3HG0A

Crystal structure of a darpin in complex with orf49 from lactococcal phage tp901-1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
137
structure length
137
Chain Sequence
b'GNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPIDHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Baseplate protein
publication title Crystal structure and function of a DARPin neutralizing inhibitor of lactococcal phage TP901-1: comparison of DARPin and camelid VHH binding mode.
pubmed doi rcsb
source organism Lactococcus phage tp901-1
molecule tags Protein binding
total genus 23
structure length 137
sequence length 137
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08931 Caudo_bapla_RBP Receptor-binding protein of phage tail base-plate Siphoviridae, head
A PF18338 BppL_N Lower baseplate protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hg0A01
2F0CA 2BSEA 4IOSA 1ZRUA 3D8MA 2BSDA 2WZPA 4HEPA 3U6XA 4HEMA 3HG0A 3DA0A 2X53A 3EJCA
chains in the Genus database with same CATH superfamily
4QTHA 2JIXD 3EBHA 4CN4A 1CDYA 1DTUA 3RKDD 4RFNC 3DMMC 4ZBJA 1PZ5B 3C6LD 4OLWL 3B2DC 5I1CL 4UT9H 1NGWA 1VADA 4MA1C 3BIAX 5AOZA 2P5ED 1S4IA 3KPRB 4U1LB 3VG9C 3M1CA 4QYOB 2QQLL 4M4PA 2OZ4A 1ZAGA 3M46A 3OM3B 5JHDB 2ZXQA 1FO0H 2AI0L 5ENWB 3F84A 1BD2D 4PJFF 5E7FA 3S5LB 1BIHA 3L3JB 3N1GC 4QXTB 5AUMA 3UXFA 2Z0BA 4Z3FA 3H9SB 3S4SG 4DPAX 1KTLA 1Q72L 2YC1A 2DV6A 4GLRH 3V55A 4KKLC 3LQZB 1XR8B 5F0JB 1RMFH 3U7YH 1KPRB 3CDGA 4N0CC 1ODAA 3VXQB 4UQIM 4LCCB 1H3GA 4PPTA 5JO5A 4ODHL 4QXWA 1FZKA 3CZSA 4AM0B 2QPFA 2G0LA 5E9DE 1KYAA 4LCWD 4JFEB 3UCQA 3H9ZA 3CV5A 5EO9B 5CJOH 4EDXB 1R3IL 4OFYA 5GS0D 4FQQA 2IFFL 4ES8A 4NQTA 2B59A 2BS71 3DV6B 1CE1H 3ZN6A 1KIRB 1X9QA 3QFGA 1XAUA 2DIJA 2WXOA 3NRFA 4H8VA 3O3EB 1FUNA 4W9JC 2LAGB 3MXWH 2BZCA 2R7EB 4P23A 3ZO9A 2X10A 4F2EA 1DVXA 5E4IA 2V2XB 4AKOA 3W37A 4WUKL 1BWWA 3KM2A 1SM3L 2FBJH 2EO7A 4KKNA 4HK3J 4LXFA 3B9VA 1IT9H 4GW5A 1BM3L 4Z78A 5ITFA 4Z3IA 4YHPA 4WWKD 4QRTA 3ME0A 1QFHA 3MNVA 2VMFA 2YIHA 4GJTB 5AYUL 4ZYKA 2VUOA 2YUZA 2AAVA 1PSKH 3AZUA 3K91A 4YHNB 2N0KA 5TTRA 4GSRA 4E41A 3WNOA 3VXTB 3LDBC 4J2XA 4JRXB 4XI5C 1YEGH 5F9OL 3UTPE 3PU7A 1QFOA 3BEWB 4IKIA 4NNYB 1YEIL 2NXYD 3TBVB 3L9RA 4PREB 4RMQA 1RZIB 2ADIA 4HUUB 4Q0XH 4HUVA 1CIDA 4Y19A 4W4OC 1XSOA 1E8WA 3HNTH 3IGFA 4AQEB 2CUHA 1OGAE 1THCA 4ABUA 3MUJA 2C4FT 2E7DA 2G9HB 2Z35B 4FI6A 2KQNA 2HN7A 5F97E 1C5DB 3UJTH 2ARJQ 5J3HC 3WHE0 4OFDA 2J1ZA 3QXAB 4MRBA 3BD5A 4XB8A 2ID5A 2VLKB 3V4VL 1UZ6F 1VEPA 3P3SA 1TYRA 3NDZE 4ZS7H 3NQIA 4L4VA 3HMXH 4QNPE 4A2DA 5KBKA 2XN1A 1ZEAH 3LNIA 1E7UA 3CLFL 1IEBA 1MIEL 2ITDB 4WUUB 5KZCD 3N41F 1I85A 3QARA 4OV6F 3UTTE 1MXDA 4DCQA 5K39B 5C0AD 3QUHA 5ICXA 1ECZA 2H8PB 2WZPD 5EOTA 1G9MH 5JHLL 1UASA 1XGQB 4EF3A 1J9RA 1RUMH 1SLVA 2Q7AA 3EJUA 3SYQA 3WUWA 3EUDA 2ZOWA 3VE0B 4UDTA 4HJ0D 1G9NH 3NEEA 4JPSA 4N8VB 5ID1B 2NRDA 4NIYE 3ZQWA 4AI7A 4E9TA 3BMVA 4H40A 5TFSH 4KTEL 5KUKA 2EKSB 4Q9BA 1HT6A 5DJ8A 4XCNB 3QDJA 4GI8A 4IOIB 1KTDA 4Y4HA 2NY5L 1C12A 2NQCA 1FPTL 3ARPA 1A7QH 5E8PB 1OTTC 1JRHH 3BYTA 3IDNA 3KWXA 1X4ZA 1VIWA 4RISH 3EO9H 1RSFA 2WCPA 3V10A 1KJ3H 5F7NC 1ZSHA 3EH2A 3LD8B 5DD6A 2JCCA 1LLAA 5GRWA 5GRUH 1M71A 3JTSA 4P49A 4YFLI 2OKMA 1MHPH 5EEXA 1X4YA 4IRJC 4Z7NB 3UTSB 1S46A 4FGMA 4L4TB 1E2ZA 1TVBA 2H0EA 4X5RA 5I66B 1FL3B 3TGXA 1GA2A 2EE9A 2NOYA 1DSFL 3BVNB 4U1IA 1QQDB 5AB0A 3IMVA 1N5AA 3BIKB 1Q9OA 2W0LA 3BVTA 4PG2A 4R5VA 5D1QE 2O26U 1QZNA 4FTVA 4G9FB 3KXFE 3VW3H 1JTOA 4IBQA 4TUJA 5T1DH 5MEOB 4X9HA 3DYOA 2KL6A 3BPNC 4M1GH 4PY8J 4U1KA 5G4NA 1WWAX 2VWEC 3BH8A 3C5ZB 3FB5B 3UBHA 3VM7A 1MREH 3M1BB 3WGUB 3ETBJ 4OUUB 5MEQA 2C7UB 4Z7VB 3MKGA 3PJNA 3VRIB 4N5ED 4C4KO 4KJYB 2CGRL 3UIYA 1KBKA 3L3KB 1NFDB 4P9ML 4BHUA 4N2AA 1PKOA 5I1JL 1O7SA 1USZA 3GSRB 4RMUA 3TEYA 5AYQA 1UM4L 4BSVB 2JH2A 4OD3L 1R17A 3DECA 4TNFA 5J11B 2EDWA 3LQAC 1FNFA 1IZJA 4B5EA 2X9WA 2DQDL 4NPKA 3OMAB 5LNEA 2LLGA 1UGKA 3IDMA 4KK8C 4DKFH 4UYQA 3WSQH 1G84A 2FT7A 3RE0A 1R33A 4O02A 2FH6A 4Z9KB 5JIIA 1G0XA 3MLWL 4DGVL 4W9FC 1JK9B 2VJ8A 5MHSE 5A7BA 5GGTL 2ATPB 4TTDC 3IKKA 5HDBE 1MQ8A 1J8HE 3GSUA 3RY6A 3QJHA 3VFVA 3JWOL 4DP1X 4PRHE 4WO4C 4JFDD 4XMWA 3ZZSA 3HG0A 1DBKL 4FFZL 5E2VL 4KZEH 5IVXF 3B2VH 3LKNB 3LN4B 5JLZB 1O9WA 1IQDB 4YHLH 2Y36L 5D6CB 4ZOCA 2QELA 3X11B 1OL0A 1T2QL 4G7SB 1W8NA 4HWZA 1NPNA 2PP8A 2QV4A 2GTWB 2Y2WA 1EEZA 2R2EA 3SZ6A 2N1TE 2FO4B 4M7ZC 1AD0A 3KAAA 4FQCL 1LWRA 1YO4A 2DMHA 2JQMA 2P5WE 3L9YA 3EYVA 1W2KT 1VLXA 4MMXC 3FH5A 3LRSB 4J3UA 2BXZA 1ZLVK 3D85A 4NGHH 3ARBA 4ZFZB 5K59F 1MQKL 4HGWB 5IOPA 4OI8A 1FGVH 2OL3A 5GRZA 3NEOA 4HJ1A 2JELL 2GIXA 5KSBF 3FCSA 4Z7WF 4NPJA 1DO5A 5GGRA 2XTJD 4YHOH 3N9GH 4WJ5B 1DP0A 4RBPH 1U58A 2FO1A 2R23B 4I3SL 2RAMA 4X5PA 3SDAA 1YUKB 5KS9F 3ET9F 2OR8A 1TZGL 1XX9C 2R39A 4EXKA 3AB0B 3S2CA 1SN5A 1WBXA 1YNTF 2NUPB 4M6ML 1O7DE 1D7CA 3VA2C 1JUFA 3O8XA 4KXCA 5EIIB 4ZAKA 4YQXH 1JXDA 1MCCA 5AKVA 2WN2A 5DJ2A 1TJHH 4PJHF 4G8AC 3SKUD 3W2DH 4C56D 1AGCA 3ZYOA 5LN8A 4RMWA 4Y9BA 2BNQE 4ZPTB 3R4DA 5DR5L 4LNRB 3D0LB 3ZL1A 2VAAA 5DZLA 5H35B 4YC2C 1HHKA 2BSRA 2OCFD 4GH7B 1SEQL 3RUGF 3V6ZA 2JIXA 1FAIL 1GIGL 3ZGHA 4LEOB 4LLQB 5J9PA 4R90L 