3HGPA

Structure of porcine pancreatic elastase complexed with a potent peptidyl inhibitor fr130180 determined by high resolution crystallography
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combined High-Resolution Neutron and X-ray Analysis of Inhibited Elastase Confirms the Active-Site Oxyanion Hole but Rules against a Low-Barrier Hydrogen Bond
pubmed doi rcsb
molecule keywords Elastase-1
molecule tags Hydrolase
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3hgpA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3hgpA01
1HCGA 1AD8H 1E37B 1O2ZA 1MKXH 3D62A 1GBBA 2FESH 2A31A 1KXCA 5A09A 2ZTXA 4YLUA 3TU7H 4YTAA 1O5FH 5I46H 1QL7A 3Q3KA 4CH8B 1LDTT 1E36B 1S81A 2ZGXH 3RP2A 1QRZA 2ZECA 5F8XA 2BHGA 5L2ZH 1EPTB 2FI4E 1HAYB 3JZ2B 4KELA 1O39A 5TCAA 1UTPA 1D6WA 1SL3A 2Y7XA 1BTXA 3SU1A 3M3TA 3S7KB 3P92A 1SMFE 3GY6A 2A7HA 1L4ZA 2HPQH 3VGCB 2PTCE 1QJ6B 2R2WU 2VVUA 1N8OB 3CS7A 4WY3A 3HKJB 1N6YA 1YKTA 3UOUA 2ZCLP 1FY8E 1FV9A 2BXUH 4I8HA 2BDYA 2V35A 2CV3A 2C4FH 2FS8A 3H7TA 4X8TH 2H1UA 1FIWA 3RXDA 1THPB 3MNXA 3EE0B 4Q7ZA 2HVXA 3QZRA 3K6YA 9ESTA 3V13A 1BMMH 1QBVH 2FYRA 1Z6JH 3SHCH 4Z6AH 2FOCA 1J9CH 5FX5A 1W8BH 1LMWB 1FXYA 3PROA 1ID5H 1O31A 1V2LT 1B0EA 1TA6A 3M7UA 2Y5FA 3SQEE 3SV9A 2AEIH 4XBBA 4A6LA 4ZAEA 1F92A 4X0WU 4HTCH 3M5OA 3VB4A 1NPMA 1G2LA 1TX7A 3RXOA 1WQSA 1EQ9A 2BLOA 1MQ5A 1WAYB 1IHSH 2OD3B 3P8OA 3STIA 1WQVH 3SOSA 3BIVH 3A8AA 1CHGA 3SZNA 3VB7A 1S82A 4R0IA 4UFEH 1YCPK 5GCHG 1HDTH 1C5MD 1TGBA 1Z1IA 3KF2A 1KLTA 2GMTB 3SU0A 4OGXA 1V2ST 1TQ7B 1P05A 1FDPA 2HNTF 2VH6A 1FJSA 4JZIA 3GICB 4OS4A 1MCTA 3L33A 1QBOA 1L1GA 1AE8H 3ODFA 1WYKA 1ZHRA 4GCHF 1CGIE 1DM4B 3AVZA 5F03A 1AZ8A 1TBZH 1TBRH 3S9BA 1V2QT 2QC2A 1MKXK 4ISIH 1FY5A 1QTFA 2HNTC 1PPFE 2VGCB 3UWJH 4D9QA 7GCHF 3SORA 1CBWC 2ANYA 2P59A 1IQLA 2BVXH 2SGEE 2JETC 3LU9B 1NRSH 1GHAG 1AUJA 2CMYA 1A3EH 2VU8E 1LVMA 2WPLS 1AY6H 5C1UA 3PTNA 5JBTA 1OWHA 1BJVA 2AIPA 1GDQA 1V2WT 1O3PB 1INCA 4ZROA 4X2WA 3K65B 3NK8A 4BANB 3U8TH 3D65E 1IOEA 2VIVA 3GDVA 1O2TA 4NSYA 2BD3A 2WYJA 1UK4A 1G3EA 2ZGJA 2W3IA 3OTJE 2HPPH 3SV6A 2H9HA 3MWIU 1GI8B 1UVPA 4ZHAA 2HOBA 1OKXA 1IQKA 2BLWA 2RA0A 3BTKE 2F9BH 1Y8TA 1ESBA 1C5ZB 4YZUA 4NSVA 1P2NA 2TGPZ 2PKSB 1C9PA 3ESTA 