3HGNA

Structure of porcine pancreatic elastase complexed with a potent peptidyl inhibitor fr130180 determined by neutron crystallography
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined High-Resolution Neutron and X-ray Analysis of Inhibited Elastase Confirms the Active-Site Oxyanion Hole but Rules against a Low-Barrier Hydrogen Bond
pubmed doi rcsb
molecule keywords Elastase-1
molecule tags Hydrolase
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3hgnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3hgnA01
2FOBA 4E05H 3MOCA 3BTEE 2AIQA 5C5NA 1HUTH 3CS0A 2OINA 1RXPA 1ZMLA 4X6OA 2ZQ1A 1SQTA 1TONA 2C4FH 2FOMB 2GX4A 1P57B 1UTMA 2GDEH 1FDPA 3BV9B 1HAOH 1C2DA 1N8OB 2FTMA 2QY0B 3SO3A 3BG4B 6LPRA 1Y3XA 1DOJA 1HAZB 4Z0KA 2A4GA 2D8WA 4F4OC 4X8SH 4X1RU 5JB9S 3UTUH 1YCPK 2P3UB 4CHAC 1NRPH 3MH6A 3TJOA 1O3AA 2ZU2A 3ATWA 3MNBA 5JBAS 1SGIB 2FI5E 1LO6A 1O32A 2FYQA 4ESTE 4GSOA 1XUHA 2G51A 2ZIQH 1ZMNA 1VR1H 3QZRA 2HALA 1KXEA 3T25A 3P95A 4FUEA 1O3JA 1FAKH 2O8MA 1RS0A 1D9IA 1HV7A 2ZDLA 4YTAA 1AO5A 3MHWU 5EXLA 2XBVA 3RU4D 1VJ9U 3VB6A 2JH0D 1HIAA 1G3EA 3AW0A 4CH8B 1ZJKA 1TQ0B 2STBE 4U30A 4ABFA 5K7RA 2OTVA 5F8TA 4UE7H 1ZTKA 1G32B 1GI4A 2O8TA 1GMHG 4OS6A 1AQ7A 2Z9LA 3MH7A 1QBVH 4B73A 2J34A 5J4SA 2ZPRA 1H9LB 5FBIA 1IAUA 3SU1A 1A5GH 2FDAA 4YZUA 1V2RT 1JWTA 3ENSB 1K1NA 1OXGA 1UVOA 4CR5A 1JOUB 1Z8IB 1TB6H 1IQKA 4B74A 3GYMA 3TJUA 1A0LA 1DANH 4X2YA 1Z7KA 3SNAA 2BOHB 2GZ9A 3GY7A 2A7HA 1ELTA 4CBOA 1O30A 4RKOB 5DO4H 4A6LA 3NKKA 3M61U 5A8YA 3EYDA 3PMHB 1K22H 1O2KA 2J2UA 3FP8E 3UQOA 5L2YH 4R8TB 1BJUA 4BXWA 1ELAA 1RJXB 5EPNA 4I7YH 1ABJH 3T5FH 4NWLA 2OC0A 3FP6E 1MBQA 1NM6A 2PV9B 2ZU4A 1NFXA 1E37B 2Y81A 2BD9A 2AGEX 4Y76A 3RXDA 2ZDNA 4FVBA 1ZRKA 3OU0A 2F9BH 1DXWA 8LPRA 4FU7A 2AFQB 2AMDA 1Y3YA 1AI8H 3T26A 2PKAA 2FZZA 2GDDA 1QTFA 1EPTB 1G9IE 2ZEBA 2NU4E 3MU8A 1ZGVA 1CHOF 4KGAA 1S83A 5AHGH 2Z7FE 2FS9A 1UTLM 3GOVB 1UVSH 2ZCLP 3P70B 1V2QT 1GBAA 4X1SU 7GCHG 5E0HA 4Y6DA 1Z6EA 3A84A 4MNYA 4MTBA 3GCHB 2G5VA 5F8XA 2Z3DA 3Q3YA 4JZFH 3O8DA 3RLWH 1XUIA 5EOKA 2FP7B 1UK3A 2I6QA 1GI6A 1AVGH 1W12U 1FY5A 5DPAA 5EW2H 1CA0C 4YLUA 2ZCHP 2A31A 2D1JA 1GMDG 3S9CA 4ZAEA 2GMTB 1TGTA 5T6DA 4BAMB 1KXAA 1O5GH 4D8NA 2WPLS 2A5IA 2ALPA 2OP9A 2PSXA 2TRMA 1CHOG 2HVXA 1P03A 3ATLA 1MCTA 4Q7YA 3SUFA 1P05A 3SZNA 1RIWC 2H6MA 3A89A 1PPFE 1C2GA 4X1PU 3ZVCA 2AMPA 1INCA 3PO1B 2ZFRH 3OYPA 4ZXXH 3IG6B 1NU9A 5FPYA 2CJIA 4KTCA 4WH6A 5A8XA 1MTNB 2XW9A 3RXCA 3S9AA 3DUXH 1O2UA 4BTIB 1VCPA 4QT8C 3PLKA 1Y8TA 1O2PA 2BOKA 1GBKA 2ODPA 1B5GH 1DS2E 1PQ5A 1EAXA 4ABHA 1N6YA 2ALVA 2BDBA 3EAJA 2ZGHA 1P06A 1GDQA 1QA0A 2ZDVH 1GJDB 1PQ7A 5I25A 1Q31A 2Y7ZA 5EXMA 3HGPA 2XC0A 4NIVA 1MZAA 4WWYA 1ESTA 4A1TA 1GHBF 3F6UH 1BRUP 3M5NA 1C5OH 1TX8A 2PGBB 2WPJS 5FX5A 1O2HA 3WY8A 5J4QA 1GWAA 2J38A 2ZC9H 1EQ9A 1V2KT 1D6WA 3LH3A 2BXUH 4DGJA 1S6FA 1LVBA 1BRCE 1OWIA 1C1TA 4CRFA 1ETTH 3T28A 3SV6A 1TPAE 5HM2A 1ELEE 2Y6TA 4FUDA 3UREA 3RXSA 1V2TT 1TLDA 1TMBH 1XUJA 4INHA 3MH4A 1L1NA 1F5RA 2D2DA 5EXNA 2TIOA 4XE4A 4ZROA 1SGPE 4WH8A 3MNXA 3W95A 3FZZA 1PPBH 3E16B 8GCHG 1ID5H 2A4RA 3HPTB 2RA0A 1P3CA 2AGGX 2FIRH 4FUJA 5AFZH 1GHBG 2QF0A 5FPSA 1GI3A 3BF6H 5B6OA 1QJ1B 2CV3A 3UWJH 4TPYA 4DCDA 1A46H 1AVXA 1J8AA 3PLBA 1C5UA 2OBQA 1X7AC 4H42U 2J95A 1HPGA 1O3MA 2QYIA 4AFQA 3QWCH 4X8VH 4FU9A 2NU2E 4HFPB 3ZZ3A 4NA8A 1XUKA 1BT7A 1O38A 1AIXH 6CHAC 1FMGA 1W7XH 1ZGIA 4XBCA 1GJ5H 3RXTA 1EB1H 1YPJH 1SGQE 2A45B 3BTKE 1GJ4H 3AW1A 1C5MD 7LPRA 5FXLA 2H1UA 3ZZBA 1UTPA 4I8GA 3VGCB 4FVDA 1KTTB 1W3CA 2ODQA 2TGPZ 4D7GA 1TPOA 1GI7B 2ZU5A 3MTYA 2HRVA 3SJOA 1Y3UA 4ZKNU 3QDZB 3BIVH 1DM4B 1QURH 4CREA 3OY5U 2QXIA 1TALA 1GGDB 1XMNB 1AFQB 1DWDH 1JIMA 1QCPA 1S5SA 2RA3A 4JYVH 2FTLE 1P12E 3GDUA 1GBTA 4AYVB 2M5TA 2O9QA 1F0RA 2ODYB 2W3KA 2BDHA 4BTUB 3LGVA 1BTUA 1GVLA 1C5ZB 1SGFG 4ISLA 1C5WB 1L1JA 1DICA 2CN0H 2PKSB 3E1XB 3MU0A 1D3QB 3U8RH 2HWLB 2NWNA 3TNSA 3UNQA 2XBWA 2J4IA 4AN7A 1TBQH 1CVWH 4B2AA 1BRAA 1SI5H 2Y5GA 1WQVH 4Y7BA 3EA9A 1A5IA 5EQSA 4DIHH 4MVNA 1V2UT 1O2VA 4AX9H 3M7UA 3RMOH 2A1DB 1C9TA 3ELAH 2FI4E 2Z9GA 2BYAX 1F92A 4YT6H 3S69A 3A8BA 1C4Y2 2BZAA 1W8BH 2Y82A 4OS5A 1OWDA 2HNTC 2IPHA 3P6ZB 2OCVB 1ZMJA 4K8BA 3ZZ9A 2CF9H 2QCYA 1TMTH 4AG2A 1BHXF 2ASUB 4NZLA 5GIBA 3LDXH 3TGKE 4YM9A 1QJ6B 3LONA 3PV4A 2D26C 1GBMA 3RXQA 1GI8B 4SGAE 2FOHA 3S0NA 1TPSA 1AU8A 1E38B 1YLCA 4ISOA 4YOIA 1TA2A 1C5RA 1XXFA 2HPPH 3QK1A 4K1SA 2J92A 2ZI2H 3KQCA 4NSYA 5DP4A 3RC4A 3EA8A 1ABIH 1T31A 1CA8B 1H1BA 5L6NH 2VIPA 1GCTC 1K9OE 4CRAA 1PYTD 3I77A 4ZKSU 1S84A 1KSNA 1BA8B 2BY6X 1FI8A 1CT4E 1V2WT 3BTDE 3RXVA 5C2ZA 3RC6A 3KQEA 3SHAH 3GY2A 1FN8A 2ZF0H 3PMAB 5JBBS 1O3KA 3L33A 3MO6A 3NPSA 1WTHD 4GVUA 3A83A 2YNBA 2QC2A 3BEIB 3F1SB 3SU3A 2FX4A 1HJAB 2WV5A 1GBDA 3RXBA 1LHGH 4TY6A 2XTTB 3MFJA 1P10A 2JETB 1HAPH 1O2YA 1EX3A 3ZVEA 1WBGB 1HLTH 1KXBA 4U32A 2EI8A 8KME2 5LPEA 1UTQA 2SGDE 1VITG 1EJAA 3F68H 5CHAB 1QB6A 2OD3B 4WMFA 1PJPA 2V3HH 1LDTT 1O2JA 1W0YH 1ANEA 1H8IH 4JCNA 1C1PA 5DJ7A 3ATIA 3H7TA 1P2JA 3QO6A 4ZMAH 1A61H 3F9FA 1ELDE 3MMGA 2AH4X 3SJ8A 1XKAC 3BTHE 4Z6AH 1DWBH 4I33A 3LGWA 1ELCA 1IQIA 1ZSJA 1P04A 1KXFA 4ZKRU 