4ZUUB 5IWLA 1OARL 4Z7UB 3UZQB 1ZXQA 1AHKA 1TJGH 5DMGD 1IAIM 4RLDA 4DZBB 5KYYB 2CG9X 3S88L 1MJ8H 2J6WA 2F7RA 2NT0A 2OXGB 2GQHA 4P9HC 5IK3B 3H3PH 4M9PA 3LRMA 3ILQD 2IWGA 5EZOH 3F7YA 2F54A 4XMXA 4NQCD 4PD4K 2Y7QA 2PWFA 4AW7A 3D07A 3HUJA 4GSDH 2ZCZA 1MCSA 3H9SE 4JX0A 4XP9L 1OO2A 1X5HA 1KGJA 3L13A 3H42H 5HDLA 1O5DT 2B16A 3MACH 2XICA 3OPZL 3DVIA 5TGBA 4FZ8L 1HI6B 3L4YA 4N2DA 3RDTC 4EMZA 4FC3E 2XOTA 4OLVL 4C47A 3AG2B 2R1XA 4GOSA 2DTMH 4N28A 4XB3A 3U46B 2ZF9A 4JFEE 4P05A 4PJIF 4QHPA 1IFRA 2OMVB 2YD6A 4FQXD 3MRCB 3OKNA 1FCGA 4P48A 3EYOA 4HEMA 4JRWA 2EECA 4PJCA 2XG5A 4OGAC 4Z23A 5HHVH 5AW6B 4N1EA 5DUBB 1ESOA 4JO5A 1QTPA 3IDUA 4JLRB 3BRGC 3VWKD 3R19A 1KULA 2XN0A 3S97C 3B3IA 1YC7A 1I8AA 1IGTB 3K72B 4LOVA 1HZLA 3RWCB 4KNTA 1LXMA 5EFIB 2NY6D 4N2IA 3G3LA 1KT2A 1U33A 4OV5A 2VITA 5C09B 1U8JB 2K4WA 1I9RH 2WLLA 3D08A 4QEGA 5MEPB 4BQ8A 3LN5A 4H1LG 3KCPB 4WWKA 2YPKA 5E6ZA 1PZUB 4QRRB 4Q2ZB 5D1ZI 1QNZH 2ZG3A 2DS4A 1RIUH 3L4TA 4Y2OA 1L9TA 3O2DH 3T6WA 1TLMA 1U8CA 3BKJL 4ZG1A 3IAGC 1GGBH 2ZX9A 3K0YA 1L5GA 3PNRB 4AITA 1JVOA 5F7AA 2W5PA 2X1PA 3IJSB 4WY7L 5DA0B 3GUFA 1AMYA 2FNWA 1FNSH 1RIHL 4B53A 3WMSA 2KQMA 3OAYK 5AD0A 2HLFD 3WFEL 5FK9B 1JHKH 5LJYH 1A7NH 4JFFB 3G08A 3H9YA 2ZUTA 4U0QB 3POHA 4FXGA 4QOKE 2DM2A 3MJ9A 3CIQA 3QIUC 1RUQL 1E4XH 5MENE 3VYOA 2CCVA 3EYSL 1RURL 1MF2L 4X7TB 3FFDA 1P5UB 3HI6H 1MVUB 3OMIB 1KGCE 2K8MA 3QORD 2VLKE 3LXBA 4EZKA 3PPEA 3IMBA 1N2RA 3ZMNA 5DLMH 1TENA 4JZNA 4P59L 4ODVL 1Z9SA 2R29H 3FU0A 1EV2E 2BDNH 1B90A 3T0AA 3LKPB 2XT1B 2PCFA 4QAWA 3RPIA 4KWUA 4Z95H 1WHPA 3D0VA 4JCLA 4OCRL 2HCZX 1XXDC 4X9IA 4KHTH 4WUUE 3NFPB 1YPZF 3S5YA 1HXYA 2H3XC 1JD7A 1J0IA 4KK9C 1L7IH 4PBXA 1C7TA 4XPGL 5T5NF 4BXSV 4DEPC 4UUJB 5CUSL 4PY7B 3J07A 1SXNA 1JZEA 2AQPA 1FLRL 2J5LB 2CZNA 2P1YA 3UTZA 5HVFB 2WZPA 4JNXA 3KCWA 4JFYA 1I1AB 4HT1H 4HXAH 1UVQB 3AMLA 3INUL 1YY8A 1VF5C 4QRBA 4NM8L 3ZTNH 1E4WL 5B3NA 3NBNA 5FUZL 3DX6A 2M8XA 1A3LL 1CICD 3MGTA 1OTUC 1A6UL 4YXLH 4DUXA 3ARED 1R5WB 2WCSA 2WJ7A 5CKAA 4XVTH 4IBVA 1BA9A 2IDSA 1IKFL 2AXGA 1OE2A 2IIJA 2V5SA 3B9KD 1MFVA 3LS4L 3LRLA 3TBSA 4I2XE 3L1OH 3F7VB 4I0PC 3UYPB 5DUJA 5IEKA 2P52A 2BVOA 2KC0A 4N20A 2X9XA 5D2NA 1KIUB 3D12B 3L4XA 3OKOA 4LSRH 1UZ8B 3J27A 2NY3B 4Z7IA 2GUYA 2EADA 9PCYA 1JZDC 3QXWA 3SGKA 3EOBA 1K2DB 1J05B 4WFGE 4XO8A 1T6BX 3WBDA 1SXCA 2L7JA 1XF1A 2PW1B 4U0RC 5ALCL 3BN9D 3UZVA 4HG4J 4L4TE 2ZUQB 2VRKA 5CP7A 3UG3A 1N19A 3TU6A 5T3XL 3NFNB 4XNZC 2Q2EB 3NZUA 2AXJA 4AW4A 1BAFH 4G9FE 5IJKA 3RHWF 2LLLA 4HJUA 3BKMH 3FAWA 4XGZA 5DZAA 4MJID 3IFOA 2VO5A 4PHXA 4R7VA 4P4KD 3TYGL 3E8UL 1OT4A 1X5IA 4OLXH 3QZBA 4WCYL 4UM8B 1FH5H 5T1KB 4NUPA 4Z7VE 4L0YA 1OP5K 4KMLB 3CFEA 4PLNC 1BZ9A 2BSSB 1A7OL 3PIQA 4PJGA 4XCYA 1BEYL 3S96A 1CL7H 3EGSA 1KGIA 2W95A 3BKYL 2QGCA 3K4DA 4YBQD 4K2UH 4NRXB 4ZOAA 4WTXA 1VFUA 3BDBA 1Q0XL 3NAAL 5C08B 5C92A 5JORA 3TA3B 2EE3A 2YK1H 4IDLA 3VFPB 5KW9L 1KMGA 3AUWB 3OB8A 1NANI 3VCLA 3BQVA 1IKOP 4LHUD 5C2BL 1AJ7L 4AOFA 1U6AL 4E0RB 3FAXA 4YDKH 1YNKH 3ZDXB 1FL6B 2Y2TA 1BVOA 1I53A 4IKNA 1SMAA 3S3CB 2IAMD 1QUNA 3D69A 1FG2A 1JYNA 4B9PA 3WD5H 8FABB 2XJKA 5AAMC 3JVGC 1MW3A 1YEDB 2F1AA 4MXVF 3FOMA 4JFDA 3QCTH 1F8TL 3UP6A 4XP6H 1P84J 4DAGL 4AG4L 2W07A 2VZ1A 4NAMA 5E99L 2YSSA 5IVZA 1RERA 3V6FA 5J6GA 2XTLA 2VDML 2GSGB 5F7KC 3LKQA 3FO2A 2DQGL 4NQVA 4J3OG 5KJRL 1M7DB 3WTSA 4HWNA 4W9CC 4XAWH 5B8CA 1ZANH 3VXMB 1LO5A 3SGJC 1V3JA 2IAND 2VDPH 1TQUA 3X12A 4QCIA 2WXIA 1UT9A 4WNQA 1NEPA 4I5BA 1NIBA 5F7MC 4N68A 35C8H 3AU0A 4OM1H 2WXPA 5MP6H 2RCSH 2HA1A 4N25A 3IBOA 1JWUA 3QXDA 1HK6A 2R51A 1AOHA 4HHAB 3AGVA 1HN1A 4LSQL 4XX1G 1ADQL 1KBBA 3QE5A 5F6IC 3X3GH 5J5EA 3QHFH 2WKOF 1MCBA 3I3DA 4KVCL 9CGTA 5I8CB 3BE1L 1ZA3B 4YSEA 1WISA 1YEHH 1KN4H 5C0IB 2AK4B 2ADJB 3SN6N 2O5XH 4U1SA 5DD5H 2R9HC 3AW5A 5HGHB 2A74A 2YARA 1DYZA 2X70B 1PQZA 2I9LA 4X0KA 3VTTA 1IM9D 4S1QL 3ULUC 1A1OB 4OM0L 3TIDB 2NY4D 3MUZ1 3JSSA 3VFGH 1F02I 3KJ6L 4C56A 4HU8A 1P53A 1XZWA 3VXUE 5I2IA 2VE6A 2WCGA 3FJTA 3OKMB 4KI5C 5KVMC 4MGXA 2C9UA 5F88A 1P0SE 5TK2A 1U93B 5E2WL 5FCSH 3IJ8A 4BQ9A 1CXIA 1G7LA 1QA9B 3QWRD 5CEYB 1P7BA 4C83A 3CFTA 2B0SL 2QQNL 1PDKA 2C9AA 1S7VA 4LL9A 1OP4A 4KDTC 4F24A 2JK5B 5FGBA 4U2ZA 4JN2A 3ZMRA 2XPGB 3QUXB 2DKSA 4D7PA 2FZ3A 2VZTA 2ZZUT 4LBEB 4YHZH 1HILA 1QRKA 3MV9E 3RDJA 4Y4KC 4ZUTB 4Y1AD 5T5FA 1JZ5A 1IUZA 2YAEA 3GBEA 4K7FB 5FW7A 5AB1A 5ICYB 4NQCA 2VLRA 4H8WL 5KSAD 1KFAL 4AQAA 4GI6A 3GGWB 5I1IL 4YK4C 3W9DB 4EAEA 4ZXBC 2DDQL 1OCCB 5JW4N 1IEAB 1RFDL 1K5NA 1JPSH 2C8NA 5EUKB 3H4HA 1GZHC 3ULVF 1UOVA 4UI2A 5E95B 1NCWH 1BV8A 4H88H 3RFRA 2M26A 1IGYB 2R0LL 4BZ2A 1ONQA 3WV0A 1JERA 1JWMB 3EYUL 4UTAL 1KXVC 5KVEL 5FYJL 3SE3C 1E6OL 3JXAA 4X5XB 4X5WB 1HEHC 1RZQA 3EUUA 4MX7A 4M7KL 3SDXF 2EXSA 1FYTA 1TU2B 4TNVK 4U6TA 4LL4A 1MWAB 3RWDA 1QR1B 4I77H 4MNHB 1J8RA 2XSKA 1C5CH 1NMBL 2BRRH 4W9KC 1NZRA 2JWYA 4NJAH 4OLEA 3TBYB 4I1RA 3VWKA 4Y2DA 1VFAB 2ZF8A 3C5JB 4AGLA 2HLAA 3K2KA 4JM2C 4XC1H 2IPKA 5C09E 4FNPA 3O0LA 2BP0A 1BZDA 3NG5A 2AJVL 1MEXL 4HJIA 2GUOA 2A6DB 3FU7A 4QRRE 4X6BB 2VDKB 2WBKA 3ZHFA 1E5CA 1RULL 3F5WB 1U42A 4FXKB 4NN5B 2NMSA 1IBZA 4RX4D 5JIKA 1KXQE 2NTSP 4UM9B 3V0WL 4H25B 1SF3A 4JKLA 4MXQD 2ZAHA 4H5SB 