1TPAE 1K21H 4B2AA 1K1MA 1UTOA 3MI4A 1DT2A 1EOLA 4IBLH 3LC5A 1O3LA 3VB5A 4MVNA 2ZC9H 4ISHH 1SGQE 5A0CA 1H4WA 5T3HA 2ZU5A 2LNCA 2QXHA 3KNXA 3GCTG 1W11U 1W14U 1YLDA 2AGIX 2B0FA 3A89A 4CRFA 2G4UA 3U98H 4CBOA 1EP5A 1VITH 2P3FH 1XM1A 1AWHB 3QLPH 4K8YA 1F2SE 2ZDNA 1GHWH 1V3XA 5EQQA 1O2QA 4UE7H 1EB2A 1F5KU 1ANBA 1T4UH 1EKBB 1W7XH 2ZGHA 4INLA 1O3AA 5A0BA 2Z94A 3A7TA 1K9OE 3KGPA 5EW2H 4AG2A 3LJJA 5ESBA 2GT8A 2XC0A 1DY8A 1SG8B 1O5EH 3HGPA 2FTMA 2SGAA 2ZGBH 4K69A 1TX8A 2NU2E 3PLBA 1XUKA 4CR9A 4Y71A 1IQEA 1O3FA 2BOHB 2A4OA 2G51A 1C5XB 2XWBI 4A92A 2PR3A 1HB0B 4ZXXH 1TAWA 1T32A 1J8AA 4ZKRU 4U2WA 4MG3A 1O2HA 3BTWE 1AWFH 2PKAA 4E05H 1DUAA 3DFLA 3UY9A 3ZZ9A 5EQRA 1GCTC 3BEFB 2CN0H 2VVCA 4Y10E 2FDAA 5DP6A 3SI3H 3OSYA 5F8TA 5CHAC 4YOJA 4K3JA 3HK3B 1GHBG 3SW2B 1M9UA 3OY5U 3RU4E 2A1DB 1GI5A 3GDUA 1MTNC 3UREA 2NU0E 4UDWH 1O5BB 2ILNA 1GBCA 1GHXH 2O8UA 4UONA 1MZDA 4GHQA 1EUFA 3GDSA 1WCZA 1C2LA 4INHA 3GCHB 1ELFA 1QRWA 4Q7XA 2V6NA 1O3CA 4Y76A 4MNXA 5E2PA 1EX3A 5DG6A 2ALVA 4ABDA 1HAZB 1PQ8A 3ZVAA 1BMLA 1LO6A 3STJA 1GBTA 3PM3A 1DSTA 1TMTH 3RXEA 1HUTH 4ZHMU 1ZJKA 2P8OC 2GP9B 1H1BA 5L30H 4LZ1H 5E0GA 2R9PA 1YPEH 3P17H 3TH2H 4INKA 4WWYA 4XSKU 4UD9H 1ELAA 2ANWA 3BSQA 1SHHB 1YBWA 2WPJS 3NKKA 3M61U 1TABE 2BDBA 5C1YA 3RXJA 4NIYA 1A0HB 2BXTH 4RN6A 3S7HB 2ZFSA 1KXBA 5E0JA 1K22H 4K1EA 1TRMA 3ITIA 4NIWA 3P6ZB 2D26C 1Y59T 1LKAA 3FZDA 4LK4A 1MKWH 1MQ6A 4X1NU 1EXFA 1GJBB 5IDKA 1LQEA 5F8ZA 1A5GH 5T6DA 1RGQA 3BTFE 3VB3A 5SGAE 1MAXA 1C5LH 4ZH8A 4CBNA 1ELEE 1TLDA 1PQ7A 3C1KA 1GI6A 4ISNA 4FUEA 3HPTB 1G36A 1C5NH 1SOTA 4Y0YE 1GWAA 4WXVA 2STAE 3NZIA 1VJAU 1H8IH 1W2KH 2B9LA 5L6NH 3KL6A 3MH6A 5E2OA 2FM2A 1Y5BT 1UVTH 2TPIZ 1NN6A 3FP7E 1JIRA 3A7VA 4TYDA 3F68H 3PB1E 4CRCA 1UTJA 1MTUA 1CA0B 3A87A 4X2YA 5GWZA 1K1JA 1P2IA 2F83A 1O2GH 3E3TA 3PMHB 3RXTA 1HV7A 1HIAA 3MU8A 1JWTA 3SNEA 1LVOA 1QNJA 5GJ4B 4GLYA 1GHVH 4ASHA 1CVWH 1KXDA 1MD7A 2WUBA 3TGIE 3EGKH 1QHRB 3ENSB 3QX5H 2BD4A 1OWEA 3DFJA 4Y11E 1HAIH 1WOFA 3V3MA 4E06H 3RC4A 1GI4A 5DKMA 4TWWA 2OBOA 3E0PB 1A5HA 2FLRH 3UPEA 1MH0A 2ZIQH 1O3OA 2ZU1A 4I31A 4ZHLU 4A7IB 3RXFA 1BMNH 3LPRA 2Z9JA 4AORA 1PQAA 3T27A 2QY0B 2WPIS 1GJ7B 2BZAA 1G9IE 3TJOA 4SGBE 5HGGA 1YPLH 2XBVA 3O8BA 5AFYH 2XXLA 5FBIA 3G01A 