3VPKA 4IGDA 3LH1A 1QB9A 1Z6JH 2ZDAH 3MNCA 1IHSH 3E0NB 3UQVA 1EZUC 4HZHA 4YOGA 1AY6H 3VEQB 2K1QA 3MU4A 2ZWLH 1BUIA 1Q3XA 5ESTE 3ZZCA 2ZZUH 1HYLA 3BIUH 1BB0B 4I8KA 1KLTA 3UFAA 3TITA 1TOCB 3B23B 5E0GA 2O8UA 5FCKA 1IQJA 2G8TA 3Q3KA 2F3CE 3IITA 1EP6A 4H4FA 9LPRA 1HAXB 3K2UA 4BOHA 2BHGA 3LJOA 1W7GH 2TGTA 1V2ST 1PYTC 1UVUH 2EA3A 3SQEE 1W13U 2ZU1A 2A4QA 3MH5A 1MH0A 2OLGA 2SFAA 4Y7AA 3S7HB 4O03A 4Y8ZA 3I78A 9ESTA 3SQHE 3RMLH 5DK1A 1T8MA 1RTLA 1K1IA 1DE7H 1N6XA 3A7WA 4KTSA 1A3EH 2PTNA 1C5VA 5DG6A 1PFXC 1BIOA 4JZIA 4X6MA 2B0FA 4AGJA 2ZP0H 1UTKA 4FXGH 3ZVFA 1FV9A 1OP2A 1QQUA 4BNRA 1PPHE 1G3DA 1XUGA 2F9NA 4AFUA 1FY1A 3P92A 1UMAH 5TCAA 1VCQA 1P9UA 2TGDA 3Q76A 4NCYA 2PSYA 2P8OC 2WPIS 1GMHF 4ZUHA 2FOAA 1O37A 1O5DH 1EXFA 2TBSA 4FUGA 3MNSA 2PWXA 3BTGE 2ZECA 1LQDB 1YCPH 3DFJA 4DG4A 2VU8E 1MKWK 1O2LA 1SGYE 2ESTE 1ZTJA 1DWEH 1BMLA 5K0HA 1GHYH 1YC0A 2DE8A 1O2SA 4XSKU 1B7XB 3TH2H 1LCYA 1L1GA 3A8CA 3P8NA 1A7SA 4TWYA 1E36B 1AZ8A 3E3TA 1QRWA 4ABDA 1MKWH 2F9PA 2PGQB 3V13A 2SNVA 1LVOA 3F9HA 4K1EA 3ZVBA 3E6PH 4CRGA 1OS8A 3UIRA 4O3UA 1SGCA 1Z8JB 2W26A 1SFIA 2H5DA 1K1MA 2C90B 3QTVH 2OBOA 1GHWH 3SV7A 4FUHA 3SNDA 1UTJA 4ZKOU 2P95A 3HATH 4X6PA 2XWAA 2BD2A 3A8DA 2WPHS 3I29A 1AE5A 2EC9H 3R3GB 5LPFA 3PYHA 2C3SA 5JBTA 7ESTE 1GI9B 1O3GA 3UUZA 4LZ1H 5JYIA 1D3TB 3TIUA 1BMAA 1DFPA 5JPMH 1HRTH 3KCGH 1O3LA 2HNTE 1GBHA 4B71A 3PTBA 4Y8YA 3GY4A 1O2IA 1ZRBA 2Z9KA 3C27B 4ABGA 1Q2WA 7GCHF 1Y5BT 1RGQA 5L30H 1O2OA 5TJXA 3TJVA 3JZ2B 1FY4A 3KEEA 3RC5A 1PPEE 1TWXB 2W7SA 1GBLA 4DOQA 2C8ZB 1QL7A 3HGNA 1HJ8A 1C1RA 1P2KA 3LGUA 1DY9A 3D62A 1BITA 3M35A 3LT3A 4B76A 1ETSH 1J16A 4MNVA 1O31A 1LQEA 4A92A 1EPTC 4BAQB 5A8ZA 2QF3A 4XFQA 1GMDF 2Z3CA 4XBDA 1QB1A 4Y10E 3VB4A 4MQAA 1GG6C 4AFSA 1GDUA 2R3UA 3LC5A 2B8OH 4LOYH 4LXBH 5FCRA 3GICB 1SPJA 3MWIU 1O39A 1YPEH 2FI3E 1CT2E 2VNTA 1BZXE 1MQ6A 2Z6BD 1XUFA 2PLXA 1A2CH 1QL9A 1S0RA 3B9FH 3S9BA 1GI0A 2BM2A 5DKMA 1TBRH 4Y79A 2V6NA 1WYKA 4JZDH 1O34A 2NU0E 4I32A 3M7QA 2UWPA 1E0FD 1BTWA 1TFXA 1PQ8A 3BEFB 3A7XA 2SGPE 4BTTB 1J9CH 1MTVA 2RCEA 1A4WH 2FLBH 5E8EH 1NFUA 1KIGH 2BZ6H 3T27A 1KLJH 1J17T 2F91A 2GP9B 1LPZB 2BY7X 1WUNH 1YPMH 1DDJA 2WPMS 1QFKH 1HB0B 1T8LA 4YESB 5LGOA 2QAAA 2GCHG 3F9EA 1CBWB 5HMAA 3PO1C 3TJNA 4MPXA 2ZDMA 4IN1A 1AFEH 3RXRA 5E2OA 1CA0B 1SHYA 2BDAA 5JB8S 1V2JT 2H5CA 5GJ4B 4UONA 2H9TH 2BLWA 5T3HA 1C4V2 1V6DA 1AWFH 5FX6A 3LIWA 1HAIH 2VIVA 1O2MA 2AIPA 5AVDA 3A81A 1K1LA 4DURA 1G2MA 4UFGH 1S0QA 4MNWA 1DXPA 5CMXH 2A4OA 3Q3XA 4GCHF 1K21H 1UCYE 4X0WU 4J2YB 3V7TA 2XRCA 1HGTH 4K3JA 4CRBA 1HXFH 5AFYH 1OYQA 3CS7A 2BD7A 4Q7XA 5ESBA 1C2HA 8GCHF 1NRRH 5T6FA 1XX9A 4DW2U 4WXIA 1GJ9B 2BTCE 3SI3H 5AF9H 2UUJB 5C1XA 1GHVH 1OPHB 3MYWA 1O3OA 1SL3A 3BTQE 1V2MT 1A5HA 1MD8A 1NO9H 3NWUA 1S81A 3Q77A 1TNGA 1YBWA 1B0EA 3TPIZ 4K69A 2FODA 3LGIA 1DT2A 1YPHE 1O3HA 1NFYA 1KTSB 2Y5FA 1K28D 1EOJA 1P2OA 4UFFH 1K1PA 1GMCG 2G00A 2GKVE 1SLVB 1H4WA 1GCDA 2BX3A 1LKAA 1MCVA 1SLWB 2R2WU 4GCHG 4ZXYH 1GBIA 1AB9B 3FZDA 5C3NA 2Z3EA 1ORFA 1DLEA 5DGJA 2VGCB 1GJ6A 1FLEE 1CE5A 4IS5A 1V2PT 2WPKS 1HCGA 2JH6D 3GCNA 2F9UA 3O8BA 4K60A 1KLIH 4GPGA 1DPOA 1TNJA 2AS9A 3RXKA 3VB3A 1EJNA 3ZVDA 2PR3A 3TH3H 2OC7A 3B8JA 1TGSZ 4CRCA 2WV4A 1KXDA 1C1UH 3A85A 1BDAA 3RP2A 3BTWE 4UFDH 2C8YB 3URDA 2FOCA 1MZDA 4TPIZ 5DP8A 2C8XB 2FOFA 3TU7H 3LPRA 3UOPA 1D3PB 3FAOA 1ANBA 3F9GA 4IC6A 3SUDA 4ZHAA 2BD5A 4FUIA 4I8HA 1GJCB 3VGCC 2UUYA 4NIXA 1QHRB 4ZHLU 1YF4A 1TBZH 3A86A 1TNLA 3RUOA 3M5OA 1ZR0A 2AGIX 1F5LA 1M9UA 5EW1H 3E90B 1O2ZA 3UR6A 3DD2H 4FUFA 2UWOA 3RLYH 1EZXC 6CHAB 3E91A 1LHFH 5HGGA 1TRNA 4KP0A 3MU5A 1G36A 1DLKB 4YO9A 1O3DA 2VB0A 1ZJDA 2A7JA 1Y3WA 3NK8A 4UDWH 1C2KA 1P02A 1QIXB 3U8OH 1EAUA 4OGYA 4E7NA 4MPVA 3U1JB 1GVZA 3A80A 4K1TA 1ZPBA 4JYTA 1VCWA 1AKSA 4D9QA 3RDZA 4GHTA 3V3MA 2UWLA 1GBFA 1NC6A 4MNXA 4XOJA 5A0AE 5FPTA 3QN7A 4IBLH 1UTOA 1HAVA 1G3CA 2J94A 4KTUA 6GCHG 2B5TB 1EKBB 2QV1A 4WJG2 3BSQA 1THPB 1BQYA 1JBUH 3UWIA 2BDYA 1QRZA 3MO9A 4ISHH 3UY9A 4OS7A 2RG3A 1YLDA 4FU8A 2VVUA 1C2JA 1ZPCA 2LPRA 1V2NT 2GGVB 2A32A 1MAYA 3HKJB 4AORA 1L4DA 3VXFH 2Z9JA 2GCTC 3K6YA 3UOUA 2IOTA 1GVKB 3V0XA 1P09A 2ZTXA 4D76A 2FWWA 5E2PA 2ZFTA 2A7CA 3M5MA 4Q2KA 1TE0A 1TAWA 2VWNA 1JXPA 2XCNA 3Q00A 5C1YA 1RTKA 5A0BA 2Z9IA 3NCLA 2O8WA 1HAGE 1O2RA 1IQNA 2FPZA 1C1SA 5ABWA 8ESTE 3SJ9A 2Q6GA 1WQSA 3HK6B 1D3DB 4K5ZA 3OX7U 1DX5M 3DT0H 5SGAE 3SU0A 3HKIB 2HLCA 4AZ2B 4DT7B 1P8VC 1O2XA 2PHBA 1ESBA 1SVPA 4X8TH 3OTJE 5IDKA 4X1QU 1Y59T 4AB9A 2ZGJA 2VIQA 3RU4E 5H4IB 3MU1A 5A0CA 5LH8A 5C1UA 1CGHA 4I31A 1CT0E 2GVFA 1LMWB 1S6HA 1SLXB 2GZ7A 3LJJA 4NFEA 1BTYA 4D9RA 1QA7A 4GAWA 3SGAE 1VITF 3U1IB 1CSOE 4MG3A 4JK6A 3SV2H 1ZSLA 2BY9X 2QXGA 1QR3E 4NIWA 3LOXA 4J1YA 1V2VT 1XVMA 3SBKA 2Q6DA 1MQ5A 4X2WA 1QRXA 2WYGA 2ZHEH 3GY6A 3SU6A 2ZFQH 3TGJE 4K8YA 2FEQH 1C5XB 2FXRA 1NRSH 3STIA 1NESE 1CGJE 3VB5A 2P94A 4IMQA 1E35B 4O9VA 2FM2A 2ZFSA 1AWHB 1SGTA 1FY8E 2ULLA 1WTGH 1GCTB 2JETC 5GWZA 2H2ZA 1W2KH 2BQ7B 1TMUH 1TGNA 1IQEA 2W3IA 5A09A 2ZCKP 3A88A 1C1MA 1SGDE 5LPRA 3UR9A 2HGTH 3L6PA 1XKBC 2YOLA 1C2EA 1P3EA 1HNEE 1NT1A 1F2SE 1EB2A 1C5SA 2AMQA 4WMEA 2RDLA 3E8LA 1QGFA 1LKBA 5IYTA 1SLUB 