A 2F18A 2WVVA 3VA6A 4MSWA 3TBYA 2ZUQC 4OLEA 5BV7C 4XOCA 3W2DL 1OTSD 3WXWH 4CW1B 3UGXA 4WJ5A 3KEDA 3ILEA 3UO1H 2VB5A 3R8BB 4M7KL 2WSPA 3T71A 1ZEAL 5CJOL 3ECQA 4HYTB 2AQTA 3F3HA 4FNLL 3GHEL 4LSVH 5D1XD 3IPFA 4S11A 2DQCH 2R0KL 1MRDL 3SY0B 1XSOA 2OTWB 3PL6C 1TXKA 1IKFH 1AKJA 3IJSA 3S96B 3QCUL 5DJAB 1IGCL 1NWPA 1T22B 2G30A 5FW8A 2DYPA 3GSVA 4X8JA 4JFOA 4YL4A 4DEWA 4O9HL 3S36H 4YO0A 4WI3A 1YNTF 2QPEB 2GJ6D 4I9XA 4YLQT 4E9TA 1KZYA 3C5ZC 4RMWA 3T0AA 4KZ0A 2JQAA 2XV2A 2WVTA 2XPYA 4UV4L 3GYRA 3EDFA 1L9QA 1LL1A 2VDNB 4J3TA 1F13A 3RDJA 1IM3B 1NFKA 5SX5H 2JV6A 3E6FA 4W9JC 4HWBL 3DX6B 4GW4A 2Q3AA 3UBFA 1I9IH 1J0YA 2VDPL 4FMKA 3AY2A 5FA3B 2NX5A 4DKAA 4QHPA 4G8EA 4B3VA 5C0GB 4P9MH 1KIUB 4ZMWA 2BMKB 4AG4H 2FJGB 2VTFA 5AD0A 1FSKB 2CO7A 3UTZB 4LRIA 1RIHH 2Y4SA 5HGBA 4FFYA 3WFZA 3ZHFA 1N67A 2PCFB 2WXFA 3NDYE 4JRYD 3HR5B 3WO4C 1XR8B 4K7PY 4EMZA 2HZHA 5D5ME 4ZZFA 5EIQA 2WCPA 3ZE1F 3WKYA 3O6FA 1L3WA 4HC1A 3O9WA 3TV3L 3ALPA 1U92B 1AD9B 3GK8L 1OARH 4HUKB 2XJKA 1S7UB 1TKWA 1JPSL 1RKRA 3OGOE 2BOCA 3DK2A 3WMQA 3D2UD 3MNDA 2L8AA 1KPVA 2EXYD 4HT1H 5D7LE 3GDCA 4QOKD 4XPFH 3ZLQC 1VAHA 3LB6C 5GZND 4ZTPH 3IMSA 5DGQA 3ZKSD 1S7VB 2JNZA 1KELL 4O2FB 2I69A 1BXXA 1LMIA 1XH3B 1JTOA 1W6LA 1D2OA 4KKCC 4BH8B 3HNVH 3U0PB 5I6MA 3CVHL 3RNQB 2YXMA 3IU4L 4YUEH 3MU3A 1LWHA 4EN3B 1GGIH 1QRNB 4HKJB 4EPSA 1VACB 2EICA 2W0FB 3UGEA 4XPFL 4MNQB 4NM8L 2NY6C 4QXWA 4AYMC 4OKVB 4MFHA 1XL4A 1KN2L 3QXAA 1R5VA 4XB7A 1DJYA 3TXAA 4FXGC 1HEHC 1T89C 3GXDA 1NBVL 2KH2B 3HZ3A 4HS6A 4G9DB 2P8LB 3LNDA 4QHUB 1BQLL 4H5SB 4NFDA 3P4NB 2AJZA 2IVFC 2AJ3B 3LQZB 2DH2A 2YZ1A 4K5PA 4JUSA 4R5XA 5GJTH 1T66C 1PSKH 2VUYA 2D3VA 1CGWA 5I19H 4ES9A 4D3CL 5EOQL 2CCVA 4TNEA 2V17L 2GSIB 3KGSA 3L1OL 2X89A 4FRWA 4Y4FC 5K33A 2W5PA 1T7XA 1NFDE 2YHGA 4EZLA 4GXFA 2HT2D 2ZOTA 4LHUA 5I1HL 2GJJA 5IUSA 4Q6IA 3RU8H 1JP5A 3MRRB 3RFZC 4GQRA 4HJSA 5IEHA 3QUYB 3FOLA 4X6DE 2X4SB 5C3TA 3MRHA 5E8PB 4Y9EA 4LEOA 1CGSL 1OCWL 3LKNB 3NSDA 4MNQE 2E7DA 4KWUA 1U93B 4F8TA 3IEAA 3BDYH 3L54A 3VX0A 4ZX3A 4L0PB 5FFOA 3QCUH 3MCLH 4MQXC 1YEIH 2J8UF 4D0DB 2YFNA 1PZCA 3T6XA 4AY0A 1T66D 2QGCA 2DBLL 3DOHA 1WH0A 4FQLL 1K3ZA 2YZ8A 1OSPH 4RGMC 4O9HH 3S36L 2WBJD 3MRLA 3OKMA 1OCOB 3CN3A 4UQCA 1U58B 2QSQA 4XT1C 4JFVA 2AZUA 4KNUA 1KOAA 2AEPL 3QH3A 4G80B 4A2MA 3NJJA 1CE1H 2GIYA 4NGHL 5KSBB 1AZBA 1URIA 1E42A 2OSLB 2VMFA 3HG1B 4JZNB 3S3JA 3X2QB 4LSQH 4OI7A 4M03A 2BSDA 1U58A 4XBMA 3DROA 3HIZA 3B2DC 4WEBL 1CXFA 3P0GB 3F2LA 3PQYD 2PLTA 2R0LH 4UTCA 4D0BA 2QDWA 2ZG3A 5HHPB 1FZMB 3HE6A 3TH2T 1PKOA 1ES0B 3HI6H 4X4YB 2JCCB 2AQQA 2HLEB 2VLLB 2VRQA 3GMNB 3MLUH 1EVTC 4B41A 4GSXA 1CIUA 2BOBB 5I6XC 1U8PB 1UD3A 1ZVNA 5J3HD 3MRHB 3QS2A 2H45A 5ILTL 1S7TB 4DW2L 5G2NA 5TH2A 2EVGA 1KFGA 