2A4QA 3LOXA 5H4IB 1BTYA 3TNTA 4ABGA 3A82A 3SN8A 1RTFB 5EQSA 1P9UA 4MQAA 1KXEA 5C3NA 3MHWU 2STBE 4D9RA 3D49H 1UVOA 4JYVH 1ANCA 4Y8ZA 2P3UB 1DANH 1CHOF 4I32A 1GMCF 2TGDA 3LGTA 2BQ6B 1HIAB 3LDXH 3A84A 3BF6H 1DOJA 1SGTA 2O9QA 3CENA 5LGOA 3UQVA 1ORFA 3Q3XA 3RXHA 1G3DA 2A7CA 1YCPM 2J95A 1NU7B 1Q31A 2FP7B 3AW0A 3SU3A 3VPKA 3ZZ3A 1KXAA 2A0QB 5T6GA 4AFQA 1HJ9A 1BRBE 5J4SA 2GZ7A 1Y3WA 1ELGA 2P93A 4K60A 2UUFB 1O3JA 4ABEA 1P02A 1WSSH 3JZ1B 2BVRH 2PGQB 3SV8A 4AFZA 4MDSA 4BTIB 2FOBA 5HMAA 4Y8XA 1HJ8A 2A4GA 4GUXA 1DFPA 1SI5H 4E7NA 1W7GH 5FAHA 1S0QA 2GCHF 2ZI2H 5HM9A 3LIWA 1HJAC 1QQ4A 1TB6H 3E90B 2ZDLA 2XRCA 1HNEE 4I33A 1KIGH 2ZGCA 1DWCH 4CREA 3ZVFA 4DG4A 1QFKH 1FY3A 2AMDA 2ODQA 3MH7A 3QDZB 4NIXA 1KTSB 5DO4H 1NFUA 1O35A 5A8YA 5J4QA 4IC5A 3UNQA 4H4FA 1A4WH 1ZTJA 1VITF 4MPVA 1CBWB 1WTHD 2AGEX 3SV7A 4FUCA 1EOJA 1JBUH 1DWDH 1C5TA 2C8WB 3M5LA 7LPRA 2FXRA 1E38B 3ATWA 3SUDA 4K1TA 1GMHF 3RXBA 1O3KA 3M3SA 1OP8A 1KXFA 1W3CA 1AKSA 3T26A 1EAIA 1NRPH 2AGGX 4B74A 4CRAA 1ZPCA 2TGAA 3FAOA 2F91A 9LPRA 1BHXF 5FCRA 1OPHB 3FP6E 3GY4A 4Y6DA 3SUEA 1YPHE 4MPXA 1PJPA 3K6ZA 4JK6A 1YCPH 1GBEA 3MO6A 3UR6A 3GISB 2Q1JA 2A45B 2R0KA 2ANKH 1O2MA 1NC6A 5FPTA 2CHAC 4DOQA 1P9SA 1VGCC 1SLXB 4NZQA 1QJ1B 4XDEA 1JMOH 1TA2A 1XUHA 2GV6A 1PPBH 1TBQH 3URDA 1C5RA 2B5TB 2FTLE 1NS3A 1JRTA 3TPIZ 5C1XA 1AQ7A 1GI7B 4MPWA 3BEUA 2IPHA 4WH8A 3RUOA 1SGFA 1P3CA 1MD8A 3I78A 2BD5A 1JIMA 3SNBA 2Q6FA 1AKSB 2PSXA 3GYLB 2H5CA 3ELAH 1ARCA 5JB8S 4KTSA 2Z3CA 1D3TB 3TGKE 1GJ5H 2Q6DA 1SSXA 1KLJH 4BNRA 3LGVA 3Q00A 1HGTH 1A61H 4Y8YA 1OWJA 1ZGVA 1V2NT 5JBCS 1LCYA 1UTLM 2NU4E 1K1PA 1C2IA 3SQHE 3SV2H 2BZ6H 2ZFQH 1FN6A 4ABBA 1C5WB 1YGCH 4AFSA 3U9AH 1ZLRA 1IQJA 3PLKA 1UK3A 1WTGH 4FUBA 4LXBH 1HAHH 3PV4A 1HAOH 4DGJA 1GVLA 3SNAA 3F9EA 1FZZA 2BM2A 3HKIB 1C2GA 1FONA 2BD8A 1L2EA 4RKOB 2OC0A 4PROA 3PWCA 1RTLA 4TPYA 1SPJA 4K5ZA 1MTNB 4F49A 1H9LB 1OYQA 5EPNA 2C8XB 4RSPA 1XVOA 4WXIA 1G37A 1ZHPA 1RD3B 1C1QA 4WF8A 1ZPZA 3Q76A 2OBQA 1V2UT 6GCHF 3DA9B 1C2MA 1H9IE 2EA3A 3ZVCA 3O8RA 1P3EA 3A7WA 4O9VA 1XUJA 3TITA 3URCA 1AU8A 3QGJA 2V3OH 2RDLA 2FOFA 1Q3XA 2P8OB 4WJG2 1F0UA 4YOGA 1NM6A 3BN9A 1UHBB 1GVZA 4Q2KA 4JYUH 1TNHA 1UTQA 4X6OA 3ZZ8A 5EW1H 1DLKB 3F9FA 3WY8A 4VGCC 2PHBA 3PLPA 3RDZA 