5TDPB 1U4EA 2W0FB 4POZC 3MV8B 4AIOA 3O4LD 4X8GA 3MRMA 2VL5A 3ZT5A 3PGCA 2OZ4L 3INOA 5EZIH 2WKGA 3UX9B 1G0DA 4GB9A 2H2PC 5DJCB 3ZR6A 3KPPB 1UA6H 5CD5D 3GBNL 4KQ0A 3AITA 3HPJB 2Q76A 3S3PA 4IRZA 2ZYHA 3O11B 4NFBA 3PQYB 3UACA 2YXWA 4E9LA 1EO7A 1XF5A 2OR7A 1B6UA 4PY8I 2X6AA 4BK4A 5JOPE 4HJJL 4MCYA 4Z5RB 2Z31C 3MDJA 3DNKA 1I3GL 5CBAB 1MKFA 3V95A 1LILA 3BXNB 3QORA 2DQTH 4NZJA 3ZKXB 2XRAL 3TF4A 2QLVB 3T1FA 3VWJB 2OQJA 3VNZA 2HRPH 1AI1H 4JFHD 5LQBL 1IE4A 4ZD3L 1LK3L 1T6VN 5DXWA 2KH2B 1QLFB 4HDIB 4X9BA 2DMBA 1HH9A 4CDGC 1VAHA 4UCFA 5DZJA 3L1FA 2F7OA 4S2SB 3NIGB 4TQIA 1I7UA 3SGEI 5ANMB 4ZNEE 7PAZA 2Z8RA 3LIZA 4XPTL 4P3CL 3FUJA 4DVBB 4OR1A 1CWVA 5HHXH 5JW5B 4A38A 3ECBA 3R8BB 2OSXA 2X4QB 2DMCA 3DX8A 4R7NA 4G1MA 1Y6NR 2VLLB 2O5ZL 3M8OL 4AL8H 1A66A 3STLA 2OMTB 1GGYA 1CFMA 2A3TA 2H3NB 5C0FB 1CICA 3JQOB 3NCXA 3VD1A 3H0TB 3AREA 4Y5XC 1T89A 1XDTT 3WDHA 2DEYX 1KDJA 4LEXH 2CKBB 4KO6A 4M02A 3NJFA 1CFVH 5B38B 3SPIA 3OGCA 2DD8L 5E8OB 2YQGA 5DVOA 3E2HC 4ATWA 1IZKA 4LRIC 4P3DB 1CLYH 5IBLC 2C4FU 2ICCA 2XQBL 2Z9TA 5GGSB 2WK2A 1VESA 3G6JF 3D2UD 5EEUA 3ARDC 2NX5E 1BBJA 2W9DL 3PWUA 1H6FA 4CW1A 1NLBL 1HAWA 5C07D 1P4LB 3BQUD 2RJMA 1LHZA 3V52L 3VFSA 2QHRL 5AOLA 2J2ZB 1BFOB 1IGIL 4PR5A 4XR8C 3A6BL 2LVCA 2OAAA 2HLEB 4X6DE 2HUEA 3L16A 5CJQH 2IPUG 4LMQE 2X4TB 1U3NA 3SSGA 1K8DB 1T7ZA 3QR1A 2B4CC 4PUBH 2OYMA 2OJZL 5T1LB 1F4AA 2OMWA 1PMYA 3S36H 4X80H 1P69B 3DOHA 4D8OA 1BXUA 3SPVA 4IDJL 4P5KA 1UXSA 4WK4B 3WJMA 5DS2A 2FE0A 1J0YA 4W70A 4R4BB 3W9EB 3GB7A 4IMLB 1WAEA 3V0JA 2HJFA 4Y16C 1GZPB 4P4KA 5D1ZC 4R97B 2XFGB 3DXAD 5JUEL 3N3EA 2PP9A 3SO3B 1IARB 3AM8A 5FM8A 4YX2L 3CSTA 1FNGA 2GI0A 5DJYB 1OM3L 3TESA 4E36A 3SGDH 1T2XA 2F7QA 2YD0A 2DM7A 3F83A 2ZCLH 4OW6A 2EXYC 3A4FA 2MQGA 1RJLA 1ZCRA 1NANH 2CIIA 1P4UA 2GK0A 3AT9A 3VTMA 2EH7H 2DQIH 4M6OL 1PIGA 3VD5A 3NN8B 1EDQA 3OMZA 2R4RL 4J28A 3U1QA 5DD3L 2VLJB 4KH9A 1Q1PA 1CT8A 3WKNA 4MNQB 1XGRA 1F4YH 2D2OA 4QHNB 3N50A 3N44B 3RWFA 3Q48A 3HG3A 4X2UA 4LHUA 4TM9A 1PD0A 3GS4A 4AQZA 2FSEB 3QO0B 2C1OA 4KOBA 4FFVD 4TSAH 4K8RH 3ARUA 1FYHB 3F85A 2KLTA 2VXQL 1I75A 4JG0H 2E46A 4KU1A 4BGDA 2IAMA 4KJWC 4JREB 1MFAH 4XMUA 1SHSA 4OIBA 3OJDB 1G9EA 1BZ7A 3D25A 4BZ1H 2E8YA 5K1NA 4G6JL 2K9FB 2WWMC 4PJ7F 3FK3A 4WV1A 3RRQA 3RL2A 3RVVC 3EXJA 4LSSL 5EUOA 4P2OD 2A9BA 1BFVL 3IDJA 3O45B 3ZDZB 1TZ8A 1LNUA 1H6EA 2P7TA 4HKXB 2QVKA 4NKIH 4PJXF 2KZKA 1T03H 5HHPA 2FBRA 1V54B 2OMZA 3RTQC 3HB3C 2JMRA 3ETBF 2Y6SD 2ZXDA 3BD3A 4D9QD 2GTZA 4LU5H 3DVGB 5B1KA 4Y9GA 4J2QA 5BQDA 3IDGA 2IANA 5BS0B 2MSPA 5J89A 4KKQA 1QI3A 2WNXA 5G55A 4HKBA 3TFKD 1BBDH 2E56A 2ZONA 5FYJU 1CTMA 4JO3L 3WEAA 3KNBB 2B14A 1F4WH 4XVUC 3SDYH 1G4RA 5D7LD 4YXKH 4WEBL 4A2FA 5FXCH 3LNHA 3L17A 1WV7T 4OCXL 5EWIH 3C08H 4GAJH 5D7JC 4F5CA 2ORBL 4O4YL 4OLYH 4JUTA 3S35X 5D5MB 2AK4E 2WZ0A 2M83A 4PD4J 5FKAB 3H9HB 4NO5B 3MCLH 4LBAA 3NSDA 2ICWA 5C0CD 2HH0L 4NQEE 3NQKA 3NESA 1PEWA 3QG7L 2W94A 4HIPA 4QTIL 5FDWA 4B5ZA 4B7LA 4O02L 1IM9A 5EZJB 3TTSA 2X42A 4PJ6A 1AANA 3BP5B 4XBEH 5EU7E 2OULB 1D5ZA 4M8VA 5D9SB 4KTDL 3QJTB 1NGYB 4OFQA 2O93L 5CLYA 2CIKB 3QI9C 3EO0B 3C9NB 1MFCL 1KXTB 2UXGA 3U30C 2Y72A 3BP6A 3DBXA 3TX4A 3SDDC 2PCYA 5EU3A 2WUBL 5CEZL 3FN9A 4AUYA 1EJOL 2BC4A 5IR1B 3QWRA 4NZFA 5GJTL 4ELMA 1GJIA 2VABB 4XWOD 2G2RB 2ISDA 4AUUA 4M5ZH 5D1XD 1RPQA 1MJJB 4R2GB 1EVTC 4JRFA 1XTLA 2B2XL 1C08A 2WGNB 4WFEE 3RAJL 4NZ8A 3PWJB 5FW6A 5ECJE 3BGFC 3P73A 2IDQA 1X44A 4JPVL 4UTBA 4Y1AA 4YPGA 3N0PB 2FQGA 5M95B 5KSAA 2WOYA 3CHXA 1O9ZA 4P0DA 2MRYA 3NT0A 4LSVH 5DK2B 4BWUA 3IGKA 1NL0H 4CILA 2X9YA 1U8MB 3PDOA 1MLBA 1COBA 1QRNB 4LAQH 5KBLA 2OL3L 1TJMA 2VSKB 2AK1H 1T7XA 2E7LA 4ONFH 2A77L 3GZPA 1WRFA 3H1ZA 3HPLB 4F8QA 1M6OA 3QNYB 4NNXA 3NZSA 2BCKA 3QYNA 2VDQH 1ZVSA 1A4BA 4MB3A 1RZPA 1AP2A 5C3IA 3P9LB 1UCBL 5J6SA 5FHBH 1DBML 5DFAA 3FT9A 2ZP0T 2LFEA 1N8OE 2I7SA 5JDSB 4N8CL 2TRYA 5KSUA 4F15C 3LPOA 1TQCC 3GMPB 1Z5LA 3KPSE 4KRPB 1MRDH 1Y1DA 3GKWL 4XP4L 2OW7A 5L0QC 4FJ6A 4FOMA 4OBRA 4PRPD 4W4OA 4MMYA 2APBA 1RU9H 2TRHA 4MS6A 4X8JA 3E0GA 2WBXA 2WC7A 3S8GB 3H4FA 5TH2A 4K3JL 5HHOB 4TVPE 5JXAH 1U8KA 4OD2A 1IM3B 4JN1L 2OPCA 2XWTB 3KR3L 1E9QA 3QDGB 3RGBA 4R26H 4RMSA 2E4TA 2VM3A 2K70A 4JZJA 1EEYB 5AW7B 1M2VA 2ADFL 3R18A 4XNAA 5JMOC 4EI5D 3LKOA 4Y4FC 1A2YA 3VYNA 1KPUB 2AJUL 2K4AA 4AIZB 5D72H 2IG2H 1RZ8A 1YN7B 3O4LA 3V4UH 2WNGA 3PJLA 3T0ED 3DK2A 4V11A 1HSAB 3LPGA 2YPLE 4IS6A 4LLVA 3MYZA 2CO2A 1X9LA 3PQYE 3L5HA 2YOCA 3V9CA 1HHJA 1NSNL 4OFPA 1KBVA 2VDNL 4HGMA 4K7PH 2HFGL 2DLFL 3GSWB 1F41A 1P4IL 3HLAA 3TM6A 1YDPB 2CO6A 4YL9A 3RTLA 4P5TB 1DDHB 3QH3A 3CXDL 3QNZA 2D31B 2E6QA 1S7QB 4CU6A 3UCRA 1ZHKA 1G6RH 2F1BA 2A9DA 3LEXB 5EORL 4F57L 3WNJA 4I0CC 3HE7D 3WNLA 2F68X 3AG3B 5FYKL 4Z7NF 5C9JA 3SGEH 2X0UA 1G9HA 2YLHA 3FQNA 3MA9H 4KZDL 2FATH 5DRNB 3VGFA 5F9DC 4LCUB 3VMNA 5ANHA 2HTLD 4LOUC 1EAJA 1JZHA 2R1WA 3C2AL 3FKUS 1H6TA 4LLUB 5ANME 3ZDWA 3EADA 1PLGH 1DUZA 2VDOH 4HWBH 3F7PC 4QO1B 4Z0XB 2JE8A 3WS3A 4K94L 4H0HB 1YCSA 1HL8A 4IKKA 2Z4QA 4TL4A 4AGNA 5IQ7H 1UQSB 1NGXB 1YQVL 1PS3A 2IPTL 1OIOA 4XNQA 1NAMB 2X2JA 3AS3A 3WAJA 1FVDA 1SY6A 4IRJA 1PG7W 2BW5A 4Z7VF 3DYMA 3FULA 4FJYA 2CHDA 3V0AC 3C6EA 1SMDA 5ILTL 1E5BA 1NFDF 5F7EL 