3LQMA 3FTXA 5CGBA 5F72S 3Q8FA 4JHVA 3SKJL 5HHMB 3KNBB 2IFGA 3VFRB 3H0TB 5IROD 5PCYA 1DN2A 4P2QB 1TZGH 1QZ1A 4TSCL 5DD3H 3KJ4B 2FEJA 1WA1X 5I17B 5KTEL 1WBXB 4EOWH 2OULB 4N20A 1S5HB 3U7YL 3RRQA 3MV8D 4PTUB 1UA7A 2YPVA 3QH3B 4DOHB 2WWNA 3GS0A 4LCIH 1HHKB 4BE6A 4N2EA 3RWGA 2V2WB 4PJIA 3BUQA 4G6AC 5IBLC 4QHUA 1LTXA 1NFDA 2X42A 2IIJA 3KCWA 4ETYA 1AR1C 1YNLL 1UCBL 1FFNB 5F0PB 3PGFL 4QTIH 4UQ9A 3WKMH 1VACA 5GS0D 2GTZB 2W9DH 3MOQA 1IEAA 3GC3A 4HMEA 5CHNB 5FKPA 5JIKA 4E9QA 1MG3C 4EOWL 4ZFFB 1D9KC 1L9OA 1HH9A 1PNDA 1VGEH 3IDJA 3IETB 1EUUA 5C07D 5ANHA 1IJNA 3I85A 1C5CL 3L7FA 3MRFA 3ARRA 4NYLA 3X1BA 4FA7B 3KM2A 3UEQA 3D69B 1A65A 1I3RA 1TKWB 4FEIA 5AW1B 3UBXB 5AUMB 3QB7C 2DQHH 2XTJC 1HHHA 3WFCH 4ZMLA 1WIPA 4KXZH 5E9DB 1DVYA 1QSFD 5EZJA 1KLFA 4CUCA 3VXSA 4Y1SA 2BVTA 4K71C 4XGZB 4ANVA 5I8CB 1IZJA 2HFEB 3A0OA 1KBGH 3D07A 1YEFH 1Q38A 3F7PC 3Q2NA 4NM4H 1XR8A 1V3JA 1VPOH 3SJVD 4CKQA 2W81C 2XZQH 3Q9PA 5KZCB 4LKCB 3HC4L 2IH1A 1TZHA 2VR4A 3NMEA 3G5XB 5F9DC 4KBPA 4EE2A 3L3OA 4NNXB 4MCZA 4MRBA 4UB0H 1EA9C 3C6LA 1F4YH 4OZGE 4WI6A 3G04A 1FAKT 3ZK0A 4MWFB 4WI7A 5AVXB 2VXSH 1NGYA 4HETA 3MN8A 2R0WH 1J1XL 4PG2C 3GM0A 5LAXA 5C09D 2QMKA 3NRQA 1N9PA 3SE9H 5DHMC 5JW3L 5E1HB 2JK5A 3QR2A 5DEGB 5DRZB 5JIMA 4OJFL 5JHDE 5JPNA 2XTJD 5EIIA 4KAQL 1Z5LA 4Y2DD 5EUOF 3RIAF 4CU7A 4U1MA 1OQOA 2GVYA 1RUPL 4R3SB 4DJMA 4MAYA 5K9KA 4ONFL 1WBYB 4GQ9H 3WNKA 3C8DA 3D39A 2WBJB 3O3EB 4N2KA 2H0FA 1FNFA 1KXVA 4PR5B 1DQLH 5BW7A 5FW6A 5I1IH 4PY7A 4KXBA 3S4SB 3U79A 5IVZA 3W81A 2KL6A 5D6DC 1L6XA 1J05B 2FWLB 3NIGB 5BRZD 4EIUA 1EFQA 3NTCH 4FZEH 2BDNL 3US1A 1SJVA 3O6LL 1J8HA 4LESA 1IQWH 3PWNB 5DO2D 3ECBA 2YKLH 2XWJA 1XH2A 4KO9A 4ZOBA 3ENEA 4K9EL 4WNSA 3PWPE 5AD0B 3L5IA 1ZT7A 2HRPH 4GI8A 1SOQA 2DQEH 3PXJA 4HLJA 4IDJL 1ZVYA 2MCPH 3VG9B 3X14B 5IUCA 2NY5L 2IG2L 3ZYJA 2X6VA 2V17H 4P5TC 3VFUA 4Z7QB 4XNUL 4WHYG 1O5DT 4U31A 4Y7OC 1HN1A 4HQQH 3DUHA 3IPEA 4MA1B 3V4VH 3ZE0B 2UXGA 4MZRA 1JGUL 1TO5A 3PAYA 4BINA 3TBSA 2VR9A 3DJZA 3OKLB 3CSTA 4XNMB 1KXQE 4J1UB 3NZHH 2VN4A 1I8LC 1MFNA 1ZTXE 2AAAA 5JPNB 4ZFGL 1FL5A 3KS0J 2OTPA 2ZKWA 3AUVA 1U36A 2XACC 4JDEA 4LFHD 4NPKA 3QCVL 1IAOB 3M1OA 1TZOA 2E86A 4P2OD 4Y8AA 1M7DB 1DQJA 1OLZA 4K23L 4Z9KB 2HA1A 4FKEA 1QEWB 2CDFB 4Q0XL 5JHLH 3RTQD 4EZJA 5DJZA 4Y4HA 3BSZH 5HD8D 3ROOA 1DSFH 3FONA 3OMIB 2TRYA 3H3BC 4PH8A 1E9OA 5AB9A 5INDB 1ODUA 2P7TB 3BPCB 4OQTA 4ZI8A 5IESH 2HFEA 1FFRA 3WJJA 2LW3A 3LB6D 3QIBA 4N0CC 2WY3B 2DPKA 1HILB 1ZT1B 3P02A 1ZRUA 1OANA 4X6CA 1UENA 3Q6GL 3BSZA 1KGCE 4NRYA 1ETB1 5GRJL 3WHE0 4BSVB 4CILA 1BYOA 2HJKB 5C2UB 1CICA 1ZT4B 1FFOB 3IAQA 3KPLB 4K7FA 3DARA 2XWZA 2WINB 3O0LA 4K5MA 4PIRF 1MG2C 3KG5A 4Y4HC 2BSRB 4PAZA 1I53A 3CX5J 2N7BA 1EEYA 4C83B 4JY4B 2CLVA 