3HGNA

Structure of porcine pancreatic elastase complexed with a potent peptidyl inhibitor fr130180 determined by neutron crystallography
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined High-Resolution Neutron and X-ray Analysis of Inhibited Elastase Confirms the Active-Site Oxyanion Hole but Rules against a Low-Barrier Hydrogen Bond
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Elastase-1
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3hgnA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3hgnA01
2FO9A 1DFPA 3A8CA 1AE8H 3UY9A 1U6QA 1A5HA 4RKOB 1LHFH 2GVFA 1UCYH 1TA2A 4Q7ZA 1TLDA 2W5EA 2ZFPH 1TNLA 2BVXH 1GI1A 4CBNA 1JIRA 3PMAB 1O5AB 2QXIA 1KTSB 2UUFB 5FX6A 2BDGA 4NIXA 1Z8RA 1UTQA 2OD3B 2SGFE 3VFEA 1NRRH 2RG3A 2OUAA 3GY8A 3QGNB 1S6FA 1V2NT 4CRCA 4IMQA 3SI3H 1IQGA 3SHCH 1EJMA 4Y8XA 1W0YH 1GHWH 3ZV8A 4AYYB 1FAXA 4BAQB 3S9AA 1YPGH 2ZGXH 1PYTD 4D7GA 4UFFH 4FUDA 8LPRA 3QK1A 2P95A 4HGCA 4X8VH 4NCYA 1SOTA 4WF8A 3PM3A 1DWCH 2ZCLP 3SGAE 4IBLH 3ZVDA 4MNVA 1O39A 2QF3A 3SJ8A 3H5CB 6CHAB 1V3XA 3GCHB 2ZDMA 3UTUH 1GWAA 1VCPA 4JZIA 4ZHAA 2UUJB 5CHAC 1BOQA 2V0BA 2ZU3A 2TBSA 1PPBH 5FPSA 2BDCA 4D9RA 3FAOA 4X2XA 2A5AA 2W7SA 1C5ZB 2VINA 3MOCA 1IQLA 5E0JA 2PGBB 3GCOA 5EW2H 4JK6A 5BRRE 3RMLH 3K65B 4BAKB 1DWDH 3SUGA 3LJOA 2J4IA 2JKHA 4O97A 1IQHA 3MU8A 1NM6A 1MCVA 1S83A 3B8JA 3GY5A 3TH2H 1HAGE 1G3EA 4NSVA 1OS8A 3A89A 2GGVB 4BTIB 1GPZA 1K22H 2ZU4A 1MZDA 2EI7A 5TJXA 3S9CA 3GYMA 3LPRA 3VB5A 1MKXH 1GDNA 2OBQA 4XBBA 3KNXA 2BD5A 4HZHA 4MTBA 4GCHF 5HYOA 1FIWA 1W7XH 1XUGA 1ZPCA 4X8SH 1EQ9A 2FI5E 1MTWA 3ATMA 5AF9H 2ZI2H 1LPKB 2BDYA 4CRFA 3RXQA 1BB0B 1P11E 1PPEE 4ISOA 2WUCA 1FUJA 2ZDNA 1SGCA 4GHQA 1CGHA 4AOQA 1W11U 1AUTC 1CT0E 5JBCS 5HMAA 2A0QB 1SGIB 3PLPA 2VNTA 4CR5A 4CR9A 3FP7E 1NY22 1TALA 4HFPB 2ASUB 3UUZA 1FMGA 1G3BA 1T31A 2CMYA 1EP5A 1XUIA 1TMTH 3A83A 4JK5A 3VEQB 1BJVA 4RKJB 5A0BA 1EZQA 4B74A 1JWTA 3E16B 2Z6BD 4OS4A 4XBCA 4A6LA 3FFGA 5EXNA 5EQQA 2WPLS 1P06A 1O32A 1NRSH 3LONA 2BD3A 3T62A 1RTKA 1RIWC 3RMOH 4LZ1H 4B76A 1Q31A 4O3UA 4KKDA 1KXDA 5B6OA 1IQMA 2P94A 4DIHH 4K5ZA 3QZQA 1DUAA 2A4GA 3TNSA 5EQSA 1V2UT 2YNAA 3ZVBA 1O30A 5A8YA 1LHCH 3UOUA 1C9PA 3SUDA 1CT4E 2HNTC 3ZZ3A 4ZROA 1O3GA 1PJPA 3M36A 2F9PA 4NA7A 3V0XA 1QBOA 1C1PA 4Q80A 1Y3XA 1IAUA 1L1NA 3BF6H 1UMAH 1MKXK 3R0FA 1DICA 1DLEA 2ZC9H 2O8WA 1MAXA 2BVRH 1O2NA 2J2UA 2VWOA 3NPSA 1NROH 2ZHEH 3UREA 1Y5BT 3BTEE 1BT7A 1ZGVA 1F7ZA 4K8YA 2H5DA 2G81E 1WQVH 1MMJN 3PROA 4XE4A 1UCYE 4BAOB 3DHKH 2HNTE 2XCNA 1O0DH 2C90B 3TJNA 1ZSJA 3CENA 2RDLA 2VIDA 1UTMA 2F91A 2FS9A 3RXHA 4ISNA 1BA8B 1QQUA 3LDXH 1ORFA 5GIBA 1FAKH 1L1JA 4ABGA 1TGTA 4YESB 1NFUA 1TA6A 1UTLM 1G3DA 4BTTB 3KCGH 3OY5U 1N8OB 1OWDA 5LPEA 1O2WA 1GHYH 2A4QA 1GHBF 1DXWA 2BD2A 1J9CH 1FY3A 4IN2A 2ZGBH 1OYQA 4FVDA 1A0LA 2ZU1A 4X6MA 1OWJA 1C4U2 1YCPH 4A1XA 2ZO3H 2ZQ2A 1AIXH 1K1OA 3SNCA 1CU1A 4U32A 1BMMH 1GMCF 1TE0A 1SLXB 1ESBA 2A7CA 1RD3B 3A7YA 3DT0H 3QO6A 2OXSA 1CVWH 4FUEA 4YM9A 1WV7H 4H6SB 3TH4H 3AW1A 4B2AA 1WOFA 4NFEA 1KYNA 3PYHA 1MKWK 3BTKE 3LGWA 4JMYA 4A1VA 4A92A 2BLOA 4I8HA 5FCKA 1O31A 1S0RA 1E38B 1XVOA 1FJSA 4Y0ZE 3SUFA 3BTTE 1Y5AT 9ESTA 3E0PB 4CRAA 3A82A 4RN6A 1HRTH 2FWWA 3MU0A 4FXGH 3SUEA 1GBBA 3SI4H 5JBAS 1LVOA 3EA7A 1GBAA 1EZSC 2FESH 1EAIA 1PYTC 2BTCE 2D2DA 3HPTB 4Y8ZA 3W94A 5GCHG 1A3EH 1C2EA 1YYY1 2A5IA 5CMXH 1IQEA 2SGQE 3EQ0H 1AWHB 3QGJA 3RXTA 1ANEA 1ETTH 5DK1A 2BOHB 4AFZA 3DD2H 1HAOH 4NGAH 2BXUH 1GBTA 1ANCA 1P2KA 1TRNA 1W0ZU 1TPPA 5FAHA 1DY8A 1HUTH 2H6MA 1JBUH 4KTUA 3ENSB 1TABE 4IN1A 2SGAA 1ZYOA 2F9UA 4TPIZ 4BAMB 3ZZ8A 1NO9H 7LPRA 1ZRBA 4F4OC 1ABJH 1GDQA 1BTWA 4CH2B 2G8TA 3A85A 1LHEH 3S0NA 1YGCH 4MPXA 4TWWA 5JYIA 1C1WH 1LHGH 4UDWH 3MO9A 1T7CA 2QCYA 1E37B 3LC3A 3SNEA 1LDTT 2DE9A 5EGMA 5IDKA 3ZYDA 3PMJA 1WBGB 2P8OC 4ZXXH 1HV7A 1Z8GA 1OX1A 1UTNA 1WU1A 2SGDE 1GMCG 3RXKA 4MPVA 2NU3E 3MH7A 1MQ6A 3D65E 1TGCA 1E34B 4MLFB 1AZZA 7GCHG 3PTNA 3TGKE 4XDEA 1EASA 2XCFA 2J34A 3GCNA 3GY6A 5DP8A 1D6WA 4ZHMU 1ELAA 1YF4A 1EOLA 2G51A 2YNBA 2ZKSA 2XRCA 4D8NA 1EUFA 3RU4D 1EX3A 1RRKA 1AB9B 2GCHF 5EPYA 1OWEA 3D23A 1AWFH 2FDAA 1AB9C 1C5QA 4YO9A 3UNRA 1ABIH 1HJAC 4X1QU 2AERH 3RXLA 3P95A 1ID5H 1F5RA 1HJAB 2R3YA 2BX3A 1RJXB 1ZPZA 3RP2A 4UFEH 2CN0H 1EAWA 3RXUA 1IQNA 2ANKH 2R3UA 2SGPE 2XYAA 3SJOA 2QAAA 2ZF0H 5DP9A 1W2KH 5GDSH 1P2MA 2H9TH 1O37A 1F5LA 2D26C 4B1TA 1NU7B 5E2PA 7KMEH 4FUFA 3QLPH 2K1QA 1LKAA 1SQAA 4X6NA 4E06H 2R9PA 3RC5A 2FIRH 5TCCA 4AZ2B 3WY8A 1BRCE 4X2WA 4FUBA 4SGAE 4E7RG 5GPIB 1C1MA 1ETSH 3EA9A 1BHXF 3AAUA 2WPKS 5DP6A 4X1PU 3MHWU 1C5LH 2F83A 1HLTH 5I25A 1GJ7B 2HWLB 2TGTA 2CHAC 4ZKNU 4ESTE 1H9IE 1Y3UA 1UTOA 1QB9A 2FODA 1PPGE 1NTPA 2CHAB 3K6YA 1PQ8A 1MTSA 4I31A 1UHBA 2VWMA 3F1SB 4JYVH 2CF8H 2WUBA 1EZXC 2BY5X 1FQ3A 2HLCA 1ACBE 4BTUB 1D6RA 1TRMA 2FOFA 4QT8C 5ETXA 3V3MA 1W10U 1S82A 3DFLA 2Z94A 1MQ5A 5FXLA 3EGKH 3UOPA 1MCTA 1J14A 3TLOA 4X6PA 3M3VA 1AVWA 1XKAC 5C1YA 1DY9A 3KQCA 3ZVFA 4B73A 1TX7A 1ZPBA 4YOJA 1BITA 1JIMA 1KIGH 1V2ST 2BLQA 2IPHA 1VZQH 4KTCA 2F9VA 5GWZA 3MWIU 1TPOA 2V3HH 4ABIA 2TGAA 1IHTH 1O35A 1LQDB 4UEHH 3BTHE 5H4IB 2TIOA 1SGFG 4KELA 5T6FA 