3HG1E

Germline-governed recognition of a cancer epitope by an immunodominant human t cell receptor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
244
structure length
244
Chain Sequence
SQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Germ line-governed recognition of a cancer epitope by an immunodominant human T-cell receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MHC class I antigen
total genus 41
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hg1E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hg1E01
1C5DA 5D70L 3RI5F 5KANI 4AEEA 3WNOA 4M7LH 4L4JA 4M93B 2JCCE 5JW3L 4QOKE 4X98B 3VGAB 5BO1H 4JVPA 5C0GB 3QEQE 4L4TE 1M7XA 3HI5L 1LK2A 1J8HA 5KTEH 3C6LB 3L3IB 4FQHA 3WFHB 3TC9A 2IPKA 1U58A 4FQJL 1QSFA 5FUZH 4UQ2A 1NBVH 3QPXH 1S9XA 4MXQD 2OK0L 1J18A 3ARTA 4FQQA 4KK5D 4DZBB 3CUPB 3T0EC 1LDSA 2XRAH 4IMLA 2XNAB 1EBAA 2HP4A 5L6YH 2JK5B 4DUXA 2BY3A 2YD4A 4P57A 1QFOA 3EO1B 4NOFA 5FV1L 1EVTC 1NUDA 2I07A 4KI5D 3W39B 1OAQH 3LEXB 1OL0A 5EIIA 4XBEH 3BSZH 4I2XA 1YYLL 4OQTA 1P4LA 5IB2B 4PJGB 2N56A 1Q9LB 4TVPL 5J3HC 1ZA3A 3OX8B 3MLUL 2BC4A 3OZ9L 3GMQA 2YK1H 4WW2F 4YQXL 4L8SC 5DD6B 4I0KA 1ACYH 2Q7NA 43CAB 3MUHL 5DQJA 4BQ9A 4O2EB 4W4OA 4ODSL 2H1PH 3HZVB 4RFNC 4KKAD 1OOAA 5JA9A 3ZKMC 3BVNB 3VD4A 1KIPB 3HPLB 1QBMH 1BMGA 4YHZH 1NMCC 3D2UA 4HKBA 4TUOB 2VXQL 5J12C 4G42B 4PTTB 3ES6A 3GBLA 4IHOA 3FT4A 4G6AC 2AI0H 2K3TA 3ARPA 3KYNB 5CZXD 4G8IA 4LCIL 1LK2B 4WI7A 2NY1B 3QIBD 4MJ2A 2ZOKA 5DXWA 5IB4B 1I7RB 2GTWA 2XZZA 3P30L 2ZOLB 4OM1L 2HWZL 3KYKH 2R69L 2XQBH 4OM0L 3TWCL 3LAFA 4JE4B 1NCCH 2EO9A 4UNTA 3SE8L 4E0RB 4K3GA 2V2WA 2EDTA 4JN2A 5E7BA 1KXVC 1FNSH 3HC3L 4HIJB 4RGMB 4GMTL 4CVWA 3OXRA 3I9GH 4KJQC 4LHUD 4LU5H 3S4SB 3WHE0 3AC0A 4QYOA 1HYRC 3OB0H 5DD3H 1PEZA 5D71L 5KN5A 2PR4H 1VKXB 2HMID 1CT8B 3BRFA 5JOFB 5KW9L 2Y6SD 5A3ID 1G0DA 1OTTC 1KJMA 3SY0A 1PKQE 1UWEH 4XHJD 4ZO6A 3RRQA 2UV3A 1UCBL 2ZJSL 4PJBF 1JK8A 4LLVA 5C0CE 1A4JA 4X9BA 5TDNA 2F53D 3V4UL 5F89A 2DKSA 2FL5A 5EZIH 4Y16A 4XVSL 3WUZA 5CBAB 1I8LA 1YEFL 2B1HH 3BDXA 5A2FA 2OR9H 3L6FA 5C6PB 2HTKD 1DBAH 4HGWB 3BW9B 4NO0A 1EGJH 3F7QA 3QH3A 5KJRL 1WJ3A 5F96H 5AG8A 4GG8A 3REWA 3EYVA 1DBJL 4HJJL 3L5XL 5KVEH 1F3JA 5KSUA 2D03H 2C3GA 2YR3A 3JWDH 3KLAB 3QG7L 2ADJB 4ENEC 5J89A 3KR3H 4S2SA 1AI1L 2XKSA 5F7EL 1BJ8A 1U8KB 1HSBB 4HUVB 3EOYG 4OD2B 4JFEA 3WFDH 3O45B 1KIQA 1A7RH 1OAUH 3M07A 4ZDHA 2EKSB 4HIIA 4XVTH 3C08H 2ATKB 5FA4A 2LQRA 2OJZH 4GAYB 3ARBB 2BC4B 3HNVL 5I1KL 5CZKA 4WWID 5EO1A 4X6CE 2ESVA 1KJ2L 5EUKB 3VXOA 1UM5H 4X83A 1WAAF 4M7ZB 5IQ9A 4RWHA 1BBDH 2NY2C 3EUUA 1FVCA 4PTUB 2NCMA 4H5SA 4HPOH 4N0FA 4C56B 1A1NB 4OZIA 3O8XC 4MCYA 2DS4A 3GBNL 2Q8AH 4D9QD 5GIRA 1FG9C 1OAYH 1WV7T 3NZ8B 3GRWH 5A3IC 4XC1L 5DRWA 1MFDH 3PJSA 4LQ1A 1Z3GH 5DT1H 3FMGL 5EZOL 2Y36L 2AK1L 1YQVH 5FFLA 4MAYB 2Z9TA 3CK0H 4UILH 4WEUD 1NH6A 4LBEA 2G75A 1LVEA 4QRUB 1YEKH 3H9YA 4YE4H 1ORQA 4C59B 3CCHB 5JXAL 1IGFL 2ZP0T 1OAZH 3UBXB 4P2RE 1RUQL 5B38G 5L0QC 3HB3C 5DZOA 3IRZA 5ACZB 3RVVC 3F7RA 3C2AL 3QNYB 4FFWC 5BJTA 5C0CB 3HI6L 1SMAA 4KPHL 4JO2L 1MCWW 5D93B 3O3EB 5E8EB 2V2XB 2YMXH 3L3GA 12E8L 4UIKL 3DIFA 2V17H 1NFDE 1JTOA 9CGTA 3NVQA 1UJ3A 4H1LB 4XP5L 3VD3A 1XF4B 3OR6B 2X4TA 5ESVA 4OIIH 1ZSDA 3O2DA 4NQEB 3NACH 4JFFE 3ZT5A 1FVEA 2BVEA 2YN3A 1ZLSL 4PJ8D 4PJ8C 3ZL4H 4AG4H 3D48R 5HYFA 3OKNA 5HYQB 3KS0H 1PGRB 3O2VH 2GFBA 5C0BB 1RJYB 2C3VA 1FO0B 3T65B 5C0JA 5I71C 2BHYA 2JELL 4MJ4A 4OT1H 2G9HB 4TSAH 1R3LA 3BUYA 3U0TA 3ULUE 4M7KH 4Y4FD 5E9DD 3A0OA 3FB8B 3BIAX 3UJTL 3RNQB 1V7ML 5C0AD 2LTQC 2CLZB 1CBVH 4Y5XB 4YQXH 3ALXA 4U1NA 4Z7OF 2G9HA 2VZSA 1UWXH 2H26A 3GHBL 3O6FB 4XH2A 1CWVA 5IMKA 2A77L 4JFFD 2R29H 4XXCC 5DJ0A 3UX9B 1YN6A 3F7VB 4S0SD 1DQLL 1S78D 4EUPA 3CSYA 4ODWA 2ITCB 3WHXB 3WFBL 4DGYL 4MNGA 1DEDA 5C1MB 5ALBH 5EA0L 5EBMA 4M1CC 2PTTA 3V4PL 4F57H 4B53A 3N85H 4JKPH 3DURA 3WEXA 1TZIA 3C09B 4PLKD 1MF2L 1FHGA 2ATPA 4JRYD 1J11A 3D0VA 1FPTH 2NZ9C 3JUYA 3QXAB 5C0NC 4UUJB 1BGXL 3T0VA 2AABL 4PY8I 4YHOH 5CJOL 2VXSL 5FB8A 4Q6IA 2WINA 5FGRA 1ORSA 5DC4B 2WZPD 4M62L 5GS1A 3G5VB 3O9WC 4PJEB 4QLRA 2H3NA 1NAKL 4EN3A 6CGTA 3BEVA 4BQ8A 1FNSL 3HC3H 5FUOL 1FYTA 2IMMA 5FGCE 5SV3A 3JTSB 5D2NC 5F3BA 1HHHA 3QXUA 1KGCE 1DEEA 4WV1A 4L5FH 3MRFB 5KVFH 3KXFE 5ENWA 2DIJA 1Q0YL 1K3IA 4KK8D 1EDQA 3REVB 4WU5B 1KULA 4LLAA 5EORH 3TIEB 2JJWA 2GEEA 3ARUA 1ITCA 4XVJL 4IEFB 4NCC1 1IC5L 5D7IF 4NWUH 3U1SH 1CE6A 3N9GL 4P2OC 5E8OB 4RAUB 3QIUC 5AAMA 3U7WH 1B3JA 2YZ1A 4MSWA 3VFRA 1OP9A 1MRFL 4YBQD 3P2TA 2WK2A 3WE6A 3QO1B 1IAKA 4ZUTA 2JJTC 4EOWH 2D9QB 1B4JH 3T4AA 1KCVH 3ILQC 2AJVL 3QHFH 1L6XA 3PIQA 4M3JA 4K94L 1RAMA 3QCUH 1GGIL 4TN9A 5GJSL 3X11A 2YUXA 1X6LA 2F53A 2GJ6B 5FAAA 5I1DB 2NY4C 4DGIH 2FIKB 1OAXH 4NCC2 5DK0B 1OTUC 4L9LB 3QDMA 4D0CA 3T4AB 1UKTA 3RWHA 2ADJA 1WCBA 3UPRA 5IK3B 3T4YA 3TBWA 2X2YA 3QUYB 3BX7C 2B39A 2IH1B 4M61B 3REWB 3PXHA 3MODH 4O4YL 1SVCP 5KSAA 1ZT4B 2PXYD 4PYGA 3MJ9A 4DVRL 5IW6A 1CYGA 3I50L 1BZ7B 3O9WD 3SKJH 4D8PA 3NZHH 3SQOL 2B1AH 3G6AA 3IB4A 4CAGA 1PVHA 4JM4H 3V0AC 3VMOA 2YPKA 2DQIH 4U7KA 4D0DA 3KPRE 1NLDL 2VUOA 1X5XA 4RQQA 4NO2B 4I4WB 3UZQA 3S37L 3OQ3B 