2WINI 3EDXB 1S85A 5GPIB 1RTFB 6ESTA 5L2ZH 1TNIA 3PMJA 4DJZB 2ZGCA 3RXOA 3EGKH 1SR5C 4NWKA 1P2MA 4A1XA 1FZZA 1UCYK 1FNIA 1P2QA 1JRTA 2JKHA 1VJAU 3SHCH 3SW2B 2VH0A 4ISNA 4IW4E 2GD4B 1F0SA 4R0IA 3SV8A 1ZHPA 4VGCB 1IOEA 2VJ1A 2AYWA 4TWWA 5JDUB 2Y5HA 1E34B 3NUMA 1AUTC 4ABEA 4OGXA 5GCHG 2FS8A 3QTOH 5GXPA 1UCYH 3ZZAA 2PFEA 1O2WA 4A5TS 2THFB 3RXGA 3SNCA 1IQGA 5EPYA 1PQAA 3DHKH 1J15A 2TGAA 1F5KU 1SGRE 2BDGA 2VIOA 3M3SA 4SGBE 1OOKB 3A7VA 4MLFB 1W14U 3BEUA 1UK2A 4JMYA 1GHAG 4PROA 1SQAA 2CHAB 4Q7ZA 4INLA 4GUXA 4U2WA 3KL6A 2VVVA 3DFLA 3P8GA 1XM1A 1MU6B 1VGCC 5EGMA 1AGJA 1G30B 1BBRK 2C8WB 1UVPA 4X6NA 4Y0YE 1ESAA 1AD8H 3ZVAA 2FESH 3A7YA 2VVCA 5E0JA 1ZZZA 2XWBI 1K1OA 1Y3VA 2ZPSA 2KAIA 1C5QA 4TY7A 2PUXB 5TCCA 3QGJA 3ZZ6A 3KNXA 1AE8H 1SOZA 1PPCE 4ASHA 3RXLA 1MTWA 3ESTA 4Y11E 4IC5A 1BBRH 1ZLRA 1KDQB 1N8OC 1EZSC 3BG4C 1WV7H 4ZHMU 2ZKSA 4E06H 3U69H 3KF2A 3K65B 4ABBA 5EG4A 4I8LA 4Y71A 2GT7A 1CQQA 1YKTA 1OSSA 4CR9A 1TGBA 5EQRA 1O33A 2QXJA 3O8CA 1FPHH 3LGYA 2QXHA 3PLPA 2UUKB 3KIDU 1YPKH 4FUCA 1OWKA 1A0HB 1P9SA 3ZV9A 3SUGA 2O8LA 1GJAB 1O3PB 1B0FA 1SFQB 1FQ3A 2YNAA 3TK6A 3TK9A 3GY3A 3T29A 3M3TA 2BD3A 1GDNA 4KKDA 1H9HE 3ITIA 1F0TA 1BTHH 4CHAB 1TPPA 3D23A 3AASA 3TK5A 2P8OB 3P8OA 3CP7A 1H9IE 2CGAA 2FOGA 3QX5H 2NU1E 5EU8A 1O2NA 3S7KB 1UK4A 1O5FH 1Y5UT 1EJMA 1SGFA 5EODA 1FAXA 3SGQE 3AAVA 3SV9A 1FN6A 2W7UA 2V0BA 1EP5A 2BLQA 1FIWA 1QL8A 4MPUA 4OS4A 3K9XB 1Z71A 1A0JA 1C5YB 2AERH 1NRNH 2FMJA 1AUJA 1HAHH 1O2GH 3ZVGA 4AFZA 1OWHA 1L2EA 3SORA 1AVWA 2R0KA 2B7DH 1V3XA 5JBCS 1ZOMA 3GYLB 2EEKA 1LHEH 2DUCA 1WCZA 3PWBA 2BD8A 4XBBA 1TGCA 1ELBA 3SNBA 2BD4A 2R2MB 1ANDA 4D7FA 1DSTA 1EAWA 4WXVA 3PWCA 1T8OA 5GDSH 3RXFA 1UTNA 1KYNA 1MAXA 1WAYB 4M7GA 3DA9B 1IHTH 4AG1A 1P0SH 1QY6A 2OC1A 5DP9A 3JZ1B 4MPWA 2A0QB 4E7RG 3FP7E 1GL0E 1TA6A 4FUBA 3H7OA 1KXCA 1MUEB 2ZPQA 1N1LA 1LVMA 3SOSA 2B9LA 2ZU3A 1T4VH 1GJBB 2WUBA 3EE0B 3P17H 2XNIA 1PPZA 3LC3A 2ZDKA 1TNKA 2A5KA 3QZQA 2VINA 3A7ZA 2C93B 1QBNA 1D6RA 5F03A 2QA9E 3NXPA 4WF8A 1AMHA 1DVAH 1OYTH 5DP6A 2GCHF 4KELA 3RXHA 3VFEA 1SSXA 3GCHC 3GY5A 3SJKA 1SC8U 1O2QA 3SN8A 2BX4A 3BG8A 4AB8A 2ZGBH 2P93A 1G2LA 5HM9A 1TRMA 7KMEH 1O5CB 1HFDA 2P59A 5BRRE 1EATA 1OP0A 1TIOA 1MMJN 4XDEA 2Z94A 3U9AH 4BAOB 4I8JA 1C2MA 1GG6B 3SU5A 1AKSB 3BTTE 2BVXH 2GMTC 1KDQA 1UHBA 1FPCH 1C2FA 3FVFB 3RM0H 2H9EH 3MI4A 2IN2A 1DITH 2NU3E 2SGEE 1EOLA 1O35A 1HAVB 1SHHB 4JK5A 3V12A 1T4UH 1YPLH 4OS2A 1CBWC 2GV7A 1O2TA 2XBXA 1O3IA 4RN6A 1GJ8B 1OWEA 4BAHB 1GHZA 1L0ZA 1VZQH 2DE9A 2HPQH 1HDTH 4IN2A 1SGEE 3BTME 4INKA 1ZSKA 3ZZ8A 1SG8B 4NA9H 3R0FA 1NS3A 1MTNC 1ACBE 1OX1A 4F49A 4X2VA 4ABJA 3ODDA 3TGIE 2ANWA 2XC4A 3PMBB 4ABIA 4H6SB 1C5PA 2VWOA 1NU7B 3GCOA 1J14A 1GMCF 2VH6A 3SNEA 2GV6A 1RIWB 1Y5AT 5C5OA 2VIDA 5HYOA 1P2NA 4CH2B 2WUCA 1ZHRA 1A1RA 1GL1A 2ZTYA 2ZHFH 3PB1E 1NFWA 4B2CA 3ZV8A 2QGRA 1BTZA 2ZQ2A 2FYRA 4X1NU 1YPGH 2V35A 2P3FH 3IWMA 1HJ9A 4ZH8A 2G4UA 2R0LA 1Z1IA 3SUEA 2A2QH 1AB9C 1RD3B 2JH5D 3AVZA 3ODFA 3TVJB 1SBWA 1JIRA 2VGCC 1BBRE 3U8TH 2BXTH 2VWMA 2WYJA 1KY9A 1O3FA 3RU4T 1CGIE 3NZIA 2G5NA 2SNWA 2G4TA 5F8ZA 1YYY1 2BMGB 1AZZA 3PROA 4K2YA 1WOFA 1JRSA 2F83A 2Y80A 3LGTA 1NTPA 1TRYA 2ZTZA 1O5EH 1LHDH 1O3NA 1PPGE 2ZGXH 2F9OA 1HXEH 1CHGA 5FHTA 2F9VA 1O3CA 2BQWB 1W10U 3D49H 1V2OT 1NN6A 5FBEA 5BPEA 1GBEA 2J9NA 2VWLA 1EASA 3FANA 2UUFB 4U01A 3ZZDA 4HGCA 2ANKH 2HNTF 2PTCE 2ILNA 3A8AA 3QLPH 2BY5X 2W5EA 1V2LT 4IMZA 2SGQE 3A7TA 1A3BH 3ZZ5A 1ETRH 1U6QA 3ATKA 3G01A 1DY8A 4NGAH 2G55A 1MU8B 1ARBA 2R9PA 6GCHF 1ZYOA 1GGDC 1P01A 1AFQC 3RMMH 3MO3A 1GI1A 1C1NA 1IQFA 4ISIH 2OQUA 3EA7A 5ETXA 3T2NA 4YOJA 1ZTLA 1OWJA 4BAKB 4NSVA 3P8FA 3KN2A 1TX7A 4NZQA 3SGBE 1W0ZU 1EPTA 4A7IB 1THRH 4Q80A 3O8RA 1O5BB 4YLQH 4OS1A 1K1JA 1ELFA 2ANMH 4TYDA 3QUMP 3RXAA 3GISB 4B75A 3ZYDA 1NY22 2AEIH 2SGFE 4JZ1A 1C1QA 2PKSC 3SU4A 4JYUH 3T62A 2OC8A 1O5AB 1W11U 1YGCH 2VIWA 2FOEA 3UNRA 1JMOH 2Y7XA 1UJ1A 1BOQA 3H5CB 1DUAA 3RXMA 4B2BA 1TABE 3C1KA 1ZHMA 2BQ6B 5G4BA 1RRKA 1FUJA 1TOMH 1GBCA 1QJ7B 2KAIB 5HXFA 1IQLA 2CXVA 3GCTF 3TLOA 3OY6U 2A2XH 3UPEA 2A5AA 4RSPA 1WU1A 3SU2A 4A1VA 1L4ZA 2ZFPH 2ZHWH 1UVTH 4AOQA 1QNJA 2BY8X 1YM0A 4CRDA 4NA7A 3VB7A 4BANB 2STAE 1SOTA 1BMNH 3LU9B 1NROH 2BVRH 3TH4H 1MTSA 2BDCA 1F7ZA 1MBMA 2GCTB 1QBOA 1GHXH 2SGAA 3RXEA 3M36A 2GZ8A 5I46H 1EUFA 1GBJA 4LK4A 2OXSA 3W94A 1Z1JA 3OSYA 1AHTH 1T32A 1BTPA 2OQ5A 2XBYA 3PM3A 3GCTG 4Y0ZE 2Q6FA 2EI7A 2TPIZ 3E0PB 1C5TA 1ZPZA 1BMMH 1O3EA 5CE1A 1DWCH 2ZO3H 1DSUA 1G3BA 1YCPM 3FFGA 2G81E 1C1VH 3SI4H 3GDVA 3RXUA 1YP9A 3KHVA 1WSSH 4H6TA 3SJIA 2BVSH 2P3TB 1XXDA 2XXLA 2FX6A 3A87A 1ELGA 3CENA 1FY3A 5F6MA 4CBNA 1QQ4A 3RM2H 2H9HA 3GY8A 4GHQA 1HAYB 2BLOA 4RKJB 4O3TA 1C1WH 5FAHA 3QGNB 1GI5A 2ZNKH 1GI2A 3GDSA 2Q1JA 4WMDA 1H8DH 4DVAU 4WY3A 1LPKB 1K2I1 3EQ0H 3A82A 1ARCA 1HJAC 3KQDA 1HIAB 2CF8H 4WVPE 3HK3B 4X8UH 3ZZ7A 4JZEH 4UD9H 5PTPA 1EZQA 1LPGB 1C1OA 3BN9A 1C5NH 1OKXA 4MDSA 1SMFE 1XVOA 4AGKA 1NRQH 4NG9H 1LTOA 5CHAC 5GCHF 4X2XA 1T7CA 3PTNA 2PW8H 1HBTH 2PUQH 2BLVA 1IQMA 1C9PA 4DY7B 1GBBA 4GLYA 1BJVA 3UNSA 2ZG0H 4UFEH 3STJA 5C20A 1AN1E 4THNH 3M7TA 5DP7A 1TYNA 3RXPA 3KQBA 2QN5T 4AYYB 1FXYA 4B1TA 1D4PB 2ANYA 