1GGDB 1RXPA 7ESTE 1HDTH 1F0SA 1QIXB 4I8JA 3U1JB 3W95A 2ZFTA 2Y6TA 1YPMH 4IC5A 1YLCA 2BD4A 4A7IB 1V2KT 1TOCB 4TWYA 1MH0A 1MZAA 3OTJE 3SU0A 4UFGH 1XUHA 2PGQB 1DXPA 2ZGCA 2R0LA 3AW0A 3SV7A 3SJKA 1C5XB 4A5TS 4OS1A 4CRDA 3VB6A 1CE5A 1K1MA 3GCTG 2FM2A 1O2GH 3TK5A 2XC4A 4LXBH 1BQYA 1H9LB 4GUXA 1QHRB 5DP5A 3E91A 1J8AA 2GMTB 1GBHA 1GI5A 1OP2A 1P05A 1TX8A 1QL9A 3LC5A 2GMTC 1QL8A 3FANA 3B9FH 4OS2A 3SORA 1O2LA 4DOQA 1IQFA 3SV9A 3TJOA 3A88A 4WJG2 3ODFA 2C4FH 2ZCKP 3P8OA 4K69A 1GI6A 1HNEE 1SG8B 1TNJA 2STBE 2QY0B 3A8AA 1TWXB 1JOUB 2QA9E 2CJIA 1UK2A 2ZGJA 2Z7FE 1MD7A 1DS2E 3Q3KA 3ODDA 4DY7B 2BY6X 1O5EH 2A2XH 1PQ7A 4TY6A 4AG2A 3N7OA 3RXPA 3M5MA 4ZH8A 1EAXA 4O9VA 3QTVH 2PFEA 2FYQA 1LO6A 2XBYA 4CBOA 4X1SU 1A7SA 2AH4X 2ESTE 4ABEA 1NC6A 1A46H 2A4OA 5FPYA 1V2TT 3A7XA 1UK4A 4E05H 5EOKA 1QA0A 4DT7B 1EKBB 2W7UA 2OQUA 1W7GH 4AGJA 1WTGH 2IJOB 1XKBC 1YP9A 1LVYA 2AIQA 4IMZA 4K1TA 5EXMA 2Q6GA 5T6DA 4FUHA 2GDDA 5A0CA 1BBRH 1YPEH 1IQJA 3QDZB 4FU7A 1ZJDA 2BOKA 2ANWA 1NPMA 4VGCC 4YOIA 3ATWA 1MTNB 3KQBA 1Z1IA 3D62A 3VXEH 1XXDA 4VGCB 1MTNC 2BLVA 1BTHH 4MG3A 1O2HA 3FP8E 3AVZA 3L3TA 4WH8A 3FVFB 1GL1A 1TGSZ 4YLQH 2G52A 2F9OA 5A2MH 2BD8A 1GJ9B 3F9HA 3NXPA 4ISIH 1EZUC 1X7AC 1BZXE 4OGXA 1HAIH 1SFIA 3E8LA 3RXRA 4H4FA 1NFYA 2PKAA 1AU8A 1L0ZA 5LPFA 1A5IA 4NSYA 4J1YA 2F9BH 1P01A 5JB9S 2VWLA 1GBDA 3STIA 1ZJKA 3K2UA 1ZTLA 3T26A 1AD8H 3M37A 2FX6A 2P16A 1VGCB 3GY7A 1ZZZA 1LQEA 2VWNA 3GDSA 4Q7XA 3VXFH 4K1SA 1NRQH 2GT8A 3RXFA 2ODPA 1O3FA 1HIAB 1GBFA 1DUEA 2TPIZ 4RSPA 4AB8A 4AFQA 1Q2WA 1BBRE 2R2WU 2FI4E 1LTOA 2V35A 3BG4C 2Q6DA 5F03A 1FY1A 1PPHE 5K7RA 2WV4A 1HB0B 4YTAA 1ARCA 2ZDLA 1GI8B 1W12U 3RU4E 1O5GH 1C1VH 3T29A 5C5NA 2FOCA 1W13U 4JYUH 4SGBE 1O2VA 2BQWB 1C2IA 3ATIA 4JZEH 2CF9H 1GI0A 2C93B 4Z6AH 5E0HA 5AFZH 3MU1A 4ZHLU 2ANMH 7GCHF 4X1NU 9LPRA 1Y3VA 2A7JA 2FOGA 2HGTH 1A61H 1FPCH 1GMDF 2H9EH 3ZZ4A 3TPIZ 1KLJH 3SU1A 3GY2A 1B7XB 1BTYA 1QQ4A 2C8YB 1C5YB 1AI8H 2Y82A 2WYJA 3NKKA 4ABBA 3A84A 1V2WT 5E0GA 1OP8A 2O8LA 3BN9A 3RM0H 1SVPA 4K2YA 3GICB 1JRTA 2OLGA 3M5OA 3PMBB 4KTSA 2BDAA 4K3JA 1C5WB 3T27A 2A45B 1P2IA 2C8XB 3M7QA 1G32B 4J2YB 4XSKU 2J94A 1SQTA 3KGPA 1XUFA 5J4QA 2Z9JA 1CO7E 5EW1H 2VVVA 1ELBA 1L1GA 4ZKOU 2UWPA 1KSNA 1WTHD 3SZNA 2KAIB 1O3NA 1AQ7A 3UWJH 1EP6A 4U2WA 3TJVA 2TGDA 2Z9LA 3NCLA 1TYNA 4X1RU 1SLVB 1PPCE 5T6GA 3RXVA 1LHDH 3QZRA 2VIQA 2Z3EA 2O8UA 1ZHMA 1EAUA 1YBWA 6GCHG 1GCTB 1K9OE 3P8NA 3PWCA 1ETRH 1GJCB 3LGUA 3BEFB 1C2GA 1GJDB 5J4SA 1NRPH 3E6PH 1QCPA 1XUJA 3S69A 3MO6A 3SHAH 1BCUH 5CE1A 2XBWA 1T8NA 2GP9B 4NFFA 1G2MA 1BDAA 1FV9A 1NFWA 2JH6D 4XFQA 1ARBA 3TK9A 3VGCB 1DSTA 3SO3A 3ZZCA 1W14U 2BMGB 3MH5A 1J15A 4CHAC 2UUYA 1ZGIA 1B5GH 2AFQB 1SGQE 3BTME 3OSYA 1PFXC 1LVMA 5EODA 4AORA 5JB8S 1TPAE 4U30A 2Y80A 4Q7YA 1BHXB 1ZSLA 1TFXA 1ZMNA 4NA8A 4AFSA 1VITF 1O2YA 1QA7A 1VCQA 1Z71A 5DPAA 1IQKA 4I8KA 2Y7XA 2G4UA 3GOVB 1YC0A 2ZDKA 1ZOMA 1C1SA 1A4WH 4WXVA 4Y7BA 2ZPQA 4R8TB 1O3PB 3Q77A 1GHBG 1H1BA 1GGDC 4INHA 5F8TA 3DA9B 4OS6A 1O2OA 1FZZA 1ZSKA 3MNBA 5HM9A 1ZLRA 3E3TA 2B5TB 1MBMA 1G36A 2VVUA 5FHTA 2AGIX 1C1RA 2ZDAH 3AAVA 4BXSA 1OOKB 4DURA 3AASA 1FDPA 6GCHF 1TMUH 4Y79A 3Q3YA 3MU5A 1QJ1B 3GY4A 2TRMA 3MH6A 4GAWA 2PSXA 1XVMA 1T8MA 4ABDA 3LGTA 2XBVA 4X2YA 2D8WA 1UVPA 1GBLA 1ZHRA 5ESTE 1HXEH 2AMQA 3LKWA 1O3BA 1P02A 3FP6E 1V2RT 1WYKA 2PUXB 5FCRA 3M5LA 3LJJA 1K1LA 1O33A 3Q00A 2Y81A 4UFDH 3SV6A 2F9NA 1SHYA 1Y59T 1K1PA 1XX9A 3ITIA 3UNQA 1Y5UT 5FBEA 3RU4T 3URCA 1BMLA 3UIRA 3OYPA 4X8UH 3IG6B 1C5VA 3U8RH 1ZTKA 1L4DA 2PKAB 1P04A 4FU9A 2ZEBA 2ZU5A 4FUIA 2O8MA 5FBIA 2FI3E 1GVKB 2OINA 1DSUA 1D3TB 1EPTB 2I6QA 2P8OB 1DITH 1GI9B 1SFQB 1YPHC 2SNWA 4X2VA 1DPOA 2VB0A 5L2YH 3KQEA 1TGBA 2FLRH 1GHXH 1AKSB 3JZ1B 4JZ1A 2P3TB 3SJIA 3LGIA 2QC2A 8KME2 3Q3XA 2VIVA 1HIAA 1HBTH 2FP7B 1HAYB 2JETC 4ZAEA 1MAYA 5EG4A 1HAZB 1DWEH 1CHOG 3O8RA 2JETB 1BBRK 5A8XA 6CHAC 1FN6A 1XMNB 2BYAX 2WPMS 2PWXA 1D3DB 3DFJA 1UVTH 4AYVB 2PTNA 4I7YH 4K1EA 2VH6A 1SLWB 1BTPA 1GVZA 2ZFRH 2R2MB 3SJ9A 4ISHH 2AMPA 1ZMLA 1G3CA 1A1RA 4ISLA 2QYIA 1L2EA 3FZZA 5CHAB 1C1UH 1SR5C 4NZLA 2PR3A 2OBOA 3VB4A 1HAVB 1F92A 1AO5A 1GJBB 5DGJA 3IWMA 2SFAA 4MNWA 2SGEE 1KXAA 3SW2B 4ZMAH 3GY3A 1EB1H 2G00A 4XBDA 1C5UA 2ZHFH 1QJ7B 4E7NA 3A87A 5ESBA 1SBWA 5C2ZA 1QBVH 5L2ZH 3TGJE 3SOSA 2B0FA 1MU8B 1DWBH 3F6UH 4LZ4B 1B0FA 2QF0A 3JZ2B 4OS5A 1E36B 2P59A 2PKSB 1S85A 4B75A 4DGJA 1KDQB 2RCEA 1FIZA 1QL7A 3ZZ5A 5F8ZA 2WPIS 3F9GA 5AFYH 4ZXYH 3BTDE 4YLUA 2AGEX 2QXHA 1DM4B 1BIOA 3L33A 2Q1JA 1S6HA 4X0WU 5EQRA 2BZ6H 1O3HA 1VGCC 1N6YA 3P6ZB 3KIDU 1HJ9A 3EE0B 3P8FA 3S7KB 3LIWA 4NIYA 2ODYB 3OU0A 1N1LA 3RLYH 4YT7H 1O2QA 3H7TA 1AHTH 3UQOA 2GZ8A 1JXPA 2A1DB 1C1OA 4GVUA 3BEUA 2BD7A 1A2CH 1C2JA 3M35A 2GTBA 3UNSA 1O3MA 5GXPA 1C5NH 1RIWB 2ZG0H 3SBKA 2FTMA 1GL0E 1TB6H 5E8EH 2NWNA 1BJUA 1O2ZA 1LPGB 3PWBA 1G9IE 2PSYA 3ZZDA 4AN7A 1NFXA 4Y7AA 2FPZA 4B71A 2GV7A 3SV8A 1GG6B 4ZKSU 1P9SA 4CRBA 1SOZA 1VR1H 1M9UA 3M3TA 3NWUA 1GHVH 4INKA 3I78A 1YCPK 1O3OA 8GCHG 2DUCA 1SMFE 1GCDA 1WAYB 4H6TA 4AFUA 3A7WA 2ZNKH 1YPLH 4YZUA 1KLIH 2XBXA 1ZHPA 1J16A 1ESTA 3CP7A 1P10A 1O5CB 5K0HA 1UVOA 1GMDG 2J38A 2OC1A 1O2PA 1NZQH 2EA3A 1P2QA 