1HCVA 3HMWL 3KVQA 5JHLL 4ODTL 3LPGA 4MNQD 2QL1A 5DRXA 3G6DL 4K3HA 4F57L 2WIIB 3MV01 5JDJA 2ZPKH 3W2DL 3MZTA 4G8EA 1FNGA 3MOBL 4QYOB 1EHLH 4JKPL 4UOW0 2Z8WC 3KYKL 5D5MF 3VFMA 3K2UL 3MRGA 4PRNA 3O8XB 3TWCH 5E5RB 4DTGH 5D7SL 4ZAKB 4QGYA 2AABH 5IEKB 3S9DB 2B2XL 3G6JF 4LKCA 1NAMA 4LNRB 3V5HA 1JIBA 3MRQB 2C1OA 1CL7I 5L7XL 1CDUA 4NN6B 4FFWD 4PPTA 1NBYB 1FLTX 5CKGA 4P5MA 2CPCA 4I18A 5JZ7D 1RZGA 1Q8MA 3UEZA 1GC1C 4P9HH 4PJDE 4HWZA 3S88L 5T3XL 3IDNA 2ILLA 1FSKC 1MI5D 1I9EA 5CP3H 4A6YH 4IHOB 3MV7D 1BX2A 1AQKL 5C2UB 1KELH 3VWKD 3QH3B 4OLYL 3NFPB 4K71B 4ZPVA 3FFCB 2R0LL 3BQUB 2R4RH 5BZWB 4GXUM 2OYPA 4LCYB 1TJGL 5L2KB 3RVXC 3OF6A 5I1HL 4WI4A 3OB0K 1BOGA 4X80L 1NGZB 5F97E 4RDQF 1MFAH 1IGIH 4EJ1C 1CGSL 2EYRA 5EC1A 4WVRA 3SOBH 4DEPC 2YPLD 1F42A 4IMKA 3CVIL 1LK3L 5I66B 4G3YH 3OKMA 3T0DA 2D0FA 1QLEH 3K2MC 2VXTH 3S36X 4OUUA 2FX7L 2YRZA 1E4XH 4J3WA 2PN5A 3S36L 5ETUA 2DKMA 4XNMB 1NKOA 3H9HB 3OJVC 4DGIL 3WFDL 5C0CD 1I85A 3MACH 3WIHA 2F53E 1ETZA 1GSMA 1KJVA 3PWJA 3VWJB 2BRQA 3IGAB 3VFVA 5ADPH 3CFJB 32C2B 3C5ZD 4WFED 4KKAC 1IKNA 1DANU 4P2QD 2APVA 1CFNB 2VDOH 5T1KA 2Z93A 5IIEA 2V2XA 3IFNH 5HYSG 5TH2B 2P8MB 4CJ1A 5ERWA 5ADOH 3BO8A 3ZE0E 4NO3A 4CW1A 2YA0A 1KJ2H 3J7HA 4IRZL 1IQWH 4XHJC 3QFDA 4KH2A 4K3EL 2VUYA 1U91A 2JE8A 1BFVH 3WIFB 1IGYA 1W0YT 2HTLD 2X70B 3KPSD 3MRMA 3CFIC 4QOKA 2P8LB 1R5IA 2VIRB 5FHBL 1LO2L 4MJIE 2ICWJ 4N90E 1F2XK 3O4LA 2E7LC 3MA7A 3Q48A 3IFPB 5DLMH 5IJKA 1A0QH 3CK0L 2ID5A 5I30H 1TQBC 4L3ED 2H2SD 2DBLH 5ICZA 3IDYC 4HWEL 1WISA 3PGFL 5DA4A 3T3PE 2K7PA 3DHMA 1BP3B 1RULH 1HEZA 2LFGA 5KVFL 2JCCA 3BXNB 3I3BA 2FJFA 3V7AE 5E4EC 5KOVC 4KFZC 3WUWA 25C8H 4P3DA 4MX7A 1N7MH 2VIRA 4XPTH 2FBJH 5F6IC 1DANT 3DVIA 2BY1A 3QXDA 3IVKB 2P44B 4KY1L 5GGVH 4NWUL 3U1SL 3SKMA 4JFYB 2DL9A 4DK6A 4NKOB 3Q6FB 3O45A 3HC4H 2OR9L 2XKUA 5BV7L 1T0MA 5IGXL 1ZLSH 4Q6YA 1U8QA 5A1AA 4FABH 1XT5A 1XR9A 4WTXA 4XCEB 5TH2A 1NGQH 3QCUL 3QG7H 1FZJA 4KJPD 4XCYA 1F3DH 5IHBA 3DYOA 3IYLW 4Z7QE 2F74B 3NCFB 2P1YA 4CU7A 2VOTA 3EFFB 5DD1H 2Y4SA 3WSQL 4MB5A 4O00A 2FO4B 5LGJB 4WU7A 5SWZE 5J11B 3QIBC 1LK3H 4I3GA 1OGAA 4I18B 3PABA 1QLEL 5HDQH 4P23B 4FG6C 1AGFA 4L9LC 5DMIL 1G9ML 3MRQA 5HVWA 3O41B 1CLZH 2P5WB 3WDJA 3BMVA 4HXBH 4TUKH 1A3LH 2M1KA 5F9OH 4WFFE 1B0WA 2XT1B 2D9CA 2YD2A 1PLGH 4JPKH 3MV7A 3UJIL 5E9DE 5GQBA 3FHQA 3NFPA 1U92A 3UTPE 4ZNEA 2FYYB 1FGVH 4OQTL 1YZZA 1MQ8A 4RX4A 2C4XA 3MCKB 3QHTC 2J12B 5I8OH 2VZUA 3ET9F 4XZUB 2FX9L 4HUNB 4I1NB 1RUKL 1BREA 1EHNA 1Q9OB 3BZEA 1D5BA 4O9HL 1ACZA 3MGOA 2MHAA 5CBAA 3FQXA 4DJMA 5TGBB 1BEYH 5HXMA 3DO7B 5C8JA 5CD3B 3QUYD 1JK8B 3HNSH 3EYQD 1FFRA 2NX5D 4OLEA 1NANI 2XTJB 2UVFA 1D5BB 4LKCB 1C12B 4OSUL 5IB1A 4KKBD 4BUHA 1IM3A 3OJMB 1J8HE 1T22A 2K9UA 5FIEA 3W82A 2DI9A 1XZ0A 2NY6C 4OFDA 3EYOA 3BH8B 3MLZH 1ZSDB 4JHAH 2NY6D 4KTEL 3X17A 2VERN 4LF3A 2VH5L 4ONHB 4JZNA 4RRPG 5DJ8A 3ARDD 4F9PC 2NY5C 3N06B 4ESKA 2YEZA 1O7SA 1IC5H 4UU9A 2ZG2A 1J10A 1DBMH 1LD9A 2PYFB 4CGTA 4O51B 4P0DA 3SGDI 3MA9L 2AERT 4BK4A 2E7LA 2AVGA 4PJ7F 5EUOF 3VJ6A 3ZT6A 1AGFB 2ZCHL 1FV1A 5HYEA 4YWGL 1BAFL 3IJHB 2UYLB 1EBPA 4DW2H 3GFUA 1KCRL 4R7DB 3QHFL 2AJVH 4GBXC 1CCZA 1ZE3C 3BDBA 2GYSA 4EQ2A 5IV2A 3FO1A 3WJLA 4PREA 5ID1A 1OGTB 4JFZL 1MFAL 1EFXD 2BVQB 4KV5E 1V7MH 4G8GA 5D7LD 3E1F1 5DF0A 1WUNT 3UO1L 1I1AC 4QRPD 3S34L 2NY2D 1F45A 1UH4A 4NRYA 4F3FA 4GXVL 1FN4B 3GIVB 3O6FC 4M61A 4Z0XA 3TYGL 1VA9A 2ED7A 3GI9H 1ZS8B 2BFVL 3QCVL 4MAYC 4PLOB 1AXTH 1G7JA 3SN6N 2LTQB 5ISZB 4CMMA 5ACLA 2BXYA 1C1EH 3VW3H 1G0YR 3JWOL 4MA8L 2JIXB 4LEOA 4FXGA 4F9LC 3LCYA 5HYSA 4Y4KC 4UAOB 2FECI 1TENA 1RUAL 5I71B 1I7ZB 1YEHH 5GS1B 4KK9C 3VWKB 3L3JB 4UT6L 3U0WL 5TJWK 3L5IA 5E6ID 5F7WC 2JCCF 3WNKA 1K4CB 5L2KD 3O2WL 1I1RA 2R2CA 5IB3B 3AXLA 1T2QL 3F5WB 3MRKB 1NC4A 4OTXH 3NABH 2A74A 3DRQA 4HIEA 3HTLX 1T83C 1RUPL 5CIPB 8FABA 5C0AE 2LAGB 5B38B 1K4DA 1VFBB 5IVXF 3G6DH 3FFCA 1EHLL 5ESAB 2ZUUA 4LLDB 3U4BL 1ZT7A 2PW2B 2GJ6E 3RUGF 1I1CA 4LPTA 3T3MF 3I6LD 4YDIH 5JPMA 5MEOA 3HE7D 1RZKL 1JHKL 1L7TH 4GBXA 4NQED 1U2HA 5GGQH 3TT1H 3TJEH 3O0RL 2VDKL 4LASH 5CJ5A 2IQ9L 5JHDE 4U1SA 4MA7L 3SCMD 3TT3L 4K7PH 5D72L 5C6TH 1F02I 4KK8C 2P5WE 4XXCA 3U0PB 2M8XA 4OJFH 3TPUB 1JFQL 4Y4HA 4M6OL 1I1AD 4LNVA 1HZHH 3RVTC 4XCNB 4JY4A 3TN0B 3TJHD 4CW1B 4YBLC 3H0TA 4OZHB 4PB9H 3V52L 2BVPA 1E28B 3OKLA 1P4BH 5D6DA 1CU4H 2IQAB 1F4AA 1IGTB 4Z7OE 1QBLH 3QQ4A 4PJGE 3BMWA 2XZCL 4PGDB 1WFOA 2XWJB 4JZNB 3S5LA 4E41E 1JBJA 1CE1L 3KNBA 5AYQA 2H32H 4QRTA 4M7LT 4V1DA 5EBWB 2IBBA 3RA7L 1AD9A 4NFCA 3TIDB 4JFFB 4J3SA 1YJDC 4UV7H 5E03A 1J12A 2L7JA 2RFXA 2YD9A 1BAFH 3SJVD 4NSKA 1OTUD 2UUDH 3B2UC 4DKDC 1CTNA 5I15H 4B41A 3NH7L 3S3PA 4PYHA 2AK4B 3GIZH 1S3KL 2BVPB 2ADFL 2R0KH 4HS6A 4FFZH 5JXED 5FHAH 3H9SA 1YECL 3CXDL 3HRPA 3C5JB 4ZTPL 1YEJL 1A64A 4OLZH 3UTSA 3CFCL 3LN5A 3OJDB 4AM0B 4H88L 4OCRH 4E41D 5C07A 5MHSD 5GRZA 3GMNA 4XP4H 4NQVA 3KPQA 2DQIL 4HBCL 3ZSSA 3NFNB 5DC9B 5EC2A 5I1LB 4MA3B 5EG6C 4LCWA 3ARGD 3Q6GL 4LCCB 1N8ZB 1NFKA 4C58B 5BVPH 4EI5D 4J6RL 1EVUA 4KJWD 4OGAD 3H42L 4JO4H 4X99A 3MR9A 4IRSD 1MFNA 4N8VB 1C5CL 5C08A 4QTIL 2XICA 5L2JA 2LE9A 4G6JH 4YO0A 1T21B 5E2JA 3CDYA 5HVHB 