2HNTE 2HRVA 1EJNA 1GJ4H 3MU0A 4BTUB 5LH8A 1L1NA 2D2DA 1B0FA 4NWLA 3SGBE 3U1IB 1C5PA 2UUYA 3UNSA 1QCPA 1GBLA 4THNH 4YOIA 1XUFA 1A0JA 1O2UA 1SR5C 1NFXA 2A32A 3SU4A 4YM9A 3RMNH 5A8XA 1SGIB 2XYAA 1ZSKA 1GGDC 2ZHEH 3Q77A 3SJOA 4IC6A 3GOVB 1Y3UA 4BOHA 2FWWA 3A88A 4X8SH 1GI0A 1VCWA 5BRRE 4Y79A 1N6XA 1WU1A 4XFQA 4ABJA 2PUQH 1ZRKA 3PMBB 5FPSA 1UK2A 4ZXYH 2BQ7B 1V6DA 2QF3A 5AHGH 3UUZA 1EJAA 1AUTC 4A1VA 1QL9A 2VIOA 1UTMA 2FEQH 2ZDVH 2O8WA 1MBMA 4U01A 1P2QA 1GBDA 1SC8U 3BG4C 1PYTD 4FVBA 4D76A 3FANA 1S6HA 4LOYH 1T7CA 1D3QB 1C1UH 2W5EA 3RC6A 2ZF0H 4BXWA 3TVJB 2EEKA 1YPJH 1P0SH 1C1VH 3ZV8A 3ZYDA 1YM0A 1UVSH 2G4TA 1GDUA 1VR1H 2QIQA 1UJ1A 2UWOA 1DS2E 4TY7A 4B76A 1P12E 2XTTB 2YNAA 3IG6B 2VB0A 4E7RG 2AFQB 2F9OA 1O3EA 4UFGH 1EZXC 2XCNA 3T62A 4DT7B 4CRBA 1O2XA 2QA9E 2ZPSA 1GHYH 2BD2A 4X6MA 5HXFA 4Z0KA 5CE1A 4IS5A 1FQ3A 3RMOH 5JYIA 1FPCH 4H6TA 1FY1A 2NU1E 1DXWA 1CO7E 1P11E 2W26A 1O3MA 2SGFE 1C5OH 1DUEA 1WV7H 6LPRA 1O3IA 2BDCA 3OY6U 2GZ9A 2GV7A 3T25A 1J17T 3LJOA 3UNRA 5DPAA 5JBAS 3ZZDA 2VJ1A 1UO6A 5C2ZA 3MTYA 3M5NA 4MNYA 1PYTC 2C8YB 1BRAA 5A0AE 1KDQA 1XMNB 2RCEA 3RU4D 4BTTB 1ELVA 3BTHE 1QGFA 2XWAA 3U69H 1EPTC 1PPZA 1CQQA 3KN2A 1V2VT 3VXEH 3V0XA 4X8UH 5DP7A 1ZMLA 3TK5A 3LGUA 1BOQA 2FOMB 3KEEA 1RIWC 3SU2A 4JCNA 1J16A 2P3TB 1GJAB 3UTUH 3UIRA 1L1JA 1UMAH 2PFEA 5DP8A 1QB1A 1EZSC 2GDEH 4FU9A 1AO5A 5C20A 2R0LA 2BVSH 3GY7A 1EB1H 1W10U 5DGJA 1GI2A 1MTSA 4TY6A 3TIUA 1P2JA 4FU8A 1EZQA 3IITA 5CMXH 3QUMP 1OS8A 1C2EA 1G3CA 3PO1C 1HJAB 3DHKH 3QTOH 3BTEE 2A5IA 2VWNA 1O2WA 3E6PH 2FS9A 1YPKH 2J9NA 1ZRBA 2I6SA 1MUEB 2Z7FE 1GL1A 1S85A 2J2UA 3R0FA 3TK9A 4JK5A 4NG9H 1HXEH 4ISLA 2QYIA 1K1OA 4YLQH 1KDQB 1O36A 5EXNA 1HRTH 1DVAH 4YO9A 4ABHA 2Y81A 2XBYA 1WUNH 2WUCA 5GCHF 1OWDA 3TJNA 1C4U2 3S69A 1C4V2 3LH3A 3T5FH 1BITA 1CGJE 1RFNA 3MO9A 4NZLA 1TNJA 1QA7A 1QBNA 2PGBB 3BTME 2FX6A 2VH0A 1CGHA 3MYWA 2D8WA 1QQUA 1W13U 2AMQA 5ETXA 2QXGA 1D3DB 2ALPA 3NWUA 1SGNE 1C2DA 1Y3VA 2HWLB 4B2CA 1SVPA 2A2QH 1X7AC 3EA8A 1SHYA 1GMDG 1GHAF 2OQUA 1C5UA 5BPEA 2C93B 4I8GA 2Y82A 3KQDA 3P8FA 1OP0A 1EASA 2BX4A 1FY4A 2R3UA 2UWPA 1BTHH 2H5DA 1Z6EA 2BB4A 1O2SA 3GY3A 4BAOB 2UUKB 4FUJA 2ZU4A 4DY7B 4FUIA 1MTWA 2ZHDA 2ZNKH 5HYOA 4A5TS 3KCGH 3RXUA 1UCYE 1BUIA 