4MDSA 1SLUB 1C1NA 3T25A 1FNIA 3BSQA 1GMHF 2ZHQH 1O2TA 1K2I1 1INCA 1MD8A 4WMFA 2AS9A 1LKBA 3EDXB 4WWYA 1KLTA 1OWHA 4YOGA 5JBTA 1GCTC 2ZQ1A 1TIOA 1V2JT 3SNBA 1CHGA 1SL3A 1G2LA 2BB4A 4TY7A 1FY5A 1N8OC 2G4TA 4I8GA 4TYDA 1NS3A 2XNIA 2Y5HA 1AZ8A 1GI3A 3TVJB 4NA9H 2BDHA 1BRAA 4BXWA 5IYTA 2GCHG 8ESTE 3LH1A 3VGCC 1UTJA 3HK3B 2OC7A 1C4Y2 4TPYA 3S9BA 1V2PT 1AGJA 3VB3A 2CXVA 2ZTXA 1CA0B 1EB2A 3U1IB 3U98H 3KF2A 3PMHB 2FX4A 2Z9GA 2G55A 1V2VT 4MQAA 1C5TA 1FXYA 2TGPZ 1F2SE 2OCVB 1T8LA 3RDZA 1O38A 5F6MA 3RXBA 4IW4E 1AFQB 1D3QB 2J95A 2G5NA 2NU2E 1UVSH 3MNSA 1AFQC 1ELFA 4LK4A 3TH3H 1SI5H 1F0RA 3NZIA 1P0SH 2BM2A 2F3CE 2J92A 1A3BH 3BEIB 1ELGA 2NU1E 2BQ6B 1GI2A 2XW9A 1H4WA 1A5GH 5C20A 1GVLA 3ZYEA 3QWCH 1K28D 3RXCA 1RS0A 1EXFA 3TU7H 1O3LA 2A31A 1GHZA 2CV3A 3SU2A 1V6DA 1ZRKA 2EC9H 1UHBB 2A2QH 2P3FH 4H42U 2M5TA 2GV6A 1GBJA 3RXOA 5F8XA 4M7GA 1HAVA 4Y0YE 2THFB 4AX9H 1LMWB 1FY8E 3RXMA 2GD4B 3IITA 4X8TH 1S81A 3PO1C 1QB1A 2PV9B 1QB6A 3K6ZA 3MMGA 3ZVGA 3A7VA 3PO1B 1VCWA 1AE5A 3PLKA 2GKVE 1OXGA 3C27B 1BTUA 2PUQH 3A7TA 4FU8A 3M7TA 1HGTH 2ALPA 1HYLA 3U9AH 2QIQA 3A86A 4AB9A 2V6NA 1C5SA 1UJ1A 1FN8A 2B7DH 5DG6A 1E0FD 1D4PB 2HALA 2BD9A 3UPEA 4NIVA 4Z0KA 4MPUA 5E2OA 2ZWLH 1KDQA 2FZZA 4ABJA 3TIUA 1TNIA 2JH0D 1UVUH 4OGYA 1C2LA 4X6OA 5AVDA 5L30H 2STAE 4BOHA 1Y3WA 3BG8A 1EPTC 2OTVA 5LPRA 1O3DA 3LH3A 1LVBA 3ESTA 1K21H 1BMNH 1C1TA 2UWOA 1IHSH 1O3JA 4FUCA 3TK6A 1EOJA 1SQOA 2O8TA 2BDIA 2QN5T 1GJ8B 1FLEE 2I6SA 1Z8IB 3UR6A 4JCNA 4HI3A 2D1JA 4FUGA 2QV1A 3MTYA 1ELCA 4ABHA 4BAHB 3ELAH 5G4BA 1QRZA 3L6PA 1CHOF 3QN7A 4AGKA 4D7FA 1D3PB 2UWLA 2YOLA 1GJAB 3D49H 6LPRA 2HOBA 2XXLA 1W8BH 3MNXA 3U69H 1OYTH 2GDEH 1GHAF 3E90B 1EJNA 2OC8A 1TBQH 2BX4A 3VB7A 3SV2H 1BMAA 1K1JA 3U8TH 3UFAA 4GLYA 1V2QT 2ZZUH 3O8CA 3ZV9A 3MFJA 1EATA 1J17T 1GJ5H 2VIOA 2A4RA 3M61U 1EJAA 5C1XA 2XTTB 1GBEA 5FPTA 3ZVEA 1YPJH 2ILNA 2ZECA 1O3AA 3F9EA 2AMDA 3RC6A 1C5RA 1KXBA 4Y76A 3LGVA 1H8IH 1O5DH 3P17H 1HAHH 3OX7U 1AKSA 1YKTA 1O3KA 1THRH 1HPGA 3LGYA 1QNJA 4O03A 2ZIQH 1PPZA 3NK8A 4NWLA 2XC5A 1SB1H 2IN2A 3QUMP 2Y5GA 4ABAA 1O2XA 1DVAH 3LT3A 1OP0A 2W3KA 3O8DA 2DE8A 1O5FH 3K9XB 3SU3A 4GSOA 1Y3YA 4D76A 1TONA 4WY3A 1FY4A 1O2KA 1A0JA 2J9NA 4NG9H 4PROA 1MBQA 1Y8TA 3HGPA 5HGGA 2G5VA 1QY6A 2XC0A 3NUMA 4I8LA 4CHAB 4WXIA 1SGRE 2HPPH 1S0QA 1V2MT 3A80A 2ZPRA 4THNH 1JMOH 1O5BB 2VIPA 2VGCB 2FYRA 5DJ7A 1XXFA 2FEQH 2WINI 1AUJA 1O3CA 2AGGX 1XUKA 2FOEA 1TQ7B 4A1TA 2HPQH 2GZ9A 1SSXA 1GI4A 1C2DA 1C5OH 2BXTH 1P3EA 3P92A 1O2UA 1O3EA 1HXFH 1AN1E 3P8GA 1P57B 1PPFE 3RM2H 2GT7A 1TNKA 1TQ0B 3RMNH 2BDBA 4DCDA 1LCYA 1THSH 2ZDVH 4NWKA 1GBIA 1TNGA 4BNRA 3OY6U 3QTOH 1OKXA 4INLA 1L4ZA 2SNVA 2BVSH 3SN8A 2FMJA 1C5MD 3BIUH 1DDJA 1HJ8A 3TITA 5LGOA 5DP3A 2ZFSA 3PLBA 2NU4E 3RXAA 1OPHB 1UCYK 5A09A 1P2OA 1BUIA 1QBNA 3T2NA 2OQ5A 3MYWA 1AVXA 1G30B 4BANB 3SU5A 3RXEA 1ELEE 3UR9A 2V3OH 1TBRH 1CSOE 1QRXA 1ESAA 1SHHB 5T3HA 1NT1A 3S7HB 2WPJS 4K8BA 1Z6JH 4I33A 2UUKB 4DG4A 2VU8E 4MNYA 2ALVA 4DW2U 3MU4A 1BRBE 2PLXA 4CH8B 2P93A 3HATH 1SGTA 3PB1E 3I77A 8GCHF 2QGRA 2PW8H 5TCAA 2H2ZA 1Z1JA 3ZZ9A 1B0EA 5I46H 2ZCHP 5EPNA 1TNHA 1PQAA 2FXRA 1O2JA 2ZA5A 4YT6H 4ABFA 2ULLA 1C9TA 1FPHH 3BIVH 1AY6H 1BRUP 5EXLA 1GBMA 3PTBA 3DUXH 2WV5A 3HKIB 2H1UA 1LPZB 3F68H 1TOMH 1CT2E 1MU6B 2O9QA 2BY7X 1VITH 1CBWB 1IQIA 1EPTA 1GMHG 1S5SA 1ZR0A 1P2JA 1SGEE 1CGIE 1GDUA 1GJ6A 1P9UA 2HRVA 3TJUA 1CBWC 4AG1A 2A32A 3I29A 4Y6DA 2W3IA 3MH4A 1CA0C 1DLKB 1UTKA 4FUJA 2C8ZB 5GJ4B 1P2NA 1CGJE 1IOEA 1T8OA 1C2MA 4NZQA 3EYDA 5GCHF 4KP0A 2QXJA 3BTWE 1SGYE 2BY8X 2KAIA 2W26A 3GYLB 3GCHC 1AFEH 4HTCH 5JPMH 1C1QA 3P70B 3VPKA 1QJ6B 1NU9A 2ZFFH 2A7HA 4UE7H 2PHBA 3KL6A 3HK6B 1QGFA 2B8OH 1YPHE 4K60A 3QX5H 3TNTA 1UO6A 3ZVAA 3SGQE 1NESE 4DIIH 1DE7H 1MTUA 4U01A 3V12A 4D9QA 2R0KA 3H7OA 3Q76A 1K1IA 2IOTA 3BTGE 1RTLA 2A5KA 5C3NA 3RLWH 3MNCA 1VJAU 3SGBE 2BZAA 4GCHG 2LPRA 4JZDH 3ZVCA 1ZMJA 4MNXA 3KHVA 1O3IA 2EI6A 2GZ7A 2HNTF 1CA8B 1GI7B 4ZUHA 2PKSC 4B2CA 3C1KA 4MPWA 5DP4A 3ATLA 2Z9KA 4O3TA 3MI4A 5DP7A 4UONA 1TAWA 2XWAA 2BQ7B 1C2KA 1FI8A 4IS5A 2ZP0H 2EEKA 3SQEE 1GJ4H 3A8DA 3SU6A 3A81A 4GPGA 1VITG 1KXCA 1O2MA 1MKWH 4ASHA 3GCTF 2BY9X 2GCTB 1QRWA 2LNCA 2FOMB 4Y71A 1ZTJA 4F49A 2EI8A 1SGNE 2GCTC 1YM0A 5L6NH 5FX5A 1FONA 1KXFA 1DANH 2JH5D 1QURH 2OP9A 1CQQA 4UD9H 4WVPE 3V13A 1WQSA 3FZDA 4R0IA 1VJ9U 1F0TA 2AIPA 1D9IA 3BG4B 2C8WB 5JDUB 1P8VC 4CRGA 3SU4A 1HAPH 4ZKRU 2FOAA 3F9FA 4KGAA 1NN6A 2B9LA 1H9HE 2ZU2A 5HXFA 1GBKA 2WPHS 1SGDE 1C2HA 1JRSA 1GG6C 2FOHA 3E0NB 5DKMA 3RXIA 1W3CA 3LOXA 3A8BA 2FS8A 1XM1A 6ESTA 1SGPE 2VH0A 2Q6FA 1P03A 3URDA 1ELVA 1HCGA 1RFNA 4JZFH 3BTQE 3B23B 1Z8JB 3PV4A 2FLBH 1BTXA 1TBZH 1S84A 1E35B 2FOBA 2ZPSA 4WMEA 3U8OH 3O8BA 2NU0E 3RXGA 5C1UA 2GX4A 3GDUA 3G01A 1OWKA 3MO3A 1QFKH 3T5FH 1G37A 2BLWA 1TX6A 1QTFA 5EU8A 1O36A 1Z6EA 3KEEA 1KTTB 3E1XB 5LH8A 4JYTA 2RA0A 3BTFE 1P3CA 2Z3CA 3ZZBA 4GHTA 1BTZA 3RUOA 2RA3A 1SGFA 1UK3A 4LOYH 3ZZAA 2ZFQH 1OSSA 5BPEA 1SC8U 1GHAG 2OC0A 1YLDA 4WH6A 2HVXA 1THPB 1K1NA 1OWIA 2Z9IA 3CS0A 1KXEA 2ODQA 2C3SA 2PTCE 5A8ZA 1RGQA 5AHGH 1N6XA 1T32A 2AYWA 1RTFB 3SNDA 1T4VH 1DX5M 1SPJA 4NIWA 1UTPA 1TGNA 4B2BA 1TPSA 