1NZQH 2BB4A 3M5LA 1CU1A 3RXIA 4LZ4B 1GHAF 1GPZA 2R3YA 2V3OH 3RMNH 3ZYEA 3ZZ4A 3LKWA 1P11E 5C67A 2P16A 4VGCC 1LVYA 3URCA 1O3BA 1F0UA 1MD7A 1MTUA 1SQOA 1TQ7B 2XYAA 1MKXK 3L3TA 1Z8RA 2FO9A 2ZHDA 5DP5A 1ANCA 1UO6A 1P2IA 1FIZA 2XC5A 1SB1H 2CMYA 2ZFFH 3VXEH 1FJSA 1S82A 4BXSA 1BCUH 5EQQA 1TX6A 1ELVA 1IQHA 1CO7E 2G52A 1TNHA 1MKXH 2FLRH 1RFNA 3BTFE 5A2MH 2CHAC 2QIQA 1G37A 1BTXA 1C4U2 1GJ7B 4O97A 2HOBA 1C2IA 3KGPA 1O0DH 3ATMA 2OUAA 1Z8GA 1BHXB 1DUEA 5T6GA 4HTCH 3N7OA 2GT8A 2IJOB 4NFFA 2PKAB 1C5LH 4DIIH 4Y8XA 1BRBE 4HI3A 2XCFA 3M37A 1YPHC 2EI6A 1OP8A 2ZHQH 4ABAA 2BDIA 1NPMA 1VITH 3AAUA 1LHCH 1C2LA 4UEHH 1EAIA 1O36A 2ZA5A 1UHBB 3U98H 4YT7H 3D65E 1FONA 2GTBA 1T8NA 2I6SA 2LNCA 4NIYA 3RXJA 1VGCB 1SGNE 1THSH 5DP3A 3K6ZA 3TNTA 3M3VA
chains in the Genus database with same CATH superfamily
4P02A 2FOBA 2YMSC 2W6ID 4E05H 3MOCA 3BTEE 2AIQA 5C5NA 1HUTH 3CS0A 2OINA 1MABB 1RXPA 1ZMLA 4X6OA 2ZQ1A 1SQTA 1TONA 2C4FH 2FOMB 2GX4A 1P57B 1UTMA 2GDEH 1FDPA 3BV9B 1HAOH 1C2DA 1N8OB 2FTMA 2QY0B 3SO3A 3BG4B 6LPRA 1Y3XA 1DOJA 1HAZB 4Z0KA 2A4GA 2D8WA 4F4OC 4X8SH 4X1RU 5JB9S 3UTUH 1YCPK 2P3UB 4CHAC 1NRPH 3MH6A 1E1QD 3TJOA 1O3AA 2ZU2A 3ATWA 3OTPA 3MNBA 3F0OA 5JBAS 1SGIB 2FI5E 1LO6A 1O32A 2FYQA 4ESTE 4GSOA 1XUHA 2G51A 2ZIQH 3MQKC 1ZMNA 1VR1H 3QZRA 2HALA 1KXEA 3T25A 3P95A 4FUEA 4TSFD 1O3JA 1FAKH 2O8MA 3F2FA 1RS0A 1D9IA 3OEHD 2KZ4A 1HV7A 2ZDLA 4YTAA 3KYFA 1AO5A 3MHWU 5EXLA 4Q63A 2XBVA 3RU4D 1VJ9U 3VB6A 2JH0D 1HIAA 1G3EA 3PV2A 3AW0A 4CH8B 1ZJKA 1TQ0B 2STBE 4U30A 4ABFA 1KMHB 5K7RA 2OTVA 2JIZD 5F8TA 4UE7H 1ZTKA 1G32B 1GI4A 2O8TA 1GMHG 4OS6A 2L74A 1AQ7A 2Z9LA 3MH7A 1QBVH 4B73A 2J34A 5J4SA 2ZPRA 1H9LB 5FBIA 1IAUA 3SU1A 1A5GH 2FDAA 4YZUA 1V2RT 1JWTA 3ENSB 1K1NA 1OXGA 1UVOA 4CR5A 1JOUB 1Z8IB 1TB6H 1IQKA 4B74A 3GYMA 3TJUA 1A0LA 1DANH 4X2YA 1Z7KA 3SNAA 2BOHB 2GZ9A 3GY7A 2A7HA 1ELTA 4CBOA 1O30A 4RKOB 5DO4H 4A6LA 3NKKA 3M61U 5A8YA 3EYDA 3PMHB 1K22H 1O2KA 2J2UA 3FP8E 3UQOA 5L2YH 4R8TB 1BJUA 4BXWA 1ELAA 1RJXB 5EPNA 4I7YH 1ABJH 3T5FH 4NWLA 4YXWD 2OC0A 3FP6E 1MBQA 1NM6A 1NBME 2PV9B 2ZU4A 1NFXA 1E37B 3DCLA 2Y81A 2BD9A 2AGEX 4Y76A 3RXDA 2ZDNA 4FVBA 1ZRKA 3OU0A 2F9BH 1DXWA 8LPRA 4FU7A 2AFQB 2AMDA 1Y3YA 1AI8H 3T26A 2PKAA 2FZZA 2GDDA 1QTFA 1EPTB 1G9IE 2ZEBA 2NU4E 3MU8A 1ZGVA 1CHOF 4KGAA 1S83A 5AHGH 2Z7FE 2FS9A 1WXRA 1UTLM 3GOVB 1UVSH 2WV9A 2ZCLP 3P70B 1V2QT 1GBAA 4X1SU 7GCHG 5E0HA 4Y6DA 1Z6EA 3A84A 4MNYA 4MTBA 3GCHB 2G5VA 5F8XA 4FETA 2Z3DA 3Q3YA 4JZFH 3O8DA 3RLWH 1XUIA 5EOKA 2FP7B 1UK3A 5EJLA 2I6QA 1GI6A 1AVGH 1W12U 1FY5A 4HG6A 5DPAA 5EW2H 1CA0C 4YLUA 2ZCHP 2A31A 2D1JA 1GMDG 3S9CA 4ZAEA 2GMTB 1TGTA 5T6DA 4BAMB 1KXAA 1O5GH 4D8NA 5EIYA 2WPLS 2A5IA 2ALPA 2OP9A 2PSXA 2TRMA 1CHOG 2HVXA 1P03A 3ATLA 1MCTA 4Q7YA 3SUFA 1P05A 3SZNA 1RIWC 2H6MA 3A89A 1PPFE 1C2GA 4X1PU 3ZVCA 3GS9A 2AMPA 1INCA 3PO1B 2ZFRH 3OYPA 4ZXXH 3IG6B 1NU9A 5FPYA 2CJIA 4KTCA 4WH6A 5A8XA 1MTNB 2XW9A 3RXCA 3S9AA 3DUXH 1O2UA 4BTIB 1VCPA 4QT8C 3PLKA 1Y8TA 1O2PA 2BOKA 1GBKA 2ODPA 1B5GH 1DS2E 2V7QD 4Q4LA 1PQ5A 4P00A 1EAXA 2WPDD 4ABHA 1N6YA 2ALVA 2BDBA 3EAJA 2ZGHA 1P06A 1GDQA 1QA0A 2ZDVH 1GJDB 1PQ7A 5I25A 1Q31A 2Y7ZA 5EXMA 3HGPA 2XC0A 4NIVA 1MZAA 4WWYA 1ESTA 4A1TA 1GHBF 3F6UH 1BRUP 3M5NA 1C5OH 1TX8A 2PGBB 2WPJS 5FX5A 1O2HA 3WY8A 5J4QA 1GWAA 2J38A 2ZC9H 1EQ9A 1V2KT 1D6WA 3LH3A 2BXUH 3OE7D 4DGJA 1S6FA 1LVBA 1BRCE 1OWIA 1C1TA 4CRFA 1ETTH 3T28A 3SV6A 1TPAE 5HM2A 1ELEE 2Y6TA 4FUDA 3UREA 3RXSA 1V2TT 1TLDA 1TMBH 1XUJA 4INHA 3MH4A 1L1NA 1F5RA 2D2DA 4XRNA 5EXNA 2WSSD 2TIOA 4XE4A 4ZROA 1SGPE 4WH8A 3MNXA 3W95A 3FZZA 1W0JD 1PPBH 3E16B 8GCHG 1ID5H 2A4RA 3HPTB 2RA0A 1P3CA 2AGGX 2FIRH 4FUJA 5AFZH 1GHBG 2QF0A 5FPSA 1GI3A 3BF6H 5B6OA 1QJ1B 2CV3A 3UWJH 4TPYA 4DCDA 1A46H 1AVXA 1J8AA 3PLBA 1C5UA 2OBQA 1X7AC 4H42U 2J95A 2KM0A 1WDIA 1HPGA 1O3MA 2QYIA 4AFQA 3QWCH 4X8VH 4FU9A 2NU2E 4HFPB 3ZZ3A 4NA8A 1XUKA 1BT7A 1O38A 1AIXH 6CHAC 1FMGA 1W7XH 1ZGIA 4XBCA 1GJ5H 3RXTA 1EB1H 1YPJH 1SGQE 2A45B 3BTKE 1GJ4H 3AW1A 1C5MD 7LPRA 5FXLA 2H1UA 4RT1A 3ZZBA 1UTPA 4I8GA 3VGCB 4FVDA 1KTTB 1W3CA 2ODQA 2TGPZ 4D7GA 1TPOA 1GI7B 2ZU5A 3MTYA 2HRVA 3SJOA 1Y3UA 4ZKNU 3QDZB 3BIVH 1DM4B 1QURH 4CREA 3OY5U 2QXIA 1TALA 1GGDB 1XMNB 1AFQB 1DWDH 3N99A 1JIMA 1QCPA 1S5SA 2RA3A 4TT3D 4JYVH 3F0PA 2FTLE 1P12E 3GDUA 1GBTA 4AYVB 2M5TA 2O9QA 1F0RA 2ODYB 2W3KA 2BDHA 4BTUB 3LGVA 1BTUA 1GVLA 1C5ZB 1SGFG 2LP6A 4ISLA 1C5WB 1L1JA 1DICA 2CN0H 2PKSB 3E1XB 3F2GA 3MU0A 1D3QB 3U8RH 2HWLB 2NWNA 3TNSA 3UNQA 2XBWA 2J4IA 4AN7A 1TBQH 1CVWH 4B2AA 1BRAA 5HKKD 1SI5H 2JJ2D 2Y5GA 1WQVH 4Y7BA 3EA9A 1A5IA 5EQSA 2XOKD 4MVNA 4DIHH 1V2UT 1O2VA 4AX9H 3M7UA 3RMOH 2A1DB 1C9TA 3ELAH 2FI4E 2Z9GA 2BYAX 1F92A 4YT6H 3S69A 3A8BA 1C4Y2 2BZAA 1OHHD 1W8BH 2Y82A 4OS5A 1OWDA 2HNTC 2IPHA 3P6ZB 3VG8A 2OCVB 3OFND 1ZMJA 3SYJA 4K8BA 3ZZ9A 3DSOA 2CF9H 2QCYA 1TMTH 4AG2A 1BHXF 2ASUB 4NZLA 5GIBA 3LDXH 3TGKE 4YM9A 2VBCA 2KCPA 1QJ6B 3LONA 3PV4A 2D26C 1GBMA 3RXQA 1GI8B 4SGAE 2FOHA 3S0NA 1TPSA 1AU8A 1E38B 1YLCA 4ISOA 4YOIA 1TA2A 1C5RA 1XXFA 2HPPH 3QK1A 4K1SA 2J92A 2ZI2H 3KQCA 4NSYA 5DP4A 3RC4A 3EA8A 1ABIH 1T31A 1CA8B 1H1BA 5L6NH 2VIPA 1GCTC 1K9OE 4CRAA 1PYTD 