1IQWL 1BOGB 3D39E 4MMXA 5LAPA 5EEUA 3TL5A 3H53A 1C8QA 1P5VA 4Q9CA 1S9KC 4WW2C 3F04A 4PV9B 3EOYG 4HS3B 2NR6A 1XB6A 2KKQA 5DVLA 3ARBA 5KVEE 1NGQL 4MDIB 2MNWA 3F6LA 4GQ9L 3OXRB 3BGAA 3OR6A 4NO5A 1CQYA 1DQQB 1MY5A 3KBHE 2OW7A 1E4JA 1UJ3B 2DIBA 5I1EH 2R2EA 1LNUB 4YXHH 2Q9OA 4KAQH 3QCTH 3OLGA 4JDEB 3W56A 2UY7A 5ID0B 4OZHB 2ZXCA 1IBGH 1JGVH 1FC1A 2DYSB 3UZVA 2B59B 4XTRD 1PBYA 2O61B 1DEEB 2YD4A 1ZIAA 5AQ0A 3PHOA 2E46A 4EN3D 3RUGB 1LP9F 4LF3A 4OCRH 3U48A 1IKFL 3FO0L 1K72A 1MWOA 2LTQC 4QRAA 4V33A 3FQWB 3JZYA 3BP4A 2C26A 4RVBA 2XFXB 1AMXA 2ZXAA 3SD2A 3WV0A 2FT6A 2K3TA 2UUDH 1WE5A 4ZRGA 5B39A 3D2UB 1E5YA 1XX9C 4Q56A 5C09B 2OQJB 5M94B 3I50L 3MREB 1I75A 3IDYC 1H9DA 3BSGA 3UTSB 2DWEA 3KPQA 1WUNT 5AB0A 1JGVL 4L4JA 4PLKC 4E9WA 4F5CA 5I1DA 1BFOB 2KBGA 3BZEB 2WYZA 4PW3A 4CGUB 4JRXE 4M7JL 4U3XA 2X28A 3PWNA 5A3IC 4MAYC 2F74B 1JZ6A 1LP9E 4UQDA 4R97B 4XTRC 1PL3A 1CZ8L 4GP8B 1MFEH 2WVSA 3FF8A 3MKGA 4NQUA 4MA7H 3WY2A 4KJPD 2M2DA 4JZNA 5I9QC 3FS9A 1UA6H 1F58H 4HIHB 1CXEA 1UQSA 5C7ZA 4N8PA 2CLZB 1FPTL 1HHIA 1N8OE 2ZCKL 4ZXBB 1ESOA 1GVIA 2W9DL 3ARTA 2CRZA 3MV8E 1VGKB 3AXIA 4IHBA 5GRWA 1MCWM 3WIHA 1G0XA 2QPFA 4ZO8A 3QEQA 3QUKA 3Q6FB 3NUKA 4Z0XB 5FYLL 1KY6A 4HWEL 4UIMB 2BC4A 1M1XB 1EO8H 1XCQA 5JMOC 1JN6B 4NQEB 3B9AA 3DC0A 3LRGA 4QHLB 2QTEA 3I9IA 4LEBA 1G6RA 2WO2B 3PABB 4XN5A 4BK8A 4I3GA 3OG4B 3VI3F 4DK5A 4LSUL 3C6EA 5GS0L 2RMNA 3BEWB 1K5WA 2O5YH 4MA8L 1C1EH 3ZDZE 4F7EA 2AMGA 1VEPA 3IKCB 3SDCD 3QNXB 4BELD 4WQOA 4BFFA 2PPFA 5IF0A 1WEJH 5TTRA 1QQDA 4M6ML 3MBXH 1OT2A 3N1PC 4PCKA 4JRXD 3VH8A 4PCSA 5DUML 1HU8A 2DQTH 2F53B 3QFJA 4XNYH 4NWUL 5ANMA 3RTQB 1NAKH 2XFXA 1AG6A 2XG5A 4KMTL 1XF2A 5MEPB 2NCMA 4ZMYA 1W16A 5J13C 3IFOB 5T1LA 4POZD 3IU3B 3ZKMD 3OZKA 5DVPA 1HNFA 2UVEA 4X7CC 1JZGA 3CHPA 3EHBB 3SDDC 3HFMH 3AQZA 4NQXB 2PO6C 1BZDA 1YEEL 4D8PB 3Q2VA 2AQ2A 5D70H 4M7LT 2V2XA 3KYKH 4XB3A 2WBWB 3W0WD 2WOBA 4GI6A 1TNMA 2EH7L 3EOTL 4ZMZA 3QQ3A 1R5VB 1MRFL 1JMZA 1X44A 2I25N 5D5MF 5E56A 3SZKC 1U21A 1W80A 2CBOA 2G2PA 4RSYA 1NCBH 1BM7A 4WUUB 2YK1L 5C08D 2W95A 2WSDA 4ZQKA 5FGBA 2VN7A 1I1AC 4B9KC 4PJCF 5MEND 3BH9A 3VD0A 4Y2DC 4E5XG 2YR3A 5CUSL 2WV3A 1RJLB 4ALAL 2HT4D 4EBQH 1UB5A 1CE1L 5HGDA 4BFOA 1DBBL 2AJUL 3G6JB 5IFHL 1SUJA 5F96H 5JORB 4RETB 2DQEL 4PVLA 2FJFA 3NCBB 3QRFM 4NNPL 2K3HA 3DSNA 2OMWA 5F9WB 3ULVH 4M8QA 5EIVA 4F2ME 4QRRB 2NZIA 2DIEA 4XMKH 4JGNA 2OW6A 4Q2ZA 3U9PH 1S7RB 5I9QB 2WUCL 2R8SL 4GT0A 3TJHC 4X50A 3ZE2B 1FFOA 2YPVL 4ZUTB 1SJXA 4G8GD 1IL1B 3P0YL 1IFRA 2N56A 9PCYA 2VQ1A 4M5ZH 4IU3B 4PD4K 2QADC 4E42A 1ZLUH 1JGLL 2G5BB 1MLBA 1U8KB 4BFBD 2GUYA 3SYOA 1SN5A 3DV6A 1RV6X 3HEIB 3ZY7A 1NM9A 1NLDL 4J3OG 4NNPH 1WG3A 3PRZA 2AKRB 5DK0B 1KCRL 4LBAA 3OXRA 4RA3A 3L1OH 4HBQA 4TSBL 