1P09A 2CHAB 1C5SA 2BDHA 1EP6A 2QGRA 5HM2A 4AGJA 3TJVA 2FIRH 4NFFA 1VGCB 4WVPE 4X2XA 3LGYA 4U30A 1V2PT 2OLGA 8GCHG 1PPCE 1SOZA 1O2RA 5ESTE 5ABWA 1BRCE 6CHAC 2Q6GA 4BAQB 3H7OA 5EXMA 3M37A 1C5QA 1T8MA 3EAJA 1PPHE 2JH5D 3F9HA 3M7QA 2G5NA 1DLEA 3TJUA 4IMZA 1LTOA 2AMPA 2GCTC 4GHTA 4O3UA 4BXSA 1RRKA 3MMGA 2FOHA 2TIOA 4M7GA 5TJXA 2H6MA 1H8DH 1AVXA 2B7DH 3SU5A 3T28A 3S9CA 3GCTF 2BD7A 2ESTE 3RXQA 1E34B 2XNIA 2G81E 1O2JA 1B7XB 4AOQA 2OUAA 1O34A 2J4IA 2EI6A 2WV5A 3S9AA 2ZHFH 1AI8H 1YPMH 1BCUH 3D23A 3SNCA 4KKDA 2J92A 2PV9B 1DICA 5E0HA 2QXIA 2AIQA 1GJ6A 1P06A 3VEQB 1IQFA 3LH1A 3V12A 4JZEH 4AZ2B 4Y7AA 1WBGB 3MH4A 1CU1A 1DXPA 1DPOA 4Y7BA 3ZZCA 2QV1A 1O2IA 4O03A 5FCKA 2FI5E 4DIHH 3K2UA 3HGNA 1AN1E 1ELBA 4KTUA 1IQNA 1GJ8B 1SGCA 3TGJE 4RKJB 1S83A 1NO9H 2VVVA 4HI3A 2ZWLH 4DJZB 1MZAA 2BOKA 2BX3A 1TYNA 1T8OA 4XOJA 1SQTA 1P03A 1O3BA 1IQGA 2AYWA 2NWNA 2OC1A 2XC5A 3ZZBA 1GBIA 4XBDA 4AG1A 1YF4A 1IHTH 2P16A 3MO3A 1C2HA 2WINI 2PSYA 5JB9S 5E8EH 2KAIA 4X2VA 3UQOA 3KIDU 5LPFA 2ASUB 1IQIA 3MNBA 2HLCA 1GHBF 4I7YH 2ULLA 1C1MA 3SJKA 1HAPH 2Z6BD 1J15A 1KYNA 4UFFH 2F3CE 4U32A 3SI4H 4DVAU 3VFEA 3BIUH 1GG6C 2BY8X 3EYDA 4VGCB 2FYQA 3U8OH 1ZHMA 4AB9A 2IOTA 1ZZZA 5FX6A 1SLUB 2ZO3H 2FOEA 2GX4A 1NROH 3RXLA 4LZ4B 3N7OA 3VB6A 1YLCA 1GJDB 1ZTKA 3RC5A 2ZP0H 1B5GH 2VWMA 1YP9A 2Y6TA 4JZ1A 2D1JA 3MU1A 3A86A 3ZZ4A 2ZU3A 4NIVA 3VXFH 1D3PB 1O2KA 2BDAA 3LKWA 2ZTZA 2JETB 1CE5A 4GCHG 4X6NA 1NRRH 2GT7A 3RXVA 1GGDB 3O8DA 3P8GA 4DW2U 2XCFA 4JZDH 4MNWA 4ZKSU 3ZZAA 2V3HH 4AYYB 7GCHG 2BY6X 2BDGA 2GTBA 1BBRE 3A7XA 1GBMA 1HAXB 4FUHA 1O2VA 4CH2B 4AYVB 3ZVDA 3RXPA 2H9TH 3A8CA 1TWXB 2KAIB 1LHFH 1HFDA 1TGNA 2J94A 1K1NA 4DIIH 1K1IA 2GDDA 1SLWB 3BG4B 1VCQA 1EZUC 1K28D 1AVGH 1PQ5A 3B23B 4JMYA 3UWIA 3HK6B 3MU5A 3U8RH 1Z8JB 3LGWA 4OS2A 3BEIB 1A0LA 4XBCA 3RXCA 2Y7ZA 1GI1A 1O3HA 2ZCHP 3MOCA 2W7SA 2OXSA 1ABIH 1S6FA 2VWLA 1QIXB 1TPOA 3OYPA 2F9VA 1FPHH 1GDNA 4CRDA 1XKAC 2OINA 2I6QA 3ZYEA 3RXAA 3PMAB 3HATH 3PMJA 4CR5A 1ZYOA 3BG8A 4IW4E 1ZMNA 2Z9LA 1ZGIA 2SFAA 1EJMA 1QB6A 1F5RA 1BTPA 1O5AB 2AH4X 2ZFRH 3LGIA 1QJ7B 4OS7A 2G55A 2CXVA 4GPGA 3LT3A 2ZZUH 3A7ZA 1NY22 4MTBA 3S0NA 4WMFA 3KQCA 1ZMJA 1DDJA 1PPEE 2OC7A 3BTQE 2BYAX 1AIXH 2F9PA 1THSH 1Y3XA 1VCPA 3ODDA 1RXPA 