3I77A 4ZKSU 1S84A 1KSNA 1BA8B 2BY6X 1FI8A 1CT4E 1V2WT 3BTDE 3RXVA 5C2ZA 3RC6A 3KQEA 3SHAH 3GY2A 1FN8A 2ZF0H 5B6LA 2IPQX 3PMAB 5JBBS 1O3KA 3L33A 3MO6A 3NPSA 1WTHD 4GVUA 3A83A 2YNBA 2QC2A 3BEIB 3F1SB 5KEDA 2K0QA 3SU3A 2FX4A 1HJAB 2WV5A 1GBDA 5CHBA 3RXBA 2CK3D 1LHGH 4TY6A 2XTTB 3MFJA 1P10A 2JETB 1HAPH 1O2YA 1EX3A 3ZVEA 1WBGB 1HLTH 1KXBA 4U32A 2EI8A 8KME2 5LPEA 1UTQA 2SGDE 1VITG 1EJAA 3F68H 5FL7D 3WWFA 5CHAB 1QB6A 2OD3B 4WMFA 1PJPA 2V3HH 1LDTT 1O2JA 1W0YH 1ANEA 1H8IH 4JCNA 1C1PA 5DJ7A 3ATIA 3H7TA 1P2JA 3QO6A 3N7DA 4ZMAH 1A61H 3F9FA 1ELDE 3MMGA 2AH4X 3SJ8A 1XKAC 3BTHE 4Z6AH 1DWBH 4I33A 4B6EA 3LGWA 1ELCA 1IQIA 1ZSJA 1P04A 1KXFA 4ZKRU 3VPKA 4IGDA 3LH1A 1QB9A 1Z6JH 4DT4A 2ZDAH 3MNCA 2JJ1D 1IHSH 2WHXA 3E0NB 3UQVA 1EZUC 4HZHA 4YOGA 1AY6H 3VEQB 2K1QA 3MU4A 2ZWLH 1BUIA 1Q3XA 5ESTE 3ZZCA 2ZZUH 1HYLA 3BIUH 1BB0B 4I8KA 1KLTA 1E1RD 3UFAA 3TITA 1TOCB 3B23B 5E0GA 2O8UA 5FCKA 1IQJA 2QF5A 3AK5A 2G8TA 3Q3KA 2F3CE 3UAIC 3IITA 1EP6A 4H4FA 9LPRA 1HAXB 3K2UA 4BOHA 2BHGA 3LJOA 1W7GH 2TGTA 1V2ST 1PYTC 1UVUH 2EA3A 3SQEE 1W13U 5C0UA 2ZU1A 2A4QA 3MH5A 1MH0A 2OLGA 2SFAA 4Y7AA 3S7HB 1YY3A 4O03A 4Y8ZA 3I78A 9ESTA 3SQHE 3RMLH 5DK1A 1T8MA 1RTLA 1K1IA 1DE7H 1N6XA 2L6OA 3A7WA 4KTSA 1A3EH 2PTNA 1C5VA 5DG6A 1PFXC 1BIOA 4JZIA 4X6MA 2B0FA 4AGJA 2ZP0H 1UTKA 4FXGH 3ZVFA 1FV9A 1OP2A 1QQUA 4BNRA 1PPHE 1G3DA 1XUGA 4FOUC 2F9NA 4AFUA 1FY1A 2YMSB 1UMAH 3P92A 1VCQA 5TCAA 1P9UA 2TGDA 3Q76A 4NCYA 2PSYA 2P8OC 2WPIS 1E79D 1GMHF 4ZUHA 2FOAA 1O37A 1O5DH 1EXFA 2KFWA 2TBSA 4FUGA 1W0KD 3MNSA 2PWXA 3BTGE 2ZECA 1LQDB 1YCPH 3DFJA 4DG4A 2VU8E 1MKWK 1O2LA 1SGYE 2ESTE 1ZTJA 1DWEH 1BMLA 5K0HA 1GHYH 1YC0A 2DE8A 1O2SA 4XSKU 1B7XB 3TH2H 1LCYA 1L1GA 3A8CA 3P8NA 1A7SA 4TWYA 1E36B 1AZ8A 3E3TA 1QRWA 2EQNA 4ABDA 1MKWH 2F9PA 2PGQB 3V13A 2SNVA 1LVOA 3F9HA 4K1EA 3ZVBA 3E6PH 4CRGA 1OS8A 3UIRA 4O3UA 1SGCA 1Z8JB 2W26A 1SFIA 2H5DA 3H09A 1K1MA 2C90B 3QTVH 2OBOA 1GHWH 3SV7A 4FUHA 3SNDA 1UTJA 4ZKOU 2P95A 3HATH 4X6PA 2XWAA 2BD2A 3A8DA 2WPHS 3I29A 3KYGA 1AE5A 2EC9H 3R3GB 5LPFA 3PYHA 2C3SA 5JBTA 7ESTE 1GI9B 1O3GA 3UUZA 4LZ1H 5JYIA 1D3TB 3TIUA 1BMAA 1DFPA 5JPMH 1HRTH 3KCGH 1O3LA 2HNTE 1GBHA 4B71A 3PTBA 2OK5A 4F55A 4Y8YA 3GY4A 1O2IA 1ZRBA 2Z9KA 3C27B 4ABGA 1Q2WA 7GCHF 1Y5BT 1RGQA 1YWUA 1O2OA 5L30H 5TJXA 3TJVA 3JZ2B 1FY4A 3KEEA 3RC5A 1PPEE 1TWXB 2IJD1 2W7SA 1GBLA 3OAAD 4DOQA 2C8ZB 1QL7A 3HGNA 1HJ8A 1C1RA 1P2KA 3LGUA 1DY9A 3D62A 4M9FA 1BITA 4RI0A 3M35A 1SQRA 3LT3A 4B76A 1ETSH 1J16A 4MNVA 1O31A 1LQEA 4A92A 1EPTC 4BAQB 5A8ZA 2QF3A 4XFQA 1GMDF 2Z3CA 4XBDA 1QB1A 4Y10E 3VB4A 4MQAA 1GG6C 4AFSA 1GDUA 2R3UA 3LC5A 3U28C 2B8OH 4LOYH 4LXBH 5FCRA 3GICB 1SPJA 3MWIU 1O39A 1YPEH 2FI3E 1CT2E 2VNTA 1BZXE 1MQ6A 2Z6BD 1XUFA 2PLXA 1A2CH 1QL9A 1S0RA 3B9FH 3S9BA 1GI0A 2BM2A 5DKMA 1TBRH 4Y79A 2V6NA 1WYKA 4JZDH 1O34A 2NU0E 4I32A 3M7QA 2UWPA 1E0FD 1BTWA 1TFXA 1PQ8A 3BEFB 3A7XA 2SGPE 4BTTB 1J9CH 1MTVA 2RCEA 1A4WH 2FLBH 5E8EH 1NFUA 1KIGH 2BZ6H 3T27A 1KLJH 1J17T 2F91A 2GP9B 1LPZB 2BY7X 1WUNH 1YPMH 1DDJA 2WPMS 1QFKH 1HB0B 1T8LA 4YESB 5LGOA 2QAAA 5C17A 5KGOA 2GCHG 3F9EA 1CBWB 5HMAA 3PO1C 3TJNA 4MPXA 2ZDMA 4IN1A 1AFEH 3RXRA 5E2OA 1CA0B 1SHYA 2BDAA 5JB8S 1V2JT 2H5CA 5GJ4B 4UONA 2H9TH 2BLWA 5T3HA 1C4V2 1V6DA 1AWFH 5FX6A 3LIWA 1HAIH 2VIVA 1BMFD 1O2MA 2AIPA 5AVDA 3A81A 1K1LA 4DURA 1G2MA 4UFGH 2KCYA 1S0QA 4MNWA 1DXPA 5CMXH 2A4OA 3Q3XA 4GCHF 1K21H 1UCYE 4X0WU 4J2YB 3V7TA 2XRCA 1HGTH 4K3JA 4CRBA 1HXFH 5AFYH 1OYQA 3CS7A 2BD7A 4Q7XA 5ESBA 1C2HA 8GCHF 1NRRH 5T6FA 1XX9A 4DW2U 4WXIA 1GJ9B 2BTCE 3SI3H 5AF9H 2UUJB 5C1XA 1GHVH 1OPHB 3MYWA 1O3OA 1SL3A 3BTQE 1V2MT 1A5HA 1MD8A 1NO9H 3NWUA 1S81A 3Q77A 1TNGA 2V3MA 1YBWA 1B0EA 3TPIZ 4K69A 3F3BA 2FODA 3LGIA 1DT2A 1YPHE 1O3HA 1NFYA 1KTSB 2Y5FA 1K28D 1EOJA 1P2OA 4UFFH 1K1PA 1GMCG 2G00A 2GKVE 1SLVB 1H4WA 1GCDA 2BX3A 1LKAA 1MCVA 1SLWB 2R2WU 4GCHG 4ZXYH 1GBIA 1AB9B 3FZDA 5C3NA 2Z3EA 1ORFA 1DLEA 5DGJA 2VGCB 1GJ6A 1FLEE 1S6LA 1CE5A 4IS5A 1V2PT 2WPKS 1HCGA 2JH6D 3GCNA 2F9UA 3O8BA 4K60A 1KLIH 4GPGA 1DPOA 1TNJA 2AS9A 3RXKA 3VB3A 1EJNA 3ZVDA 2PR3A 3TH3H 2OC7A 3B8JA 1TGSZ 4CRCA 2WV4A 1KXDA 1C1UH 3A85A 1BDAA 3RP2A 3BTWE 4UFDH 2C8YB 3URDA 2FOCA 1MZDA 4TPIZ 5DP8A 2C8XB 2FOFA 3TU7H 3LPRA 2F43B 3UOPA 1D3PB 3FAOA 1ANBA 3F9GA 4IC6A 3SUDA 4ZHAA 2BD5A 4FUIA 4I8HA 1GJCB 3VGCC 2UUYA 4NIXA 1QHRB 1YLNA 4ZHLU 1YF4A 1TBZH 3A86A 1TNLA 3RUOA 3M5OA 1ZR0A 2AGIX 1F5LA 4AC9A 1M9UA 5EW1H 3E90B 1O2ZA 3UR6A 3DD2H 2KCOA 3N7EA 4FUFA 2UWOA 3RLYH 1EZXC 6CHAB 3E91A 1LHFH 5HGGA 1TRNA 4KP0A 3MU5A 1G36A 1DLKB 4YO9A 1O3DA 2VB0A 1ZJDA 2A7JA 1Y3WA 3NK8A 4UDWH 1C2KA 3KQ5A 1P02A 1QIXB 3U8OH 1EAUA 4OGYA 4E7NA 4MPVA 3U1JB 1GVZA 3A80A 4K1TA 1ZPBA 4JYTA 1VCWA 1AKSA 3FKSD 4D9QA 3RDZA 4GHTA 3V3MA 2UWLA 1GBFA 1NC6A 2F4LA 4MNXA 4XOJA 5A0AE 5FPTA 3QN7A 4OM9A 4IBLH 1K0HA 1UTOA 1HAVA 1G3CA 2J94A 4KTUA 6GCHG 2B5TB 1EKBB 2QV1A 4WJG2 3BSQA 1THPB 1BQYA 1JBUH 3F2HA 3UWIA 2BDYA 1QRZA 3MO9A 4ISHH 3UY9A 4OS7A 2RG3A 1YLDA 4FU8A 2VVUA 1C2JA 1ZPCA 2LPRA 1V2NT 2GGVB 2A32A 1MAYA 3HKJB 4I86A 4AORA 1L4DA 3VXFH 2Z9JA 2GCTC 3K6YA 3UOUA 2IOTA 1GVKB 3V0XA 1P09A 2ZTXA 4D76A 2FWWA 5C0TA 5E2PA 2ZFTA 2A7CA 