3GSXB 4GEJA 2IALA 2WIIB 2DWYA 2IH1A 4MHHG 4UQ9A 4FKKA 4N2HA 4DN3L 4MDIB 2UZXA 4HX1B 3T4YA 3ZU8A 5AOIA 3V5KB 3BAKA 2ZOKA 2CDEB 2DYPD 3LXAA 3WFCL 1W0YT 2N7BA 4H0LC 4GW1A 1BMWA 3PNWA 1HHHA 2PO6B 4LCYA 1ES0B 2ENSA 1YMMB 5AVTB 4Q9RH 2Y7NA 3D2UA 3JT0A 4PBWD 2RD0A 1OLZA 1X5LA 4G6AD 3U4EB 2YR3A 4LRNL 5C07A 1ET7A 2HFEA 5BO1L 3TURA 2RHEA 1GTFA 1C16A 4LARL 4TUKL 3UG4A 3HI5H 4PVBA 2O6PA 4MAYB 3H2WA 4HUCA 5BW7A 2JLPA 1B6DA 1DUYB 1SEBA 1WHOA 3G5YB 3U7WH 3V0VB 1PFCA 3MRPA 4HKZA 4PWHA 1HL5A 1JZ6A 4NO3B 3QRFM 4R0LB 2NYYD 5D96B 3HRZC 3QRGH 1KYOK 4G7VL 4TLSA 2AERT 5I1DB 5JPNB 3I6KA 3PHQA 4Y5YA 3KG5A 1UEMA 2VERN 3WHE1 4PLJD 5DO8A 3TV3H 1ULVA 2G2NA 2XIDA 2O61B 3HAEA 1FP5A 2Z3FA 4IIQC 4KK5C 1BJ8A 1CVSC 4K55A 3ECQA 4HU2A 3LH9A 1NCJA 3FUIA 2CPCA 2DBJA 1VCAA 3B5TA 3WS6C 5TE6L 5GPRA 1HQ4A 1O7DC 3RPBA 4XWGL 1TTUA 4HCIA 4WO4A 3RZCC 4ZMYA 2R59A 4NRYA 3F3HA 4I4WA 5H8DA 4F2MA 5FFLA 15C8H 2Q20A 3P3TA 4GBXD 4MNQE 3VXNB 1HXMB 1QYGH 1K72A 2PWGA 1Q0YH 4X99B 1AZUA 3HOGA 2MHAA 5SV4A 2BX5A 5GSVB 1G7PA 2NUTA 2PPEA 4B9JA 2B5IC 2QR0A 3VH8G 4NUGL 2NDFA 3C6LB 3WTVA 3DJZA 3SKOA 2EVIA 3RVUD 2Q9OA 4FS0A 5CBEB 1BOGB 4A04A 4L9LC 4WW2B 2W91A 5IGXH 2J6EH 4DUVA 3ZXAC 4PB0H 1CXKA 1OQXA 5HDWA 4OLWH 4S10A 5I1CH 1T5XA 1YG9A 3PV7A 2GABA 1BD2B 1SJHA 2VDOB 5HJGA 4C58B 2QQLH 1A3ZA 5CP3A 4M03A 4P2OA 1YYLL 1JGVL 2DN7A 2EIEA 4F80A 4JZOB 5IM7A 4QY8A 1TITA 3ARGD 1BG1A 3F62A 2AI0H 4CVXB 3FB7B 4KMQA 4TS6A 3H2PA 3GC3A 4Z7UF 1UWXK 5CLTA 4LCWB 1Q72H 3WCYA 1W8OA 2IADB 1II4E 2MFNA 1EIBA 3GI8L 4PJFA 2Q86B 2JLLA 3JV4B 5D71H 4WI0B 5D7LA 5HGBB 5HHMD 1CR9L 2A0LD 2W65B 5LGJB 2DPKA 1LO0L 2XZCL 1R3IH 1FE8H 3PFUA 4LMQI 4ZUSB 4CVUA 2IFFH 5IKCA 1J1OL 1URLA 2DKMA 1MCIA 3SYPA 3IJ9A 5K1VA 3TLRA 2YA2A 2QPEB 4L1SA 1KPVA 1Z5YD 3LZNA 4X4YB 4MWFB 5DYOB 2AMUA 1DE4B 2PUQT 4GQ9L 2X1XR 4PW4A 5HVGB 2LW3A 1ETA1 1U4FA 4AEIH 4E42A 5C0CA 1EO5A 4WUKH 5A2FA 2VYRE 2JCWA 1SM3H 3B7UX 3VXRA 1FFRA 5DJ6A 5LBSA 2V5RA 5EU5B 1U8IA 4D0CA 4U6XB 3PWVB 1BM3H 1WP6A 5DK3A 4ZFFB 5AYUH 4Y19E 2W60A 3MLZL 4NUMA 2IOMA 1KDIA 3PHSA 4TPRL 4P8QA 4ELKB 4PGJA 3IPBA 3ABGA 2KHAA 3O2VH 4IRSC 1XZ0A 1QHOA 1OCRB 1YEIH 2VH5L 5B38G 5EB9A 2XZZA 4JJ5A 4EN3B 4F7CA 2P8MA 4CMHC 1VPOL 1I3VA 4KY1L 1J11A 5D1XA 3QIWB 2YPVL 3WLBB 2I24N 5EBMA 3FU8A 1AO7A 3D4YA 4GAAA 1XAKA 5CU5A 2J1YA 5HDQL 3CUPA 3KWWA 1N4XH 4L4VE 1CURA 5DEFB 3EHBB 5HYJA 5IFJA 3AWEA 3RX7A 3FOLA 3MX0B 3MBWA 2OTWA 3OKEB 5F1NA 4F7TA 5FYKU 3IXAA 1QRNE 1ZKAA 4RRPM 3V4VH 4HIJB 1PL3A 4FFTA 4NZUL 4DKTA 2EXTA 5C0AB 5C0JA 1JS4A 1S5HB 2X7LA 4KNQA 2OFQA 4KHXL 2FL5A 3C60C 1H3PL 1I3UA 3D39B 3CLFH 2F2HA 1FNLA 1MIEH 3C8KB 4O2EA 4IKLA 5EPMB 5GGQL 5B1JC 3US1A 1AGBA 1S7TA 1IC1A 2J25A 1LMIA 3LNEA 1BJ1J 3IRCA 1DVUA 1BZOA 5M7QA 2XKNB 1RIVL 2BSBA 2XWBB 4L18A 1AGEB 2VKXA 4P46D 3QDJE 1YJDL 1NUNB 4U2YA 1XCTB 2BY2A 1NBZA 1KB3A 2R27A 4NBXB 1MCNA 4PRPA 3AT0A 3IAQA 1NKGA 4XHJC 5KG9B 1JGDB 2WXNA 4ZUWA 5B39A 1DBBL 3NCEB 1ZGLA 5HHOE 1D9KC 2FR4A 3BZFB 2X6BA 1UUNA 2W92A 1CGSL 3QDGE 3KS0J 4EUPH 1I9JL 2JCCE 3GDCA 3P0VH 4G11A 4KTEH 2JI2A 3HZMA 2YGQA 1EMTL 1T0MA 5FA3B 4ETQA 4XO3A 1O0VA 2NY5H 1FPTH 1T83C 4JY4B 2VN7A 3BSZL 4FP8L 4EI5A 4WLCA 4IGBC 5DK0A 3QFDA 3QQXA 1KNOB 5K1JA 1RZJC 4ZZKA 2WWNA 4PJ8C 5IW6B 1V27A 2EIKB 4KH2A 3T0EA 4FTVE 4MD0A 2IWFA 5FWRA 3FQWB 4QHLB 3QFJD 1WUNT 1JWSA 3DLQR 5I17A 3RL1A 5HI4C 3OHXA 5C1MB 5T3ZE 1DSFH 3DIFB 4P2QB 4MSWB 4G82A 1IMHC 1OF2A 2QDVA 5KANI 1Z9OA 4MRCA 4IEFA 1QFWL 4TUOB 3ARFC 1OPGL 3A6OA 3GJFH 4GKNA 4BZ2L 2WIMA 1WC7A 3HE7A 1NPJA 1S7RA 3Q8CA 4S1RL 3SY0B 1X5JA 2Z65C 3KDMA 3N42B 1NBQA 1KCUH 4I0PA 5E8DL 2HKHL 3W0WB 3AY2A 2IDUA 2R15A 3FC8A 4P9MH 5I1JH 3ARSA 3VRJA 2B20A 4NRZA 3AY4C 1HQRB 1UM4H 4KTGA 4OD3H 4RMVA 4OUOA 4X98A 2AV1A 2BIQA 3ZKSD 4CRPA 4M3KB 5F3FA 4HIHB 1BVNP 4IOSA 4JFZL 1EFXA 3D18B 3H7BB 4UAHA 2DQDH 4FLRA 4EKJA 4DN4L 3BZ4A 4JG9A 2XX1A 5B3SB 4M7LL 3V9EA 1GVIA 4X6EA 3TP4A 3V4VB 3BWAA 3MLWH 5HBBA 4DGVH 5I1GL 2UZPA 1S9WB 4LVOC 4H44C 5DHXB 1U8LA 1PYWB 3MMEB 1YMME 2P46B 3JWOH 4GUCA 4QF1A 3EFFB 1TZOA 1J88A 2B39A 4QAMB 3RVWD 3OG4B 1DBKH 2AKRA 4FFZH 5E2VH 4JM0A 5C0BB 5I19L 3NGBC 1CFTB 4JPIB 1RK0B 1BQKA 2Y36H 3W5MA 4XZ4A 3AMKA 3ZDXF 5FO9A 1T2QH 3FQ2A 2GHZA 2XG4B 1QO3A 1AQMA 3OZKA 3AS0A 4XBPB 5JNYA 4OFKA 1T7VA 3CXHK 3QJSB 4GQPH 5FF6B 4FQCH 1QSED 2VZVA 3TN0D 4NDMB 1PZAA 3IS0X 4U31A 1ZHNB 1QBLL 3ARQA 2YMXL 4WU7B 1TETL 2OCJA 1MQKH 5EF1A 3ZX1A 2Y5TB 5FCUH 2E7HA 4PCSA 4ZMZA 3DBSA 2I85A 1SUHA 2JELH 1NBYB 2UUDK 4B96A 2BXYA 3FQ4A 1KXHA 2HJLB 1A3RL 3LIZL 4DP0X 3JVGA 1HWWA 4GFTB 4WNSA 4I3SH 1B0IA 4XH2B 1QPXA 5AVVB 3SO5A 3TBTB 3BT0A 4JRYD 2NY5C 3FT1A 4Z7WA 5KJ4A 1TZGH 3FBKA 3K1DA 3WN6A 4M6MH 4Z7AA 1KG0B 1U36A 4GBXA 4QTFA 3ZHDA 4UTCA 1NFKA 5KS9A 1JYVA 3P2DA 2VC2H 3UO8B 4FKEA 4Z8FL 3DSFL 5GRXG 5I1AA 4TTGA 43CAB 1YNTA 1ITBB 4GAGL 3IF1A 3MCKB 3GRWA 3G5ZB 2R1YA 3GQFA 1BF8A 2P5EE 1BVLB 1WFOA 3MGOA 5DR5H 1JGLL 4ZW8A 3SBWC 3W39B 4PJHA 4NENA 5EU6A 3BPOB 2DTSA 5HPOA 1ZJAA 4PGEA 1FAIH 1MWOA 3K5SA 1GIGH 3UGUA 1A25A 3QUYD 3HUJE 5LVEA 4R90H 1BD2E 2QKIB 1G1OA 1OARH 2BOCB 4IM8A 2NY1B 3AS1A 4YIQA 2FWLB 3WNKA 4CKQA 3S88H 3NTCL 1SMOA 3F12B 5KVFE 1KY6A 1OAKH 3RUGA 3GF8A 1Z3GL 5SWZD 