5FYKL 3QIBA 1AJ7H 3IXTA 2JJVA 1FVCB 4JQVA 3NA4A 2MFNA 4J3XA 3U46B 2AK4E 1I9RH 1R5WB 4XNUL 5DQJB 1A21A 1K8IB 3MRKA 2VQUA 3Q5OA 5CEZH 4KI5F 4N1CA 5FV2A 1KPRB 5I9QC 3MV8D 4HH8A 2ORBH 2VLRD 1EO8L 4M9OA 5I30L 3FT3B 4E5XA 4HIIB 3KYAA 4WI5A 5F6HJ 4Y88A 4P2QA 5SWQA 4X4YA 3S88H 4WHTA 1ZHNA 5EO0B 3TO4B 1T0PB 2B20A 3P4OB 1S9XB 3QUMH 4WTZA 3VU2A 1FZKB 2R2EA 3VDBA 1UB5B 4P49A 1I7TA 1P7KB 4D2NA 1R3JB 3SGEH 3KLHD 3MLXH 1GH7A 3H8NA 4U3CA 2HT3D 4BUGA 1EO7A 2UWEA 4TSBH 4ZO7A 3MRMB 4KUCD 3VI4F 3IKKA 2R2HA 1INQB 3ULVF 3V52H 4BK5A 4ZFGH 2X89A 3V8CA 4Q6IC 1CU4L 5GZND 2VLRE 3QQ3A 3KJ4C 3D1MC 3VFSB 3VFNA 3T8XA 5CP7A 2FL5B 3WJJC 3QUMA 5SWSE 3B9EA 2UYLA 4M93C 4HHAB 3KYMA 4PJ7A 4O58H 5KVDH 2NW2B 5DEFB 3GMLB 1A6AA 4PJAE 1ZLWK 3RWFB 3SDAC 3G9VA 5HJ3B 1EEZA 1MCBA 3UCRA 2EE9A 5L2JB 3JSSA 4JFXB 5CGTA 4GSDH 3KPRB 1IAIH 3R06A 3TYGH 4WO4A 3HZMB 4S2SB 2YKLL 1I1FA 1DP0A 2DQEH 3U36A 3EYOB 4JEGB 4H20L 3N1GC 1R6VA 2EC9T 1RIUL 4NKIL 3NIGF 4JGUA 2DD8L 1MFEH 4P2OA 5FF6A 3NAAL 4OUOA 1IM3B 3SDCB 3O81A 3LQAL 1FNEA 5K59F 5KG9A 4HXAH 3MNVB 3DECA 3LN5B 2P43B 2IPUG 2XG5A 3VG0H 1M7DA 2IEPA 3CX2A 3PWLB 1UYWH 3FO2A 1HDMA 3KPOA 3WBDA 5IR1B 2ZCKL 4XP4L 3G04B 1FIGH 5TGBA 3DO7A 3IAGC 2ARJA 3CGTA 1U8HB 3MUJA 1UM6H 5D7LB 2D2OA 1U3HA 3AREA 5I75B 2UZIL 3FONA 4U0QB 4MQ7B 3B6SB 4JCLA 1QSEB 3EBAA 2XZQH 2H41A 1KEML 1U36A 1U8NB 4OIAA 4WFFD 4BZ2L 1OSPL 3O6KL 4UDUB 2ICWB 2G5BB 4U2YA 3MV7B 2W59A 3IF1B 3LKQB 1IC1A 4RWYH 5HBBA 1K4DB 4KJYB 1WBZB 3D18B 4M02A 5DJCA 3QPQC 3VXMB 3JV0A 4MB3A 3TJEL 3PWPE 3ARXA 4XXDB 4CBPA 5KS9B 3PG2A 3PWPA 1KPVA 1OWRM 1G6RH 3BKMH 3ZTNL 4F7PA 5L2KA 1GGCL 3CD4A 1EO8H 2UZXB 1A6TB 4M4PA 2G5BA 1P5VA 1RURH 4PJHE 1MNUL 4KY1H 3F7PC 4YAQB 3SKOB 4IDLA 4Y16C 3GSRA 3FB7A 4FQLL 3DGGB 4PB9L 1IZJA 3TVMC 1CN4A 1RHFA 3DROB 4U6YA 4AIZA 1DBML 2R1WB 4PJ7E 4HLZG 1BVZA 3QUXB 5CJBA 3WFCL 3HCVB 1B2WH 1QFUL 3ALPA 1T80A 5HYIA 3FHAA 2FR4A 2XZAL 4G80B 1IGMH 2NXZB 2PCPB 3FQRA 3SO3C 5TE6H 2HYMA 3MLVH 1JYNA 5ESQA 1TCRA 3TEUA 5ELIA 4RCAA 3N1FC 4YHKL 3D39D 4G6AD 1LP9B 5F1IA 5B39B 4PRHE 2LU4A 1H3PL 3I85A 1KJ3L 3SCMB 2AQ1A 5L88H 3LRGA 3T77A 4FFZL 4QXUH 1LO3L 3ARBA 2DMBA 4GKOA 5E99H 1JNNL 3VWKA 1CDGA 3GSOA 2GITA 4PJIE 3VI4E 4NQSB 4R0LB 3KPRA 5EIIB 4JFXA 4RIRB 1N0LA 4NO5A 4OKVA 2HFGL 2NY0B 2YOCA 4LFHD 1E4WH 4AEFA 3E0GA 1OAKL 2GT9A 5BOPA 1MUJA 4UTBL 3HA0A 5EH1A 2D3VA 4DZ8B 1NJ9A 3MFFB 5EBLB 4FTVD 1OY3B 3H7LA 1LILA 1TVBB 4MSWB 4MJIB 5IW1B 3VFRB 3V0VA 2BRRL 3NCMA 1JHTB 3CH1A 3TBYB 3VXUD 1SM3H 5IW6B 4GG6E 3BP5B 5E2TL 4BSJA 5BRZA 1DQJB 3EYFB 4BSWB 3W0WB 1RJZA 2CO7B 4HCRL 3WLBB 3WIHL 1JCKA 1IFHL 3RL1A 2AJXL 3C5ZA 1J1OL 1MHCA 5E6IA 1WQVT 1WFNA 5T1MB 2DF3A 4Q7DA 1NKRA 1XGRB 3U79A 3QIWD 4KI1A 1C08A 1JZ5A 3MV9B 2RFXB 3PV6B 4XP9H 2GSIA 4HQQH 4Q0XL 4KUCF 4U6XB 2RAMA 1N64H 5EOCJ 2AJYL 4CNIB 2VDKH 3B8YA 1B6UA 5CWSB 2R15A 3CZFB 2VR9A 3UTPD 3MLWL 5D7KE 1WSST 4Z7VE 2MWCA 3ARGB 1X7QB 2YHGA 1V8HA 1FG2A 4Y5YA 5CEZD 3TBSA 1T03L 4LSPL 4EI5B 3WE6B 4L4VE 4JG0L 2FH6A 3AB0C 3OKMB 3MA9H 4LP5A 1YMHB 3QPQD 1HE7A 1GGBH 3KJ6H 4Z18A 4KHXL 1KG0A 2PXYC 3VG9C 3BD4A 4I9WD 4DKFH 4ERSH 5LQBL 2ATKA 3P0YH 4KGJA 4OCMC 2ITDB 4AEHL 1LO4H 5J1TC 1HCFX 2AQ3A 3MPCA 4ZPVB 5LVEA 3TZVC 1JGEA 1WLHA 3VCLA 4P5TA 3L1OL 3F6LA 1MHPH 3RA7H 3VMNA 2P5WD 3V4VL 1NGWA 3OGCB 4ZNCD 1A6UL 5DQ9B 5ITFA 1J8HD 3VXNB 1NSNL 3MRJB 4N0CC 2BNRA 3NTCL 5I8EB 5C9JA 3GJFA 5D1QA 5D9SA 4PRPD 4P3CL 3ROOB 4ALAL 4G5ZH 4GAFB 3TO4D 3TH4T 2F9BT 4O2FB 4XC3L 4G43A 3V5KB 1EMTL 5F7LB 1S5IH 4FZEH 1Q94A 3VGGA 3K0WA 3FN0L 2OTWB 3CSGA 5IBLC 2VDMH 1CGXA 2BSSA 4GKSB 1VFAB 2DQCL 1FO0H 3ELAT 1RIUH 2VLME 3EYQC 2IFGA 5I19H 1WEJL 5HI5D 3MV11 3MJ7B 1OB1A 5F1SA 3GI8L 1FZOA 3Q6GH 1DQDL 4E9LA 2NXZC 3CZFA 1S7UB 4GS7C 2ESVD 4Y5VB 4LOUC 5I8CA 4CNIA 1X5GA 1MHEA 3D3VE 3G6JB 4HS8L 4QRTB 4XBPB 3VFMB 1OAKH 1IT9H 2DM2A 1YN6B 1CLOL 1LE9B 4LSRL 1PG7L 1A7QH 2X1OA 1DLFL 3ABZA 4F37K 4TOYL 1FNAA 4UB0H 4MD4A 3F62A 4PY8J 1WFUA 4J2XA 1BD2E 5BVJB 1OVZA 2W9EH 1D3CA 1J7VR 5IM7A 1BFOA 2BSED 3OPZH 3ARDB 4G7VH 4X7SH 5F7FA 4HJGB 4OZ4A 5GGQL 5J4MA 2OXGA 1UCBH 5CBEB 2VDNH 3GJFK 3BWUC 2CLVB 3Q6FA 2EIEA 4MHHG 3QDAA 4YXKH 3UZEA 5BRZB 4QNPF 3QJFB 5EZIL 3HFML 3JWDC 3DX9B 3W9EB 5BXFA 1VACA 5B39G 2F54A 4FFYH 5EFIA 1I3RA 1XCQA 1I7TB 5LAXB 3PXJA 3ILPA 3OAUL 5DS8B 3MJ9H 1KPUB 3SGKA 4NRXA 4R2GB 3QNZA 5GRUH 4QRSA 3BN3B 1R0AH 5I74B 3P4LA 5ICZB 5KBNC 4PRBA 3MXWH 3RWFA 4PJAB 1P7QB 1MCEA 3ZE1E 4U49A 2LV4A 3D3VB 1XZ0B 3GHEL 3KYMB 3RAJL 1B6DA 5J0BA 4YDVA 1S7WB 1TLKA 4F58L 2XPGA 4Z78A 4GRWH 3U82B 5T3ZE 1DUZA 4PRID 3W9DA 4XAWH 5CZXC 4HS3A 3NIFE 3DO3A 5JHDD 2KZWA 1I7ZA 2EECA 3EHBD 3SDCC 5TQ2H 4URTB 3VXMD 4D3CL 4FTVA 2FGWL 4OLZL 4GSDL 3QEHB 5GGUA 3SDXB 2QHRL 5JTWA 1QNZL 2EIZA 2YPLA 1Q94B 4DOHB 3NTCH 1MLBA 2EDBA 1VPOH 5LXGL 1UGNA 5T1LB 4KKCD 3DBXA 4YBHA 4Z7QF 3WL9A 4CU8A 4MS8C 3MV9E 4ZTOL 5GS0H 1K6QL 4PR5A 3GSQA 3QQ9C 1LGVA 4NBZB 5M95B 2AK1H 2YPVL 5K33A 4JRYA 4OI9A 3WFHA 1TITA 1V3LA 3Q3GA 1N0XL 3DROA 4U6YB 4FQXA 1JF6A 2IALB 5H37H 1AR2A 5JW5B 3G5XB 3V4UH 2X42A 4ZG1A 1S7UA 2R39A 3CU7A 2ZUVA 3BSZL 3BRDA 1ZGLA 2W65A 3O41A 3GI8H 4XRCB 4OLUH 4PJBB 1AO7A 2A9MH 