5AZ2H 2KDGA 4HEME 4LGSB 4IMKA 5DVKA 1X5LA 1J5DA 1W72B 2VDQH 3JWOC 1YYCA 2A73B 3APNA 4BQ6A 3ECVA 5BRZA 1BIIA 2E74C 3X13B 1M7DA 1UASA 1FG2A 1JV2B 1P5VB 5F7NC 4Y19A 1OHZA 1GSKA 3DX4A 2KPWA 3QWRD 4FCHA 1FORL 3EBGA 4QRRE 2VXUL 3KLKA 4XXWC 5C3LD 1SXNA 2B7DT 2L7UA 2YFOA 4WEMB 2N4IA 2XVGA 4XP4L 4DZBA 3DIVA 3EBIA 1T7VA 3HHMA 3ARGD 2VDMB 4KI5D 4XCYA 5F9JB 2DYPB 3GSVB 4X8JB 5I1GL 2CJTA 3KWXA 4M1DH 2CGRH 2ZXQA 5LBSL 5DFWH 4X6CB 1YMMB 2EDKA 5D1XA 3VB8A 4OJCA 3HCVA 1JK8B 1NANI 4RQQB 1KNOB 5EOTB 3SJVE 5FB8B 4KGLA 3IFPB 1YJDL 2A6KA 4YH6A 1QLRB 5E6IA 5IOPA 4LBEB 4M62L 3JV4B 2VM4A 1G9NC 1UOWA 3LV3B 4TN9A 4HZLA 4W9EC 2KZBA 4M4PA 5DUMH 4G59C 1RUKH 3KW7A 1JXKA 5DXWA 1BW8A 2F0CA 2P44B 1X5KA 2BNRD 4R7DA 3FT1A 4JFFB 3BZ4B 2ARJB 4M43H 3T04D 2LLNA 4BQ9A 2NTFB 1NCWL 2CCWA 4PRIE 4IKJA 1KXQA 4CL7A 3QIWA 2GSIA 2ZJSL 3K8MA 5IVXA 3KWUA 1QRNE 1LJMA 3RPIA 4D7BA 2VDKH 5HHNA 3BUPA 3E9UA 3RY6C 2O5XH 4B60A 2EJ1A 3NEEA 2VIRB 4PRIA 3SPGA 3ILPB 4GS7C 1G9NL 2CKNA 3BAXA 2X0UA 5IQ7H 4HS6B 1TJIH 4D9QD 1RJZA 4HUMB 2FSEB 1HVXA 2NY1D 5DTFA 4TSCH 3R1GL 3GSXA 4DP2X 1W8EA 1MCSA 1UVQB 4OLYH 1JZJA 1DJSA 4XBPB 1DVFD 1HOCB 2PO6A 3L17A 4L3EE 2XOTA 3WS3A 3AS0A 3VI4F 1KTJA 1RSFA 4WHYH 4P57B 4IQHA 3C87A 5DFAA 4YOKA 3V4UH 4FQXB 2O26U 3F01A 3U0PA 2V3FA 3HBQA 4F9PA 2ZUQB 2CBPA 1BBJB 2VQ1B 5BV7B 2UZIL 4UT7L 3PGDA 4WWKC 3TIEB 3JTSA 2VDNH 4JFYB 4KTDH 4P2RB 4W9GC 2I9LB 4P23D 3ETBJ 1TCRA 4NHUB 5GZNA 5E9DA 4PVMA 3B2VL 1X5YA 4QRRA 1YMME 3DX7B 3MV9D 4OIIL 3SKNA 1FV1B 2DQCL 2R0KH 4ZMOA 5CO1A 2SODB 4V2CB 4OCRL 5B1JC 1NC2D 4JFYA 4X80L 3UO1L 5KJ4A 5LKNA 3RBGA 4I77L 2K9FB 2PCFA 5AOIA 2F5AL 3B7TA 1A4KA 3QPXL 4WWNA 3Q8CA 3U4EB 3BH9B 3QC6X 1G7JA 2WQUA 1GJIA 3ARDD 5JOFB 4ZQKB 3AG1B 3S35L 3C5ZB 1KTDB 2X4QB 2YQBA 4NZJA 3MQIA 1XGPA 4XBPA 3ZL4H 2B39A 2OXHB 2TSAA 3X1FA 2G2RA 3TN0A 1FBIH 3CZKA 4XX1E 43C9A 1AGCA 4F15C 2YAOA 1BV8A 3E6FB 3QAZC 3PWVA 3S35X 1WFTA 3Q44A 2GQHA 6FABL 3MC0A 4KRMB 5IB4B 4IRJD 4D8PA 4OLZL 2Z8VC 3VFSA 3FFDA 3U6RB 3UIZA 4YDLC 3W9EB 4YSDA 4LEXL 5FDWB 5FHBH 5FYLD 2HG5A 1AH1A 3ORJA 4I4WB 3KH3A 5DRNA 1WD9A 4TQEL 2HG0A 2WJ5A 4OCWH 3G5VB 4U05A 2F53A 2EDYA 5MHSD 3VD7A 5A3ID 2VDKL 5FV2A 1NMAH 2XX0A 1JTTA 3WS6C 5IREA 2VL5B 4YGVA 1R47A 4FP8H 1R33A 3JTTB 5CHNA 5IQ7L 5DUBA 4NN7C 3ARZA 1F1AA 3OJ2C 2B15A 1R24B 3KLAB 3UAJA 4OLXH 4Y1AE 1EBAA 1Y7VA 5AAMC 2X1PA 2SEBA 4GKNB 3VQMA 2Y7MA 1BQLH 2VDRL 4KY1L 3HS0B 5ACZB 1IAMA 1MJ7L 3AUWB 4G83A 3NJXA 4MSWB 2WHVA 4HJTA 2P80A 1CFQB 3G7TA 3TVMB 5JR1L 5JHLL 5CN2A 3WJLC 3F85A 2QQKH 1IC5L 3HG5A 4S1DC 4UOW0 3DLQR 4DKEL 3QUZC 1AXSA 1VFAB 1OCZB 2JCCF 3WKNA 2MOGA 3EJPA 4HW6A 4YL9A 2B1HL 1T1WB 4PPTA 1F6FB 3Q05A 4XPAH 4M1DL 4X4KA 3GSNL 3QDGD 3RY6A 1F4XH 1OD9A 4N1HB 3O81A 3PP4L 