3QJZA 4HH8A 4L48A 2Q7YA 3CHPA 2XQYG 4X4ZA 4L5FE 1UJTA 4M93B 4HMDA 4OU3A 1OLLA 2D3NA 4XN2A 3ARGA 5JHMA 2L7UA 1CMOA 4XP9H 4ZJ9A 1U2YA 3D4GA 3GI9L 4LCWE 2V2TA 5D7EA 4J1UA 4S0HA 4TNWF 1LP9B 4FEIA 1I1YA 4PJCE 5F7LB 4FQXB 5BZDA 2G4EA 5DUPL 4MZ3A 4FZ8H 4CU7A 1KWKA 1ZE3H 4JGNA 4OLVH 1IX2A 2ERJB 1RZGA 3FTXA 4Z77B 3WFBL 5HYQB 2UX6A 1GYUA 1AR2A 3ULVD 1R24B 2DJSA 1J12A 3FFOA 3MR9B 3UL4A 5F7UA 5GZNC 4KROD 2XV0A 5IW1A 2ITEA 4H8PA 1KYFA 4LKCA 3FXIC 4NLHA 3ZRSA 5DHMC 3CLWA 2COVD 1Z3RA 4PJIA 3QDMD 3BZEB 3TPUB 3TBCA 2NR6C 1BQHG 3D48R 4QXUL 2ZWLT 4YJZL 2BVTA 3BKCL 5HYSG 1TUPA 1PGRB 3C8HA 4Y4KA 5DEGB 2D7TL 5GISL 1GYWA 2AXFA 2JKRM 1WQVT 5BZWA 4WTWA 1SZNA 3TO2B 4CKVX 2CJUL 3NIDB 2B3RA 4FLHA 2YBRA 2YN5A 4LLMB 2ADGB 2E75C 3DPBA 1RJCA 3NH7H 1A9EB 4MDRA 2VJ0A 4ONGL 3BKJH 2ZQKA 3PHOA 4RGND 2E74C 4X5QA 4WY7H 2JB5L 5JMRA 1KXVA 1JPTL 4GMSL 5K9KB 2CBTA 2HVJB 1E40A 3ENEA 4ZMAT 3P3YA 1RIHH 5EIVA 4YVUA 1DL7L 1X9RA 5TE7L 3WFEH 1AXSB 1AQKL 1N0LB 5AW0B 3ZTCC 2YHGA 2J3SA 4YZFF 2FX7L 4W9ZA 3RWIB 2EDTA 3UFIA 4CSPA 1JF1A 5A6MA 5KVGL 4KV5F 1RUQH 4HZLA 3EYSH 1RURH 1MF2H 3S2AA 3UROR 2V33A 2ZPKL 3WN5A 1DEEB 1A8JH 4L2YA 3JYCA 5DFVD 4BH8B 1P7QD 1DQQA 3GINA 4JM2A 4ODVH 1J86A 3UMTA 5C0AE 3HI1B 4TVSa 4HUMB 5FO7A 4I18C 3ZLQC 3QAZC 4LAJH 3FT4B 4OCRH 5FYLL 8CGTA 1I1AC 3D39E 4LCIL 4FRWA 1X5ZA 1R5VA 4UBDC 3ZKMD 1TJXA 3VXOB 4HGKC 1B0GA 1E5ZA 1S3KL 3WELA 1CGYA 4XPGH 4U1HA 3HKZA 3F7QA 4JAMA 5CUSH 1QBAA 3L4VA 3LKRA 4FE9A 2CCLA 5I76A 1D6EA 1FLRH 4N0FA 4BA8A 5DMIL 2E59A 3OQRA 2IGLA 3B9KB 4Q6IC 4HKJB 1IGFL 3INUH 4HBCL 4AM0Q 4NM8H 4NZTL 1E4WH 3GSOA 4JFQA 1V3LA 3JV0A 4P46A 5D1QD 1XGPB 2JXMA 5D2NE 4J23A 5FUZH 1A3LH 3JZYA 1SPDA 1A6UH 4BZYA 3HJ0A 3NIGF 3L3IB 2Z31A 1IKFH 3LS4H 2DEWX 2N3JA 4ODXB 4BD4A 4AYFA 1VGKA 3HG2A 4IW4C 1CF1A 4HAFA 2BOBA 4KJPD 3D4ZA 4HOMA 4HJTA 1UOLA 5IMLA 1JXFA 1KIPB 1QSFB 1B3JA 1KLFB 4J8RB 1U92B 3QIBB 4RCAA 1ZTXE 1HSBA 4N0RA 4JCWA 4Y9CA 1R9FA 3QZMA 2XA3A 5E1AB 3UYRH 3QJXA 2GYSA 2XXGA 3L7FA 4L1TA 3OR7A 3PP4L 4ANKA 1UWGL 1QUPA 2LLNA 2JNZA 1P7KB 1JPFA 4ADJA 4NHCL 5ALCH 4G42B 2A6KB 2HG5A 1GHFL 2EDRA 2Y25A 2ROXA 3PL6B 3QFJA 1FFNA 1YUHB 4MJIB 3O9WB 1AHWA 4GSQA 4P2QE 1J8SA 3N5AA 1GS6X 1PKQA 5GS2H 3EAKA 1ZHLA 4ODBD 5L88L 2CCWA 5TJWK 5T3XH 2D8KA 2AGJL 2WYIA 4PJGE 2LR4A 1WZKA 1XIWD 4Y5XA 3RI5F 4V1DA 1OWWA 3TYGH 1ZLVH 3EJZD 1OSEA 2BS8A 3E8UH 4GKZA 3VFUA 5ADPL 4WCYH 3AG4B 5DS1A 3T8XA 1HDMA 1EZVX 2FGWL 3EH3B 3ZYZA 3EOTL 3OSVA 1GSMA 4RAUA 5E6IB 3IKCB 5DGQA 3TA3C 5I1LA 4NPYA 3DX7B 4LRIA 1F6LL 3NIFB 4AK1A 1A7OH 2IOIA 4DKEL 4YZWA 2HT3D 3KLSA 3VU2A 5J13C 3UEZA 1CLCA 3BKYH 3L3HB 4D0DB 5JXEA 4TKWA 3NAAH 3K5RA 1Q0XH 4U1NA 1OF0A 2AITA 2EYSA 3KE0A 5JIDA 1SXZA 2XY2A 4PJ9C 4XPFH 1A6ZB 4QHMA 3WFHB 3CHOA 2Z93A 2V8LA 4F7KA 5KW9H 3KPLB 1G0YR 5F3HB 2UXVA 3IJHB 2LU4A 2MCAA 4JFDE 5C2BH 3ZRFC 1AJ7H 1U6AH 4ICXA 4HS8L 3QJRB 2G0KA 4PJAB 3QQ9D 4H13C 2WSKA 4Y16A 4TVPH 2YGOA 4ANVA 5D1ZA 4WO0A 3RGVD 4BUQA 2CNZA 5IFHL 4XO9A 3N44F 3BEVB 2K45A 2FGZA 2JI3A 1F8TH 3UPCA 4DAGH 4HAGA 4ZT1A 1T7WA 3K3QA 3RQ3A 4AG4H 3ZO0A 4N6QA 5HY9B 4YDZA 2VKWA 5I30H 1KWGA 1VZGA 1MCOL 2VDMH 2X4RB 2H1XA 3UC2A 3G6AA 4FTDA 2AJSL 4CMMA 3WO4C 3R06A 5K9QI 4N0UB 2DQGH 5KJRH 2V7HA 2BNRB 1QSEA 2OMUB 5D7KD 1JGEB 2A83B 1MUJB 2XTJE 3VGDA 4PLOB 3HE6C 2QVFB 4K71C 4YE0A 3OR6B 1OVZA 3V4PA 1DVFB 1FO0L 3ZDZF 4F7MA 3X17A 1FGNL 1JPGA 3BPLC 3KPRD 1WIOA 5F89A 4HFWB 1ADQH 1L6XA 2CLVA 2EABA 5JHDD 4FABL 4KVCH 2OSLA 2DYSB 1S7UA 1CYGA 2DWEA 4C56E 3BE1H 1CD1B 4MVBC 6FABL 2WBJB 3KLAB 5EU7C 3EJQA 1I4FA 1HESA 3HZKB 3GZQA 4G8GB 1MCHA 1SY6L 1VEOA 2VZUA 4E5XB 2WKOA 4NAQA 3MFGB 5HGDA 4K5OA 2D0FA 4KK6C 4OM0H 4NT6A 3KJ6H 3OKDA 1JOIA 4TQHA 4KY2A 4XC3L 3RTQA 2K9UA 4U6VH 4JFED 4TNGA 5D5MF 3SE4C 2F15A 1OQOA 5E9DA 3WI9A 3MN8A 3IJEA 4GXVH 4LVNB 2BM3A 3UEQA 2E9JA 3IETB 5E2WH 4U1MB 3HR5B 2QQNH 1IT9L 3NJLA 1RHHA 4NQCE 4Z0BH 2DQUL 3UAFA 3QUYA 5DI8A 5E1QA 3DX0A 2VT0A 2UVFA 3GSNL 1RLBA 2CDFB 2Q3ZA 2YD9A 1G7QA 3E7JA 3L4UA 4ICWA 1K8IB 1ZT4A 1RCYA 1KGUA 2HTKC 2GJZB 4QHUB 3OAYH 3LQAL 5J0BA 5JA9A 2CNYA 1GZQB 1WIUA 3CZKA 2NSXA 4NQDB 4G59C 3U36B 3KGSA 1TFPA 3KBEA 1KJVB 4H8WH 2VLMD 2PTTB 1KFAH 1LP9E 1D3CA 5I1IH 2Z0UA 2WVTA 1AG0A 2DDQH 3MREA 4OY9A 4JRXD 1DN2A 4U6HA 4WFFD 1WCBA 1S78D 1FZJA 5KBMA 2AV7B 3GLDA 4J3OD 2ICEA 1SXBA 1VEMA 2R0LH 1ZWIA 2BCMA 3FT3B 4QRUA 3EYUH 3NOIA 3X3FH 4UTAH 1WAAF 4Y2LA 1F45A 5FYJH 3D87B 1MFDH 5F7DA 4ZNCD 4PGBB 3S35L 3G9VA 2L04A 1FVEB 1DVYA 4M7KH 3WIHA 2ZX5A 1S9YB 1UEYA 1Z9MA 4ZS7L 4RSYA 3K71A 5GZOC 1ZEAL 3CFBA 3FB8B 3QDMA 1NMBH 4IJ3B 4W68A 3ECVA 5KN5A 1H5BB 2VDMB 4B97A 3SDXA 4G8EA 3RWGB 4KXZH 3SQOL 3ES6B 3TJHC 3UMNA 1PNCA 1TYJA 2B9BA 4LESA 1C1EL 3NIDE 4F9LC 3T5WA 2AXWA 1GYVA 1MEXH 3TT1L 2XVKA 2G75B 5C0GB 4JPWL 5J6HA 2XC8A 3CC1A 2X88A 2WQWA 3L7EB 3DKHA 3T3MB 1CVRA 1RULH 3FO9B 1NCGA 3MLTB 1ILSA 4XNUL 3VGBA 4M9OA 4F20A 1JDDA 1MXGA 2CWRA 2L0DA 2Y4SA 3V0WH 4BM7A 3F65A 1CF8L 1CG9A 4DT2A 3N55A 3UTTA 5EG6C 2XN2A 3FQRA 1OB1B 4Y9FA 2WQUA 2WYTA 4GRLC 5TFSL 4PRAB 4R96A 2AQTA 2OZ4H 1I31A 1T0PB 5A2AA 4HULB 1CUOA 1U0QA 4J27A 3GBNH 1MHHB 4F9PC 1QI5A 3QYMA 4LLDB 4RZCB 4FQHB 2X6CA 3Q43A 1OY3B 1LK2B 3CSFA 2DH3A 3E9TA 5GIRA 