4YZFE 2OR7A 1G9EA 2X4UA 3DMMB 1I7UB 2IBZY 2ICWA 4ZUWA 4NP4L 1EJ6A 4KROB 5EU6E 3WIHH 1U93A 2OS7A 4WU7B 1XCTA 4UIKH 3TIDA 3IF1A 3LKQA 4U05A 2I26N 1EH9A 4LCCA 1SBSL 1YQ2A 1XIWA 4XI5D 2XN9D 5IFHL 1ZOXA 2Q1EA 1X5LA 4JANB 4PGBA 3WN5B 4X7TB 1HHIB 3QHZL 3AVEA 4G7VL 4X7SL 3EAKA 1YJDL 4U6XA 5HGAA 3T09A 2EH8H 1MHHA 4PP2A 1JWSA 2FHFA 4TVPE 1WFTA 2WLZA 3QULB 1R3KA 4NZRL 4HBQA 2VAJA 1F90L 4N9GB 3BFOA 3TYFB 2YSSA 4LLVB 4FTVB 2OI9B 4W81A 3X3GL 4MJID 1BBJA 5H35A 2C1OB 2DIBA 2N7AA 4NQDB 3TFKC 3KYNA 1U95B 2AK4D 5HHOE 3RY6C 1K2DB 3P0YL 3ARED 5IVZA 3W0WD 5F71A 5C9KA 4YHYB 4XCCL 2FHCA 4Z7WF 1D5MA 3LS4H 1QHOA 3O6LH 4E41B 1TETL 5DZNA 1IGML 2DLGA 4KI5E 5C0EA 3I9GL 2NZIA 3PUCA 1DQLH 3QI9B 4WDIB 4U1MA 4YUEH 2DIAA 2QKIA 3RTQA 4M8QB 1NAMH 2X1PA 1HSAB 5AEAA 3HI1B 2V2WB 4JN2B 1VEOA 4QHUA 5D71H 3MOQA 3MV9A 5I8KL 3TV3H 1E6OH 4BSVA 4BZ1H 4C4KT 5JQHC 4NUGL 1XCQB 4GW1B 5E00A 5BS0E 4GRLA 2FGWH 3RVUD 5TPWL 3DUHA 3QEGL 3WFZA 2CR3A 3IFOB 2I9LA 2EYTA 5E2VH 4JM2F 1KT2B 5C0DB 5D2LF 2CUHA 3BP6B 4XI5C 3NPSC 2JKXA 3RTQC 1JHTA 1I4FB 2DJ4A 3CVHL 4ZTOH 4K55A 4KV5F 4QWWD 4ETQB 3P77B 3I75A 4U1LA 4Y7MA 5K9KA 1MWAB 1LQSR 3RZWA 4OLWH 2X4RA 2X6MA 5DFTA 3MX0A 4DN3L 2MSPA 4YDLC 3MTRA 1TPXC 5FOBB 1RIHL 4L8SA 3IDIA 4P4KB 2P5EB 3HMXH 1W2KT 1LE9A 3KR3L 4W6XB 3RY6A 5IQ9B 2P47B 3MMEA 1KJVB 3PWJB 3VWJA 4XNZC 1DTUA 4NQSA 3VGFA 3AUVA 4C56A 3FO1B 2QR0B 1ACYL 1ZA6B 5MEPB 2C5DC 2MQCA 1CGUA 1R5WA 2GTZA 1QA9B 5JR1L 4JY6A 4KKLD 2HT2D 2E8ZA 4NZTH 5LBSH 5CZVL 1A6WH 3KPSA 4RSVA 3TNMA 5I1KH 5E8OA 2A1WH 4LPUA 2DQGH 5HYSB 2R29L 2P7TA 4YHZL 1J0JA 1DUYB 2BSSB 4G9FE 4KTYA 3E6FB 1N2RB 5HSFA 3WUWG 5E08H 4IMLB 4FQLH 5FYKD 1BBDL 4G8FA 4NQXA 4R26L 2EDWA 2VWEC 3BPLB 4XCFL 4PY7A 2OL3B 2EEAA 4DGYH 2HLAA 4WI2A 4Q9BA 4LL9A 5M94B 1BVLA 1D5ZB 3ZKSD 3LKRA 1MCOH 2PNDA 5DYOA 3EYVB 4XMKL 3HCVA 4MQ7A 1IKFL 5B21A 3VXSD 4LSTL 1F90H 4M6AA 3L6FB 5DJ0B 2ZG3A 1GC1H 1MF2H 3DI3B 5GSRB 2OJEB 5E24E 1FPTL 1DQMH 1UZ6F 4KDWA 4L8CA 5HY9A 3T3ME 3HLAB 3LEYH 4QXGH 3K8LA 4Q6IB 4GMTH 5LGHH 1YMMD 3QWRA 4NWTL 2EYSA 3I50H 4I3RH 1OARH 4FQCH 5BO1L 3SKJL 3ULVE 1PY4A 3EHBC 4NNXB 3SDCD 5KZCD 1FC2D 2AEIT 1IEBA 3PQYA 2VL5A 1HSAA 4MVBD 3QAZC 3JTTA 2Q76A 5SWZD 3QDJE 1TETH 4N0UA 1HHIA 1FO0A 1GVIA 5GS3A 1HOCB 3QCTH 5HHQA 3MNWB 1HKLH 4S1SH 2XA8L 4BQCA 3PDGA 4XC3H 4R8WL 4RFOL 1QNZH 5D7JB 5JOEA 1V5JA 1DL7H 1YNTB 1X4YA 3OKKB 4M7JH 1OB1B 4G8GD 3OTTA 3U30C 2VLKA 4NQDA 4XBEL 2EYSB 5TF0A 4JRXA 1W0WA 3QFJA 2AV7B 1QO3B 4DVBB 1H15A 4R4BB 4JZJB 4XTRC 4N1HB 2NPLX 4XTRD 1KC5L 1OPGL 3VXRE 2MHAB 1RJZB 3SGJC 4M5YH 5HDLA 2Z35B 4RRPA 1S7VA 1X6NA 4WEBH 1A7NH 2DKUA 5LG1A 4LSRH 5BQ7B 4M43L 2FX8L 1AI1H 3A6CL 2RCSL 2VYRE 2DYPA 3I3EA 4L4VB 5J6GA 2J6EH 5C0JB 3BZ4A 4PJCB 5J9PB 3VXQB 4KRMB 1YEIH 5H8DA 2QQNL 3T1WA 3OPZL 2KQMA 5DVKA 1LMKA 5F7YC 4WNQB 2V5MA 2GK0B 4QNPE 5I18L 2ED8A 3JV6B 1KELL 5T1LD 1JJUA 4R3SB 4F33B 1QP1A 5I74C 1SJEB 5I76B 3I2CH 5DJYB 2AGJL 1EEZB 1FDLH 1JI2A 1T5XA 4WGWB 1MEXH 3GMQB 3SDDB 1QA9A 1JPFB 2A1WL 4GBXD 2BSRB 2XTJE 4HH9A 4X9HA 1M6OA 3D39B 4FQXB 4MQTB 4PGCB 5DJ6A 4X6FB 2IANB 4Z7WB 4XP1L 3RZCB 5I1CH 3QFJD 4HK3N 4M48L 1YEDB 5D8JH 1MFDL 3BP7A 5FO7A 4ZYKA 4B0MM 4NUJA 3BD3A 1Y6MR 1MREH 1CQYA 3RPIA 4NN5B 2W92A 4MDJB 5C08B 4KTDH 2ZPKL 4NT6B 1HH6A 3P9LB 1FN4A 5DD3L 1SEQL 5FUOH 4QRPE 5D1ZD 1AHWB 2XN9B 3PHSA 1QPXA 4HC1H 5T3ZH 1RZJH 1YUHB 1RZ7H 4I5BA 3BIBX 3FN0H 4WY7H 5JORA 4BH7A 2OBGA 2IANA 1UZ8A 5EORL 1EZVY 2F5AH 1OT2A 1Z0MA 5GGRA 4FRWA 4GLRI 4PBXA 1B0RB 4XNXH 1D7FA 2C4FT 3EFDH 4M6MH 5EZLB 4ELMB 4K07A 3HI1A 4O5LH 5B8CC 4IM8A 2FHBA 1DQDH 1IGJB 2DWEB 3QISA 1INDH 4QWWC 5DHYA 4GRLD 4NO5B 3LS5H 5TDPB 2EDQA 1X4XA 5DLML 1N0XH 2ICCA 2OLDA 1YNTA 4M7JL 3O2VL 1JVKA 3SE4C 4A2MA 4G6FD 4M7ZC 4HUWA 1DLFH 1E27B 1MLCA 3WNPA 5CEXA 4MXWH 4UB0L 5C0EB 1CF8L 3QI9D 1ZHKA 3L7FA 1I1YB 4JPVH 4RX4D 3KPPB 3VFTA 2DYPB 4L4VA 4HFUL 2W0FA 5GZOC 1IAOB 4OZHE 2VL5B 1WT5A 3GO1H 5IT2H 2DJUA 3TVMB 2E3VA 1TNNA 3VRJA 3BD5A 2CK0L 4H1LH 4KQ3H 1JWSB 2PCPA 3B43A 1Y0LB 5C0IB 4K7PY 4F7CA 4DKEL 2W0FB 3B5HA 2VN4A 4U7MA 2X40A 4DFHA 1D6VL 4M9PA 1H5BB 3D9AH 5K93A 4XB8A 2OQJB 2V5RA 1A2YA 1BIHA 4YHNB 2RJMA 3CFKA 3NN8B 4IOIA 1TFHA 3H9HA 1FDLL 4JGMA 3BPNC 3L3KA 1GOHA 1T20B 4XB7A 2A73B 1XF2A 1DDHA 3W2DH 1YYMH 1A3RL 2NW2A 3CX5K 4O2EA 3MV8E 3S96B 4DTGL 1VFAA 5JXEC 4JY5L 4OCXL 4YPJA 4EDXB 4XCNA 4TUJA 1DDHB 3D2UD 1HHJB 2FEEI 3O6LL 2EXYC 3I6KB 3OG6B 4QHNB 5L7XH 4KTDL 3QUZD 3S3JA 3BKYL 3EDDA 2V9TA 4JPKL 3MRHB 2VAAB 3RUGE 4HPYL 1A14H 1TZHA 5CSGA 5DRZA 3D85D 3ALWA 3UTZB 2HLFC 2W07A 1PKQA 3UPAA 4P4KC 1ZT7B 4LMQE 5HGDA 4P5MB 2B0SL 4R6UA 4WY7L 3FQUB 3FO2B 3KPOB 3G6AB 5C3LD 1LNUA 4JFQA 2GW5A 1A6ZA 4HS3B 2XTJC 3OG4B 1DVFA 2R4RL 5FYJD 1A22B 5DSCA 1SBBA 4OI7A 1R3LB 3MLRH 4HT1H 2XA3A 1IC4L 3SKMB 3T0AA 2DM7A 3OKNB 1FFPB 1PZUB 1K8IA 4U0RC 1JYXA 1NJ9B 1URLA 3LN4B 3U46A 3WUWB 2XRAL 4NP4H 5L6YL 1KENH 4WGVB 5CWSA 2Q20A 4KRPD 4GRLC 5KZCB 1KB5L 1XFPA 3MRPB 2R23A 3HMXL 4PJXF 4O51A 5TF1H 3B9AA 2RCSH 2DN7A 1G0XA 3CZJA 2X4TB 4KTEH 4M8QA 4MXWL 2L0DA 2X4PB 1KPUA 3PHOB 3MACL 3BHBA 2HKFH 2WWKT 4Y2DC 4ONHA 4L29B 5EC2B 3QI9C 1S7RB 4P2OD 1WAAE 5HDQL 2KDGA 