4SGAE 2OCVB 3EA9A 3B8JA 1K1LA 1OWKA 1XKBC 2ZDAH 4CHAC 2ZFTA 1ZJDA 1GBFA 3CS0A 3SBKA 1JRSA 1AVWA 1OWIA 1UHBA 5C67A 2BDIA 2A5KA 5LPEA 4X6PA 2YOLA 1JXPA 1QR3E 2BMGB 4KP0A 1C1OA 1V2OT 3E0NB 1RIWB 2PWXA 1GCTB 4BAMB 1CA8B 5CHAB 5L2YH 1C1TA 1GI9B 2BQWB 8ESTE 1Z8RA 1J14A 3MNSA 1T4VH 4B71A 3GY2A 3OX7U 4TWYA 1T8NA 2ZHQH 3FFGA 1SBWA 1BA8B 1UTKA 3ATIA 1C4Y2 3KQBA 2FLBH 1D6RA 1SGFG 1FAKH 5F6MA 2FZZA 2A5AA 3IWMA 1ESTA 1UCYH 2Z3DA 3PO1B 3BTGE 1ZOMA 1BJUA 3GYMA 2LPRA 3A83A 1BTWA 2SGQE 3ZVBA 2QXJA 2AERH 2Z9KA 3TK6A 4TPIZ 5AFZH 3RXIA 1EAUA 1FLEE 5K0HA 1AB9C 1FI8A 1TGSZ 5EGMA 2Y5GA 7KMEH 3AASA 1YYY1 1V2JT 2UUJB 3RXRA 5GDSH 3QTVH 2R2MB 3RLWH 2Y80A 1BTZA 2G8TA 4B2BA 1ELCA 5LPRA 5A2MH 2FX4A 2ODPA 2IN2A 1PPGE 2PUXB 3P8NA 1L0ZA 5EPYA 4AFUA 5DP5A 4NA8A 1G32B 2BY5X 3U1JB 2FI3E 2FOGA 4FU7A 1C9TA 2RA3A 4AGKA 2C3SA 1AFQC 4HGCA 4X1PU 4K1SA 1NZQH 1PFXC 2EI8A 3E91A 3B9FH 3F9GA 2C8ZB 2TRMA 1O30A 1CT2E 2TBSA 1A5IA 1O2NA 1CSOE 1LHCH 2VIWA 1TMUH 1SQAA 2R3YA 1CT0E 1LHEH 1C1SA 1ANEA 1TALA 1V2MT 1HAVA 5JPMH 5DK1A 1ESAA 2CF9H 5G4BA 1IQHA 4OS5A 3ZVGA 3ATLA 1SGDE 2ZA5A 1ZR0A 1H9HE 1IQMA 4OS1A 3GY5A 3AW1A 1HYLA 6CHAB 2WYGA 1Z71A 1O33A 3CP7A 4GSOA 1AGJA 5EOKA 4IGDA 4MPUA 1Z8GA 2GCTB 5I25A 1KLIH 3EDXB 4UEHH 1O2YA 4OGYA 1L4DA 3H5CB 4K2YA 2B8OH 1OYTH 4NCYA 1F0SA 2PW8H 4WMDA 2OC8A 2RG3A 3SGAE 1YC0A 3QWCH 4MNVA 1LVYA 1UCYK 4Y0ZE 8KME2 1SGPE 2BY7X 1O2PA 4A1TA 4OS6A 1ETTH 2V0BA 2XBXA 2ZEBA 3QGNB 4FXGH 1V2TT 1ZSLA 3M36A 4I8LA 4D7FA 5B6OA 1EAXA 5JDUB 1VJ9U 3SJ9A 3O8CA 1ELTA 1NTPA 1AZZA 2DE8A 1C2FA 3TLOA 2QCYA 2FODA 1HAVB 1C5VA 2BLQA 3RU4T 1O3NA 1Q2WA 4UFDH 1GL0E 1S5SA 1O38A 2WPMS 1QRXA 5GXPA 2ZFFH 3M3VA 4YT7H 5C5NA 1F0TA 3DUXH 1NT1A 4YT6H 1BBRH 2BTCE 1G30B 1UTNA 2GGVB 2QF0A 2ZPQA 1BQYA 1LPGB 3QZQA 5DP9A 1TPPA 4O3TA 4NA9H 1P10A 2HGTH 1W12U 1Y5AT 1CHOG 1GMCG 1KSNA 1O37A 2ZCKP 3I29A 2EI7A 2ZPRA 4ABIA 4K8BA 2O8TA 4DCDA 4IN2A 1SQOA 2WPKS 2SGDE 1MAYA 3L6PA 4GVUA 4H6SB 1ETRH 3VGCC 1OXGA 4IN1A 1NESE 2ZTYA 3GCOA 2H9EH 2P94A 1GCDA 1LQDB 1N8OC 4WH6A 3SUFA 1Z7KA 3DD2H 3TH3H 2VNTA 1GJCB 5TCCA 2W3KA 4HZHA 2CGAA 1O5DH 3RLYH 5K7RA 4ISOA 1D9IA 1EAWA 1TOMH 3BTTE 3EQ0H 1NRQH 2WV4A 1GBJA 1O32A 1LHGH 2HALA 4NFEA 3SJ8A 2JH6D 3MFJA 1GG6B 1TE0A 5C5OA 1EATA 