1RZFL 2JB6A 5INCA 4HJJH 2KZBA 2MOGA 4ORGB 1I3GH 4HLJA 4IOFD 1ORQB 5B7EA 3BP4A 1TPXB 1H0DA 2XRAH 2XTSA 4YGAB 4Z3HA 1AS7A 1TCMA 1P7QA 3OZ9L 1JHLH 2MPVA 3VFTB 5F3BA 1IGJB 5ERWB 3CN4A 3LNFA 4WVRA 5LQBH 3UBGA 5FO8A 5I6XB 1GOGA 5EC2A 4K07A 1MFMA 1K3IA 2H32B 4UDUA 4NUJA 4AQ8C 1OP5H 2GSIA 1VDGA 4NNPH 2AEOA 4EUPG 4YGVA 4Y5VB 3UTSD 2RFXA 4P07A 1KJMB 3NPSB 5DURB 2HWZH 1PEZA 4XPTH 2D3JA 3HHRB 4IU2B 3QJVB 1MREL 4P3CH 1TNNA 4P9HL 3ARTA 4QLRA 3RVXC 4AVHA 2NY0C 1OPOA 1E2WA 3CXFA 2O5ZH 3M8OH 1ED3B 4BSWB 5D1QA 4UF7C 3GBDA 4G9DB 4GIAA 4XRCA 2CR0A 3MGAA 3C5ZD 3LMJL 2XNAA 1M05A 1BVKA 3RKPA 4U4IA 4JDZA 4JKKA 3TVMD 3BWSA 2J8UB 1MJUL 1KB5L 3UGEA 4G5AA 3LS5L 4BWTA 2Q6WA 5KAQG 3FSOA 3BQUB 4PP2B 3LEYL 2ICWJ 3K6SA 4DKFL 3T4AA 2AC0A 2XQBH 2R2BB 4BDVB 3OX8A 1XGUA 5I74C 1VZHA 5DFWH 1X3DA 2W9DH 2ZWZA 3M07A 4N9GB 4H1LA 3FUEA 2EDFA 1UXWA 1ND0A 3VQMA 3E6HA 3MROA 4EVNA 4F8NA 2DIAA 2QHRH 3G6JA 4Y88A 4A2GA 4I7ZC 1IGIH 5JQ6H 3A6BH 5ACZA 1IC5L 2FQDA 4MJIE 4NSKA 4B9ZA 4UV4H 3IXTB 4A7TA 1R75A 2F1EA 1ZK9A 3P77A 1YZZA 4KZEL 1AZVA 4Y2NA 2OJZH 1MRFL 1YA5A 4G70B 3DXAB 3M7OA 2ARWA 4BQBA 4HIEA 4IDJH 4B9CA 4XBGA 3N6YA 1ZMYA 1J8HA 4JFOB 4PG9B 1XIWA 3O6FB 2A6IA 1HXKA 4YSQA 1OTSD 4W9EC 3QUKA 1JZIA 1CDJA 1EXUB 1ASPA 4HFUL 2C3VB 4E9WA 5JUEH 4FNTA 4G7RB 7TAAA 4YBLC 5D93B 1VADB 4H2AA 4BFFA 1J0HA 1IGML 3NIFE 4MMZC 4YX2H 2GI7A 1OM3H 4ZMNA 5BVPH 2W80C 3NSCA 4OJEH 4HJSA 2VNCA 3DIVA 1OSPH 1FGVL 1PCXA 2ZP9A 1ORSA 2ZWKA 2NCEA 2WP3T 4P57A 3CXHJ 4HP5A 4M6OH 5BRQA 1FZOA 4WIQA 3RFZA 1QAWA 3GRBA 4PWEA 4L8SB 5DD3H 2FH8A 3O3DB 1T21A 2XU9A 1L0YA 2FUQA 3AAZA 1LE9B 1KTLB 3QZPA 1LVEA 5D2LB 5DHEA 2GY5A 2DLEA 4JREC 2UYLB 5ICZB 3DV4B 4F7PA 4OZFA 1QSVA 1XWVA 3CBJB 4F3FA 3HRZA 1M1XB 1PY9A 3RVTC 4KKBC 4XNYH 5EA0L 4OF5A 1IE5A 4W9DC 3GMOB 1TT6A 3MUY1 5EUOE 4PJAE 2P24A 2VXQH 2DMKA 3TBBA 1CD8A 3AWGA 4KKRA 2OA9A 1HAUA 3KVPA 3W2DL 4IIQA 2VDLL 5A2JH 2P80D 3DA0A 4KKAC 4AC2A 3VD0A 1FV1A 2ENPA 4UQ3B 2Y07L 2XPYA 2IANE 2WXFA 4G6JH 2EUZA 5A40E 4LSSH 2PTVA 4YHML 4ZI8A 3F7RA 1BFVH 3FCTA 2WSPA 3FUFA 4WW2F 2H6PB 2BSED 1TZHB 4M5SA 4N0UE 4AKPA 4NJ9L 3QNXA 4PJ7A 2X2IA 3GTNA 3ILPA 5IIEB 3CNKA 1CBVH 1X5YA 3CHRA 3MRBB 2W81C 2OX5A 3DSNA 3FCGA 4KAQL 4F5CE 2BNQA 4G43A 4YHPB 5DRXA 3TT3L 2CXGA 2NTFB 4P23C 2BHZA 4QRPB 4R4ND 2K7QA 4JO3H 1PZ5A 3H53A 3LZRA 3RILA 4ES9A 5HDOA 4GIPD 4WEBH 3FTUA 3ZL4L 1NGPH 1LWHA 4NKMB 4ENEC 3FRPB 3KPRA 4OCXH 4U1LA 4W6WB 3LXCA 2ORBH 4O4YH 3V5HA 1I1FB 2WQRA 1LEGB 1PZBA 5JHDA 3DIDA 4HUWB 2Y5QA 4ZX5A 4G8GE 1F0LA 1PZCA 2DTML 3KYNB 2BLFA 5ENWA 3LVEA 3S5LA 5C70A 3SJVB 3L3JA 4QXTA 2HN7B 3H9SA 2HH0H 2YXMA 4F92B 3KVDD 3NJGA 1F3DH 3QG7H 2ALWA 4QTIH 3LQZA 1QABA 1XR8A 3GZKA 4O02H 5H94B 4Q58C 1KPRA 3IYLW 3MJWA 4GG6B 2BOLA 4LCCA 2FUTA 4M1CD 3MRGB 4KTDH 4AM0A 4Z76B 2UZYB 1GAFL 2WWOA 3FU9A 4WJG3 4AJYV 3IT8D 3Q3GB 4JFEA 5EO9A 4PRBB 4EDXA 5CIPH 3QWOB 4UT7L 2WUBH 3N0AA 3C8DA 3DV6A 5CEZH 1KIRA 2IO5A 3AG1B 4W4NA 4Y1AE 5I73B 2ZSVB 3O3EA 4AX3A 1ETJA 4AQ1B 1WFIA 3CVDA 4U6YB 1QNZL 2R7EA 3X1FA 1RIUL 2V2XA 3G5WA 3ZTDC 1GGBL 4AYBA 1EXHA 1A4JB 3Q5YA 4JPVH 3KLHD 1KJ2B 4GXUM 4YHNA 3UO1L 2IQ9L 4APQD 3RHWK 4MKTA 3EJPA 3VXTA 1KTDB 2OL3H 4HSAC 1EDYA 5F1KC 4PJ5B 3RGHA 4NNYA 2WTOA 3D50A 4LHQB 3TBVA 3U2JA 2VRQA 4PREA 4HJGB 1RZIA 4HUUA 4Z3GA 3KS0H 4GAFB 1UCBH 4JFFD 4AQEA 1DBMH 2Z4TA 4WEUD 4LIQL 1AAJA 2Z35A 2G9HA 3C5XA 4N8CH 4Z95L 3BHBB 4G72B 3LY6A 1XF3B 3QXAA 4BK8A 1XH2A 3GKWH 4XP4H 3EH1A 3KM1A 3ZJAA 2VLKA 1JDCA 4UAOB 4U3XA 3LPFA 4AVIA 1KENL 1G7IB 1XGYL 1ZVHA 3IJYB 2EDXA 3TZVB 1IAMA 2N4IA 3RJQB 3GRWL 1T1ZB 4XCCL 4RETB 3TCLB 4JN1H 3APFA 3L3OB 3BZ5A 1DQVA 4HXAL 1MPAL 5DQ9B 4IBTA 2HFFB 3QRBA 4WUUA 4FFWD 1AGFB 2WB1A 2ADFH 2EIJB 4PG2C 3ZMEA 1IAOB 5K39A 1YEWA 2NXZC 3C5SB 2HMIC 1FRGL 2AJUH 2WKLA 3P4MB 4XODA 3QCUL 1V7ML 1XGQA 2X2HA 3X14B 3OXRB 2EUWA 4BFKA 3VE0A 3M17B 5M94B 1MN4A 1NSNH 4BV1A 4S1DD 2VDNH 4N8VA 5ID1A 4JFHE 3ULUL 2HFGH 5CSGA 2DLFH 5KVFH 5DHVH 2EKSA 4XCNA 1N70A 2X53A 4ZMOA 4YDLC 4IU3B 3CXDH 3OBAA 5E8PA 2NY3D 4GRWB 4HCRA 4W6YB 2CO7B 4FEMA 2IV8A 1WZ1L 1OZTG 1ZV2A 5CIPB 5FYKH 5HSFA 3T3PE 3KPOB 1DJYA 2Z7YA 5IV2B 4ATTA 4KZDH 2QQKL 5LNGA 2EXWC 4G6ML 3C2AH 4UOW0 3BKML 1GJWA 3EOAB 1L3NA 3LIUA 1H3TA 3OJVC 4L4TA 3QB7C 5I9QC 2EAEA 3LB6C 1FBIL 4HWZB 3DX2A 3RY6C 4AUJA 5I66A 1FL3A 3QGVA 2QZQA 4K94H 4MD4B 3BVNA 2EDQA 1QQDA 3BIKA 1YQVH 2IPTH 3VG0L 3N42F 1AD0B 2EDBA 2OZNA 5EBGA 4G9FA 1RJYB 5MEOA 2DYPB 1G6VK 2VXUH 2XWJB 3HC3L 5ILTH 3QUML 5SX4H 3C5ZA 3FB5A 5F7EH 3M1BA 4F93B 3FFCB 4LNVA 5F0LB 4OUUA 5C07E 4DN3H 5IOPB 2C7UA 4Z7VA 1DFXA 2YK1L 1ZA6B 3VRIA 4KJYA 3L3KA 3JTTB 4JDEB 1NFDA 4QDGA 3WFCH 5BQ7B 2WV3A 1IQWL 5IMMB 4M6AA 2O5NA 3GSRA 2AABH 3PWLB 3ARBC 4BSVA 2NCMA 5C08D 3ZYJA 4UOZA 3QS2A 3ZDYE 1YNKL 4LRNH 3WY2A 5TQ2H 3FSAA 4Z3EA 4OI7A 2L7QA 3WD5L 1YRKA 3MJ9H 4TUKH 4HISA 3FYIB 4E9SA 4CC1A 1AZZC 2PYED 3VFNB 3OC5A 2D9QB 3SDAC 1JK9A 3QCTL 1AGCB 3DXAE 1UXLA 1KOAA 1WF5A 5AZ2H 3BFOA 4G7VH 2ATPA 1TJIL 2WLNA 4DP5X 3HMXA 4JFSA 1HHIB 3O8XC 4ZSOB 1KGXA 1YLBB 4ZAKC 3Q8BA 4G7QB 4MXWL 4WKXA 3T1WA 1T1YA 3GJEB 4OZ4B 5HP5A 2ZSWB 4F2ME 4NYLA 4DHLA 5AZEL 4XAWL 2NNFA 1O6VA 5EOQL 2Y5EA 3LKNA 4NQXB 3UBXB 1SQMA 1IQDA 5A2CA 5D6CA 