3RWIB 1SJXA 1I8MB 4RAUA 5FM4A 3EYFA 4BSWA 4JQIH 5D2NE 4YWGH 2APBA 4W4OC 3AMLA 3AFLA 4G8GB 5IESH 1J86A 2KL6A 4XPGH 3PGDB 1FC1A 3SDYL 4JFZH 4NO3B 4TULL 2NY5L 2AKRB 4YHIB 4DZ8A 1H15B 4R4BA 1NDGA 4LHQB 2Y06L 3TBTB 4Z0BL 1EFQA 3GB7A 4Z7UF 3HUJE 4HK0A 4QTHB 1FAKT 1C5BL 2OMBA 3VDCA 3HUJA 1XGTA 4GUPB 4BFBD 3AREC 1AXSA 4OCSL 1FL3A 5DMJB 3T0ED 3X11B 3KPNA 3VFUA 4S1RL 3QI9A 4UV4L 3DV4B 3FRUB 3DXAA 4NQCD 5IF0A 3RZCA 1N6UA 1Q0YH 1PY9A 3FOLB 2FJHB 2QADB 4WWKC 1EZVX 3HNSL 1KTRL 1NPUA 5I8KH 1RULL 2YD6A 5DVMA 4LCCC 5BZDB 2QTEA 1EAPA 2OMNA 4W70A 3QO0B 3RVTD 3EO9H 3DYMA 4OSUH 4AQ1B 1KACB 1B4RA 1IGCL 1YNKH 4U4BA 2WBJB 5T3XH 3GK8L 5E2WL 2VQTA 2K7QA 3BQUA 4S1SL 4OTXL 2FBJL 3STZB 4R2GC 2MJWA 2HRPH 1MCSA 3QEQA 3BEWB 4L4TA 2IAND 3E2HC 2Y07L 5IHZB 5D96B 5F3BB 3RZCD 4KROD 2I5YH 3HRZA 1S7XA 4APQA 5HGAB 3ZSTA 3JBG7 1UB6B 3WD5H 4KC3B 4NN7C 4HV8B 4DCQA 3HE6C 2BSTA 4P3WA 1IM9D 5I1HH 1HK6A 1G6RA 4ISVB 2V2TB 3BW9A 2V7HB 3DBXB 3WL9B 3KWWA 4JAMA 4DUWA 4TUJB 4HKXA 2Q87A 1AQDB 4EIZC 4G9DB 3E6FA 1AP2B 4XGZA 4LNRA 3VCLB 2WW8A 5F89B 1E4XL 4HIEB 2RGSA 1DBAL 2C3WA 2M26A 1UJ3C 1TZIB 1FH5H 4PUBH 4GAJL 1RJLA 1S8DB 1RJYA 2C3VB 4WCYH 5AUMB 1ODAA 2VISA 1J1XH 2B1AL 5T5NG 4GW5B 4LGRB 1AGEB 4GFTB 4ODBD 2J8UB 4PJGA 1MWAH 4KRPC 4OCWL 3ZTJH 2M2DA 3QA3A 3RWJA 2Q3AA 3FOLA 1XH3B 3AREB 3QDGE 4WUUE 5GRVK 1CE1H 1T1ZA 4L8SB 1H5BA 4EN3D 2Y23A 1LP9F 3MJ8A 1RUAH 3RWEA 3PDOA 1Y0LA 5C0IA 3SQBA 1WT5C 3U0WH 3TO4C 2YC1A 2ZSWA 5TQ0L 4JY4B 3E8UL 3QNYA 3L5JA 1T0MB 1QSFB 5BS0A 1VCAA 4LCUA 4PFEA 3P4MA 1A7OH 2R4SH 2HTLC 4NPYB 4P59L 3SGKC 2NTFB 4X6BA 1N5YH 4HPOL 3BPOB 1A9BB 1JGLL 4X4XB 4AZ8A 2DYPD 5T1KD 2XQBL 1T1YA 1BZ7A 3CFCH 4ZSOB 4X8JB 4GW1A 2NY3C 2GJJA 4X7CC 1XF3A 1RZJC 1FCGA 2WV3A 4KVCH 5C07E 3T3PF 5MEQA 4FMFA 1X3DA 3QEUA 1X5YA 2HVJA 1UWGL 4PJ5E 3OGOE 4H26B 1FRGH 1EXUB 1A6VH 1IEAB 3ZT7A 4WTZG 5HYJD 4R0LA 2XA8H 4ENED 1KCLA 5CIPA 5GISL 3IDMA 3LSOB 5EZJA 1I8KB 4H26A 5EOTA 2F5AL 4LLQA 4CVZA 4B7IA 3CXHK 3ZDYF 1DN0A 2OL3H 2VN7A 3ZYJA 1CGTA 1NCDH 2P5ED 3UBXA 2A6KA 4PRAB 4NGHL 4GW5A 3HS0B 1HWHB 1I3RB 1MY7A 4PRHB 4ZSOA 2PYEE 5FDWA 2QR0A 2Z31A 2IC2A 3U9PL 3TP4A 3SOBL 4C54A 1UKSA 5HGDB 7CGTA 2XG4A 3L7EB 2R0ZL 4DGVH 4PJEF 1MFCL 4X99B 3MC0A 3EOTL 5DTFB 3VXUE 1LNUB 1Y18A 2X4QB 1Q9OA 1KCUL 3BKJH 3L5XH 2Z91B 2AAVA 4LIQL 2V2TA 5DHXB 4IIQB 1A1NA 4JJ5A 3D6GA 2DJSA 3DTXA 3WS3A 2VDOL 5HHNA 4MNGE 1IBGH 1XR8B 4U1JB 3SEPA 3MRHA 4PLJC 2HKFL 1YN7A 4OGYL 1A1OA 4XNYL 3DI2B 4OB5H 1AGDB 1U6AH 2KH2B 1U93B 3UBXI 4X4MA 4IRZH 4TUKL 5SV4A 2UY7A 3STZA 4LLUA 4X4ME 2FB4L 2VSDA 3CVHA 1OQOA 1YEHL 2EDRA 4H88H 3HNVH 2R1YB 3KXFD 1S8DA 1S9YA 1UA6L 4XNQB 3CLEH 1M1SA 4IRJD 1RD6A 1R24B 4YDKL 1T66C 5FHBH 4OF5A 4YHPB 4L8BB 1FZMB 3BISA 3EFFA 4TPRL 5DFVD 3VXQA 3EOAB 2F74A 5KSUB 1N4XL 3C6SB 4XMLH 1DN2A 2F8VA 5DGRA 3MREB 5T5NF 4UNVA 4MJ5A 3EJJX 5GGTH 4IMKC 4RQQB 3CDGA 4P48A 3PV6A 4M6NH 5D7JD 3PWLA 4OBSA 1RZKH 3VXRB 4QTHA 4YHOL 4QRRD 1JGUL 1OSZB 4YFDB 3FAWA 3L7EA 1HN1A 4PRIA 1KB5B 2AJUL 1W0WB 2O5XL 4P2OB 4WI9A 1EHXA 4Z7NF 1FLRH 5C3TA 4YXLH 1NAKH 1PG7W 2MKWA 2A83B 4JM2A 2CD0A 1JFQH 3FB6A 4F9LA 3P73B 4UT9H 5ICYB 2CR6A 4KPHH 2FATH 3D87B 5FUZL 3TPKA 1J0KA 1MCCA 4F7EA 3QRGL 5FA3B 1PAMA 1OF2A 2YRLA 1NGPH 1XF4A 3OR6A 5ESVB 5E2UL 4Y4KB 1KTLB 5IWLA 3QIWC 4LSVL 2Q3ZA 3QDJB 5C09D 1CZ8H 4WIQA 1YPZA 5JPNB 3DARA 3HG1A 4OD1L 3WD5L 2X4NA 4QRSB 4DW2L 4JRXE 3C9NB 5JO5B 1MJJA 1XGTB 3DMMA 1IRAY 5ALCH 3WJLC 4UV7L 4LHUG 3VRLF 1H0DB 1ES0B 4Y1AE 5EU4A 2I25N 4ZD3L 5CHNA 3QUMB 2G75B 1B0RA 1SYSA 2Q6WB 2BVUA 3C09C 2O5ZH 1UH2A 4IS6B 3IETB 2CLVA 4GBXB 2QSTA 3GMRB 4W6WB 1Y6KR 3NCJH 4HMDA 4EEEA 3UJJH 2UZYB 5EBGA 1RIVL 1EUUA 1IBGL 3C60D 4D0CB 1UJTA 1XGUB 4N0UE 4HBCH 4JLRA 4FQIH 4H1LG 4JPWL 4NT6A 2HFEA 4XP6L 4PJXE 2JB5L 1FYTB 3M1BB 2XWTA 2EYTB 3U4EA 3GSXA 4C83B 5I8CB 1MQKL 4RGOH 4YR6B 4LIQE 5F3HA 3P30H 1JPFA 1K8DB 2Y06H 3T77B 3HB3D 2X7LA 4KMTH 3RKPA 3JWOC 1T5XB 3K4AA 1FIGL 2GCYB 3WO3B 1KTDA 3DVNA 3GGWA 3VFPB 3U4EB 3MLYH 4XNUH 5A40E 3PP3H 1S9WB 1HHKA 3IDIB 3RTQB 3X3FH 3QDJA 3SDAB 4KHTL 2AJZA 5HI5C 1XGUA 1CG9B 2BOCB 1QOKA 4D9RD 1UEYA 3TT1L 2YS4A 3VD9A 1QSEE 1T1XB 5DGQA 4M6NL 4GQ9H 4QXWA 4IOIB 2FJGB 3BDYL 4W6YB 4WUUB 1DEEB 2XY1A 3L5WB 3EDJA 4MA3A 4JR9L 5FUCE 1AY1L 2I9LB 4M6OH 4LVHC 3BZ4B 4PJCA 4XPFH 4EN3B 2P8LA 2AJUH 4FQ1H 1HHGB 5IJVB 3QEQB 2H26B 3BKML 4LLMA 1JGEB 3BWAA 4TVPH 2NY3B 3H7BB 1YA5A 5IQ7L 4N0YH 1DQTA 2ZUWA 5L0QB 2YXFA 1HQ4A 3RJQB 4L3AA 4EDXA 3D0VB 2X1XR 5HHXH 4WUKH 5CLTA 2QADC 4YC2C 5D96C 3O3AA 3HG1B 5KJRH 5EDXA 3VXMA 5L9DL 1A3QA 1FL6A 5MERA 4FMKA 3TVMD 1CFNA 5T1KB 4YBQC 4HF5H 2E9JA 5E4IA 5B22A 5CGMA 4DGVL 4LSVH 3MCLH 2DICA 1KB9K 4PJFE 2BFVH 2CGRH 2X10A 3MZGB 3VGBA 3I6GA 1X44A 3MLVL 4AEIL 1L9MA 1F4WL 2ARWA 2VISB 2R0KL 4P9HC 5B3NA 4ZD3H 3CXDH 1TPXB 3QXWA 5F9JB 1TZGL 2Q76B 1KJ3H 1AIFB 4HWBA 3MRRB 5TE7L 3RY5A 3TCLA 2Z4QA 1MWAL 4N9GA 2A6IB 1XAUA 4D8PB 5E99L 4DVRH 2YPLE 1R3KB 4YEFA 1SYVB 2FB4H 2PYEB 4XPGL 2EE2A 3VG0L 4LP4A 5FF6B 3PGCB 5D1QB 2FJGA 5D9SB 1OT1A 5IBTL 4UINL 3X13A 2JB6A 3D2UB 2X1WL 5DQDL 1Y6NR 1VADA 3NIDF 4LKXA 1JUFA 2WP3T 4PJIA 1NGWB 3OGCA 4PBVC 3RUGA 5MEOB 2OX5A 