3V7TA 1Z7KA 4Q2KA 4XOJA 3SQHE 1P12E 1HAXB 4IC6A 3SNAA 5PTPA 1H8DH 2VJ1A 3M3SA 1KY9A 1V2LT 1C2FA 4WMDA 2VGCC 2ZTZA 2ZTYA 5C5OA 3UQVA 3KN2A 1F5KU 2VVCA 2ZHWH 1ELDE 2WYGA 1WCZA 3R3GB 2VIWA 1T4UH 2H9HA 3BV9B 2FTLE 4I32A 3M7UA 1V2OT 2AEIH 3ATKA 3RXSA 1HFDA 3EAJA 1YCPM 4Y11E 5C67A 1YPKH 3HGNA 3RXDA 1DT2A 1O2RA 2ZHDA 1GBCA 3STJA 3EA8A 1TRYA 1NRNH 2Y5FA 3M5NA 3LU9B 4MVNA 1AVGH 1DOJA 1WSSH 1F0UA 2BHGA 4Y10E 5A0AE 2Y7ZA 1O2IA 4CREA 5ABWA 4DJZB 3ZZ6A 1ANDA 5SGAE 2P3UB 2CGAA 4FVBA 1MTVA 1P09A 3KQDA 3RMMH 5JBBS 5DO4H 3HKJB 4OS7A 1ELTA 1WUNH 3A7ZA 2ZGHA 3UWIA 1PQ5A 3ZZ7A 3GISB 4DVAU 4IGDA 1O34A 3CS7A 1O2SA 4Y8YA 1Q3XA 3T28A 3GDVA 2ANYA 3TGIE 1ANBA 1QR3E 1AMHA 2Z3DA 5HM2A 2H5CA 3RXJA 2QXGA 1C4V2 1C5PA 1MUEB 1TMBH 2XWBI 1A0HB 3RC4A
chains in the Genus database with same CATH superfamily
2FO9A 1DFPA 3A8CA 1AE8H 3UY9A 1U6QA 1A5HA 4RKOB 1LHFH 2GVFA 1UCYH 4Z1MD 5C94A 1TA2A 4Q7ZA 1EFRD 1TLDA 2W5EA 2ZFPH 2L6OA 1TNLA 2BVXH 1GI1A 2HVYB 5HIYA 4CBNA 1JIRA 3PMAB 1O5AB 2QXIA 1KTSB 2UUFB 5FX6A 2BDGA 4NIXA 1Z8RA 1UTQA 2OD3B 2SGFE 3VFEA 1NRRH 2RG3A 2OUAA 3GY8A 3QGNB 1S6FA 1V2NT 4CRCA 4IMQA 3SI3H 1IQGA 4ACBA 3SHCH 1EJMA 1VKYA 4Y8XA 1W0YH 1GHWH 3ZV8A 4AYYB 1FAXA 4BAQB 3S9AA 1YPGH 2ZGXH 1PYTD 4D7GA 4UFFH 4FUDA 8LPRA 3QK1A 2P95A 4HGCA 4X8VH 4NCYA 1SOTA 4WF8A 3PM3A 1DWCH 2ZCLP 3SGAE 4IBLH 3ZVDA 4MNVA 1O39A 2QF3A 3SJ8A 3F2FA 3H5CB 6CHAB 1V3XA 3GCHB 2L74A 2ZDMA 3UTUH 1GWAA 1VCPA 4JZIA 4ZHAA 2UUJB 5CHAC 1BOQA 2V0BA 2ZU3A 2TBSA 1PPBH 5FPSA 2BDCA 4D9RA 3FAOA 4X2XA 2A5AA 2W7SA 1C5ZB 2VINA 3MOCA 1IQLA 5E0JA 2PGBB 3GCOA 5EW2H 4JK6A 5BRRE 3RMLH 3K65B 4BAKB 1DWDH 3SUGA 3LJOA 2J4IA 2JKHA 4O97A 1IQHA 3MU8A 1NM6A 1MCVA 1S83A 3B8JA 3GY5A 4OM9A 3TH2H 1HAGE 1G3EA 4NSVA 1OS8A 3A89A 2GGVB 4BTIB 1GPZA 1K22H 2ZU4A 1MZDA 2EI7A 5TJXA 3S9CA 3GYMA 3LPRA 3VB5A 1MKXH 1GDNA 2OBQA 4XBBA 3KNXA 2BD5A 4HZHA 4MTBA 4GCHF 5HYOA 1FIWA 1W7XH 1XUGA 1ZPCA 3NRLA 4X8SH 1EQ9A 2FI5E 1MTWA 2XOKD 3ATMA 5AF9H 2ZI2H 1LPKB 2BDYA 4CRFA 3RXQA 1BB0B 1P11E 1PPEE 4ISOA 2WUCA 1FUJA 2ZDNA 1SGCA 5F53A 4GHQA 1CGHA 3AK5A 3FOAA 4AOQA 1W11U 2YMSD 1AUTC 1CT0E 5JBCS 5HMAA 2A0QB 1SGIB 3PLPA 2VNTA 4CR5A 4CR9A 3FP7E 1NY22 1TALA 4HFPB 2ASUB 3UUZA 1FMGA 1G3BA 1T31A 2CMYA 1EP5A 1XUIA 1TMTH 3A83A 4JK5A 3VEQB 1BJVA 4RKJB 5A0BA 1EZQA 4B74A 1JWTA 3E16B 2Z6BD 4OS4A 4XBCA 2J98A 3FFGA 4A6LA 5EXNA 5EQQA 2WPLS 1P06A 5GNDA 1O32A 1NRSH 3LONA 2BD3A 3T62A 1RTKA 1RIWC 3RMOH 5C17A 4LZ1H 4B76A 1Q31A 4O3UA 4KKDA 1KXDA 5B6OA 1IQMA 2P94A 4DIHH 4K5ZA 3QZQA 1DUAA 2A4GA 3TNSA 5EQSA 1V2UT 3PV5A 2YNAA 3ZVBA 1O30A 5A8YA 4F55A 1LHCH 3UOUA 1C9PA 3SUDA 1CT4E 2HNTC 3ZZ3A 4ZROA 1O3GA 1PJPA 3M36A 2F9PA 4NA7A 3V0XA 1QBOA 1C1PA 4Q80A 1Y3XA 1IAUA 1L1NA 4RT1A 3BF6H 1UMAH 1MKXK 3R0FA 1DICA 1DLEA 2ZC9H 2WHXA 2O8WA 1MAXA 2BVRH 1O2NA 2J2UA 2VWOA 3NPSA 2WZQA 1NROH 2ZHEH 3UREA 1Y5BT 3BTEE 1BT7A 1ZGVA 1F7ZA 4K8YA 2H5DA 2G81E 1WQVH 1MMJN 3PROA 4XE4A 1UCYE 4BAOB 3DHKH 2HNTE 2XCNA 1O0DH 2C90B 3TJNA 1ZSJA 3CENA 2RDLA 2VIDA 1UTMA 2F91A 2FS9A 3KYGA 4ISNA 3RXHA 1BA8B 1QQUA 3LDXH 1ORFA 5GIBA 1FAKH 1L1JA 4ABGA 1TGTA 4YESB 1NFUA 1TA6A 1UTLM 1G3DA 4BTTB 3KCGH 3OY5U 1N8OB 1OWDA 3FO8D 5LPEA 1O2WA 1GHYH 2A4QA 1GHBF 1DXWA 2BD2A 1J9CH 1FY3A 4IN2A 2ZGBH 1OYQA 4FVDA 1A0LA 2ZU1A 4X6MA 1OWJA 1C4U2 1YCPH 4A1XA 2ZO3H 2ZQ2A 1AIXH 1K1OA 3SNCA 1CU1A 4U32A 1BMMH 1GMCF 1TE0A 1SLXB 1ESBA 2A7CA 1RD3B 3A7YA 3DT0H 3QO6A 2OXSA 1CVWH 4FUEA 4YM9A 1WV7H 4H6SB 3TH4H 2OK5A 3AW1A 4B2AA 1WOFA 4NFEA 1KYNA 3PYHA 1MKWK 3BTKE 3LGWA 4JMYA 4A1VA 4A92A 2BLOA 4I8HA 5FCKA 1O31A 1S0RA 1E38B 1XVOA 1FJSA 4Y0ZE 3SUFA 3BTTE 1Y5AT 9ESTA 3E0PB 4CRAA 3A82A 4RN6A 1HRTH 2FWWA 3MU0A 4FXGH 3SUEA 1GBBA 3SI4H 5JBAS 1LVOA 3EA7A 1GBAA 1EZSC 2FESH 1EAIA 1PYTC 2BTCE 2D2DA 2W6JD 3DSGA 3HPTB 4Y8ZA 3W94A 1NBME 1SKYE 5GCHG 1A3EH 1C2EA 1YYY1 2A5IA 5CMXH 1IQEA 2SGQE 3EQ0H 1AWHB 3QGJA 3RXTA 1ANEA 2M2AA 1ETTH 2KCOA 5DK1A 2BOHB 4AFZA 3DD2H 1HAOH 4NGAH 2BXUH 1GBTA 2V7QD 1ANCA 1P2KA 1TRNA 1W0ZU 1TPPA 5FAHA 1DY8A 1HUTH 2H6MA 1JBUH 4KTUA 3ENSB 1TABE 4IN1A 2SGAA 1ZYOA 2F9UA 4TPIZ 4BAMB 3UB0A 3ZZ8A 1NO9H 3UAIC 7LPRA 1ZRBA 4F4OC 1ABJH 1GDQA 1BTWA 1E1QD 3F2GA 2KX4A 4CH2B 2G8TA 3A85A 1LHEH 3S0NA 1YGCH 4MPXA 4TWWA 5JYIA 1H8ED 1C1WH 1LHGH 3F2HA 4UDWH 3OTPA 3MO9A 1T7CA 2QCYA 1E37B 3LC3A 3SNEA 1LDTT 2DE9A 5EGMA 5IDKA 3ZYDA 3PMJA 1WBGB 2J97A 2P8OC 4ZXXH 1HV7A 1Z8GA 1OX1A 1UTNA 1WU1A 2SGDE 1GMCG 3RXKA 4MPVA 2NU3E 3MH7A 1MQ6A 3D65E 1TGCA 1E34B 4MLFB 1AZZA 7GCHG 3PTNA 3TGKE 4XDEA 1EASA 3DCLA 2XCFA 2J34A 3GCNA 2K0QA 3GY6A 5DP8A 1D6WA 4ZHMU 1ELAA 1YF4A 1EOLA 2G51A 2YNBA 2ZKSA 2XRCA 4D8NA 1EUFA 3FKSD 1EX3A 3RU4D 3F0OA 1RRKA 4M9FA 2QF4A 1AB9B 2GCHF 5EPYA 1OWEA 3D23A 1AWFH 2FDAA 1AB9C 1C5QA 4YO9A 3UNRA 1ABIH 1HJAC 4X1QU 2AERH 3RXLA 3P95A 1ID5H 1F5RA 1HJAB 2R3YA 2BX3A 1RJXB 1ZPZA 3RP2A 4UFEH 2CN0H 1EAWA 3RXUA 1IQNA 2ANKH 2R3UA 2SGPE 2XYAA 3SJOA 2QAAA 2ZF0H 5DP9A 1W2KH 5GDSH 1P2MA 2H9TH 1O37A 4AC9A 1F5LA 2D26C 4B1TA 4B6FA 1NU7B 5E2PA 7KMEH 4FUFA 3QLPH 2K1QA 1LKAA 1SQAA 4X6NA 4E06H 2R9PA 3RC5A 4ASUD 2FIRH 5TCCA 4AZ2B 3WY8A 1BRCE 4X2WA 4FUBA 4SGAE 2GJGA 5GPIB 4E7RG 1C1MA 1ETSH 