1HAGE 4FVDA 1DITH 1BIOA 1MU8B 4NGAH 1Y3YA 4FUFA 5GIBA 6ESTA 1NRNH 1OOKB 2GCHG 1RJXB 2SNWA 1SFQB 1Z1JA 2NU3E 2AS9A 5EU8A 3RM0H 1SB1H 3GCNA 3A85A 1T8LA 1O2LA 3A7YA 5AVDA 4ZKOU 3AAVA 3RXSA 2J38A 4ZKNU 1DSUA 4O97A 3W95A 2G00A 1K2I1 2JH0D 1W0YH 1VITG 2GMTC 1ACBE 3SHAH 1ABJH 1MTVA 4J1YA 5DJ7A 3PYHA 3M35A 1A2CH 1TNIA 3SNDA 2W7UA 3M7TA 1FN8A 5JBBS 1HXFH 1KY9A 1BRUP 4NWKA 1TNGA 1DY9A 2PKAB 1GMHG 1O2OA 1N1LA 3RXKA 3A80A 2FO9A 1Y5UT 3T2NA 3T29A 2BY9X 1P04A 2VGCC 1FAXA 2TGTA 3M5MA 4B1TA 2QAAA 1C1RA 1QL8A 1C1NA 4NA7A 1BHXB 1TGTA 3L3TA 3RMLH 2GKVE 3ZV9A 2VIPA 2G5VA 2SNVA 3GY8A 2OTVA 3FP8E 1FNIA 3QO6A 3ZZ5A 1FUJA 3K9XB 1BBRK 2H2ZA 1DWBH 3PTBA 3E16B 1XXDA 2F9NA 3TH4H 2VIQA 2P95A 1KTTB 5AF9H 2UWLA 1TQ0B 4GAWA 1TNKA 1GHZA 4FUGA 1HPGA 1G3BA 5A8ZA 1SGRE 5FHTA 3F6UH 3ZZ7A 1TRNA 3E1XB 4ZUHA 2GVFA 1THRH 1GBKA 3RM2H 1XUIA 1ZTLA 2IJOB 2O8MA 2ZFPH 1Z8IB 4Q80A 1HLTH 1OSSA 3DT0H 4MLFB 2PKSC 4B73A 2F9UA 2DE9A 2DUCA 1F7ZA 2CJIA 2THFB 2XC4A 3AAUA 3SUGA 3FZZA 3F1SB 5PTPA 1LPZB 1MMJN 4CHAB 1BDAA 1A46H 4JZFH 1RTKA 2J34A 1E0FD 1D4PB 4CRGA 1P01A 2VWOA 4X1SU 2G52A 1VZQH 1GPZA 2ANMH 2Z3EA 1TGCA 1TPSA 3R3GB 3Q3YA 3EA7A 2SGPE 3KQEA 4ZMAH 3NPSA 1XUGA 3SGQE 1JOUB 4F4OC 1S84A 3MH5A 2ZQ1A 3E8LA 1OX1A 4IMQA 4Q7YA 4XE4A 2OP9A 4JYTA 3ZZ6A 1TOCB 3NCLA 1GI3A 2GZ8A 7ESTE 3P95A 3MU4A 3UR9A 4WMEA 2YNBA 1QURH 1NU9A 1YPGH 5GPIB 3RMMH 3RXGA 4KTCA 2ODYB 1V2KT 2BD9A 5DP4A 5T6FA 4QT8C 2BLVA 1C2KA 2CF8H 1A3BH 3NUMA 4I8JA 3P70B 1A7SA 4X1QU 1E35B 2A4RA 1BZXE 3PWBA 5EXLA 1C1WH 3KHVA 2XW9A 5FXLA 1AB9B 4YESB 1DX5M 1NFWA 3ZVEA 1AMHA 1XXFA 1P2OA 2A2XH 1MKWK 3V7TA 1ZSJA 6GCHG 2C90B 2ZDMA 1QB9A 1SGEE 4X1RU 1F5LA 1O3GA 3A8DA 1AFEH 4R8TB 1O3DA 1QA0A 1IAUA 3TNSA 3A81A 3ATKA 5EG4A 1P57B 1BB0B 2VIDA 5FPYA 4D7GA 1SFIA 1TIOA 3LONA 2ZQ2A 1O0DH 2K1QA 3MNCA 1LPKB 1DE7H 1CT4E 1GJ9B 3GCHC 5DP3A 4BAHB 1P2MA 5EODA 3W94A 1FMGA 2EC9H 3BV9B 2PTNA 4ESTE 1O5CB 4A1XA 4B75A 1MCVA 1AFQB 1XX9A 4ABAA 2ZKSA 3SO3A 2ZU2A 1FIZA 3UFAA 1NFYA 2Z9IA 1OP2A 8LPRA 1S0RA 1UVUH 3UOPA 3SJIA 2M5TA 3I77A 1T31A 2VINA 1ZPBA 2Y5HA 4DURA 4KGAA 2PLXA 1QY6A 1TMBH 4H42U 1SGYE 2FPZA 1LHDH 1XVMA 1GBHA 1P2KA 2A7JA 4I8KA 2XBWA 2Z9GA 2QN5T 5IYTA 4ABFA 3C27B 1AE5A 1SLVB 3BTDE 1GMDF 1TX6A 1AHTH 1ETSH 