3DKHA 4Z7WE 4YSTA 4DKTA 5IW6A 3LHAA 1SEBB 2A73A 3B56A 2A3TA 4TSAH 4BZ2H 4F92B 4MX7B 1KIQB 2W80C 3EO9L 4GT7A 4MB3A 4JJ5B 4FDWA 4HAKA 2BOBA 2CGRL 5I28A 4Y5VB 3LOWA 5LBGA 1I9JH 1W0VA 4FL4C 4NERA 4ZX5A 3SDDD 3QGVA 2OL3H 1I8KB 4FYSA 3NP3A 1PZSA 3NN8B 1NGXA 5C7XL 2BVUA 1Q9LB 5FW7A 4LF3B 5C0BD 3T9WA 5KVFE 3RX8A 3GBLA 4TNGA 2E8YA 2OR8A 4G43A 2DD8L 3GO1H 2CK2A 1E4XL 1TQTA 3V0IA 3QDMA 5BNXD 5LUMA 2NDFA 5GS2H 3REWB 4JPKL 3O6FD 1TQBB 2D3JA 3F7YA 3LN4A 1CGUA 5E2JA 1OT1A 4F8PA 1HTYA 3S5ZA 2YSTA 3WFDL 4FQXD 2OJZL 5D1XE 5HDQH 3BZFA 1MCRA 2UUDK 3ZDXF 4Z78A 4OB5L 2WXKA 1QASA 1ZS8B 5C0EA 4ELMA 3WL9A 4B97A 4N0FB 3V5HB 1U93A 4NRXA 4WW2B 3FT2A 3DOSA 1B2WL 4XO4A 2E7MA 5HBBA 4I88A 2WXMA 4HD9A 4OUUA 3RY4A 2C9AA 5GS2D 3AZUA 3KLQA 2NNCA 2XA8L 5HHME 5ESQA 4HOMA 4XP6H 2FHBA 4K5LA 4YR6B 1P84J 2QADD 3K4AA 4MZ3A 1SDDA 2ODHA 2W0PA 1HZLA 1FGNH 4RMSA 3QHZH 2ODIA 2E27L 2YQGA 5EF1A 3HC2A 2NYYD 3MBWB 2R27A 4J3OC 1ORSB 5JA9A 1CFVL 1QO3B 3QPKA 5E99L 1E43A 1MAJA 4J12A 3GMQA 1DO6A 3NEXA 2ESVB 4GRWB 2GK0B 1KT2B 1EFXB 4QWWC 3VRJB 2VDLH 4WDIB 2YPLD 5ALBH 1T5WA 1OAUL 5C08E 4PJ8B 2E9IA 3FSZA 1KBVA 3WOVA 4JPIA 5TDOA 1C12B 1EHLH 3EYOA 1MVUB 2CLRB 1CE6B 5HY9B 3QNXA 3RJOA 4KY1H 1YYLL 2BMKA 4PJ7E 5IQLA 1JMXA 5GRYA 1E8XA 2EEXA 2LV4A 4KO5A 1D6EB 1UB6B 1QSED 3AREA 2DL2A 5DHYB 1FA4A 2JKRM 1LMKA 3WDHA 4PRHD 3O2DA 3JBG7 1UKQA 4PJGE 1PEWA 1YPZE 1UD6A 4RAUA 4PGEA 1FL5B 4L8CA 1IM3A 2WZAA 3PWPD 2DLFH 2HG5B 4GAYA 1E27B 3VGAB 5IT2H 1WZLA 1UURA 2GFBA 1P5UA 3OX8A 4TRPL 4X2UA 1J8HE 5IB4A 1D3CA 5DD5L 5L2KB 5DC4B 5HYSB 4WO4C 3CFUA 4B9PA 1AGDB 5IHWA 2HLAA 4PJFB 43C9B 1TFPA 5KBPA 5KTEH 3T0VA 3AY4A 4MKTA 4ZPTA 4CSTA 4F20A 1T22A 1ZD6A 3FK3A 1IMHC 2VITB 1RZJH 4LLMB 2A9NL 4QYOB 3RVTC 3HZKA 3SDDA 2IMNA 3V2AR 4APQD 2EXSA 4BUGA 4J27A 1YPZF 1DP0A 1NL0L 4WKZA 3LKOB 4KVCH 5CIPA 4K07A 3SB3A 5SX4I 5LO7A 1KCSH 3MUHL 4WY7L 4HJ0C 3KZ8A 2WQWA 1QBBA 1AGBA 3U7WL 1ZK5A 4NKIH 5D7IF 4KRPB 1TCMA 1XMWA 4PRDA 3DGDA 5JHDD 3VSTA 2ZYRA 3NJVA 2PCPB 3CFEA 5L2KA 2NXYD 1QBMH 1TCRB 3AU1A 5EEVA 1P5UB 3OX8B 3VI4B 1WFNA 4L3CA 5GHWH 4YIQB 1BQHA 3ULAB 4BGDA 1FVDA 3VCLA 3MXWL 4PBVC 3PV6B 4OIIH 4WWPA 1CLZL 3KVDD 1HS6A 3VFGH 4WEUD 5KUKA 1L7IL 1IM9D 4MJID 2J1WA 3KLHD 4PJEE 4L3EA 1ZAGA 1Q72H 2GC7C 3CLFH 3EYFB 3IXAA 2WO3B 3GSXB 4FYRA 3SY0A 1C5BH 5ENWB 4U1JB 1H5BC 4YZFE 3C09B 4BYHA 1U91A 4H0IA 3L6FB 4A63A 5I1EL 2EIEA 3DA0A 3CSGA 2BP3A 3C75A 3D25A 4JHZA 1PLCA 4PV9A 4WI8A 3IYLW 3VXPB 5IV2B 1ND0A 3UC2A 1QBLH 1T3FA 3QNFA 3B34A 2WXOA 4NZTL 2CRIA 1Z5HA 5I6OA 5EZJB 4Y4KC 1JXJA 1TPXB 1RHHB 4JQIA 1KPUB 1G5AA 4FQHA 1LDSA 2YPLB 4KTGA 2P9RA 4PLJD 4ELKB 1GSMA 4AH2B 4UTAL 1QSZA 1F97A 4LEEA 3QNZA 5J1AB 1O7DE 1IKNC 2IPKB 4X6FA 4NLAA 1KJ2H 1EO5A 3QORD 5AAWC 