3M5MA 4Q2KA 1TE0A 1TAWA 2VWNA 2RDEA 1JXPA 2XCNA 2KCAA 3CNRA 3Q00A 5C1YA 1RTKA 5A0BA 2Z9IA 3NCLA 2O8WA 1HAGE 1O2RA 1IQNA 2FPZA 1C1SA 5ABWA 8ESTE 4ZCNA 3SJ9A 2Q6GA 1WQSA 3HK6B 1D3DB 4K5ZA 3OX7U 1DX5M 3DT0H 5SGAE 3SU0A 3HKIB 2HLCA 4AZ2B 4DT7B 1P8VC 1O2XA 2PHBA 1ESBA 1SVPA 4X8TH 3OTJE 4RT0A 5IDKA 4X1QU 1Y59T 4AB9A 2ZGJA 2VIQA 1SKYE 3RU4E 5H4IB 3MU1A 5A0CA 5LH8A 5C1UA 1CGHA 4I31A 1CT0E 2GVFA 1LMWB 1S6HA 1SLXB 2GZ7A 3LJJA 4NFEA 1BTYA 4D9RA 1QA7A 4GAWA 3SGAE 1VITF 3U1IB 1CSOE 4MG3A 4JK6A 3SV2H 1ZSLA 2BY9X 2QXGA 1QR3E 4NIWA 3LOXA 4J1YA 1V2VT 1XVMA 3SBKA 2Q6DA 1MQ5A 4X2WA 1QRXA 2WYGA 2ZHEH 3GY6A 3SU6A 2EY4C 2ZFQH 4ASUD 4K8YA 3TGJE 2FEQH 1C5XB 2FXRA 1NRSH 3STIA 1NESE 1CGJE 3VB5A 2P94A 4IMQA 1E35B 4O9VA 2FM2A 2ZFSA 1AWHB 1SGTA 1FY8E 2ULLA 1WTGH 1GCTB 2JETC 5GWZA 2H2ZA 1W2KH 2BQ7B 1TMUH 1TGNA 1IQEA 2W3IA 5A09A 2ZCKP 3A88A 1C1MA 1SGDE 5LPRA 3UR9A 2HGTH 3L6PA 1XKBC 2YOLA 1C2EA 1P3EA 1HNEE 1NT1A 1F2SE 1EB2A 1C5SA 2AMQA 4WMEA 2RDLA 3E8LA 1QGFA 1LKBA 5IYTA 1SLUB 2J97A 2WINI 3EDXB 1S85A 5GPIB 1RTFB 6ESTA 5L2ZH 1TNIA 3PMJA 4DJZB 2ZGCA 3RXOA 3EGKH 1SR5C 4NWKA 1P2MA 4A1XA 1FZZA 1UCYK 1FNIA 1P2QA 1JRTA 2JKHA 1VJAU 3SHCH 3SW2B 2VH0A 4ISNA 4IW4E 2GD4B 1F0SA 4R0IA 3SV8A 1ZHPA 4VGCB 1IOEA 2VJ1A 2AYWA 4TWWA 5JDUB 2Y5HA 1E34B 3NUMA 1AUTC 4ABEA 4OGXA 5GCHG 2FS8A 3QTOH 5GXPA 1UCYH 3ZZAA 2PFEA 2KR7A 1O2WA 4A5TS 2THFB 3RXGA 3SNCA 1IQGA 5EPYA 1PQAA 3DHKH 1J15A 2TGAA 1F5KU 1COWD 1SGRE 2BDGA 2W6JD 2VIOA 3M3SA 4SGBE 5F53A 1OOKB 3A7VA 4MLFB 1W14U 3BEUA 1UK2A 4JMYA 1GHAG 4PROA 1SQAA 2CHAB 4Q7ZA 4INLA 4GUXA 4U2WA 3KL6A 2VVVA 3DFLA 3P8GA 1XM1A 1MU6B 1VGCC 5EGMA 1AGJA 1G30B 1BBRK 2C8WB 1UVPA 4X6NA 4Y0YE 1ESAA 1AD8H 3ZVAA 3EE7A 2FESH 3A7YA 2VVCA 5E0JA 1ZZZA 2XWBI 1K1OA 1Y3VA 2ZPSA 2KAIA 1C5QA 4TY7A 2PUXB 5TCCA 3QGJA 3ZZ6A 2HLDD 3KNXA 1AE8H 1SOZA 1PPCE 4ASHA 3RXLA 1MTWA 3ESTA 4Y11E 4IC5A 1BBRH 1ZLRA 1KDQB 3PV5A 1N8OC 1EZSC 3BG4C 1WV7H 4ZHMU 2ZKSA 4E06H 3U69H 3KF2A 3K65B 3ZIAD 4ABBA 5EG4A 4F48B 4I8LA 4Y71A 2GT7A 1CQQA 1YKTA 1OSSA 4CR9A 1TGBA 5EQRA 1O33A 2QXJA 3O8CA 1FPHH 3LGYA 2QXHA 3FO8D 5DN6D 3PLPA 2UUKB 3KIDU 1YPKH 4FUCA 1OWKA 3FOAA 1A0HB 1P9SA 3ZV9A 3SUGA 2O8LA 1GJAB 1O3PB 1B0FA 1SFQB 1FQ3A 2YNAA 3TK6A 3TK9A 3GY3A 1FX0B 3T29A 3M3TA 2BD3A 1GDNA 4KKDA 1H9HE 3ITIA 1F0TA 1BTHH 5C94A 4CHAB 1TPPA 3D23A 3AASA 3TK5A 2P8OB 3P8OA 3CP7A 1H9IE 2CGAA 2FOGA 2J98A 3QX5H 2NU1E 5EU8A 1O2NA 3S7KB 1UK4A 1O5FH 2RFKC 1Y5UT 1EJMA 1SGFA 5EODA 1FAXA 3SGQE 3AAVA 3SV9A 1FN6A 2W7UA 2V0BA 1EP5A 2BLQA 1FIWA 1QL8A 4MPUA 4OS4A 3K9XB 1Z71A 1A0JA 1C5YB 2AERH 1NRNH 2FMJA 3W1EA 1AUJA 1HAHH 1O2GH 3ZVGA 4AFZA 1OWHA 1L2EA 3DSPA 3SORA 1AVWA 2R0KA 2B7DH 1V3XA 5JBCS 1ZOMA 3GYLB 3WW7A 2EEKA 1LHEH 2DUCA 1WCZA 3PWBA 2BD8A 4XBBA 1TGCA 1ELBA 3SNBA 2BD4A 2R2MB 1ANDA 4D7FA 1DSTA 1EAWA 4WXVA 3PWCA 1T8OA 5GDSH 3RXFA 1UTNA 1KYNA 1MAXA 1WAYB 4M7GA 3DA9B 1IHTH 4AG1A 2WZQA 1P0SH 1QY6A 2OC1A 5DP9A 2K8IA 3JZ1B 4MPWA 2A0QB 4E7RG 3FP7E 1GL0E 1TA6A 4FUBA 3H7OA 1KXCA 1MUEB 2ZPQA 1N1LA 1LVMA 3SOSA 2B9LA 2ZU3A 1T4VH 1GJBB 2WUBA 3EE0B 3P17H 2XNIA 1PPZA 3LC3A 2ZDKA 1TNKA 2A5KA 3QZQA 2VINA 3A7ZA 2C93B 1QBNA 1D6RA 5F03A 2QA9E 3NXPA 4WF8A 1AMHA 1DVAH 1OYTH 5DP6A 2GCHF 4KELA 3RXHA 3VFEA 1SSXA 3GCHC 3GY5A 4ACBA 3SJKA 1SC8U 1O2QA 3SN8A 2BX4A 2QF4A 3BG8A 4AB8A 2ZGBH 2P93A 1G2LA 5HM9A 1TRMA 7KMEH 1O5CB 1HFDA 2P59A 5BRRE 1EATA 1OP0A 1TIOA 1MMJN 4XDEA 2Z94A 3U9AH 4BAOB 4I8JA 5HIZA 1C2MA 1GG6B 3SU5A 1AKSB 3BTTE 2BVXH 2GMTC 1KDQA 1UHBA 1FPCH 1C2FA 3FVFB 3RM0H 2H9EH 3MI4A 2IN2A 1DITH 2NU3E 2SGEE 1EOLA 1O35A 1HAVB 1SHHB 4JK5A 3V12A 1T4UH 1YPLH 4OS2A 1CBWC 2GV7A 1O2TA 2XBXA 1O3IA 4RN6A 1GJ8B 1OWEA 4BAHB 1GHZA 1L0ZA 1VZQH 2DE9A 2HPQH 3SZEA 1HDTH 4IN2A 1SGEE 3BTME 4INKA 1ZSKA 3ZZ8A 1SG8B 4NA9H 3R0FA 1NS3A 1MTNC 1ACBE 1OX1A 4F49A 4X2VA 4ABJA 3ODDA 3TGIE 2ANWA 2XC4A 3PMBB 4ABIA 4H6SB 1C5PA 2VWOA 1NU7B 3GCOA 1J14A 1GMCF 2VH6A 3SNEA 2GV6A 1RIWB 1Y5AT 5C5OA 2VIDA 5HYOA 1P2NA 4CH2B 2WUCA 1ZHRA 1A1RA 1GL1A 2ZTYA 2ZHFH 3PB1E 1NFWA 4B2CA 3ZV8A 2QGRA 1BTZA 2ZQ2A 2FYRA 4X1NU 1YPGH 2V35A 2P3FH 3IWMA 5CDFE 1HJ9A 4ZH8A 2G4UA 2R0LA 1Z1IA 3SUEA 2A2QH 1AB9C 1RD3B 2JH5D 3AVZA 3ODFA 3TVJB 1SBWA 2GJGA 1JIRA 2VGCC 1BBRE 3U8TH 4ACAA 2BXTH 2VWMA 2WYJA 1KY9A 1O3FA 3RU4T 1CGIE 3NZIA 2G5NA 2SNWA 2G4TA 5F8ZA 1YYY1 3PRDA 2BMGB 1AZZA 3PROA 4K2YA 1WOFA 1JRSA 2F83A 2Y80A 3LGTA 1NTPA 2M2AA 1TRYA 2ZTZA 1O5EH 1LHDH 1O3NA 1PPGE 2ZGXH 2F9OA 1HXEH 1CHGA 5FHTA 2LELA 2F9VA 1O3CA 2BQWB 1W10U 3D49H 1V2OT 1NN6A 5FBEA 5BPEA 1GBEA 2J9NA 2VWLA 1EASA 3FANA 2UUFB 4U01A 3ZZDA 4HGCA 2ANKH 2HNTF 2PTCE 2ILNA 5HIYA 3A8AA 3QLPH 2BY5X 2W5EA 3DSGA 1V2LT 4IMZA 2SGQE 3A7TA 1A3BH 3ZZ5A 1ETRH 1U6QA 3ATKA 3G01A 1DY8A 4NGAH 2G55A 1MU8B 1ARBA 2R9PA 6GCHF 1VKYA 1ZYOA 1GGDC 1P01A 1AFQC 3RMMH 3MO3A 1GI1A 1C1NA 1IQFA 1NBMD 4ISIH 2OQUA 3EA7A 5ETXA 3T2NA 4YOJA 1ZTLA 1OWJA 4BAKB 4NSVA 3P8FA 3KN2A 1TX7A 4NZQA 3SGBE 1W0ZU 1EPTA 4A7IB 1THRH 4Q80A 5KECA 3O8RA 1O5BB 4YLQH 4OS1A 1K1JA 1ELFA 2ANMH 4TYDA 3QUMP 3RXAA 3GISB 4B75A 3ZYDA 1NY22 2AEIH 2SGFE 4JZ1A 1C1QA 2PKSC 3SU4A 3FN8A 4JYUH 3T62A 2OC8A 1O5AB 1W11U 1YGCH 2VIWA 