3EA9A 1BHXF 3AAUA 2WPKS 5DP6A 5EJZA 4X1PU 3MHWU 1C5LH 2F83A 1OHHD 1HLTH 5I25A 1GJ7B 2HWLB 1UW7A 2TGTA 2CHAC 4ZKNU 4ESTE 1H9IE 1Y3UA 1UTOA 1QB9A 2FODA 1PPGE 1NTPA 2CHAB 3K6YA 1PQ8A 1MTSA 4I31A 1UHBA 2VWMA 3F1SB 1NBMD 4JYVH 2CF8H 2WUBA 1EZXC 2BY5X 1FQ3A 4B6EA 2HLCA 1ACBE 4BTUB 1D6RA 1TRMA 2FOFA 4QT8C 5ETXA 3V3MA 1W10U 1S82A 2VBCA 3DFLA 2Z94A 1MQ5A 5FXLA 3EGKH 3UOPA 1MCTA 1J14A 3TLOA 4X6PA 3M3VA 1AVWA 1XKAC 5C1YA 1DY9A 3KQCA 3ZVFA 4B73A 1TX7A 1ZPBA 4YOJA 1BITA 1JIMA 1KIGH 1V2ST 2BLQA 2IPHA 3F0PA 1VZQH 4KTCA 2F9VA 5GWZA 3MWIU 1TPOA 2V3HH 4ABIA 2TGAA 2IPQX 1IHTH 1O35A 1LQDB 4UEHH 3BTHE 5H4IB 2TIOA 3KQ5A 1SGFG 4KELA 5T6FA 1GGDB 1RXPA 7ESTE 1HDTH 1F0SA 1QIXB 4ZCNA 4I8JA 3U1JB 3W95A 2V3MA 1WDIA 2ZFTA 2Y6TA 5EJLA 1YPMH 4IC5A 1YLCA 2BD4A 4A7IB 1V2KT 1TOCB 4TWYA 1MH0A 1MZAA 3OTJE 3SU0A 4UFGH 1XUHA 2PGQB 1DXPA 2ZGCA 2R0LA 3AW0A 2XNDD 3SJKA 3SV7A 1C5XB 4A5TS 4OS1A 4CRDA 3VB6A 4I86A 1CE5A 1K1MA 3GCTG 2EY4C 2FM2A 4RI0A 1O2GH 3TK5A 2XC4A 4LXBH 1BQYA 1H9LB 4GUXA 1QHRB 5DP5A 3E91A 1J8AA 2GMTB 4P00A 1GBHA 1GI5A 1OP2A 1P05A 1TX8A 1QL9A 3LC5A 2GMTC 1QL8A 3FANA 3B9FH 3PRBA 4OS2A 1O2LA 3SORA 4DOQA 1IQFA 3SV9A 3TJOA 3A88A 2RDEA 4WJG2 3ODFA 2C4FH 2ZCKP 3P8OA 4K69A 1GI6A 1HNEE 1SG8B 5EIYA 1TNJA 2STBE 2QY0B 3A8AA 1TWXB 1JOUB 2QA9E 2CJIA 1UK2A 2ZGJA 2Z7FE 3ZIAD 1MD7A 1DS2E 3Q3KA 3ODDA 4DY7B 2BY6X 1O5EH 2A2XH 1PQ7A 4TY6A 4AG2A 3N7OA 3RXPA 3M5MA 4ZH8A 1EAXA 4O9VA 3QTVH 2PFEA 2FYQA 1LO6A 2YMSB 2XBYA 4FETA 4CBOA 4X1SU 1A7SA 2AH4X 2ESTE 4ABEA 1NC6A 1A46H 2A4OA 1QZ8A 5FPYA 1V2TT 3A7XA 1UK4A 3GS9A 2EQNA 4E05H 4XD7D 5EOKA 1QA0A 4DT7B 1EKBB 2W7UA 2OQUA 1W7GH 4AGJA 1WTGH 2IJOB 1XKBC 1YP9A 1LVYA 2AIQA 4IMZA 4K1TA 5EXMA 2Q6GA 5T6DA 4FUHA 2GDDA 5A0CA 1BBRH 1YPEH 1IQJA 3QDZB 4FU7A 1ZJDA 2BOKA 2ANWA 1NPMA 4VGCC 4YOIA 3ATWA 1MTNB 3KQBA 1Z1IA 3D62A 3VXEH 1XXDA 4P02A 4VGCB 1MTNC 2BLVA 1BTHH 4MG3A 1O2HA 3FP8E 3AVZA 3L3TA 4WH8A 3FVFB 1GL1A 1TGSZ 4YLQH 2G52A 2F9OA 5A2MH 2BD8A 1GJ9B 3F9HA 3NXPA 4ISIH 1EZUC 1X7AC 1BZXE 4OGXA 1HAIH 1SFIA 3E8LA 3RXRA 5T1VA 4H4FA 1NFYA 2PKAA 1AU8A 1L0ZA 5LPFA 1A5IA 4NSYA 4J1YA 2F9BH 1P01A 5JB9S 2VWLA 1GBDA 3STIA 1ZJKA 3K2UA 1ZTLA 3T26A 1AD8H 3M37A 2FX6A 2P16A 1VGCB 3GY7A 1ZZZA 1LQEA 2VWNA 3GDSA 4Q7XA 3VXFH 4K1SA 1NRQH 2GT8A 3RXFA 2ODPA 1O3FA 1HIAB 1GBFA 1DUEA 2TPIZ 4RSPA 4AB8A 4AFQA 1Q2WA 1BBRE 2R2WU 2FI4E 1LTOA 2V35A 3BG4C 2Q6DA 5F03A 1FY1A 1PPHE 5K7RA 2WV4A 1HB0B 4YTAA 1ARCA 2ZDLA 1GI8B 1W12U 2JIZD 3RU4E 1O5GH 1C1VH 3T29A 5C5NA 2FOCA 1W13U 4JYUH 4SGBE 1O2VA 2BQWB 1C2IA 3ATIA 4JZEH 2CF9H 1GI0A 2C93B 4Z6AH 5E0HA 5AFZH 3MU1A 4ZHLU 2ANMH 7GCHF 4X1NU 9LPRA 1Y3VA 2A7JA 2FOGA 2HGTH 1A61H 1FPCH 1GMDF 2H9EH 3ZZ4A 3TPIZ 1KLJH 3SU1A 3GY2A 1B7XB 1BTYA 1QQ4A 2C8YB 1C5YB 1AI8H 3OEED 2Y82A 2WYJA 3NKKA 4ABBA 3A84A 1V2WT 5E0GA 1E1RD 1OP8A 2O8LA 3BN9A 3RM0H 1SVPA 5HIZA 4K2YA 5KECA 3GICB 1JRTA 2OLGA 3M5OA 3PMBB 4KTSA 2BDAA 4K3JA 1C5WB 3T27A 2A45B 5EJ1A 1P2IA 2C8XB 3M7QA 1G32B 4J2YB 4XSKU 2J94A 1SQTA 3KGPA 1XUFA 5J4QA 2Z9JA 3F3BA 1CO7E 2WPDD 5EW1H 2VVVA 1ELBA 1L1GA 4ZKOU 2UWPA 1KSNA 1WTHD 3SZNA 2KAIB 1O3NA 1AQ7A 3UWJH 1EP6A 4U2WA 3TJVA 2TGDA 2Z9LA 3NCLA 1TYNA 4X1RU 1SLVB 1PPCE 5T6GA 3RXVA 1LHDH 3QZRA 2VIQA 2Z3EA 2O8UA 1ZHMA 1EAUA 1YBWA 5C0TA 6GCHG 1GCTB 1K9OE 3P8NA 3PWCA 1ETRH 1GJCB 3LGUA 3BEFB 1C2GA 1GJDB 5J4SA 1NRPH 3E6PH 1QCPA 1XUJA 3S69A 3MO6A 3SHAH 1BCUH 5CE1A 2XBWA 1T8NA 2GP9B 4NFFA 1G2MA 1BDAA 1FV9A 5HKKD 1NFWA 2JH6D 5CDFE 4XFQA 1ARBA 3TK9A 3VGCB 1DSTA 3SO3A 3ZZCA 1W14U 2BMGB 2KCAA 3MH5A 1J15A 4CHAC 2KZ4A 2UUYA 1ZGIA 1B5GH 2AFQB 1SGQE 3BTME 3OSYA 1PFXC 1LVMA 5EODA 4AORA 1E79D 2KCPA 5JB8S 1TPAE 4U30A 2Y80A 3DSOA 2IJD1 4Q7YA 1BHXB 1ZSLA 1TFXA 1ZMNA 3CNRA 4NA8A 4AFSA 1VITF 1YWUA 1O2YA 1QA7A 1VCQA 1Z71A 5DPAA 1IQKA 4I8KA 2Y7XA 2G4UA 3GOVB 1YC0A 2ZDKA 1ZOMA 1C1SA 1A4WH 3KYFA 4WXVA 4Y7BA 5CHBA 2ZPQA 4R8TB 1O3PB 3Q77A 1GHBG 1H1BA 1GGDC 4INHA 5F8TA 3DA9B 4OS6A 1O2OA 1FZZA 1ZSKA 3MNBA 5HM9A 1ZLRA 3E3TA 2B5TB 3WWBA 1MBMA 1G36A 2VVUA 5FHTA 2AGIX 1C1RA 2ZDAH 3AAVA 4BXSA 1OOKB 4DURA 3AASA 1FDPA 6GCHF 1TMUH 4Y79A 3Q3YA 3MU5A 1QJ1B 3GY4A 2TRMA 3MH6A 4GAWA 2PSXA 1XVMA 1T8MA 4ABDA 1W0KD 3LGTA 2XBVA 4X2YA 2D8WA 1UVPA 1GBLA 1ZHRA 2AHME 2QF5A 5ESTE 1HXEH 2AMQA 3LKWA 1O3BA 1P02A 3FP6E 1V2RT 1WYKA 2PUXB 5FCRA 3M5LA 3LJJA 1K1LA 1O33A 3Q00A 2Y81A 3OE7D 4UFDH 2F9NA 3SV6A 1SHYA 1Y59T 1K1PA 1XX9A 3ITIA 3UNQA 1Y5UT 5FBEA 3RU4T 3URCA 1BMLA 3UIRA 3OYPA 4X8UH 3IG6B 1C5VA 3U8RH 1ZTKA 1L4DA 2PKAB 1P04A 4FU9A 4ACAA 2ZEBA 2ZU5A 4FUIA 2O8MA 5FBIA 2FI3E 1GVKB 2OINA 1DSUA 1D3TB 1EPTB 2I6QA 5FL7D 2P8OB 5DN6D 1DITH 1GI9B 1SFQB 1YPHC 2SNWA 4X2VA 1DPOA 2VB0A 5L2YH 3KQEA 1TGBA 2FLRH 1GHXH 1AKSB 3JZ1B 4JZ1A 2P3TB 3SJIA 3LGIA 2QC2A 8KME2 3Q3XA 2VIVA 1HIAA 1HBTH 2FP7B 1HAYB 2JETC 4ZAEA 1MAYA 5EG4A 1HAZB 1DWEH 1CHOG 3O8RA 2JETB 1BBRK 5A8XA 6CHAC 1FN6A 1XMNB 2BYAX 2WPMS 2PWXA 3H09A 1D3DB 3DFJA 1UVTH 4AYVB 2PTNA 2LELA 4I7YH 4K1EA 2VH6A 1SLWB 1BTPA 1GVZA 2ZFRH 2R2MB 3SJ9A 4ISHH 2AMPA 1ZMLA 1G3CA 1A1RA 1H8HD 4ISLA 2QYIA 1L2EA 3FZZA 5CHAB 1C1UH 1SR5C 4NZLA 2PR3A 2OBOA 5KGOA 3VB4A 1HAVB 1F92A 1AO5A 1GJBB 5DGJA 