4XBGB 2JI2A 2XXCB 2ICWA 5D7HA 1HH9B 2H2SC 1XZWA 5E1AB 5EUKA 1AOZA 2DQMA 3KLLA 4HUNB 4JN2A 2Z7YA 4AQAA 4APXA 2A0LD 1MOEA 4XVTL 4OCYL 3EO0A 4ZFOB 3TX4A 5SX5K 4FFVD 2P7TA 1TT6A 3BPCA 5L9DH 4N0FA 2HB0A 1E9OB 1JOIA 2B5IC 2DIAA 3JV4A 3SGEH 3VI3E 1WF5A 5MEQB 2R4RH 5DVMA 2PP8A 1HEZB 3VWKB 4BH7A 3AVEA 1FE8H 5TF1L 4QKXB 1QVOB 1H3PH 3B2XA 1J87A 2IFFL 3UH8A 1TUPA 3ZO0A 3IMVA 4GAAA 3MLTB 5EBLA 3NH7H 4PJCA 1QATA 3F84A 2BLFA 2QLYA 3AQDA 4GW1B 4EN2A 3PP3K 3QEHB 1ZSDA 2X9WA 3CVHH 5F7FA 3ARPA 3UZQA 2YUXA 4WNQB 2YPLE 1DDHA 3DDGA 2QR0A 4PGBA 1RCYA 2IWEA 2YXWA 4Y9CA 4IKIA 4URKA 5LBSH 1MPAL 1QOKA 2CUAA 2V2TB 4RESB 5IB2B 5JQ6H 4XXCC 5AYUH 4ZMXA 1BJ8A 2JB6A 4U6XA 1BIIB 1PZBA 3NN8A 4RH4A 4GMSL 3D9AL 3SDXF 2XYCA 4ZFGH 2FGZA 3TV3H 2FQEA 1AQKH 3KWWA 5ACLA 5TPWL 4Y1TA 2AGJH 1J9CT 5DK0A 1MWAL 4X4YA 1DANU 1HXKA 3POHA 2D9CA 3MV11 4JPWL 4X4ME 3EFOA 3I3DA 4LDEB 4WO0A 1VESA 4U7SA 2P28B 3VFPA 2IWKA 2Z8SA 5IW6B 5AVRB 3K91A 1NC4D 3BAKA 4MHHG 4YNYA 5L2KD 1XGZA 4LU5L 1U4EA 1CFTB 4Z3GA 1LQSR 1QI5A 2F19H 3PFQA 4PY7B 2EDDA 3NCYS 3S4SA 2X9XA 4ZMAT 1XF3B 5IHUH 3FN0H 4X6DF 3FTWA 4KPHH 1N64H 2XZZA 1OW0C 2WNWA 3AS1A 4B5ZA 5D4IA 1CDBA 4NKDA 3S5LA 1RZ8B 1GA2A 5MEOB 5CN3A 3O3UN 4EAEA 4LCUB 3QPQC 2PPEA 1AQMA 3SDYH 1X5AA 4L3ED 5DT1H 1OCCB 3QJRB 3E2HB 5E94A 1TEYA 2C3VB 4M6OL 4OFYA 5AKSA 4CMHB 3MOBH 1HL4A 1OM3L 1BQRA 2BSTA 4Q9RH 3P77A 4FQPA 5AL8A 5ACZA 5B38A 4UDTA 5F1IB 1D6EA 1UB6A 3AREB 4B9FA 3LAFA 1Q90A 1WT5A 2JKXA 1C16B 4F8OA 3N41F 2WP3T 3T3PB 4UIKH 4RBPK 3T1FB 2CUHA 3Q8BA 3K6OA 2VLKB 1BAGA 1BZ7B 3W37A 1J5CA 2ATKA 5DWPA 1NUDA 3O41B 5DMGD 2XV0A 3CDGA 2WLLA 3U1QA 4OKDA 4YDIL 1RVFH 1DTUA 3MRMB 5TQ2H 3UXFA 2K78A 5BOZG 1KTBA 5EEWA 4JL1A 1EEZA 1Z0NA 4ZSOE 3S3SA 5GGRY 4PB0H 2XXMB 3W2DH 2PETA 3WXWL 1MEXL 2GB2A 3VXSB 2XWCA 1N10A 4WFFE 4FQXC 4LRIC 4OLWL 2FH6A 4X5QA 2Y1YA 1I3RB 3UBXA 1FNGB 2QZ5A 2YEQA 1DBJH 3LKPB 2QFRA 1BPLB 3MRDB 1OT4A 5TE7L 4M8UA 4JRFA 4R97C 4KMLB 2CD0A 3RHWF 1WBZB 1YMMD 4G8AC 4K8RD 3V7AE 4HU2A 3CHOA 4H5SA 2AQ3A 2XNAA 4G9DA 1JCKA 4QOKE 1LE5B 2XKNB 3HHSB 2Q0ZX 3EO9H 4WJG3 4QHNA 4O02A 3T4AB 3CQQA 2OXHA 2FBOJ 2GITA 3VMNA 4D8OA 3O11B 3AQYA 3N1MC 2VSKB 1DBAL 3LZLA 3NYKA 1VADB 3P1VA 3NJFA 4ZFQA 1WLHA 4I13B 4NO2B 4IJTA 5SWZE 5DK2B 3W39A 1SXAA 3NCJL 2AMUA 1ADQH 3M45A 1WEJL 3NFPA 1ZHNB 5DD6B 1M1XA 1SYSA 5E00B 3FSVA 2Q2EB 1QZNA 5FCUL 4JFEA 2D7OA 5FECB 1SF3A 3Q6FA 1FAIH 4JJOA 5I1KL 3H9SA 5GXBB 2O6DA 4G6MH 1T80A 3L45A 4XWGL 3D5OF 1OWRM 5TE6L 1VERA 1IZKA 1RZ8A 2WYIA 3F7YB 4UU9A 5MEOA 3WENA 2R56L 4NAQA 3K6NA 1EHKB 2WOYA 1T5XA 1T4WA 3QWOA 5IWLC 1IC4L 5EO1B 2YD3A 4UZUA 4H2CA 5AVSB 4GLRH 5FYLH 4NHUA 3TP4A 3X3FH 1MFDL 1B0GB 3O8XA 4PGCA 1L5GB 5ALCL 5I71B 3FQNB 5LCVH 2Y3NA 3PHSA 4YX2H 2E3VA 