2FOEA 3UNRA 1JMOH 2Y7XA 1UJ1A 1BOQA 3H5CB 1DUAA 3RXMA 4B2BA 1TABE 3C1KA 1ZHMA 2BQ6B 5G4BA 1RRKA 1FUJA 1TOMH 1GBCA 1QJ7B 2KAIB 5HXFA 1IQLA 2CXVA 3GCTF 3TLOA 3OY6U 2A2XH 3UPEA 2A5AA 4RSPA 1WU1A 3SU2A 4A1VA 1L4ZA 2ZFPH 2ZHWH 1UVTH 4AOQA 4XD7D 1QNJA 2BY8X 1YM0A 4CRDA 4NA7A 5T1VA 3VB7A 4BANB 2STAE 1SOTA 1BMNH 3LU9B 1NROH 2BVRH 3TH4H 1MTSA 2BDCA 1F7ZA 1MBMA 2GCTB 1QBOA 1GHXH 5IK2D 2SGAA 3RXEA 3M36A 2GZ8A 4Z1MD 1EUFA 5I46H 1GBJA 4LK4A 2OXSA 3W94A 1Z1JA 3OSYA 1AHTH 1T32A 1BTPA 2OQ5A 2XBYA 3PM3A 3GCTG 4Y0ZE 2Q6FA 2EI7A 2TPIZ 3E0PB 1C5TA 1ZPZA 1BMMH 1O3EA 3WWBA 5CE1A 1DWCH 2ZO3H 1DSUA 1G3BA 1YCPM 3FFGA 2G81E 1C1VH 3SI4H 1EFRD 3GDVA 3RXUA 1YP9A 3KHVA 1WSSH 4H6TA 3SJIA 2BVSH 2P3TB 1XXDA 2XXLA 2FX6A 3A87A 1ELGA 3CENA 3OEED 1FY3A 2J98B 5F6MA 1UW7A 1QQ4A 4CBNA 3RM2H 2H9HA 3GY8A 4GHQA 1HAYB 2BLOA 4RKJB 4O3TA 1C1WH 5FAHA 3QGNB 1GI5A 2ZNKH 1GI2A 3GDSA 2Q1JA 4WMDA 1H8DH 4DVAU 4WY3A 1LPKB 1K2I1 3EQ0H 3A82A 2HVYB 1ARCA 1HJAC 3KQDA 1HIAB 2CF8H 4WVPE 3HK3B 4X8UH 3ZZ7A 2PP6A 4JZEH 4UD9H 5PTPA 1EZQA 1LPGB 1C1OA 3BN9A 1C5NH 1OKXA 4MDSA 1SMFE 1XVOA 4AGKA 1NRQH 4NG9H 1LTOA 5CHAC 2YMSD 5GCHF 4X2XA 1T7CA 3PTNA 2PW8H 1HBTH 2PUQH 2BLVA 1IQMA 1C9PA 5DSFA 4DY7B 1GBBA 4GLYA 1BJVA 3UNSA 2ZG0H 1H8ED 4UFEH 3STJA 5C20A 1AN1E 2QE7D 3M7TA 4THNH 1TYNA 5DP7A 3RXPA 3KQBA 2QN5T 4AYYB 1FXYA 4B1TA 4B6FA 1D4PB 2ANYA 1NZQH 2BB4A 3M5LA 1CU1A 3RXIA 4LZ4B 2JDID 1GHAF 2AHME 1GPZA 2R3YA 2V3OH 3RMNH 3ZYEA 3ZZ4A 3LKWA 1P11E 5GNDA 5C67A 2P16A 4VGCC 1LVYA 1QZ8A 3URCA 1O3BA 1F0UA 1MD7A 1MTUA 1SQOA 1TQ7B 2XYAA 1MKXK 3L3TA 1Z8RA 2FO9A 2ZHDA 5DP5A 1ANCA 1UO6A 1P2IA 1FIZA 2XC5A 1SB1H 2CMYA 2ZFFH 3VXEH 1FJSA 1S82A 4BXSA 1BCUH 5EQQA 1TX6A 1ELVA 3UB0A 1IQHA 3PRBA 1CO7E 2G52A 1TNHA 1MKXH 2J5UA 2FLRH 1RFNA 3BTFE 5A2MH 2CHAC 2QIQA 1G37A 1BTXA 1C4U2 1GJ7B 4O97A 2HOBA 1C2IA 3KGPA 1O0DH 3ATMA 2OUAA 1Z8GA 1BHXB 1DUEA 3NRLA 1H8HD 5T6GA 2KX4A 4HTCH 3N7OA 2GT8A 2IJOB 4NFFA 2PKAB 1C5LH 4DIIH 4Y8XA 1BRBE 4HI3A 2XCFA 3M37A 1YPHC 2EI6A 1OP8A 2ZHQH 4ABAA 2BDIA 1NPMA 1VITH 5EJ1A 3AAUA 1LHCH 1C2LA 4UEHH 5EJZA 1EAIA 2XNDD 1O36A 2ZA5A 1UHBB 3U98H 4YT7H 3D65E 1FONA 2GTBA 1T8NA 2I6SA 2LNCA 4NIYA 3RXJA 1VGCB 1SGNE 1THSH 5DP3A 3K6ZA 3TNTA 3M3VA
chains in the Genus database with same CATH topology
2FOBA 4E05H 3MOCA 3BTEE 2AIQA 5C5NA 1HUTH 3CS0A 2OINA 1RXPA 1ZMLA 4X6OA 2ZQ1A 1SQTA 1TONA 2C4FH 2FOMB 2GX4A 1P57B 1UTMA 2GDEH 1FDPA 3BV9B 1HAOH 1C2DA 1N8OB 2FTMA 2QY0B 3SO3A 3BG4B 6LPRA 1Y3XA 1DOJA 1HAZB 4Z0KA 2A4GA 2D8WA 4F4OC 4X8SH 4X1RU 5JB9S 3UTUH 1YCPK 2P3UB 4CHAC 1NRPH 3MH6A 3TJOA 1O3AA 2ZU2A 3ATWA 3MNBA 5JBAS 1SGIB 2FI5E 1LO6A 1O32A 2FYQA 4ESTE 4GSOA 1XUHA 2G51A 2ZIQH 1ZMNA 1VR1H 3QZRA 2HALA 1KXEA 3T25A 3P95A 4FUEA 1O3JA 1FAKH 2O8MA 1RS0A 1D9IA 1HV7A 2ZDLA 4YTAA 1AO5A 3MHWU 5EXLA 2XBVA 3RU4D 1VJ9U 3VB6A 2JH0D 1HIAA 1G3EA 3AW0A 4CH8B 1ZJKA 1TQ0B 2STBE 4U30A 4ABFA 5K7RA 2OTVA 5F8TA 4UE7H 1ZTKA 1G32B 1GI4A 2O8TA 1GMHG 4OS6A 1AQ7A 2Z9LA 3MH7A 1QBVH 4B73A 2J34A 5J4SA 2ZPRA 1H9LB 5FBIA 1IAUA 3SU1A 1A5GH 2FDAA 4YZUA 1V2RT 1JWTA 3ENSB 1K1NA 1OXGA 1UVOA 4CR5A 1JOUB 1Z8IB 1TB6H 1IQKA 4B74A 3GYMA 3TJUA 1A0LA 1DANH 4X2YA 1Z7KA 3SNAA 2BOHB 2GZ9A 3GY7A 2A7HA 1ELTA 4CBOA 1O30A 4RKOB 5DO4H 4A6LA 3NKKA 3M61U 5A8YA 3EYDA 3PMHB 1K22H 1O2KA 2J2UA 3FP8E 3UQOA 5L2YH 4R8TB 1BJUA 4BXWA 1ELAA 1RJXB 5EPNA 4I7YH 1ABJH 3T5FH 4NWLA 2OC0A 3FP6E 1MBQA 1NM6A 2PV9B 2ZU4A 1NFXA 1E37B 2Y81A 2BD9A 2AGEX 4Y76A 3RXDA 2ZDNA 4FVBA 1ZRKA 3OU0A 2F9BH 1DXWA 8LPRA 4FU7A 2AFQB 2AMDA 1Y3YA 1AI8H 3T26A 2PKAA 2FZZA 2GDDA 1QTFA 1EPTB 1G9IE 2ZEBA 2NU4E 3MU8A 1ZGVA 1CHOF 4KGAA 1S83A 5AHGH 2Z7FE 2FS9A 1UTLM 3GOVB 1UVSH 2ZCLP 3P70B 1V2QT 1GBAA 4X1SU 7GCHG 5E0HA 4Y6DA 1Z6EA 3A84A 4MNYA 4MTBA 3GCHB 2G5VA 5F8XA 2Z3DA 3Q3YA 4JZFH 3O8DA 3RLWH 1XUIA 5EOKA 2FP7B 1UK3A 2I6QA 1GI6A 1AVGH 1W12U 1FY5A 5DPAA 5EW2H 1CA0C 4YLUA 2ZCHP 2A31A 2D1JA 1GMDG 3S9CA 4ZAEA 2GMTB 1TGTA 5T6DA 4BAMB 1KXAA 1O5GH 4D8NA 2WPLS 2A5IA 2ALPA 2OP9A 2PSXA 2TRMA 1CHOG 2HVXA 1P03A 3ATLA 1MCTA 4Q7YA 3SUFA 1P05A 3SZNA 1RIWC 2H6MA 3A89A 1PPFE 1C2GA 4X1PU 3ZVCA 2AMPA 1INCA 3PO1B 2ZFRH 3OYPA 4ZXXH 3IG6B 1NU9A 5FPYA 2CJIA 4KTCA 4WH6A 5A8XA 1MTNB 2XW9A 3RXCA 3S9AA 3DUXH 1O2UA 4BTIB 1VCPA 4QT8C 3PLKA 1Y8TA 1O2PA 2BOKA 1GBKA 2ODPA 1B5GH 1DS2E 1PQ5A 1EAXA 4ABHA 1N6YA 2ALVA 2BDBA 3EAJA 2ZGHA 1P06A 1GDQA 1QA0A 2ZDVH 1GJDB 1PQ7A 5I25A 1Q31A 2Y7ZA 5EXMA 3HGPA 2XC0A 4NIVA 1MZAA 4WWYA 1ESTA 4A1TA 1GHBF 3F6UH 1BRUP 3M5NA 1C5OH 1TX8A 2PGBB 2WPJS 5FX5A 1O2HA 3WY8A 5J4QA 1GWAA 2J38A 2ZC9H 1EQ9A 1V2KT 1D6WA 3LH3A 2BXUH 4DGJA 1S6FA 1LVBA 1BRCE 1OWIA 1C1TA 4CRFA 1ETTH 3T28A 3SV6A 1TPAE 5HM2A 1ELEE 2Y6TA 4FUDA 3UREA 3RXSA 1V2TT 1TLDA 1TMBH 1XUJA 4INHA 3MH4A 1L1NA 1F5RA 2D2DA 5EXNA 2TIOA 4XE4A 4ZROA 1SGPE 4WH8A 3MNXA 3W95A 3FZZA 1PPBH 3E16B 8GCHG 1ID5H 2A4RA 3HPTB 2RA0A 1P3CA 2AGGX 2FIRH 4FUJA 5AFZH 1GHBG 2QF0A 5FPSA 1GI3A 3BF6H 5B6OA 1QJ1B 2CV3A 3UWJH 4TPYA 4DCDA 1A46H 1AVXA 1J8AA 3PLBA 1C5UA 2OBQA 1X7AC 4H42U 2J95A 1HPGA 1O3MA 2QYIA 4AFQA 3QWCH 4X8VH 4FU9A 2NU2E 4HFPB 3ZZ3A 4NA8A 1XUKA 1BT7A 1O38A 1AIXH 6CHAC 1FMGA 1W7XH 1ZGIA 4XBCA 