3IWMA 2SFAA 4MNWA 2SGEE 1KXAA 3SW2B 4ZMAH 3GY3A 1EB1H 2G00A 4XBDA 1C5UA 2ZHFH 1QJ7B 4E7NA 3A87A 5ESBA 1SBWA 5C2ZA 1QBVH 5L2ZH 3TGJE 3SOSA 2B0FA 1MU8B 1DWBH 3F6UH 4LZ4B 1B0FA 2QF0A 3JZ2B 4OS5A 1E36B 2P59A 2PKSB 1BMFD 1S85A 4B75A 4DGJA 1KDQB 2RCEA 1FIZA 1QL7A 3ZZ5A 1FX0B 5F8ZA 2WPIS 3F9GA 5AFYH 4ZXYH 3BTDE 4YLUA 2AGEX 2QXHA 2JJ2D 1DM4B 1BIOA 3L33A 2Q1JA 1S6HA 4X0WU 5EQRA 2BZ6H 1O3HA 1VGCC 1N6YA 3P6ZB 3KIDU 1HJ9A 3EE0B 3P8FA 3S7KB 3LIWA 4NIYA 2ODYB 3OU0A 1N1LA 3RLYH 4YT7H 1O2QA 3H7TA 1AHTH 3UQOA 2GZ8A 1JXPA 2A1DB 1C1OA 4GVUA 3BEUA 2BD7A 1A2CH 1C2JA 3M35A 2GTBA 3UNSA 1O3MA 5GXPA 1C5NH 1RIWB 2ZG0H 3SBKA 2FTMA 1GL0E 1TB6H 5E8EH 2NWNA 1BJUA 1O2ZA 1LPGB 3PWBA 1G9IE 2PSYA 3ZZDA 4AN7A 3N7DA 3FN8A 5B6LA 1NFXA 4Y7AA 2FPZA 2RFKC 4B71A 2GV7A 3SV8A 1GG6B 4ZKSU 1P9SA 2JJ1D 4CRBA 1SOZA 1VR1H 3VG8A 1M9UA 3M3TA 3NWUA 1GHVH 4INKA 3I78A 1YCPK 1O3OA 3OAAD 8GCHG 2DUCA 1SMFE 1GCDA 1WAYB 4H6TA 4AFUA 3A7WA 2ZNKH 1YPLH 4YZUA 1KLIH 2XBXA 1ZHPA 1J16A 1ESTA 3CP7A 1P10A 1O5CB 5K0HA 1UVOA 1GMDG 2J38A 2OC1A 1O2PA 1NZQH 2EA3A 1P2QA 4MDSA 1SLUB 1C1NA 3T25A 1FNIA 3BSQA 1GMHF 2ZHQH 1O2TA 1K2I1 1INCA 1MD8A 4WMFA 2AS9A 2KR7A 1LKBA 3EDXB 4WWYA 1KLTA 1OWHA 4YOGA 5JBTA 1GCTC 2ZQ1A 1TIOA 1V2JT 3SNBA 1CHGA 1SL3A 1G2LA 2BB4A 4TY7A 1FY5A 1N8OC 2G4TA 4I8GA 3DSPA 4TYDA 1NS3A 2XNIA 2Y5HA 1AZ8A 1GI3A 3TVJB 4NA9H 2BDHA 1BRAA 4BXWA 5IYTA 2GCHG 8ESTE 3LH1A 3VGCC 1UTJA 3HK3B 3N99A 2OC7A 1C4Y2 4TPYA 3S9BA 1V2PT 1AGJA 3VB3A 3OEHD 2CXVA 2ZTXA 1CA0B 1EB2A 3U1IB 3U98H 1MABB 3KF2A 3PMHB 2FX4A 2Z9GA 2G55A 1V2VT 4MQAA 1C5TA 1FXYA 2TGPZ 1F2SE 2OCVB 1T8LA 3RDZA 1O38A 5F6MA 3RXBA 4IW4E 1AFQB 1D3QB 2J95A 2G5NA 2NU2E 1UVSH 3MNSA 1AFQC 1ELFA 4LK4A 3TH3H 1SI5H 1F0RA 3NZIA 1P0SH 2F4LA 2BM2A 2F3CE 2J92A 1A3BH 3BEIB 1ELGA 2NU1E 2BQ6B 1GI2A 2XW9A 1H4WA 1A5GH 5C20A 1GVLA 3ZYEA 3QWCH 1K28D 3RXCA 1RS0A 1EXFA 3TU7H 1O3LA 2A31A 1GHZA 2CV3A 3SU2A 1V6DA 1ZRKA 2EC9H 1UHBB 2A2QH 2P3FH 4H42U 2M5TA 2GV6A 1GBJA 3RXOA 5F8XA 4M7GA 1HAVA 4Y0YE 2THFB 4AX9H 1LMWB 1FY8E 3RXMA 2GD4B 3IITA 4X8TH 1S81A 3PO1C 1QB1A 2PV9B 1QB6A 3K6ZA 3MMGA 3ZVGA 3A7VA 3PO1B 1VCWA 1AE5A 3PLKA 2GKVE 1OXGA 3C27B 1BTUA 2PUQH 3A7TA 4FU8A 3M7TA 1HGTH 2ALPA 1HYLA 3U9AH 2QIQA 3A86A 4AB9A 2V6NA 1C5SA 1UJ1A 1FN8A 2B7DH 3PRDA 5DG6A 1E0FD 1D4PB 2HALA 5KEDA 2BD9A 3UPEA 4NIVA 4Z0KA 4MPUA 5E2OA 2ZWLH 1KDQA 1W0JD 2FZZA 3TIUA 4ABJA 1TNIA 2JH0D 1UVUH 4OGYA 1C2LA 4X6OA 5AVDA 5L30H 2STAE 4BOHA 1Y3WA 3BG8A 1EPTC 2OTVA 5LPRA 1O3DA 3LH3A 1LVBA 3ESTA 1K21H 1BMNH 1C1TA 2UWOA 1IHSH 1O3JA 4FUCA 3TK6A 1K0HA 1EOJA 1SQOA 2O8TA 2BDIA 2QN5T 1GJ8B 1FLEE 2I6SA 1Z8IB 3UR6A 4JCNA 4HI3A 2D1JA 4FUGA 2QV1A 3MTYA 1ELCA 4ABHA 4BAHB 3ELAH 5G4BA 1QRZA 3L6PA 1CHOF 3QN7A 4AGKA 4D7FA 1YY3A 1D3PB 2UWLA 2YOLA 3N7EA 1GJAB 3D49H 6LPRA 2HOBA 4DT4A 2XXLA 1W8BH 3MNXA 3U69H 1OYTH 2GDEH 1GHAF 3E90B 1EJNA 2OC8A 1TBQH 2QE7D 2BX4A 3VB7A 3SV2H 1BMAA 1K1JA 3U8TH 3UFAA 4GLYA 1V2QT 2ZZUH 3O8CA 3ZV9A 3MFJA 1EATA 1J17T 1GJ5H 2VIOA 2A4RA 3M61U 1EJAA 5C1XA 2XTTB 1GBEA 5FPTA 3ZVEA 1YPJH 2ILNA 2ZECA 1O3AA 3F9EA 2AMDA 3RC6A 1C5RA 1KXBA 4Y76A 3LGVA 1H8IH 3EE7A 1O5DH 3P17H 1HAHH 3OX7U 1AKSA 1YKTA 1O3KA 1THRH 1HPGA 3LGYA 1QNJA 4O03A 2ZIQH 1PPZA 3NK8A 4NWLA 2XC5A 1SB1H 2IN2A 3QUMP 2Y5GA 4ABAA 1O2XA 1DVAH 3LT3A 1OP0A 2W3KA 3O8DA 2DE8A 1O5FH 3K9XB 3SU3A 4GSOA 1Y3YA 4D76A 1TONA 4WY3A 1FY4A 1O2KA 1A0JA 2J9NA 4NG9H 4PROA 1MBQA 1Y8TA 3HGPA 5HGGA 2G5VA 1QY6A 2XC0A 3NUMA 4I8LA 4CHAB 4WXIA 1SGRE 2HPPH 1S0QA 1V2MT 3A80A 2ZPRA 3WWFA 4THNH 1JMOH 1O5BB 4Q63A 2VIPA 2VGCB 2FYRA 5DJ7A 1XXFA 2FEQH 2WINI 1AUJA 1O3CA 2AGGX 1XUKA 2FOEA 1TQ7B 4A1TA 2HPQH 2F43B 2GZ9A 1SSXA 1GI4A 1S6LA 1C2DA 1C5OH 2KFWA 2BXTH 1P3EA 3P92A 1O2UA 1O3EA 1HXFH 1AN1E 3P8GA 1P57B 1PPFE 3RM2H 2GT7A 1TNKA 1TQ0B 3RMNH 2BDBA 4DCDA 1LCYA 1THSH 2ZDVH 4NWKA 1GBIA 1TNGA 4BNRA 3OY6U 3QTOH 4F48B 1OKXA 4INLA 1L4ZA 2SNVA 2BVSH 3SN8A 2FMJA 1C5MD 3BIUH 1DDJA 1HJ8A 3TITA 5LGOA 5DP3A 3WW7A 2ZFSA 3PLBA 2NU4E 3RXAA 1OPHB 1UCYK 5A09A 1P2OA 1BUIA 1QBNA 3T2NA 2OQ5A 3MYWA 1AVXA 1G30B 4BANB 3SU5A 3RXEA 1ELEE 2K8IA 2V3OH 3UR9A 1TBRH 1CSOE 4XRNA 1QRXA 1ESAA 1SHHB 5T3HA 1NT1A 3S7HB 2WPJS 4K8BA 1Z6JH 4I33A 2JDID 2UUKB 4DG4A 2VU8E 4MNYA 2ALVA 4DW2U 3MU4A 1BRBE 2PLXA 4CH8B 2P93A 3HATH 1SGTA 3PB1E 3U28C 3I77A 8GCHF 2QGRA 2PW8H 5TCAA 2H2ZA 3SYJA 1Z1JA 3ZZ9A 1B0EA 5I46H 2ZCHP 5EPNA 1TNHA 1PQAA 2FXRA 1O2JA 2ZA5A 4YT6H 4ABFA 2ULLA 1C9TA 1FPHH 3BIVH 1AY6H 1BRUP 5EXLA 1GBMA 3PTBA 3DUXH 2WV5A 3HKIB 2H1UA 1LPZB 3F68H 1TOMH 1CT2E 1MU6B 2O9QA 2BY7X 2YMSC 1VITH 1CBWB 1IQIA 1EPTA 1GMHG 1S5SA 3W1EA 1ZR0A 1P2JA 1SGEE 1CGIE 1GDUA 1GJ6A 1P9UA 2HRVA 3TJUA 1CBWC 4AG1A 2A32A 3I29A 4Y6DA 2W3IA 3MH4A 1CA0C 1DLKB 1UTKA 4FUJA 5C0UA 2C8ZB 5GJ4B 1P2NA 1CGJE 1IOEA 1T8OA 1C2MA 4NZQA 3EYDA 5GCHF 4KP0A 2QXJA 3BTWE 1SGYE 2HLDD 2BY8X 2KAIA 2W26A 3GYLB 3GCHC 1AFEH 4HTCH 5JPMH 1C1QA 3P70B 3VPKA 1QJ6B 1NU9A 2ZFFH 2A7HA 4UE7H 2PHBA 3KL6A 3HK6B 1QGFA 2B8OH 1YPHE 4K60A 3QX5H 3TNTA 1UO6A 3ZVAA 3SGQE 1NESE 4DIIH 2PP6A 1DE7H 1MTUA 4U01A 3V12A 4D9QA 2R0KA 2J98B 3H7OA 3Q76A 1K1IA 2IOTA 3BTGE 1RTLA 2A5KA 5C3NA 3RLWH 3MNCA 1VJAU 3SGBE 