4HK0A 1GC1H 5EU3B 4PVBA 4OCYH 2FBJH 4TUKL 4Q89A 5DD1H 3WFEH 1S9XA 2IOIA 4ORZC 4NOFA 1BCIA 4Z3FA 1YNLH 5TH2B 1NCUA 4DGVL 4MB1A 5A43C 4FQXA 4AYGA 4R26H 1MZYA 3EYVB 1PYWB 3PDDA 3UERA 2AQSA 1NMAL 4JDVA 1CFMA 4N8CH 4A1RA 3C8KA 1BJ1H 5HHOD 3B2UD 4OCWL 2CA4A 3ARFC 5DMKA 3FMGH 4UNIA 3RYMA 4XXWA 2NXYC 4UQ3B 2VLKE 5IM7A 5DD3L 1O6SA 4U6HB 4X0KB 5IGXH 4KTYA 4A2LA 4N0YH 4ZNEA 1NDGA 4AWJC 5I6KA 3LEYL 4ALAC 1XF5B 3GSRB 1ZLUK 2VQUA 2BO0A 4CMMB 3K71B 4DERA 5JZ7C 3QUXB 3BPOC 1LWJA 1J5IA 4ZOCA 4G80A 4FJZA 3VVVA 3L5XH 1VZGA 2AJSH 5E6ID 4FMVA 1P4UA 3SPIA 4F27A 5TPWH 2CDEA 5GRUH 4G7QB 4NP4H 3ESVF 5BS0B 4YSPA 1IGYB 3P40A 1FFPB 5K5YA 5FIEA 3RFZA 3IMUA 4BH7B 2P8PB 4B0MM 2XWTA 2R0LL 4UCFA 4XB8A 5KAQF 3M88A 3QIWC 4PFEA 2Y6SD 4HZLB 2EEFA 2ZX5A 3CFCH 3CZFB 4M1CD 1CDCA 1M9WA 2F58H 2YQ3A 2VM3A 3EG9A 3GDBA 4CW1A 3QFDA 2ZNWA 4JN2B 4L3FA 4LCWE 1AJ7L 1R3JA 1FFPA 3ARED 3V0HA 4AKOA 3DVGB 1MREL 3DJSA 3RZWA 4LHUB 5D4QA 3OL2A 4JMXA 1FYTA 1FDLL 2VLKD 5HYQB 3V79C 3QORC 4XCYB 4JRXA 3DXAE 5E6IC 1CGSH 4FQHB 3R8QA 4KX9A 1G87A 3G3LA 1I1AA 2G0KA 2WQAA 4M6OH 4QKTA 3QIBB 1CTMA 4N2OA 2GEQA 3V0FA 5IQOA 1YEIL 5IEKB 1UWFA 2QKIB 3R18A 2O6FA 5FDYA 3IWUA 5KVGL 4HF5H 4Z3HA 5GGSY 1YEHL 4R83A 3EFDH 1OGSA 3MVSA 3IJEA 4LQ1A 1RUQL 1P6AB 5BV7H 1GW0A 4JFHE 4D3CH 2H3XC 1XCTA 4S1QL 2WW8A 4M56A 1U8QB 1JGEA 1T4KB 5GQBA 4RNRA 4DVRH 1PKQB 2VERN 3PJSB 3QG7H 3VXME 4PP1D 2AK4E 4IRSB 4RFNC 2ZUUA 5ERWA 1QSEE 4KUZL 1WGOA 4ABVA 4K2UH 5CKGA 2C9XA 3DNKA 3VCLB 3LS4L 1NEZA 2H2SD 4PLOB 3JWDC 3Q3GA 2CBTA 2BINA 4NQCA 3RURA 2FO4A 2VDKB 1M2OA 2H5UA 4YUEL 3WUWA 3QZWG 2WAQA 2W8CA 2EDXA 1NBVH 4RSVA 3S8FB 2FX7H 5GRZA 5F0LB 2DJSA 4OF7A 5AYUL 5KVDL 1JD7A 4PJEF 1R3HB 3B1UA 5D7JA 2EUXA 2HT3C 1LO2L 3GUTB 4OVVA 4UWQB 4PREB 4ODVH 5B1AB 3HNVL 1J48A 1ERNA 1SDAB 4MJ2A 5DJ8A 5D93B 3UYPA 4GJTB 5I5RA 3DI3B 3QJOA 2NOYA 2FYYB 2MMXA 3CK0L 4LASL 5D4JA 2FLRT 4TNVK 1Z9LA 1B90A 1WHPA 2P5ED 4G8EB 5DJ6A 5C0GA 4HT1L 4I2XB 3UMTA 2XT1B 1QBML 3P30L 3OBAA 1G7QB 1HZHH 2QTVA 3QQ3B 4GAFB 4KKQA 1KPRA 1RZKC 1HHJB 1KB5A 5CEYA 1FE8L 3BXNA 4KXAA 1RIHL 1CGVA 5DEJA 4E68A 1NSNH 2AABL 2JIXA 3WIIL 1VJSA 3KGUA 2VIRA 1NEUA 2JCWA 5CJ8A 3LD8C 4E9VA 4TNFA 1T21A 5BO1H 4CSSA 3G08B 2Y06H 1UXSA 2YC1B 3NESA 2W0LA 5EZIH 5T5FH 4HWBH 3QWRA 2VN3A 4AIZA 5F88B 5AZ2L 1MHHB 2OJZH 1EEZB 5CCKH 1A9BB 4OF8A 4J8RB 3ZSTA 5KUMA 3S96A 2K70A 5DRWA 1U3NA 2ADFH 4PW4A 3LZNA 4WTZA 3QR0A 4PRNB 1CGXA 2B4CH 4PJ9A 1BD2D 2LFEA 2CLRA 3EJYC 4XWOD 1G7IB 4G82A 4GG6B 1ILUA 4AL8H 4MNGA 4ODTL 43CAA 2LGNA 1QLFB 2AK1L 2DLGA 2H8PB 4RZCB 4CGTA 4NAMA 4NZRH 2ICWJ 1N7MH 3VSUA 3MRGA 4XGZA 4FQ2L 4FFWC 4MQXD 3HCVB 3WTTA 2VDML 4JR9H 3QIBD 2V8LA 1JF1A 1HHHB 3CSYA 3NGBC 1ORSA 2BP8B 2GY7B 3ZKND 3PV7A 4LPUA 4NO0B 