1GJ5H 3RXTA 1EB1H 1YPJH 1SGQE 2A45B 3BTKE 1GJ4H 3AW1A 1C5MD 7LPRA 5FXLA 2H1UA 3ZZBA 1UTPA 4I8GA 3VGCB 4FVDA 1KTTB 1W3CA 2ODQA 2TGPZ 4D7GA 1TPOA 1GI7B 2ZU5A 3MTYA 2HRVA 3SJOA 1Y3UA 4ZKNU 3QDZB 3BIVH 1DM4B 1QURH 4CREA 3OY5U 2QXIA 1TALA 1GGDB 1XMNB 1AFQB 1DWDH 1JIMA 1QCPA 1S5SA 2RA3A 4JYVH 2FTLE 1P12E 3GDUA 1GBTA 4AYVB 2M5TA 2O9QA 1F0RA 2ODYB 2W3KA 2BDHA 4BTUB 3LGVA 1BTUA 1GVLA 1C5ZB 1SGFG 4ISLA 1C5WB 1L1JA 1DICA 2CN0H 2PKSB 3E1XB 3MU0A 1D3QB 3U8RH 2HWLB 2NWNA 3TNSA 3UNQA 2XBWA 2J4IA 4AN7A 1TBQH 1CVWH 4B2AA 1BRAA 1SI5H 2Y5GA 1WQVH 4Y7BA 3EA9A 1A5IA 5EQSA 4DIHH 4MVNA 1V2UT 1O2VA 4AX9H 3M7UA 3RMOH 2A1DB 1C9TA 3ELAH 2FI4E 2Z9GA 2BYAX 1F92A 4YT6H 3S69A 3A8BA 1C4Y2 2BZAA 1W8BH 2Y82A 4OS5A 1OWDA 2HNTC 2IPHA 3P6ZB 2OCVB 1ZMJA 4K8BA 3ZZ9A 2CF9H 2QCYA 1TMTH 4AG2A 1BHXF 2ASUB 4NZLA 5GIBA 3LDXH 3TGKE 4YM9A 1QJ6B 3LONA 3PV4A 2D26C 1GBMA 3RXQA 1GI8B 4SGAE 2FOHA 3S0NA 1TPSA 1AU8A 1E38B 1YLCA 4ISOA 4YOIA 1TA2A 1C5RA 1XXFA 2HPPH 3QK1A 4K1SA 2J92A 2ZI2H 3KQCA 4NSYA 5DP4A 3RC4A 3EA8A 1ABIH 1T31A 1CA8B 1H1BA 5L6NH 2VIPA 1GCTC 1K9OE 4CRAA 1PYTD 3I77A 4ZKSU 1S84A 1KSNA 1BA8B 2BY6X 1FI8A 1CT4E 1V2WT 3BTDE 3RXVA 5C2ZA 3RC6A 3KQEA 3SHAH 3GY2A 1FN8A 2ZF0H 3PMAB 5JBBS 1O3KA 3L33A 3MO6A 3NPSA 1WTHD 4GVUA 3A83A 2YNBA 2QC2A 3BEIB 3F1SB 3SU3A 2FX4A 1HJAB 2WV5A 1GBDA 3RXBA 1LHGH 4TY6A 2XTTB 3MFJA 1P10A 2JETB 1HAPH 1O2YA 1EX3A 3ZVEA 1WBGB 1HLTH 1KXBA 4U32A 2EI8A 8KME2 5LPEA 1UTQA 2SGDE 1VITG 1EJAA 3F68H 5CHAB 1QB6A 2OD3B 4WMFA 1PJPA 2V3HH 1LDTT 1O2JA 1W0YH 1ANEA 1H8IH 4JCNA 1C1PA 5DJ7A 3ATIA 3H7TA 1P2JA 3QO6A 4ZMAH 1A61H 3F9FA 1ELDE 3MMGA 2AH4X 3SJ8A 1XKAC 3BTHE 4Z6AH 1DWBH 4I33A 3LGWA 1ELCA 1IQIA 1ZSJA 1P04A 1KXFA 4ZKRU 3VPKA 4IGDA 3LH1A 1QB9A 1Z6JH 2ZDAH 3MNCA 1IHSH 3E0NB 3UQVA 1EZUC 4HZHA 4YOGA 1AY6H 3VEQB 2K1QA 3MU4A 2ZWLH 1BUIA 1Q3XA 5ESTE 3ZZCA 2ZZUH 1HYLA 3BIUH 1BB0B 4I8KA 1KLTA 3UFAA 3TITA 1TOCB 3B23B 5E0GA 2O8UA 5FCKA 1IQJA 2G8TA 3Q3KA 2F3CE 3IITA 1EP6A 4H4FA 9LPRA 1HAXB 3K2UA 4BOHA 2BHGA 3LJOA 1W7GH 2TGTA 1V2ST 1PYTC 1UVUH 2EA3A 3SQEE 1W13U 2ZU1A 2A4QA 3MH5A 1MH0A 2OLGA 2SFAA 4Y7AA 3S7HB 4O03A 4Y8ZA 3I78A 9ESTA 3SQHE 3RMLH 5DK1A 1T8MA 1RTLA 1K1IA 1DE7H 1N6XA 3A7WA 4KTSA 1A3EH 2PTNA 1C5VA 5DG6A 1PFXC 1BIOA 4JZIA 4X6MA 2B0FA 4AGJA 2ZP0H 1UTKA 4FXGH 3ZVFA 1FV9A 1OP2A 1QQUA 4BNRA 1PPHE 1G3DA 1XUGA 2F9NA 4AFUA 1FY1A 3P92A 1UMAH 5TCAA 1VCQA 1P9UA 2TGDA 3Q76A 4NCYA 2PSYA 2P8OC 2WPIS 1GMHF 4ZUHA 2FOAA 1O37A 1O5DH 1EXFA 2TBSA 4FUGA 3MNSA 2PWXA 3BTGE 2ZECA 1LQDB 1YCPH 3DFJA 4DG4A 2VU8E 1MKWK 1O2LA 1SGYE 2ESTE 1ZTJA 1DWEH 1BMLA 5K0HA 1GHYH 1YC0A 2DE8A 1O2SA 4XSKU 1B7XB 3TH2H 1LCYA 1L1GA 3A8CA 3P8NA 1A7SA 4TWYA 1E36B 1AZ8A 3E3TA 1QRWA 4ABDA 1MKWH 2F9PA 2PGQB 3V13A 2SNVA 1LVOA 3F9HA 4K1EA 3ZVBA 3E6PH 4CRGA 1OS8A 3UIRA 4O3UA 1SGCA 1Z8JB 2W26A 1SFIA 2H5DA 1K1MA 2C90B 3QTVH 2OBOA 1GHWH 3SV7A 4FUHA 3SNDA 1UTJA 4ZKOU 2P95A 3HATH 4X6PA 2XWAA 2BD2A 3A8DA 2WPHS 3I29A 1AE5A 2EC9H 3R3GB 5LPFA 3PYHA 2C3SA 5JBTA 7ESTE 1GI9B 1O3GA 3UUZA 4LZ1H 5JYIA 1D3TB 3TIUA 1BMAA 1DFPA 5JPMH 1HRTH 3KCGH 1O3LA 2HNTE 1GBHA 4B71A 3PTBA 4Y8YA 3GY4A 1O2IA 1ZRBA 2Z9KA 3C27B 4ABGA 1Q2WA 7GCHF 1Y5BT 1RGQA 5L30H 1O2OA 5TJXA 3TJVA 3JZ2B 1FY4A 3KEEA 3RC5A 1PPEE 1TWXB 2W7SA 1GBLA 4DOQA 2C8ZB 1QL7A 3HGNA 1HJ8A 1C1RA 1P2KA 3LGUA 1DY9A 3D62A 1BITA 3M35A 3LT3A 4B76A 1ETSH 1J16A 4MNVA 1O31A 1LQEA 4A92A 1EPTC 4BAQB 5A8ZA 2QF3A 4XFQA 1GMDF 2Z3CA 4XBDA 1QB1A 4Y10E 3VB4A 4MQAA 1GG6C 4AFSA 1GDUA 2R3UA 3LC5A 2B8OH 4LOYH 4LXBH 5FCRA 3GICB 1SPJA 3MWIU 1O39A 1YPEH 2FI3E 1CT2E 2VNTA 1BZXE 1MQ6A 2Z6BD 1XUFA 2PLXA 1A2CH 1QL9A 1S0RA 3B9FH 3S9BA 1GI0A 2BM2A 5DKMA 1TBRH 4Y79A 2V6NA 1WYKA 4JZDH 1O34A 2NU0E 4I32A 3M7QA 2UWPA 1E0FD 1BTWA 1TFXA 1PQ8A 3BEFB 3A7XA 2SGPE 4BTTB 1J9CH 1MTVA 2RCEA 1A4WH 2FLBH 5E8EH 1NFUA 1KIGH 2BZ6H 3T27A 1KLJH 1J17T 2F91A 2GP9B 1LPZB 2BY7X 1WUNH 1YPMH 1DDJA 2WPMS 1QFKH 1HB0B 1T8LA 4YESB 5LGOA 2QAAA 2GCHG 3F9EA 1CBWB 5HMAA 3PO1C 3TJNA 4MPXA 2ZDMA 4IN1A 1AFEH 3RXRA 5E2OA 1CA0B 1SHYA 2BDAA 5JB8S 1V2JT 2H5CA 5GJ4B 4UONA 2H9TH 2BLWA 5T3HA 1C4V2 1V6DA 1AWFH 5FX6A 3LIWA 1HAIH 2VIVA 1O2MA 2AIPA 5AVDA 3A81A 1K1LA 4DURA 1G2MA 4UFGH 1S0QA 4MNWA 1DXPA 5CMXH 2A4OA 3Q3XA 4GCHF 1K21H 1UCYE 4X0WU 4J2YB 3V7TA 2XRCA 1HGTH 4K3JA 4CRBA 1HXFH 5AFYH 1OYQA 3CS7A 2BD7A 4Q7XA 5ESBA 1C2HA 8GCHF 1NRRH 5T6FA 1XX9A 4DW2U 4WXIA 1GJ9B 2BTCE 3SI3H 5AF9H 2UUJB 5C1XA 1GHVH 1OPHB 3MYWA 1O3OA 1SL3A 3BTQE 1V2MT 1A5HA 1MD8A 1NO9H 3NWUA 1S81A 3Q77A 1TNGA 1YBWA 1B0EA 3TPIZ 4K69A 2FODA 3LGIA 1DT2A 1YPHE 1O3HA 1NFYA 1KTSB 2Y5FA 1K28D 1EOJA 1P2OA 4UFFH 1K1PA 1GMCG 2G00A 2GKVE 1SLVB 1H4WA 1GCDA 2BX3A 1LKAA 1MCVA 1SLWB 2R2WU 4GCHG 4ZXYH 1GBIA 1AB9B 3FZDA 5C3NA 2Z3EA 1ORFA 1DLEA 5DGJA 2VGCB 1GJ6A 1FLEE 1CE5A 4IS5A 1V2PT 2WPKS 1HCGA 2JH6D 3GCNA 2F9UA 3O8BA 4K60A 1KLIH 4GPGA 1DPOA 1TNJA 2AS9A 3RXKA 3VB3A 1EJNA 3ZVDA 2PR3A 3TH3H 2OC7A 3B8JA 1TGSZ 4CRCA 2WV4A 1KXDA 1C1UH 3A85A 1BDAA 3RP2A 3BTWE 4UFDH 2C8YB 3URDA 2FOCA 1MZDA 4TPIZ 5DP8A 2C8XB 2FOFA 3TU7H 3LPRA 3UOPA 1D3PB 3FAOA 1ANBA 3F9GA 4IC6A 3SUDA 4ZHAA 2BD5A 4FUIA 4I8HA 1GJCB 3VGCC 2UUYA 4NIXA 1QHRB