2BZAA 4GCHG 2LPRA 4JZDH 3ZVCA 1ZMJA 4MNXA 3KHVA 1O3IA 2EI6A 2GZ7A 2HNTF 4FOUC 1CA8B 1GI7B 4ZUHA 1WXRA 2PKSC 4B2CA 3C1KA 4MPWA 5DP4A 3ATLA 2Z9KA 4O3TA 3MI4A 3SZEA 5DP7A 4UONA 3MQKC 1TAWA 2XWAA 2BQ7B 1C2KA 1FI8A 4IS5A 2ZP0H 2EEKA 3SQEE 1GJ4H 3A8DA 3SU6A 3A81A 4GPGA 1VITG 4TT3D 1KXCA 1O2MA 1MKWH 4ASHA 3GCTF 2BY9X 2GCTB 1QRWA 5DSFA 2LNCA 2FOMB 4Q4LA 4Y71A 1ZTJA 4F49A 2EI8A 1SGNE 2GCTC 1YM0A 4TSFD 5L6NH 5FX5A 1FONA 1KXFA 1DANH 2JH5D 1QURH 2OP9A 1CQQA 4UD9H 4WVPE 3V13A 1WQSA 3FZDA 4R0IA 1VJ9U 1F0TA 1KMHB 2AIPA 1D9IA 3BG4B 2C8WB 5JDUB 2KCYA 1P8VC 4CRGA 3SU4A 1HAPH 4ZKRU 2FOAA 3F9FA 4KGAA 1NN6A 2B9LA 1H9HE 2ZU2A 5HXFA 1GBKA 2WPHS 1SGDE 1C2HA 1JRSA 1GG6C 2FOHA 3E0NB 2WSSD 5DKMA 3RXIA 1W3CA 3LOXA 3A8BA 2FS8A 1XM1A 6ESTA 1SGPE 2VH0A 2Q6FA 1P03A 3URDA 1ELVA 1HCGA 1RFNA 4JZFH 3BTQE 5IK2D 2CK3D 3B23B 1Z8JB 3PV4A 4YXWD 2FLBH 1BTXA 1TBZH 1S84A 1E35B 2FOBA 2ZPSA 4WMEA 3U8OH 3O8BA 2NU0E 3RXGA 5C1UA 2GX4A 3GDUA 3G01A 1OWKA 3PV2A 3MO3A 1QFKH 3T5FH 1G37A 2BLWA 1TX6A 1QTFA 5EU8A 2WV9A 1O36A 1Z6EA 3KEEA 1KTTB 3E1XB 5LH8A 4JYTA 2RA0A 3BTFE 1P3CA 2Z3CA 2KM0A 3ZZBA 4GHTA 1BTZA 3RUOA 2RA3A 1SGFA 1UK3A 4LOYH 3ZZAA 2ZFQH 3OFND 1OSSA 5BPEA 1SC8U 1GHAG 2OC0A 1YLDA 4WH6A 2HVXA 1THPB 1K1NA 1OWIA 2Z9IA 3CS0A 1KXEA 2J5UA 2ODQA 2C3SA 2PTCE 5A8ZA 1RGQA 5AHGH 1N6XA 1T32A 2AYWA 1RTFB 3SNDA 1T4VH 1DX5M 1SPJA 4NIWA 1UTPA 1TGNA 4B2BA 1TPSA 3V7TA 1Z7KA 4Q2KA 4XOJA 3SQHE 1P12E 1HAXB 4IC6A 3SNAA 5PTPA 1H8DH 2VJ1A 3M3SA 1KY9A 1V2LT 1C2FA 4WMDA 2VGCC 2ZTZA 2ZTYA 5C5OA 3UQVA 3KN2A 1F5KU 2VVCA 2ZHWH 1ELDE 2WYGA 4RT0A 1SQRA 1WCZA 3R3GB 2VIWA 1T4UH 2H9HA 3BV9B 2FTLE 4I32A 3M7UA 1V2OT 2AEIH 3ATKA 3RXSA 1HFDA 3EAJA 1YCPM 4Y11E 5C67A 1COWD 1YPKH 3HGNA 3RXDA 1DT2A 1O2RA 2ZHDA 1GBCA 3STJA 3EA8A 1TRYA 1NRNH 2Y5FA 1YLNA 3M5NA 3LU9B 4MVNA 1AVGH 1DOJA 4HG6A 1WSSH 1F0UA 2BHGA 4Y10E 5A0AE 2Y7ZA 1O2IA 4CREA 5ABWA 4DJZB 3ZZ6A 1ANDA 5SGAE 2W6ID 2P3UB 2CGAA 4FVBA 1MTVA 1P09A 3KQDA 3RMMH 5JBBS 5DO4H 3HKJB 4OS7A 1ELTA 1WUNH 3A7ZA 2ZGHA 3UWIA 1PQ5A 3ZZ7A 3GISB 4DVAU 2LP6A 4IGDA 1O34A 3CS7A 1O2SA 4Y8YA 1Q3XA 3T28A 3GDVA 2ANYA 3TGIE 1ANBA 1QR3E 1AMHA 2Z3DA 5HM2A 2H5CA 3RXJA 2QXGA 1C4V2 1C5PA 1MUEB 1TMBH 2XWBI 1A0HB 3RC4A
chains in the Genus database with same CATH topology
2FO9A 1DFPA 3A8CA 1AE8H 3UY9A 1U6QA 1A5HA 4RKOB 1LHFH 2GVFA 1UCYH 1TA2A 4Q7ZA 1TLDA 2W5EA 2ZFPH 1TNLA 2BVXH 1GI1A 4CBNA 1JIRA 3PMAB 1O5AB 2QXIA 1KTSB 2UUFB 5FX6A 2BDGA 4NIXA 1Z8RA 1UTQA 2OD3B 2SGFE 3VFEA 1NRRH 2RG3A 2OUAA 3GY8A 3QGNB 1S6FA 1V2NT 4CRCA 4IMQA 3SI3H 1IQGA 3SHCH 1EJMA 4Y8XA 1W0YH 1GHWH 3ZV8A 4AYYB 1FAXA 4BAQB 3S9AA 1YPGH 2ZGXH 1PYTD 4D7GA 4UFFH 4FUDA 8LPRA 3QK1A 2P95A 4HGCA 4X8VH 4NCYA 1SOTA 4WF8A 3PM3A 1DWCH 2ZCLP 3SGAE 4IBLH 3ZVDA 4MNVA 1O39A 2QF3A 3SJ8A 3H5CB 6CHAB 1V3XA 3GCHB 2ZDMA 3UTUH 1GWAA 1VCPA 4JZIA 4ZHAA 2UUJB 5CHAC 1BOQA 2V0BA 2ZU3A 2TBSA 1PPBH 5FPSA 2BDCA 4D9RA 3FAOA 4X2XA 2A5AA 2W7SA 1C5ZB 2VINA 3MOCA 1IQLA 5E0JA 2PGBB 3GCOA 5EW2H 4JK6A 5BRRE 3RMLH 3K65B 4BAKB 1DWDH 3SUGA 3LJOA 2J4IA 2JKHA 4O97A 1IQHA 3MU8A 1NM6A 1MCVA 1S83A 3B8JA 3GY5A 3TH2H 1HAGE 1G3EA 4NSVA 1OS8A 3A89A 2GGVB 4BTIB 1GPZA 1K22H 2ZU4A 1MZDA 2EI7A 5TJXA 3S9CA 3GYMA 3LPRA 3VB5A 1MKXH 1GDNA 2OBQA 4XBBA 3KNXA 2BD5A 4HZHA 4MTBA 4GCHF 5HYOA 1FIWA 1W7XH 1XUGA 1ZPCA 4X8SH 1EQ9A 2FI5E 1MTWA 3ATMA 5AF9H 2ZI2H 1LPKB 2BDYA 4CRFA 3RXQA 1BB0B 1P11E 1PPEE 4ISOA 2WUCA 1FUJA 2ZDNA 1SGCA 4GHQA 1CGHA 4AOQA 1W11U 1AUTC 1CT0E 5JBCS 5HMAA 2A0QB 1SGIB 3PLPA 2VNTA 4CR5A 4CR9A 3FP7E 1NY22 1TALA 4HFPB 2ASUB 3UUZA 1FMGA 1G3BA 1T31A 2CMYA 1EP5A 1XUIA 1TMTH 3A83A 4JK5A 3VEQB 1BJVA 4RKJB 5A0BA 1EZQA 4B74A 1JWTA 3E16B 2Z6BD 4OS4A 4XBCA 4A6LA 3FFGA 5EXNA 5EQQA 2WPLS 1P06A 1O32A 1NRSH 3LONA 2BD3A 3T62A 1RTKA 1RIWC 3RMOH 4LZ1H 4B76A 1Q31A 4O3UA 4KKDA 1KXDA 5B6OA 1IQMA 2P94A 4DIHH 4K5ZA 3QZQA 1DUAA 2A4GA 3TNSA 5EQSA 1V2UT 2YNAA 3ZVBA 1O30A 5A8YA 1LHCH 3UOUA 1C9PA 3SUDA 1CT4E 2HNTC 3ZZ3A 4ZROA 1O3GA 1PJPA 3M36A 2F9PA 4NA7A 3V0XA 1QBOA 1C1PA 4Q80A 1Y3XA 1IAUA 1L1NA 3BF6H 1UMAH 1MKXK 3R0FA 1DICA 1DLEA 2ZC9H 2O8WA 1MAXA 2BVRH 1O2NA 2J2UA 2VWOA 3NPSA 1NROH 2ZHEH 3UREA 1Y5BT 3BTEE 1BT7A 1ZGVA 1F7ZA 4K8YA 2H5DA 2G81E 1WQVH 1MMJN 3PROA 4XE4A 1UCYE 4BAOB 3DHKH 2HNTE 2XCNA 1O0DH 2C90B 3TJNA 1ZSJA 3CENA 2RDLA 2VIDA 1UTMA 2F91A 2FS9A 3RXHA 4ISNA 1BA8B 1QQUA 3LDXH 1ORFA 5GIBA 1FAKH 1L1JA 4ABGA 1TGTA 4YESB 1NFUA 1TA6A 1UTLM 1G3DA 4BTTB 3KCGH 3OY5U 1N8OB 1OWDA 5LPEA 1O2WA 1GHYH 2A4QA 1GHBF 1DXWA 2BD2A 1J9CH 1FY3A 4IN2A 2ZGBH 1OYQA 4FVDA 1A0LA 2ZU1A 4X6MA 1OWJA 1C4U2 1YCPH 4A1XA 2ZO3H 2ZQ2A 1AIXH 1K1OA 3SNCA 1CU1A 4U32A 1BMMH 1GMCF 1TE0A 1SLXB 1ESBA 2A7CA 1RD3B 3A7YA 3DT0H 3QO6A 2OXSA 1CVWH 4FUEA 4YM9A 1WV7H 4H6SB 3TH4H 3AW1A 4B2AA 1WOFA 4NFEA 1KYNA 3PYHA 1MKWK 3BTKE 3LGWA 4JMYA 4A1VA 4A92A 2BLOA 4I8HA 5FCKA 1O31A 1S0RA 1E38B 1XVOA 1FJSA 4Y0ZE 3SUFA 3BTTE 1Y5AT 9ESTA 3E0PB 4CRAA 3A82A 4RN6A 1HRTH 2FWWA 3MU0A 4FXGH 3SUEA 1GBBA 3SI4H 5JBAS 1LVOA 3EA7A 1GBAA 1EZSC 2FESH 1EAIA 1PYTC 2BTCE 2D2DA 3HPTB 4Y8ZA 3W94A 5GCHG 1A3EH 1C2EA 1YYY1 2A5IA 5CMXH 1IQEA 2SGQE 3EQ0H 1AWHB 3QGJA 3RXTA 1ANEA 