4FNLH 3UJIL 1HSBB 2XDHA 1IC0A 1NAMA 3KJ6L 4LCVA 4C56E 3KGTA 3WAJA 2GIMA 2DLIA 3K5RA 4GXUM 5EU6E 4F1SA 2BS8A 5HGAA 4PJ7F 4ETQB 5E6RB 2ZF8A 2WBKA 1S7SB 4NKDB 2CPCA 2FEDC 4H26B 2P5WA 3TH4T 3ULSA 2TSBA 1N5YL 8FABA 4L8SC 1F3DJ 3UJJH 4HIHA 3BUYA 5FYKL 4CC1A 4MXQD 1CDIA 1V3MA 1RK1B 4WW2A 4UM9D 1F4XL 5C0RH 2CIKB 3WL9B 1RUAH 1LO4L 3KPNB 1I4FB 1MFBL 4L4TB 4MGXA 4HCRA 4NXSA 5I1DB 4RAVB 2QQLH 1FG9C 4ZO9A 3TPUB 3D0LB 1TJGH 4U1SB 3RL2A 5C6PB 4OF5A 3HG2A 5HJBA 4PGJA 4ZW7A 3QFJE 1RJCA 4RX4D 5ANME 3F65A 5IKCB 3BKCL 2EDMA 3B7YA 3LKSB 3ZT7A 2W92A 4XP6L 4A7VA 1S5HA 3RI5K 1UCBH 1ZDQA 1TTUA 3CE1A 3G6JE 5LWYL 3T6WA 5DQDH 2BSSB 3OMAB 4NWTH 4PJ5A 2V7NA 1IL1A 5T3ZD 5ITBH 2CBQA 5E0QA 4WLCA 4PRHA 4P99A 1FZKA 1VA9A 1KIPA 1G7MB 1MF2H 2X7LA 4LRNL 1LHZA 1B4LA 4M6MH 3T0EB 3LZRA 1RZPA 4KI5E 2OMWB 5I15L 1KMGA 1LXMA 4Y4KB 5T3ZE 1MRCL 1CMOA 3TYFB 5EBLB 4WFHD 4WGWB 3UTTD 1SLUA 5CEXA 5K59E 2OSYA 3MV9A 4FF9A 4G8IA 2G5UA 1WWCA 4Y5XB 2PR9A 3K1DA 1M7IB 1SXBA 1MQKH 3VE0A 3TPUA 4LIQE 4FG6C 2XVLA 4G8FA 4PHZA 2WC7A 1SQ2N 3WMPA 5FYJD 5ILTH 3EW3B 1CDYA 3A6CL 4R4BB 3MJGX 5E5UB 5TE4H 5GISH 4X9FA 3NOIA 1EBPA 1MWAB 2NY7L 4NUGH 4HK3J 1MCBA 1XD0A 2GABA 1DSYA 2NX5E 3C2AL 2F54D 5EU6D 5HJ3A 3ARBC 3U6XA 4G71B 2EDFA 4H26A 1W0WB 4XXDB 2E47A 4A2HA 5DMYA 1OAUH 2NR6C 4ETQA 3ARUA 1Q0YL 3QRGH 1YQVH 3DJRA 2VSDA 4ELKA 4F2EA 5JPMA 2J8UB 1UH3A 4P3DA 3DVFA 2XRAH 4FTVB 3KBFA 3S35H 4JO2L 4JRYA 4N1EA 1EXGA 2J72A 1I7TA 3KVQA 4KRLB 5J1SC 4L8BA 2Y6SC 2WN2A 4NHCL 3KHQA 3BKJL 3LEVH 4CVZA 4IMLA 5I0VA 1HNYA 3O4OB 4O4YH 3OAWA 3HMXL 4JANA 4PGZA 1CGYA 3ZXAC 2XA8H 3VVWA 2Z7WA 4NO0D 5KANG 1Z3GH 3MFGB 5ENWA 4FQ2H 3IPBA 4PWFA 4DKEH 4IIZA 3D0VA 3II1A 3FTSA 2CNYA 3BVNB 3N5AA 1WK0A 4NLHA 3EZ8A 4PBDA 4Z7UB 3T2QA 4HFUL 1I7RA 4N5ED 4TL5A 3IXTA 1DE4B 3LSOB 1IU1A 4PRAB 3CZLA 4HLEA 1C7TA 4FQQB 1ZXQA 3L7EA 1JPGB 3EYQC 4JG1H 2DKUA 2XLLA 4JY5L 4KV5E 1WTLA 3ZKQD 3MLZH 3VI4E 3G08A 5CCJA 3EDEA 5EULV 2XJLA 4JFPA 3GBMH 5D2LE 1IRAY 3MUGB 2LU3A 3QIWD 4ZXBA 4OLXL 4X6BB 1KXHA 3CAFA 4LLDA 1XBDA 5F93C 1YQ2A 3D33A 5A6MA 1E9QA 1OKEA 1TVBB 2OZNA 4M1CC 1SY6H 1WZAA 1AI1H 3AXLA 3BLBA 3QVAA 2C9PA 3N1FC 1AACA 2HVKB 3V9FA 1E28A 5HVWA 4P2OB 4TTGA 4ZUSA 2ADGA 4RIRA 4GBXC 3D3VA 4W9HC 4U1GB 1MUJB 3PYCA 5I82A 4C8XA 3QDGA 1OAXL 2R1XA 2OMVA 1YEKL 3BEVA 4AEIH 1NCCL 3DO7B 3QIUA 2F61A 2D3LA 2Q3ZA 3GXFA 4Z5RA 3NT0A 4O2FA 1A7RH 1JUFA 3TO2A 5C86A 3MYJA 2AQRA 2LABA 1QNZH 4J3WA 4F8NA 1BP3B 3CHSA 3OQ3B 2KMWA 1XF4B 1CL7I 1JXFA 3SHSA 4M8VA 3DV4B 4EUPA 3CK0H 1FV1A 2X87A 4DQAA 2ADJA 3ULUE 5BUGA 2HLAB 3VUAA 2VNCA 3DVIA 4ZMQA 4XCNA 3AGWA 1A4JB 3BH4A 5HYSA 4LIQH 4O2EB 4YN3A 1WWWX 3G6AB 2VMCA 5I5IA 3MLPA 4QRBA 5H37A 4M3JA 4KDWA 5GRVL 4X9HA 3QUGA 2R2BB 2B59A 3A3YB 4CKVX