3WYRA 5GS2D 1RK0A 3JZ7A 2FECL 3IDYB 5AYUL 5IVXE 5JHLH 4TPRH 4PJ9D 4DQOH 5I1JL 2HVKA 4P3CH 5FK9B 2EC8A 5T3XD 5IVXA 3WV0A 1JZ8A 3RKDD 1N5YL 5SWQB 2FCBA 5DHYB 2ITDA 2XZQL 1HINL 3T2PA 5DUML 5C2BH 1MH5A 2X7LB 1UM4L 4LASL 5FECB 4GXUN 5CLWA 1XIWC 4UIMB 3C6LD 3D39E 5JDSA 1ZVHA 4K7PL 2ORBL 4W68A 4YNYB 4KQ4H 4RBPK 5IEKA 2W38A 1M6OB 3D39A 4J23A 4PGCA 1JYWA 1CDIA 3RL2B 3WXWL 4LARL 3P0VL 1JZ2A 4RGND 2B1HL 1IGCH 1YNKL 4U1GC 1I8KA 3HR5A 5E56A 5EB9A 2ZZUT 2OZ4A 1FFOB 1GGCH 2BY0A 2F54E 5FECA 1P7QA 12E8H 1AR1C 4ONGL 3MO1A 1T6VN 1IKNC 2EKJA 4K8RD 1F4XL 4K9EL 1JI1A 4IRJB 5I6XB 5JZ7C 1ED3B 1R5VB 5IG7B 4GUPA 4WO4D 1UVQA 3CXHJ 3WO4C 4LSPH 3UXFA 3BAEL 5E2UH 1ERNA 2VAAA 3IS0X 4K2UH 4KK6C 5DFWH 1JF1B 4OD3L 4PJ5D 4NRYB 1JZ6A 3NOIA 4XVTL 1DFBL 5JW4R 1FFQA 3OKEA 3ZE1F 3PP4L 5IBUG 1UG9A 1WWBX 3C6LA 3ARFD 3L3IA 4FQHB 2PUQT 1KFAH 5CBEA 1MFCH 3RWCA 3RWIA 4HX1B 3OKYA 5I0ZA 2WBWB 5TE4L 1YEEH 2X4NB 5F1KC 3RWEB 3O2DL 4FQ2L 5DEGA 1ZANH 4LAQH 2VLKD 3S5LG 4J1UA 4Y0GA 3RX8A 5DJYA 3T0EA 1WZ1L 2PYFA 4JHWH 3WCYA 2A6JA 1F4WH 3PF2A 4LSUH 4I13B 2WQRA 3MR9B 1E4XI 1KUMA 2W0PA 1RIVH 5DUBA 3O3DA 1OF2B 4A2LA 1XIWD 4ZFFB 3UTTA 1JGDA 2W60A 5HHPB 4F58H 1E0OB 3PP3K 4X6CB 5C0RH 3PL6C 3IU3A 2BDNH 5FO8A 3BPNB 1FAIL 1VB9A 4PV8B 4YDKH 2WLYA 4RISL 5GRJH 3RGVD 2J88L 1JNLH 1AR1D 4AIXA 3H9SB 2VXSH 4LHUB 4AQOA 1BQLH 4NCDA 4NNPL 2HH0H 2FR4B 1KXQE 4EBQL 3MRNB 1Q9KA 3QDMD 3KPPA 3VFTB 1QRNA 4HV8A 4DCQB 1CFTB 2MCG1 1W72H 4EZMA 4J3OC 1FVDB 5EOQL 5IHZA 1I1FB 4IJ3C 3IDNB 1A4KB 3ULVD 2VLLA 1ZXQA 1BFTA 2DL2A 3QUML 5EBWA 1J05B 3HPJB 4KDTC 4YAQA 4JRYE 4PRPE 2YPVH 5D1ZA 2J8UE 2JF1A 1HHJA 4PRPA 2P5WA 1E4JA 1MRCH 5ANME 3SDAA 4L3CA 5EU6B 3CMGA 3SO5A 3GUTA 4M5ZH 4OT1L 1CFVL 4O02H 4M8VA 5TFSL 1C8PA 4XPFL 1P9MC 2F5BL 4UQ3A 5CP7B 2BZDA 4HMEA 2FO4A 3BGMB 4LDOB 3QQ3B 4XPTL 1PJ9A 1YDPA 1UC6A 4EI5A 4OKDA 4G8GE 1CBVL 3MRBB 1M7IA 5C71A 5GZNC 1K3ZA 1T66D 1P69B 2GQHA 3L9RB 4AEHH 3B6SA 4YFLI 4I2XB 4K8RL 5C07D 3VWKC 1MHPL 1CR9H 3RNKB 3SDAD 1XGRA 4ODXA 1U8OB 4P5TB 3ZDZE 2HLAB 3O6MH 4X6EB 3DHJA 3M45A 3ARBD 2YKLH 5A2JH 3BKCL 5F70A 4YX2H 4KJPC 1H3PH 1ZAGA 4PV9A 1KFAL 2DLFL 4EXPX 1FE8L 5MP6H 2R1XA 3MNVA 1S9WA 2ADIA 5TQ2L 4B50A 1S7TA 2VDML 5BV7C 1CD1A 2JCCB 3RL2A 4GS7B 1UQSA 1LP9E 4V1DD 2Y7QA 2NY3D 3QCVH 3VRIA 4ELKB 1K8DA 5DK3A 5DUBB 3EDFA 4JVWA 3VH8G 4DKAA 2AXGB 4MAUH 5F3HB 4YR6A 4MLIA 4QF1B 5F9OL 1C1EL 2H2PD 4XHQA 3RDTA 2YD3A 4FXGB 3QNZB 3RVWD 3DETD 2VXVH 1UM6L 4BH8A 5JPNA 3O4LB 5DQDH 1SY6H 2AXFA 3VI3F 1NC2B 3HZYA 4WNQA 1QRNE 4KI5C 2AXGA 3RIFK 2CXGA 1IEAA 3MOAH 4OV6F 2OP4H 1FFPA 5BJTB 2Y9RT 3MGTB 1QVOA 1XGPA 2HJFA 4GRMB 2WSKA 4P5KB 5D7SH 4J3TA 3SCMA 4HK3J 2J88H 5IMMB 2Y1VA 4RWYL 4LEXL 1JWMB 4NPYA 5I1GL 1UZ6E 5HD8D 1KF9B 1U95A 1AKJA 5EU5A 4H25B 2GAZA 3CC5A 2R9HC 3MGTA 4NOBA 1GPOH 4JZJA 4FZ8L 2N1KA 5BVJA 3P4MB 1MNUH 4JFHD 1TDQA 1J5OH 1X5FA 4FQJH 1P4IH 4OZ4B 3PHOA 1G9NH 4LPCA 4WV1B 5EN2B 4QHUB 5LWYL 2NW3A 1AHWC 4KKBC 1NLBH 2GJ6A 4N9OB 2P8MA 5DMGC 1NANH 3ARBC 5HDOA 2XKNA 5D1QD 4Y5VA 4LSSH 5J6HA 1RIHH 3UYPA 2FYYA 1C16A 2ENSA 4Y2DD 5KVGH 2MTPA 1ORSB 4NN5C 3MJ7A 2RBLA 4OJFL 5E9DB 1NEUA 4MWFA 1FFNA 2ARJQ 5C0AB 2FWOB 5HHXL 5KS9A 3SDXF 35C8L 4OD3H 4LVOB 5DJZB 5DJCB 4UTAH 4OCYL 1HH9B 5CZVH 5GRVL 3KPLA 2DM4A 4ZXBB 4XAWL 1A1MB 1R3HB 4OZGB 1CICB 3BP4B 2FGZA 2E5EA 1U8MB 4QXUL 2FLBT 43C9B 1MJUH 5TE4H 5DRZB 3ARFA 1QSVA 3NCJL 3CFEB 2IFFL 1G6RB 1G7PB 3JV4B 4M00A 2H3NB 3T2QA 1BX2B 5F7DA 1H8OA 3STLB 4PGBB 3G5VA 1P6AB 1IKFH 1BVLB 5TE7H 2CKBA 1KOAA 4OIBA 5ADOL 3SE4A 2R2BB 1JF5A 2Z35A 4FXKB 4JHBA 3GNMH 4NQTA 1CGWA 4S11A 1NCWH 2OR8A 2R9HD 2N4IA 5SWSB 5C7XL 5FYKU 1A1MA 43CAA 4PG9B 3PQYE 5F21B 1S9YB 3F58H 4JKLA 1XF5B 3NA9L 4QRRB 2ADGA 1ZHKB 3L7FB 1NAMB 1FORH 4HCRH 2VITA 1JNLL 1DUZB 2XTLA 3VRLE 4Y19B 1DN0B 4DN3H 4CKVX 4DUVA 1WICA 2QLVB 5E6YA 1A2YB 1A0QL 4TSCH 1QQDA 4HQQL 4Q0XH 5E1HB 1G7JB 4MXQC 1RHHB 3PNWB 4F7CB 4JFOA 3RU8H 3QUKA 5FM5M 1JHKH 3F7YA 4U1LB 5L8KB 1TQBB 1Y18B 3VFNB 1AY1H 1RV6X 5C09B 1CDCA 3SDXA 4N90D 1ORQB 1F58H 2AKRA 3IU4L 3BP5A 4NQCA 4TNVF 4JPIA 4XPHL 4K9EC 4LSQH 3IVKA 1IC7L 1MCHA 1U8LA 5E5MB 2W60B 4R7DA 1R3JA 4U1KA 3SE9L 3QJHA 1BVKA 3WLWD 3RGVB 2I27N 3DXAD 3T0XA 2IG2H 2VKWA 1RZ8A 1WC7B 3H9SD 1DQQA 5D5MA 5FYJE 3TBWB 3P4OA 4BFIA 5FO9A 1CG9A 4MD4B 1WGOA 5BW7C 3H3PH 5B3JE 1JV5A 3S8WA 4F9PA 1GC1L 2AXFB 2LVEA 3LIZH 32C2A 1WTLA 1OAUL 2GY7B 4RMWA 4ALAH 2F53B 4WEMB 4U6HB 1OM3H 1JRHL 5MI0B 4K3DH 4ZOBA 5I15L 5ILTL 2VZ3A 2CDGB 1T89A 3NCBB 2QHRH 4OUUB 1E6OL 1MAKA 2W0LA 5EU6D 4QOKB 1TCRB 1F8TH 2CJUH 3QZWA 2X70A 4HXBL 1ADQH 2ZUYA 1QBBA 1UM5L 3MRLA 2APWA 4LSUL 3WJJA 5I1CL 3FT2A 4X0KB 1ZHLA 2NMSA 4DEPB 2XN9E 4YHYC 1PLGL 3QULA 4FXKA 1FCCA 2WAHA 2XNAA 2YC1B 1QD0A 5J1SC 3ROLA 4GAGL 1GL4B 3CDGB 1AFVH 4UNUA 4X6DE 2UUDK 1L0QA 2VABA 4YIQA 2ZCLL 5CSBA 4ZAKD 3PWVA 4LMQI 5BVPL 4N8PA 2DBLL 2PKDA 2CXKA 4KK9D 5C07B 3LQAH 5HI3D 2ERJB 5INDA 1J87A 7FABL 4HLZH 2VC2H 4OLUL 1JZ4A 4P5TD 5DD5H 1DBBH 3LRSA 1CICA 3DX6B 4UIMA 3MRRA 1N7ML 1MCQA 1DE4A 1HKFA 1QSFE 3HI5H 5DHVH 3V6OE 4L3CB 4QRRA 1YMME 4DN4H 4O5LL 5DRNA 5FKAA 3GUTB 1I9IL 4EI6B 1U41A 4ZAKA 3LKNA 3FQTA 4F7TA 3P9MB 