1ETTH 5DK1A 2BOHB 4AFZA 3DD2H 1HAOH 4NGAH 2BXUH 1GBTA 1ANCA 1P2KA 1TRNA 1W0ZU 1TPPA 5FAHA 1DY8A 1HUTH 2H6MA 1JBUH 4KTUA 3ENSB 1TABE 4IN1A 2SGAA 1ZYOA 2F9UA 4TPIZ 4BAMB 3ZZ8A 1NO9H 7LPRA 1ZRBA 4F4OC 1ABJH 1GDQA 1BTWA 4CH2B 2G8TA 3A85A 1LHEH 3S0NA 1YGCH 4MPXA 4TWWA 5JYIA 1C1WH 1LHGH 4UDWH 3MO9A 1T7CA 2QCYA 1E37B 3LC3A 3SNEA 1LDTT 2DE9A 5EGMA 5IDKA 3ZYDA 3PMJA 1WBGB 2P8OC 4ZXXH 1HV7A 1Z8GA 1OX1A 1UTNA 1WU1A 2SGDE 1GMCG 3RXKA 4MPVA 2NU3E 3MH7A 1MQ6A 3D65E 1TGCA 1E34B 4MLFB 1AZZA 7GCHG 3PTNA 3TGKE 4XDEA 1EASA 2XCFA 2J34A 3GCNA 3GY6A 5DP8A 1D6WA 4ZHMU 1ELAA 1YF4A 1EOLA 2G51A 2YNBA 2ZKSA 2XRCA 4D8NA 1EUFA 3RU4D 1EX3A 1RRKA 1AB9B 2GCHF 5EPYA 1OWEA 3D23A 1AWFH 2FDAA 1AB9C 1C5QA 4YO9A 3UNRA 1ABIH 1HJAC 4X1QU 2AERH 3RXLA 3P95A 1ID5H 1F5RA 1HJAB 2R3YA 2BX3A 1RJXB 1ZPZA 3RP2A 4UFEH 2CN0H 1EAWA 3RXUA 1IQNA 2ANKH 2R3UA 2SGPE 2XYAA 3SJOA 2QAAA 2ZF0H 5DP9A 1W2KH 5GDSH 1P2MA 2H9TH 1O37A 1F5LA 2D26C 4B1TA 1NU7B 5E2PA 7KMEH 4FUFA 3QLPH 2K1QA 1LKAA 1SQAA 4X6NA 4E06H 2R9PA 3RC5A 2FIRH 5TCCA 4AZ2B 3WY8A 1BRCE 4X2WA 4FUBA 4SGAE 4E7RG 5GPIB 1C1MA 1ETSH 3EA9A 1BHXF 3AAUA 2WPKS 5DP6A 4X1PU 3MHWU 1C5LH 2F83A 1HLTH 5I25A 1GJ7B 2HWLB 2TGTA 2CHAC 4ZKNU 4ESTE 1H9IE 1Y3UA 1UTOA 1QB9A 2FODA 1PPGE 1NTPA 2CHAB 3K6YA 1PQ8A 1MTSA 4I31A 1UHBA 2VWMA 3F1SB 4JYVH 2CF8H 2WUBA 1EZXC 2BY5X 1FQ3A 2HLCA 1ACBE 4BTUB 1D6RA 1TRMA 2FOFA 4QT8C 5ETXA 3V3MA 1W10U 1S82A 3DFLA 2Z94A 1MQ5A 5FXLA 3EGKH 3UOPA 1MCTA 1J14A 3TLOA 4X6PA 3M3VA 1AVWA 1XKAC 5C1YA 1DY9A 3KQCA 3ZVFA 4B73A 1TX7A 1ZPBA 4YOJA 1BITA 1JIMA 1KIGH 1V2ST 2BLQA 2IPHA 1VZQH 4KTCA 2F9VA 5GWZA 3MWIU 1TPOA 2V3HH 4ABIA 2TGAA 1IHTH 1O35A 1LQDB 4UEHH 3BTHE 5H4IB 2TIOA 1SGFG 4KELA 5T6FA 1GGDB 1RXPA 7ESTE 1HDTH 1F0SA 1QIXB 4I8JA 3U1JB 3W95A 2ZFTA 2Y6TA 1YPMH 4IC5A 1YLCA 2BD4A 4A7IB 1V2KT 1TOCB 4TWYA 1MH0A 1MZAA 3OTJE 3SU0A 4UFGH 1XUHA 2PGQB 1DXPA 2ZGCA 2R0LA 3AW0A 3SV7A 3SJKA 1C5XB 4A5TS 4OS1A 4CRDA 3VB6A 1CE5A 1K1MA 3GCTG 2FM2A 1O2GH 3TK5A 2XC4A 4LXBH 1BQYA 1H9LB 4GUXA 1QHRB 5DP5A 3E91A 1J8AA 2GMTB 1GBHA 1GI5A 1OP2A 1P05A 1TX8A 1QL9A 3LC5A 2GMTC 1QL8A 3FANA 3B9FH 4OS2A 3SORA 1O2LA 4DOQA 1IQFA 3SV9A 3TJOA 3A88A 4WJG2 3ODFA 2C4FH 2ZCKP 3P8OA 4K69A 1GI6A 1HNEE 1SG8B 1TNJA 2STBE 2QY0B 3A8AA 1TWXB 1JOUB 2QA9E 2CJIA 1UK2A 2ZGJA 2Z7FE 1MD7A 1DS2E 3Q3KA 3ODDA 4DY7B 2BY6X 1O5EH 2A2XH 1PQ7A 4TY6A 4AG2A 3N7OA 3RXPA 3M5MA 4ZH8A 1EAXA 4O9VA 3QTVH 2PFEA 2FYQA 1LO6A 2XBYA 4CBOA 4X1SU 1A7SA 2AH4X 2ESTE 4ABEA 1NC6A 1A46H 2A4OA 5FPYA 1V2TT 3A7XA 1UK4A 4E05H 5EOKA 1QA0A 4DT7B 1EKBB 2W7UA 2OQUA 1W7GH 4AGJA 1WTGH 2IJOB 1XKBC 1YP9A 1LVYA 2AIQA 4IMZA 4K1TA 5EXMA 2Q6GA 5T6DA 4FUHA 2GDDA 5A0CA 1BBRH 1YPEH 1IQJA 3QDZB 4FU7A 1ZJDA 2BOKA 2ANWA 1NPMA 4VGCC 4YOIA 3ATWA 1MTNB 3KQBA 1Z1IA 3D62A 3VXEH 1XXDA 4VGCB 1MTNC 2BLVA 1BTHH 4MG3A 1O2HA 3FP8E 3AVZA 3L3TA 4WH8A 3FVFB 1GL1A 1TGSZ 4YLQH 2G52A 2F9OA 5A2MH 2BD8A 1GJ9B 3F9HA 3NXPA 4ISIH 1EZUC 1X7AC 1BZXE 4OGXA 1HAIH 1SFIA 3E8LA 3RXRA 4H4FA 1NFYA 2PKAA 1AU8A 1L0ZA 5LPFA 1A5IA 4NSYA 4J1YA 2F9BH 1P01A 5JB9S 2VWLA 1GBDA 3STIA 1ZJKA 3K2UA 1ZTLA 3T26A 1AD8H 3M37A 2FX6A 2P16A 1VGCB 3GY7A 1ZZZA 1LQEA 2VWNA 3GDSA 4Q7XA 3VXFH 4K1SA 1NRQH 2GT8A 3RXFA 2ODPA 1O3FA 1HIAB 1GBFA 1DUEA 2TPIZ 4RSPA 4AB8A 4AFQA 1Q2WA 1BBRE 2R2WU 2FI4E 1LTOA 2V35A 3BG4C 2Q6DA 5F03A 1FY1A 1PPHE 5K7RA 2WV4A 1HB0B 4YTAA 1ARCA 2ZDLA 1GI8B 1W12U 3RU4E 1O5GH 1C1VH 3T29A 5C5NA 2FOCA 1W13U 4JYUH 4SGBE 1O2VA 2BQWB 1C2IA 3ATIA 4JZEH 2CF9H 1GI0A 2C93B 4Z6AH 5E0HA 5AFZH 3MU1A 4ZHLU 2ANMH 7GCHF 4X1NU 9LPRA 1Y3VA 2A7JA 2FOGA 2HGTH 1A61H 1FPCH 1GMDF 2H9EH 3ZZ4A 3TPIZ 1KLJH 3SU1A 3GY2A 1B7XB 1BTYA 1QQ4A 2C8YB 1C5YB 1AI8H 2Y82A 2WYJA 3NKKA 4ABBA 3A84A 1V2WT 5E0GA 1OP8A 2O8LA 3BN9A 3RM0H 1SVPA 4K2YA 3GICB 1JRTA 2OLGA 3M5OA 3PMBB 4KTSA 2BDAA 4K3JA 1C5WB 3T27A 2A45B 1P2IA 2C8XB 3M7QA 1G32B 4J2YB 4XSKU 2J94A 1SQTA 3KGPA 1XUFA 5J4QA 2Z9JA 1CO7E 5EW1H 2VVVA 1ELBA 1L1GA 4ZKOU 2UWPA 1KSNA 1WTHD 3SZNA 2KAIB 1O3NA 1AQ7A 3UWJH 1EP6A 4U2WA 3TJVA 2TGDA 2Z9LA 3NCLA 1TYNA 4X1RU 1SLVB 1PPCE 5T6GA 3RXVA 1LHDH 3QZRA 2VIQA 2Z3EA 2O8UA 1ZHMA 1EAUA 1YBWA 6GCHG 1GCTB 1K9OE 3P8NA 3PWCA 1ETRH 1GJCB 3LGUA 3BEFB 1C2GA 1GJDB 5J4SA 1NRPH 3E6PH 1QCPA 1XUJA 3S69A 3MO6A 3SHAH 1BCUH 5CE1A 2XBWA 1T8NA 2GP9B 4NFFA 1G2MA 1BDAA 1FV9A 1NFWA 2JH6D 4XFQA 1ARBA 3TK9A 3VGCB 1DSTA 3SO3A 3ZZCA 1W14U 2BMGB 3MH5A 1J15A 4CHAC 2UUYA 1ZGIA 1B5GH 2AFQB 1SGQE 3BTME 3OSYA 1PFXC 1LVMA 5EODA 4AORA 5JB8S 1TPAE 4U30A 2Y80A 4Q7YA 1BHXB 1ZSLA 1TFXA 1ZMNA 4NA8A 4AFSA 1VITF 1O2YA 1QA7A 1VCQA 1Z71A 5DPAA 1IQKA 4I8KA 2Y7XA 2G4UA 3GOVB 1YC0A 2ZDKA 1ZOMA 1C1SA 1A4WH 4WXVA 4Y7BA 2ZPQA 4R8TB 1O3PB 3Q77A 1GHBG 1H1BA 1GGDC 4INHA 5F8TA 3DA9B 4OS6A 1O2OA 1FZZA 1ZSKA 3MNBA 5HM9A 1ZLRA 3E3TA 2B5TB 1MBMA 1G36A 2VVUA 5FHTA 2AGIX 1C1RA 2ZDAH 3AAVA 4BXSA 1OOKB 4DURA 3AASA 1FDPA 6GCHF 1TMUH 4Y79A 3Q3YA 3MU5A 1QJ1B 3GY4A 2TRMA 3MH6A 4GAWA 2PSXA 1XVMA 1T8MA 4ABDA 3LGTA 2XBVA 4X2YA 2D8WA 1UVPA 1GBLA 1ZHRA 5ESTE 1HXEH 2AMQA 3LKWA 1O3BA 1P02A 3FP6E 1V2RT 1WYKA 2PUXB 5FCRA 3M5LA 3LJJA 1K1LA 1O33A 3Q00A 2Y81A 4UFDH 3SV6A 2F9NA 1SHYA 1Y59T 1K1PA 1XX9A