3X11A 2JKNA 4FNUA 5E0FA 1A8ZA 5TE6H 1WD8A 3IAPA 3ML8A 5I0YA 2GTWA 1ZIAA 4S1SH 3QJUB 2RCSL 4XWGH 2FO4A 2GPZA 3ALWA 3J8F7 3VXMD 3RKDC 1G7HB 4EZMA 3PV6B 2F54B 4TQ8A 3JUYA 3C6LC 2VISB 5IWLC 2PXYB 1UYWL 2G3MA 5FFOA 3LRSA 1QLRB 1R3KB 2QPDB 4X4ME 3CH1B 1QVOA 4UMSA 3Q8FA 4J3SA 4ZFZA 3B9DA 4WW2C 1N3NB 2OTUB 1C8QA 5DHVB 4JE0A 4HGWA 4GG8A 4WZ9A 4NUGH 1U8NB 3P1VA 4C55A 1T1XB 3SPCA 1NCBL 1EHLH 4JGJA 4WJ5A 1RXLA 2BP8B 2WAHA 3U82B 1SN2A 3FT2B 1A1NB 2R23A 3VFGL 5CZXD 3HN5A 3EYOB 2V3FA 2XG5B 3FO1B 1U91B 4I9WE 2DJ4A 2P80A 3L5XH 3WMPA 2FJHB 4D9QE 3PAUA 1TVHB 2EDYA 2NUPA 2JF1A 2YAHA 3BLPX 2E47A 4U05A 5EIIA 1TQVA 2RQEA 3LKSB 4PJFE 2C1PB 5E23A 1VKXB 5GS0C 2JTYA 3GZOA 5J1AA 2F61A 1YYLH 1JGVH 2G3XA 2BSEA 3QXVA 5D7LE 2N01B 3IN0A 4J5VA 1E2VA 4A2MA 1IBBA 5TE4L 4ZPTA 4LNRA 3D0LA 2VAJA 5H35A 3LN5B 3EF4A 4QRPE 2YPKB 1OHQA 4HEPA 4YHZL 1TO5A 2W9LA 5GSRB 3GI8H 5I1HL 4LEOA 4LLQA 4OIAA 4ZUUA 1L5GB 1WBYB 2ED8A 4Z7UA 3UZQA 5KYYA 4DZBA 1CR9H 3QUXD 3SBWA 5A2KH 5C0CE 5J1TC 1P7HL 2OXGA 4WWKC 3KGTA 1LO0H 2KLRA 5IK3A 2XZCH 2NNRA 4LSUL 5GRVK 1LP9F 1N10A 2ZXGA 3DOSB 4XCEB 1J1OH 2R2HA 5DDHB 1F6AB 4OZGF 1ACXA 4KRMB 3IB4A 1A3QA 3LVTA 3QHZL 3D9AL 2EH8L 5AENA 4YSUA 3OAWA 3TC9A 4DUWA 1OOAA 1BZEA 2EILB 2NXYC 4HD9A 4GQ9H 4R7XA 5A2BA 3FFDB 3SQBB 2ZWYA 4ABQA 3VYPA 4GG6E 2MNWA 5TDOB 2B4CL 3T04D 4ENZA 1HI6A 4WHTB 4GMTL 1CGTA 1NUFA 1PJWA 1Z9SB 4FXGC 4DQOL 3U46A 4B95C 4NI6A 3RPIB 3MLSL 4YUEL 2OMVA 3MRCA 5D1XE 2PWEA 2VJXA 3LXUX 4AMKL 1CDIA 2F8OA 5JA8B 4TPRH 1YHPA 4PJDB 4MTMA 5DS8B 1BZ8A 3CLEL 5CWSB 3BO8B 2KDYA 5DUBA 4JO8A 1A6TB 4NHUB 4KDVA 3PABB 3PYCA 2VH5H 2VN6A 3DDFA 1W16A 4JLRA 3PWNA 1VPOH 4KY1H 5GZNA 1CN4A 3WTYA 1IGTA 3BUDA 1S5IL 1FSKB 2YPVH 3RWHB 1XD1A 4RFOL 3RWCA 5EFIA 2IBZX 3MRRB 1AQDB 5HDQH 1J5OH 5E1HB 2VDRB 5CINL 3TO4B 5C09A 1U8JA 2DW5A 5MEPA 2F5AL 1UM5L 1X7SA 3ISYA 1UZ6E 1XL6A 2Z64C 3KCPA 4QRRA 4Q2ZA 4L1LA 4PCKA 1SGKA 4IBLT 4R7DB 2CGZA 1YYML 3S4SB 4J4PD 4YDJB 2YEQA 4ZFQA 4E9QA 1Z0NA 1SVBA 5HVHC 1Y0LB 3MV8D 5E51A 3IMUA 1TKWB 3IJSA 2XHNA 4NZUH 4WI7A 4HJ0C 1YPZB 4KHXH 1A6AB 1H3PH 4QT5B 4ZW3A 4H20L 3PP3K 4Q7DA 4JFFA 4X7CC 5F9WC 4PV1C 5D2NC 2CDGB 4OQ1A 4U3SA 4IBSA 2HT4D 3MTXA 1RIVH 1KCRL 1P5UA 1MVUA 1N18A 3L1EA 3M1OA 4W81A 4AEEA 3VD3A 3SGKC 4XN8A 1DQDH 4ZO8A 1YJDH 5FA4B 4F33B 2VERA 4ANUA 4Q89A 3VWJD 1KN2L 2CRZA 2ICWI 4L1BA 1DBBH 3LKPA 4LZKA 2GBAA 3ARYA 3K80A 3VXSD 4GSXA 1CGSH 2J72A 1I9JH 2E3VA 1T1WB 3T0EE 2R0WL 3NFPA 1EMTH 2NZ9D 3QXTA 2CR6A 1OXYA 2QMKA 4UUJA 3U9PL 5DMJB 3BSZH 4FP8H 4PY7A 4R8WL 4YO0B 3HMWH 1NKOA 2TSBA 1HHGB 1I1AA 4JHZA 3U1SL 4WW1B 1BJMA 1CPUA 5I8EB 4NM4L 1MDAA 4UQ2A 4MA7L 2FK9A 3Q8EA 1CLYL 1R5WA 4N5EC 2VR8A 1NMAL 3N04A 1QBBA 3ARWA 4RIRB 3WENA 5IOKA 3ARDD 2OI9C 4U3CA 1X6LA 4P5RA 3F7VA 4BFJA 1PG7X 2KZWA 3QRLA 4C4KT 5CSZB 5DD0L 3VI4B 2UY6B 1KIUA 3QZNA 1UZ8A 1QFWH 1CYXA 1OPGH 4BZ2H 3MZTA 1FFTB 4AXWB 2WQAA 1FHGA 3LNDA 4OZHB 1L4IA 4BQ6A 1HEJC 4M5YL 2NX5A 1DFBL 1K2DA 2IVFC 5E8DH 2C34A 1J05A 5I71C 4RA0C 4X80L 2HKHH 1M6UA 2ZD0A 1P1ZB 4PEEA 5L2KB 3HHSB 1ZPLA 1J9CT 2FLMA 2IQAB 4XPAL 4O2CB 2QV2A 2CR3A 3CQQA 5T1LD 5L9DL 3ZIMA 4JMXA 3FRPG 1GOHA 3NFNA 4XMZA 1QTSA 3KL5A 4HSQA 4JFZH 2AQ1A 5KVDE 3MC0A 3CCHB 4DN4H 3CZLA 4RNRB 1FWXA 2GBTA 3JWNE 3MV7B 3X12B 5FLUA 25C8L 1Q9WB 3NIFF 4MS8C 5IROD 2FHBA 4LE8A 3SDCB 2EUXA 4BKSC 4M7LH 4UM8A 3FFCE 2ARJB 3O2DA 3ROOB 5T1KA 2VM9A 4XPHL 5BRZD 1RK1B 1XSJA 3HG1D 2XIIA 3TEXA 5I1GH 5I15L 4EQ3A 1RUPL 4NS0A 2CAKA 1YNLH 1F4XL 3OL2A 3WFDL 5EV7A 1JI1A 1SHWA 1GL4B 5IVXE 4U1GC 1IVLA 1CGUA 3I2CL 4AY0A 2E76C 4NRXA 2LV4A 3RG1C 5C08A 2VLJD 3TA3A 4IRZH 3OKYA 4MNQD 3VFPA 4JG0L 4BUGA 1L6ZA 1ZHBB 1MW1A 1D5MB 2XTJC 2H2SD 3HZVB 3APCA 1ET8A 1XB6A 3BVDB 1GXEA 2FYVA 5AW4B 4BZ1L 3DUHA 2EE2A 4E0RA 3E80A 3GHEL 1FL6A 5K59E 4FMVA 3OXSB 4DESA 4N22A 2A74C 1ZLWK 3T77B 8FABA 1OT1A 1W91A 4ZMLA 1FAKT 1UWXH 2UVEA 5KSBE 1QBLH 1KYUA 2AQ3A 4I87A 3WUWG 4FYTA 1BX2B 1TETH 2H47C 1YEDA 4Z7WE 1M53A 4CSZA 4D8PB 2E7MA 3TPKA 5KYUB 1EQWA 2YQ2A 3OQ3B 5KS9E 5EOCJ 3S48A 3LIZH 1BBDL 2GSGA 2JJTC 1W72B 4WQOA 2Y3AA 4GAYB 4YL4A 1OWRM 5GRVL 4XVUD 2B15A 5K9JL 1DEDA 3S0PA 5GHWH 1M7DA 3D4CA 3MJ7B 1ZOXA 3VXMA 1Z32X 5LG6A 3NCBB 1UGNA 4GAJL 5BS0D 5CGTA 5FGBC 2VLRB 4PJHE 5DMGC 4MQXD 1FNEB 1KCVL 5K9QG 3LPWA 4M8RA 5D7IB 1CTOA 4TUUA 3DSFH 4Z8FH 4AE0A 4B0MB 1XQ4A 1DQIA 4JGUA 2WD0A 4GAGH 6PCYA 2RGSA 4HHAA 3DVNB 1ZV9A 2NW2A 3RUGE 1JGLH 2FEJA 3HE6A 1R3LB 4M29A 1BFSA 2EQDA 5SWZB 5I8CA 5FUCE 1ZA3A 4QRFA 3BGMB 1BOYA 2FIKB 4YDIL 1Y18A 4YHYB 3QPKA 5INDB 4DH2A 5C0IA 1YMHB 2ADJA 2AK4A 2BHYA 3E6FB 3HBGA 1X5AA 3ABKB 5T33L 3NTCH 5L6YH 2X70A 1WZAA 1I3RB 1Z3GH 1A1OA 4OCMC 2IMNA 2RIKA 3B7RL 3GD1C 4PW3A 3VFRB 5HYFA 2GVYA 3IBEA 4UOQA 4PTTB 2D9CA 3PXHA 4HH9A 4MYWB 5HHME 5CJ8A 3GI9H 3OKMA 5AVSB 3MUGB 1U93A 1VA9A 1JGUL 3VWKC 2R69L 3BVXA 2X4OB 1QA9A 1EUTA 4NO2B 5CEYA 4KROB 2BY0A 5DUPH 5D8JH 5AW2B 4M00A 3SPHA 1HOEA 5IT2L 2NY6C 4AQOA 2QADB 1HJCA 3FTGB 3QEHB 4R2GD 1B0WA 1GGCL 2XPGA 4LVHC 3PUUA 4M6NH 5JIQA 1GTNA 4LBEA 3QWQB 4LAQL 2B08A 1ITCA 1HH6B 4HUNB 4ZUTA 4ONFL 1KEML 4K7FA 5AKTA 1U2HA 5ICYA 5DVKA 2IBZY 1N0XL 3A21A 4ZQKA 3T65B 2H45A 3TH4T 3ZRCC 5EHFA 3W9DA 4XN5A 1HIML 4QXUH 