1CVSC 1DJSA 1MY5A 5E7FA 4KROC 4JQXC 1F4XH 5DJDA 4U1JA 1T83A 4K9EH 3UYOD 4Z77A 2VSCA 5DMGD 1F5WA 3FFCD 3KPQB 4ZUUB 4HW6A 1WAAA 1QEWB 1Z2KA 1P5UA 5LKNA 3VXPB 3VXNA 3F6IA 1UB6A 4J12A 5IVZB 1YPZE 5TFSH 4TVSa 5ICYA 1IEBB 4E0RA 1OP5K 2A83A 1HDMB 4HUUB 1F58L 5BS0D 2P42B 2YPKB 4HFUH 3K8MA 2D4FA 5HGHB 2AV7A 4JM2D 1NBYA 1JPTH 2YWYA 1AIFA 5C0ND 1G7QA 1E6JH 3UJTH 4OLXH 5CJQH 4NYLA 1FGNH 4NSKB 1G9MH 4RMVA 4UDTB 5KG9B 1L7IH 1SMOA 1YEEL 5C92A 3MJGX 4PJFA 2QQKH 4XZUA 4X7TA 3EYUH 3O2DH 5HYJE 1T1WA 4NHCL 2A77H 3GI9L 3HZKB 4NQEA 2XFXA 5A2LH 4Y5YB 1U92B 5E5UB 2DQHH 1MLCB 3W5NA 4PGEA 5CJXA 3AGVA 5DK0A 3LD8C 5MENE 4AENA 3QQNA 3L3GB 4R8WH 2VDRH 5KSBB 1UCTA 4Y4HC 4ORZC 4MD5B 1EXUA 5CKAA 3MNZA 4PJHB 5ALBL 4L1DA 3KPSB 4LSDA 3TBVB 4QF1A 1H3XA 3OHXB 4Y2DB 1ZGLB 4X5XB 1IAII 2VLJE 3QJHB 5DK2A 3RX5A 1MFEL 4O2CB 1VHPA 2Y25A 3O2WH 5GRJL 3QPXL 3RWCB 3QJFA 3PL6D 2IALA 3PWUB 2HG5A 3DJ9A 1RU9H 2R56H 2R2HB 4LCUB 2VLJB 2IJ0C 1E4WL 3NA9H 5E94A 4C55A 3B2VL 4Q9CA 4TTGA 1BQLL 3V0VB 1F3RB 1GIGL 2HJFB 4GRMA 3ARDA 4P5KA 5HI4C 4EVNA 5KTEL 4LLDA 4GQPH 5T33L 2PW1A 4LRNH 2PO6A 1CF8H 5DTFA 2L7UA 5I1EH 1L7TL 1NUNB 1V3KA 3C8KB 1JRHI 2EDEA 2PF6A 4BZ2H 2EH8L 2D0GA 2IQ9H 5A2IH 1SYSB 3MCG1 3BJLA 5CUSL 2IPUK 4CL7A 3ARYA 4PBWD 1FZOB 1MCJA 3IJHA 1D6EA 1QLRA 2ICEA 3BE1H 1NCBH 4MNQA 4CVZB 3QXVA 3G5ZB 3PWPB 2MKLC 4X4ZA 1U8IB 4OGXL 3U7YH 3HAEG 1CE6B 2FH8A 2XWTB 3SHSA 1DCLA 4R3SA 1G84A 3DURB 2HFEB 3D18A 3MRCA 4PP1D 4AENB 2P5EE 3UBXG 4JFDE 1PSKH 4RMSA 4ZDHB 2B5IB 5HGBA 1PG7X 1CQKA 2IG2L 4NDMB 2QV2A 1U8KA 2VLLB 1XMWA 3G6JE 3VFOA 4EUPB 1U58B 4BYHA 5IB1B 2AS5M 4AY0A 2EXWC 1WK0A 4UTAL 3EJYC 4OM0H 2XZAH 4P23D 5GS0D 5J57B 2PO6C 3BKCH 2PO6D 2E9IA 5TE6L 1NCCL 5J6GB 5JQ6L 5M7QA 2E6PA 4U1NB 3B5TA 1X5HA 2ADFH 5EU4B 2G2RA 3OSKA 1YDPB 5IBLD 4PD4K 5F88B 1L6ZA 5HVGB 4ELMF 4OF7A 3MGOB 4UUJA 4Z8FL 4LAJH 4Y4FA 2NY5H 3Q5YA 3ZKMD 2GJ6D 4YFEA 4HZLB 5ID0A 5C0AA 1NSNH 4XNXL 1T2JA 3OMZA 3LV3B 1KTLA 1VEMA 2PR4L 1FBIL 3ARRA 3CVHH 1H9VA 2FJHA 4MJ6B 1CD9B 3B83A 4GKNB 2EDYA 3DXAB 4ORGB 4I3SL 4JFFA 1S9VB 2Y36H 1MCDA 1A4KA 2D0HA 4Y19A 3QWOB 4JZOA 3CDFA 4ZSOE 5D7LA 2WUBL 4ZPTA 3TN0A 2MQ3A 4NYLB 3VD5A 3X12A 1YEKL 1DBKL 2P45B 1BECA 2XTJD 2NY7H 1QYGH 1A7NL 3ARSA 2IBZX 5GZOD 5MHSE 5DURD 2DQFA 2FX8H 5I1GH 5B3JF 2VQ1B 1F00I 1HZHL 5K59E 3W0WA 5E2WH 3BZEB 3VGDA 3HLAA 4GG6A 1A6WL 4AIOA 3SDCA 5KSAB 1I9JL 2ZOKB 1KEGH 2HRPL 4QOKD 4LLWB 5DUPH 1Q72L 4PG2C 4XPBH 1KB9J 5HYQA 2PW2A 5IHUH 4KRNA 2HMIC 2X4SA 3I2CL 2GHWB 2VR5A 3O8XD 3QG6B 1XCTB 4LDEB 3IAQA 4L8BA 1NBQA 1ZHLB 4LSSL 2BVOA 3P4NA 1R24A 4WW2B 3IU4H 2LU7A 4KXZI 3BOVA 3WO4B 4G8FB 4NQXB 4Q2ZA 3E6HA 4LSTH 1QRND 5IESL 1CIUA 2V9QA 1NCBL 1IQDA 5E8NB 3ZDYE 3R1GL 1UWXK 3VRIB 4ELKA 4OGXH 1OTSD 1U8IA 1S5HB 35C8H 1AC6A 3TNMB 4NKMA 2NY2B 3I6LE 3WKMH 4LPWA 4QXGL 3GSUB 4Y16D 3MRGB 4PRNB 4RA3A 3TBSB 1OGAE 4UAOC 4JY5H 4OCXH 4NJ9H 1MI5B 5B39A 1XGQA 3WIIH 4JFQB 4RNRA 1NMAL 5ISZD 4M1DH 4FQXC 2MPAL 5FYLE 3DSNA 3S35H 2BVOB 1UB5A 3P4NB 3P77A 2BJMH 3BQUD 2AXHA 2D7TL 5CGYC 3SGJA 5EIVA 2DLEA 4F7MB 4X0KA 1DL7L 5DMKA 2QBWA 3QEHA 2AJ3A 2ZUTA 4J8RA 3MRLB 3L95B 1KT2A 5C0DA 1BM3L 4AIZB 1MHCB 5E6IB 4OFVA 4CJ0A 5BXFB 2CSPA 4G5ZL 1T1YB 4GW4A 5EU7C 1I4FA 4U33A 2DTML 2JJSA 4HKJA 4FS0A 1IGYB 3FN3A 3OJDA 5BS0B 1ROWA 3CH1B 1BIIA 2Q7YA 1TVBA 5J12B 2DQDH 2DQUL 5AD0A 4RGNC 1K5NB 4OIIL 5IK3A 1KBGL 1T7ZA 2IAMC 4NQUA 4L29A 1LO2H 4H8WH 1T4KA 4JRXB 1WZMA 1BWWA 1BZQK 3TBVA 4RFNB 4WFHD 3C2AH 1T89C 4OFKA 4HZAA 5I75C 1A6VL 2F58H 3QUZC 1UFUA 2P24A 1PX3A 3WDIA 1A7QL 5A16B 3RUGB 1P84J 1CDBA 4C56E 3KNBB 4ZUVB 1B9ZA 4XT1C 3KLAA 1HIML 2NY7L 1EUTA 2NQCA 2WNGA 1F6AA 2OQJA 1F3JB 3GMNB 3GDBA 3DLQR 5ANMA 5BOZG 1I3UA 1A7BA 3EGSA 3I3DA 4GKZA 1TCMA 3P3YA 4NGHH 1TJHL 5SWSA 5IR1A 1NGZA 3EO0A 4LGPB 1J1XL 4YXKL 1LO5A 3MSPA 3CPLB 2DLTA 4G9FA 2UY6A 4JO3H 4Y8DC 1JGVL 1A9EA 2EDXA 3H7BA 1HYSC 5I1IL 4X6CA 4ODXB 4TULH 4UOJA 1T1ZB 1MIML 1YJDH 1OAXL 1CICD 5DJAA 4I0PC 3B5GA 4M4RA 1E27A 2VZ1A 4XBPA 4LVHB 3SKNA 4EN3C 3WN5C 1LDPL 1FIEA 3QDGA 2J7LA 3V8OA 2XOTA 2E27L 3DOSA 4MA1B 1JPTL 4J4PD 1J1PL 1W0VA 4JDZA 1I7UA 1UJ3B 1E6JL 3RAJH 1XF5A 2R1YA 3FCTA 4UQ3B 2IMNA 4KGLA 1Z6JT 4B5EA 1OM3L 5CEYA 1BF8A 1E28A 2YBRA 2CUIA 4F15C 3K4DA 3K74B 5E6IC 3JVGC 3QIUD 3GK8H 1JMZA 1KJ2B 4JO2H 4PRDB 1QSEA 2DMCA 2QQLH 4HEME 3TGXA 1FP5A 1INDL 3MMEB 2WWMC 1MLBB 2W9DH 4R4NC 1N4XH 3TNNB 2DAVA 3QP3A 1T6WA 2Y07H 4L8DB 1HH6B 4HKBB 1KEMH 4OCNC 4KZEL 1DLHB 2DTMH 4AJ0A 1GZPA 3HG1E 4LHUA 3U7WL 3V6OA 4MCYB 2GAZB 5GGVY 3FFDA 4PTUA 2B2XH 1VESA 3GJEA 1RU9L 1JGUH 2R56L 3MV8B 1FJ1B 2JELH 3OZ9H 1DBBL 1P53A 5EUOA 2VLRB 1JPST 4D94A 1KENL 3OR7B 1QYGL 5DI8B 2GFBB 4P46D 5IEHB 2I9TB 3H3KA 2A9ML 2A6DB 2PXYA 4PUBL 3U6RA 3T2OA 1D9KA 4P2QE 3S3SA 1SEBB 3UYRH 1JV5B 1NGXA 2OTPA 2EE3A 5AG9A 1D6VH 2ZSVB 3C9NA 5JO5A 3V79C 1I9JH 1LD9B 1KEGL 1L9NA 1PW3A 4N8VA 3MRIB 5EOCH 4PGZA 4NRXB 1FL5B 2C26A 2SEBB 5JNYA 2XXCB 5GJSH 3MLWH 4XNYH 2APTA 5CSZB 3DGCR 4E41A 1XF3B 1VADB 1U8PB 4P4RA 1RUMH 1ZMYA 4CMHB 3B3IA 3GMOB 4X6DF 2NX5B 1VEPA 1W72B 3IS1X 3LKPA 1DQJA 1ONQB 3N85L 4JO3L 4P99A 4BH7B 1Z9SA 3DV6A 1S7QA 1U8LB 5E5MA 2H45A 2VXTL 