1C9SA 1QRND 3BKCH 2GCYB 1IEAA 2BVYA 1IKNA 5GISH 5EUKA 1GGTA 2D7TH 2HLFC 4K8RD 3OAZH 3H85A 3WJLC 3IPFA 5BOZG 4K0OA 2CJUH 3AXIA 1IGYA 4RWHA 1TQWA 3QULB 1HZHL 1JWMA 4LLWB 1EHXA 5BMFL 4OF3A 2H0PA 4X5XA 4X5WA 5C97A 2WW8A 5IHWA 1A4AA 3QORC 2R56L 1E8ZA 5J12B 1TU2A 2VO8A 4FHBD 4WENB 1Q9LB 1MWAA 4HPOL 1QR1A 4XNMB 4MNHA 5L8LB 2F08A 2JB5H 4IBZA 4LPYA 1JPTH 1Q38A 4J3VA 4L3EB 4TRPL 3IFPA 3SCMB 1AR1B 3TBYA 2OMYB 5TE7H 2YD4A 3VD9A 3DX8B 1AQKH 1VFAA 3T3MF 5GGVY 4Y4FD 4AC4A 1OM9A 2FX7H 2ZICA 5D72L 5KVGH 1ETB1 2IG2L 2A6DA 3I50H 4DP9X 4X6BA 5SWSB 3PUCA 1OGSA 3ETTA 4FXKA 3F5WA 2ZPKH 3VX1A 3PE9A 4UM9A 3EDDA 4H25A 4J4PA 4H5SA 5TDPA 5ID0B 2W0FA 3KWVA 1B88A 3GTTA 3MV8A 3QQ3B 4DP8X 1CICC 3MFFB 1B2WL 4DFHA 1YPZE 2A9CA 3AREC 1T89C 5ES4B 3LN9A 1J8KA 2FX9L 3BWUF 1FFOB 4UB0H 4GKLA 3B9KC 4LCIH 4APXB 5DJCA 1SJXA 3KPPA 2YPLA 2OCCB 3HPJA 4MB1A 2WTPA 3O11A 1KLGB 1JJUA 3PQYA 1S3KH 3VMPA 3EJTA 4AENB 4MASA 2BY3A 1PJ9A 3UJIL 3B43A 3Q7JA 4Z5RA 3ILEA 2CLZB 5C0DB 5DMIH 4P5TD 5CBAA 5BV7B 4KVNL 1IGFH 3BXNA 4HBCH 3CFUA 4NZTH 5BZZA 4F9PA 1JF6A 5F2FA 2FHFA 1J5CA 1L9SA 2IOOA 1PLGL 5LO7A 5B4MD 3FMGL 3VWJA 2BO0A 3PAZA 4P5KB 1OAXL 3BN9C 3CJJA 3V0HA 1DQTA 1XFPA 4W9IC 5AB9A 5IQ7L 2HJFB 3TCTA 3QC6X 1QLFA 4HDIA 4OJFH 4TULL 1ZPUA 4S2SA 2J73A 2XLLA 5ANMA 4HG4K 4JFPB 4WU5B 4NC1E 3IDYB 3QFJE 5IZ7A 4DVBA 3C12A 3B83A 1LDSA 1PKQE 5JW5A 4B9KC 4P4KC 1KYDA 2X4QA 3PP4H 2J8UF 2VLLA 3P9MB 5F9JB 4H2CA 4G83A 1LD9B 4JHWL 2OMTA 3ATAA 1E50A 2H3NA 4IMKC 4MLSA 1BVZA 4NHCH 4UTBH 5C0FA 2EEFA 5IQ9B 1OKEA 3H0TA 1GHFH 3C6SB 3IMSA 5DJXB 1FG9C 4YSCA 4Z6AT 2CKBA 2OW6A 4FLSA 3REVB 1UJ3B 3EBIA 3UERA 5L88H 5B38A 1TR7A 4YBQC 2W9EH 4YE4L 1S9KC 3VI4E 3I9AA 1AC6A 4F37K 1I7RB 1WWWX 2AGJH 1ZT1B 2OSWA 3SE9H 5E8OA 5E5MB 5E00B 4FCAA 4P3DA 2PO6D 2W0PA 5GGSA 4L29B 4OZHE 2Q0ZX 3VRLE 1YY9D 1P4LA 3EKCA 3FH7A 4GQZA 4N2GA 2FGWH 3A47A 3EOTH 4YFDB 3EG9A 1W8EA 1LEIB 4MAYD 5IHLB 2UUDH 2J2ZA 1BFOA 4NZRL 3QR0A 5F1IB 1N5YL 2MH4A 3C09B 3EJRA 3OZLA 2PPCA 2IAMC 5DD1L 4DKEH 1XV8A 2X4TA 5DJDB 5GRJL 1K8DA 5HVWA 4FXTA 4K5MA 5T1LA 1V10A 5HHPB 2OXHB 3V7AG 4B3VA 2M2DA 5F7FA 3MV7E 3SPGA 1KBGL 3D51A 4WV1C 3TCXA 1NH6A 3SE6A 1LM8V 3BUQA 3OGOE 5HJ3B 4R4BA 5L4IA 3W9EA 5L2JB 1XBRA 5GGSY 4IMLA 3WIFB 4RGMC 1GZPA 3VACA 3FRUB 3VGAC 5TPWL 3FB6B 3UTQB 4I1PA 1IL1B 4LEBA 1H3UA 3K0WA 3HS8A 3RGVB 4CADB 3MJ8B 2IC2A 1P84K 2IH3B 2HZHA 3I74A 4HS8H 5DJYA 4FQJL 4BEIA 3CGTA 4B6ZA 1Q0YL 4MXVE 3DK0A 43C9B 4QMEA 4UQCA 1R19A 3BSGA 2QVMA 4U3HA 4ZTOH 4RFNB 3DMMB 3EGXB 2CPUA 5D2LF 5IFHH 3NN8A 1OCWH 1OCZB 4HXBL 2HXAA 2VLJA 5C2UB 4QKTA 4HHWA 4MNQA 2VN3A 3WIAA 4PJXB 1XTMA 5IGXL 2DLHA 4QHNA 2J6EL 3VSUA 1KZYA 1J10A 1MCOH 1D5XB 2BSTB 4PB0L 4CJ1A 2AJSH 4L3AA 3KHQA 5KUMA 1NKRA 2X4PB 2FSEA 5AQ0A 3QO0A 6CGTA 2IBBA 1JXKA 1CLOL 1E27B 2FJFB 1AYOA 2BNUA 2XACC 4NB7A 1VERA 4FLOA 5J4MA 3OJDA 2H1LM 1LEKA 3TFBA 2NY4C 1IIIA 4JRYE 4FG6D 1FGNH 1MCQA 1TMQA 3B56A 5DQJB 3QDAA 3IU4H 3K8LA 3TA4D 4WSJA 4OZIB 3LRKA 4AV0A 4Y9EA 1UWEH 2WVSA 3O3BB 3PG2A 5EO1B 5DC4B 3O45A 3EH5B 5DZ9A 1XVSA 3AQYA 4HKXA 1CDGA 4FABH 1RZJL 3DC0A 3EZJB 4JFTA 1C08B 5B1CA 6FABH 5D71L 3FH8A 1UKTA 2J8OA 4K9EC 1PLCA 1UFUA 1SY6H 3DVGA 3X1BA 1NEUA 1FE8L 4LVNC 5BS0A 1OAYL 2QSCL 4UU9B 4BFNA 2PPAA 3P3UA 4B27A 3KNBA 1N7ML 4MJ4A 4XC3H 3LV3B 3AT8A 2GITB 3NJIA 3H3BC 1EUUA 4JL2A 1U8PB 5FGRA 4AEIL 1BIIB 4A7UA 5KSAC 4I3RL 4OFVA 4N87A 3CX5K 5SWZE 4ZFOA 2BCKB 4BH7B 5LGHL 2COQA 3FSZA 3LDBB 5FKAA 4GG6F 1A14L 2IXQB 3ESOA 3H9HA 4NO5A 2E7LC 1EZLA 1S7SB 2DQUH 1SLXA 2BZDA 2ZXBA 3NJNA 1IC4L 2P43B 3GSNH 4MQSB 2BERA 5IG7B 1UH2A 1YAZA 1U3YA 5EZJA 5C0NC 5I6LA 1V55B 3BP5A 5CLXA 2L7EA 5JR1L 3LQAH 4YBHA 3ZE0B 1NC2A 3O2VL 5D9SA 4EIGB 1T80A 5BOJA 4LHJB 4GYBA 1NGYA 4WWNA 1KIQB 2Q2LA 3OKKB 3LEVL 3QQDA 1SXSA 2CIKA 5E8EB 4L3CB 2CJ3A 3D30A 3EO0A 3C9NA 1INQB 1AYRA 1KXTA 3KYKL 5FGCB 3ULVE 1DBAL 3GEFA 3HAEH 1EEQA 3N1QC 2ZKHL 3CZNA 5IR1A 1N4XL 1E8XA 3MCG1 4MDJB 4WSGA 2VR7A 1G7JB 2BSCA 3T6VA 2VABA 3AWFA 4EN3D 3QDME 3O6ML 5G2NA 2G2RA 4HETA 1FN4B 3SDXE 5I75C 1A9VA 3QIWD 2EC8A 1MJJA 1N6UA 1H5BC 2ZAIA 2P26A 3CSGA 4DSYA 2A7BA 4JZJC 3S35H 2KPWA 3PWJA 1R3JB 4GW4B 2ZUXA 3EHBD 3QS3A 3EBGA 4MXQC 4JR9H 1IJ9A 1DSYA 1WAAA 2EIMB 2NNAB 1SOQA 1FQ9C 2XUWA 7FABL 2JJWA 1TFHA 5DK2A 1CI5A 1JHTB 3MRKB 3PRZA 5H2BB 3EOYG 2YUWA 1U8MA 2F5BL 1QRNA 2CUAA 3UBXI 2H9GB 3SQOH 5CD5C 4RGNE 1C1EH 3FPXA 3RURA 3HPLA 1A64A 2VMEA 1NDMB 3TT1H 3D3VB 3QNYA 4JPWH 3D39D 4CN6A 3P9LA 1QR4A 3FQNB 1KELH 4ERSL 1FO0B 3MOAL 4XNUH 1GGUA 4OSUL 5JDSA 1CF8H 1DLHB 4YOKA 3TWCL 4L37B 3GMPA 2HX7A 3P0VL 2C3HA 2VZ3A 1BQSA 2EDJA 2AEPL 2VRAA 5CP3H 4OAWA 3TEWA 4E2OA 3VD7A 1PF3A 1E5UI 4WDIB 3KWTA 1UKQA 2CM5A 4KTYA 4P5MB 1I8UA 4IRJB 4TLKA 5HHOA 4RMTA 3MRJB 2WGXA 1EEUA 2HRLA 1IM3A 4YS4A 2XWTA 5L4MA 1RZFH 3QDGA 4AJWA 5I6XC 2YAOA 2OMNA 1JIBA 3GXMA 1EEYA 3KH4A 1QASA 4PI2A 4DGWC 5I5MA 2UZXB 1JNHB 1UG9A 3OZ9H 5CILL 1KPUA 5C0EB 2AANA 5E5LA 4TNVF 2X6UA 4AIZA 3BPNB 1YN7A 3MV01 5AW5B 2VQTA 1UTDA 3DO7A 4NN6C 1HSAA 1DN0B 4CGTA 2F53D 4UWQB 1L9MA 5E4EC 3ABMB 4DFIA 1RZKH 2PLTA 1UWFA 3GSNB 1IFGA 4GRWF 5JPMB 3GSWA 1XMWA 4P2QD 4P9HH 3GXIA 1KCUL 1A9BB 1YDPA 4XPBL 2IGTA 3TVMB 2YRLA 4P5TA 1DDHA 2D3