2NX5E 3SE8H 2AJSH 4ONOA 1P7KA 3ME0A 5DURB 4MNHA 1JGLH 3L3DA 4MMXC 2YWZA 3NZHL 3SQOH 5HPOA 4R96B 4U1IB 4FA8A 1J9CT 4XCCH 3GBMH 2J6EA 4RIRA 2BERA 4JQXA 1CIDA 2BMKB 3VXPA 1G1CA 1UWGH 1MCPH 2QKIB 4ZAKC 3MO1B 3VW3L 3OKDB 5F7MC 3BH8A 1A7PH 3LEVH 3OAZK 1KN2H 5H94B 2DI8A 1MCWM 5IW3A 3OF6D 4FQCL 3DX8B 2O5XH 1JTPA 3RVVD 3DRTB 4P5TC 1EFXB 3BESR 5E2TH 1GOFA 5ETUB 4XVJH 5KSVA 2R1XB 1HXYB 3K2UH 1T3FB 4Z7VF 1IC4H 1PEWA 5TPWH 2W65B 2P46B 4OZFH 1JMXA 1T04A 3LKSB 5KSBE 3EYSH 3IKCB 3U9PH 3WXVL 4XGZB 4EOWL 1U42A 4S1DC 2GK0A 3BPCA 1SHMA 4HD9A 3DMMC 5GSRA 4JB9H 1CLOH 4CUCA 1FYTE 4PJDF 3L5WA 4Z7VA 5T33H 1UXSB 1NL0L 4OZHF 1II4E 4HWZB 4QY8A 4GG8B 5D2LB 3LY6A 1NUFA 1A7RL 3L3OB 2VNCA 3BP4A 4ACPA 3N1MC 1CGSH 4WO4C 1FH5L 2WINB 2EXWD 1Q0XL 2B4CC 1IMHC 3BJ91 1CGYA 4NC0B 1HH9A 1JNHA 3DX7A 4I8DA 4MA7H 3T2NL 3MRCB 3UAJD 1NUGA 2NNAB 3MRDB 3TCLB 1ZHBB 1KG0B 5CUSH 4U3HA 5GGTA 4D0BA 3F5WA 5GS1C 4NZTL 5LBSL 2N7BA 3AU1B 3S7GA 3A67L 3UYRL 1EAPB 4YXHL 3VA6A 2QQNH 4YJZL 2APFA 1SVZA 5FYJL 1A5FL 5F9WC 1A1OB 4Z0BH 2Q8AL 4LLQB 2BNRD 4WFGE 1H8SA 3MBXH 3RIAF 1OAYL 2FNBA 3HE7B 4QT5A 5E9DA 1C5BH 3RWGB 3ARGC 1FVDA 2D4DA 3S5LB 4OF6A 3DV4A 2XWJA 3PHQA 5ITBH 1IQWL 3HMWH 1Q9KB 3JUZA 1YNLL 1MQKH 4HGMA 4XMKH 3WSQH 3A6BH 2BHZA 3K80A 4HHAA 4PJ7B 3LHPH 2DTSA 1NC4D 2HVJB 5D6CA 3WNMA 5C0FA 4YHLH 4UQ2B 1CXEA 3RNQA 4PJ8B 3TH2T 3TN0D 1J1PH 2X9YA 3CCHA 5C86A 4Y1AD 1INQA 4LDLB 1S3KH 1OAZL 1N6QH 4ZS7H 2KUTA 5FHAL 3T0WA 4U1SB 1JL8A 1NMAH 5LGHL 2GKIA 5BRZE 1F6AB 3HI6H 3S35L 4CVUA 2YZ8A 4R7NA 1JHLL 2Q8BL 4W4NA 2AJ3B 3U36B 4Z8FH 3RWHB 4M03A 1ITBB 3P9LA 3GSVB 1N5AA 1YMMA 3QWRD 4RAHA 5IBTH 4CMHC 1GGTA 4EDWH 2BNQA 4HWEH 5IG7A 2E7BA 2X9WA 4OQTH 4JFOB 1TQCB 3KAAA 2R23B 1I85C 2H9GB 3MJ8B 4IJ3B 1LEKA 3RDTB 1KN2L 2QSQA 4K7FB 3K46A 4BH8B 3VXUB 4QHMB 2D31A 4YK4C 4AG4L 1EEQA 3TZVB 1VDGA 2QSVA 2NR6C 3CIQA 1UZ8B 1TJGH 1H3GA 3PGFH 4M7KL 1RZIA 2F19H 1T7VA 5FEBA 1RJCA 3IXTB 3FFDB 5IGXH 2GUOB 3SCMC 4WRLA 1RJLB 3P0VH 1ZVYA 2EE6A 5HPMA 3I02B 5GSVB 1KCUH 3MV9D 3ULVL 4U7SA 1T0NB 4CADB 4LIQH 2EDDA 3EO1A 1U3JA 3GHBH 4MCZB 4K3JH 5IMLA 3O3BB 4AL8H 5ESQB 3VXRA 4OCWH 4IRSB 4QXTB 4JG1L 1ZHNB 2J8HA 1JPGA 3MQIA 4NUJB 3WFBH 4HKZA 1G7MB 4HGWA 4NO0B 1NCUA 1MI5E 4WFHE 4NN7B 5ECJE 3FQTB 5ID1B 4FFVC 5DDHA 3GSRB 3W11C 3X14B 3E8UH 4OV5A 3GMPB 3I6KA 4K3EH 1KLGA 3A67H 5E8NA 3QAZB 4J3VA 3PWNB 1BFSA 1BGXH 5AUMA 2NY1D 4S1QL 3QIBB 4UMGA 4F15B 1U9KA 4RFEB 4ZOEA 1T21A 5J8OA 3ARWA 2EYRB 1BD2D 1SJEA 5I76A 5CEYB 1G9NC 4WENB 5JIPA 4RMTA 1J05A 3FCTB 2W1NA 3HPJA 4NJ9L 1TMCB 1LDPH 5DJ8B 1S9VA 4ZMAT 5EU3A 1DSFH 1CD0A 4R4FH 4PRPB 2IADB 3L3KB 3NFNA 3NPZB 2AW2A 2BOBB 1U8HA 3A6BL 1QFWH 3LV3A 1G7LB 1HNFA 5I6XC 4HIJA 3F12B 3E3QC 3TF7C 1IEHA 1XR9B 3RVWC 3AAZB 3OKLB 5EN2A 3C60C 4EI5C 2JJUA 4J3UA 1GGUA 1QHPA 5JMRA 1RFDH 2Z92A 5I8OL 5KSBF 4YPGA 4NUGH 4XMPL 1L0XA 1D5XA 3MROA 3JV5A 4X5WB 3LRHA 1PZ5A 3G5YA 5BZDA 2VKXA 1BZ9B 1O0VA 2VH5H 3EFDL 4M6ML 3M17A 3KPRD 3TM6A 2QQQA 3R8QA 3MREA 2FSEB 5DYOB 2CO6B 4S1DD 1BF2A 5FGCB 3B9KB 3E2HB 1NDMB 1U8PA 4P4RB 4Q9RL 4GKNA 4KZEH 4MDIB 3H6JA 4RMQA 3CFBB 4GLRH 4KUZH 3QUXC 1TNMA 3HZMA 4PJEE 4TQEH 1X5ZA 2GT9B 4K7FA 2ZCHH 4N0UB 1FL6B 1RZFL 1BWMA 5D93C 1WVZA 4EKXA 4BFIB 5D1QC 5GXBB 4U1IA 5C0CA 3DVNB 3GGWB 1MRCL 4Z9KB 3VFPA 3ZKQD 4MNQB 2RB8A 3AM8C 1LO0L 3GB7B 5KVMC 5DS8A 1T2XA 1CFBA 3CVHB 3RHWF 4K7PX 1U6AL 5CCKL 4HKJB 2IAMB 2YK1L 4ZUTB 3LRSB 1TVHA 4GT7A 4TNVK 3IT8D 4YH6A 4OBRA 3ZTNH 1CK0L 1P4BL 4X6BB 1XF1A 4BQBA 3P0GB 2NTSP 4JGJA 3LPWA 3S35X 1MPAH 2C1PA 4H8WC 4WUUA 5GRWA 3GKWH 2BHUA 5J11C 1KLFA 2H2PC 1VGEL 2VABB 4JN1L 4YIQB 4L3EA 3KPMB 1QSED 1P7QD 2PW1B 2OL3A 4G80A 1KIPA 3HPLA 1LEIA 1ZEAH 4QHLB 2GK2A 5DWUH 3QXTA 4NKDB 5IIEB 3BP7B 5FO7B 4ZYKB 3HNTH 1HHKB 4OKVB 3MOBH 3DXAE 4XBGB 4I0PD 3SPVA 2QHLA 4NHUA 2E27H 3SO3B 2HG5B 3H9SE 1RUKH 3RKDC 3IFOA 1F13A 3FT3A 4O9HH 4E5XB 4PRDA 3FO9A 4S1QH 4BZ1L 1LWRA 4JY6B 4OM1H 2PTUA 2A6KB 2D7QA 2O93L 1P4LB 1H0DA 5IB2A 5F9AC 2BK8A 1AD0B 1PQZB 3QEGH 1J88A 4YDVB 4OZIF 3U4BH 1P1ZA 3IDMB 3LQZB 2A0LC 5EWIH 2OI9C 2NNAA 4KDTA 5JOPE 3H2WA 3QUXD 3TIEA 4XX1G 4PJXB 4JLRB 4PRBB 1S9KC 1MVFA 3VE0B 1A7PL 4FNLL 4ONGH 4OLWL 1V05A 1TVDA 3NPSB 2B7DT 2NXZD 1PYWB 1T7WA 2BNRB 5C9JB 5MEQB 3TNNA 1EEYB 3CSBA 3OKOB 3O3UN 1AQKH 2CIIA 3FONB 4IOSD 1FYHB 4LPVA 1BVKB 2Q86A 1CZ8L 3MOAL 1V7NH 3VFGL 2BNUB 1NGYB 1M71A 3BAEH 3BEWA 4L4TB 4PJEA 3O6FA 4XH2B 1U0QA 1RK1A 3V0WL 4K2UL 4K71C 4N8VG 3G04A 4D9QE 2EICA 2XWBA 3AS0A 2VZOA 3EYSL 1FNLA 1J0ZA 4XVUC 1ZTXH 3VJ6B 4TRPH 4R90L 1LO5B 1Z9OA 1F4YL 3MCLL 1GPOL 1AO7E 1X5AA 2I5YL 2UVEA 3ZLQC 1IAOA 4HJ0D 3T1FB 1NL0H 3VA2C 2J6EL 3K7UA 1AD9B 3QDME 5D7JA 4ZPTB 2AEQL 4GXVH 5EBMB 4Z5RA 4ORGA 3ARQA 3ARGA 3WLWC 1YEIL 1RZFH 4F7EB 2AJYH 3O6FD 5A16A 1NCTA 3LMJH 5EOCL 3T2NH 4PLNC 2XZCH 2D7OA 1JTTA 2XKNB 5I2IB 4YHNA 4FQIL 4Q97A 3GIZL 4G6MH 5MP6L 3OXSA 3ZYIA 5ICXB 3RDTD 2A2QT 1LE5B 4OZGE 2JJSC 1AGBB 4KZDH 4ZTPH 5F88A 1A6AB 5ID0B 4LPXA 5KS9E 3KJ6L 5I9QB 3RIFF 1L0YA 1YC7A 4RZCA 5ACMA 3W11D 5FKPB 3DX6A 4E42B 4PD4J 2GTWB 4Y5XA 2HWZH 3TZVD 4L8CB 3PGDA 2NY1C 4UINH 3JVGA 3GKWL 5H2BA 3U2SB 1T2QH 1MHHB 2VXUL 4JRYB 5HVHC