1P8VC 2O8LA 1ANDA 1GBAA 3NXPA 1BT7A 1HBTH 1G2MA 4J2YB 1MU6B 1EPTA 2WPHS 4HFPB 3QN7A 1ELDE 1LKBA 3SU6A 1MBQA 1W0ZU 1C1PA 2JKHA 2OQ5A 4AX9H 4D8NA 1C5YB 2FMJA 1GVKB 1O5GH 2ZDKA 4X8VH 1F0RA 1A1RA 2FOAA 1C2JA 1U6QA 3ATMA 3RXMA 3FVFB 3QK1A 1DWEH 5FBEA 4AN7A 3OU0A 3A8BA 1TNLA 8GCHF 4BAKB 1CA0C 2GD4B 1YPHC 1RS0A 1ARBA 1TFXA 3LC3A 1V2RT 4FUDA 1BTUA 1LVBA 1TRYA 2ZG0H 2ZHWH 1TONA 4AB8A 1BMAA
chains in the Genus database with same CATH superfamily
1HCGA 1AD8H 1E37B 1O2ZA 1MKXH 3D62A 1GBBA 2FESH 1E1QD 2A31A 1KXCA 3F0OA 5A09A 2ZTXA 4YLUA 3DSOA 3TU7H 4YTAA 1O5FH 5I46H 1QL7A 3Q3KA 4CH8B 1LDTT 1E36B 1S81A 2ZGXH 3RP2A 1QRZA 2ZECA 5F8XA 2BHGA 5L2ZH 1EPTB 2FI4E 1HAYB 3JZ2B 4KELA 1O39A 2GJGA 5TCAA 1UTPA 1D6WA 1SL3A 2Y7XA 1BTXA 3SU1A 3M3TA 3S7KB 3P92A 1SMFE 3GY6A 2A7HA 3CNRA 1L4ZA 2HPQH 3VGCB 2PTCE 1QJ6B 2R2WU 2VVUA 1N8OB 3CS7A 4WY3A 3HKJB 1N6YA 1YKTA 3UOUA 2ZCLP 1FY8E 1FV9A 2BXUH 4I8HA 2BDYA 2V35A 2CV3A 2C4FH 2FS8A 3H7TA 4X8TH 2H1UA 1FIWA 3RXDA 1THPB 3MNXA 3EE0B 4Q7ZA 2HVXA 3QZRA 3K6YA 9ESTA 3V13A 1BMMH 1QBVH 2FYRA 1Z6JH 3SHCH 4Z6AH 2FOCA 1J9CH 5FX5A 2WPDD 1W8BH 1LMWB 1FXYA 2W6ID 3PROA 1ID5H 3UB0A 1O31A 1V2LT 1B0EA 1TA6A 3M7UA 2Y5FA 3SQEE 3SV9A 2AEIH 4XBBA 2YMSD 4A6LA 4ZAEA 1F92A 4X0WU 4HTCH 3M5OA 2K8IA 3VB4A 1NPMA 1G2LA 1TX7A 3RXOA 1WQSA 3GS9A 1EQ9A 2BLOA 1MQ5A 1WAYB 1IHSH 2OD3B 3P8OA 3STIA 1WQVH 3SOSA 3BIVH 3A8AA 1CHGA 3MQKC 3SZNA 3VB7A 1S82A 4R0IA 4UFEH 1YCPK 2J98A 5GCHG 1HDTH 1C5MD 1TGBA 1Z1IA 3KF2A 1KLTA 2GMTB 3SU0A 4OGXA 1V2ST 1TQ7B 1P05A 1FDPA 2HNTF 2VH6A 1FJSA 1BMFD 3GICB 4JZIA 1MCTA 4OS4A 5T1VA 3L33A 1QBOA 5KECA 1L1GA 1AE8H 3ODFA 1WYKA 1ZHRA 4GCHF 1CGIE 1DM4B 3AVZA 5F03A 1AZ8A 1TBZH 1TBRH 3S9BA 1V2QT 2QC2A 1MKXK 4ISIH 1FY5A 1QTFA 2HNTC 1PPFE 2VGCB 1E79D 3UWJH 4D9QA 7GCHF 3SORA 1CBWC 2ANYA 2P59A 1IQLA 2BVXH 2SGEE 2JETC 3LU9B 1NRSH 1GHAG 1AUJA 2CMYA 1A3EH 2VU8E 1LVMA 2WPLS 1AY6H 5C1UA 3PTNA 5JBTA 1OWHA 1BJVA 2AIPA 1GDQA 1V2WT 1O3PB 1INCA 4ZROA 4X2WA 3K65B 3NK8A 4BANB 3U8TH 3D65E 1IOEA 2VIVA 3GDVA 1O2TA 4NSYA 4AC9A 2BD3A 2WYJA 1UK4A 1G3EA 2ZGJA 2W3IA 3OTJE 2HPPH 3SV6A 2H9HA 3MWIU 3F2GA 1GI8B 1UVPA 4ZHAA 2HOBA 2J98B 1OKXA 1IQKA 2BLWA 2RA0A 3BTKE 2F9BH 1Y8TA 1ESBA 1C5ZB 4YZUA 4NSVA 1P2NA 2TGPZ 2PKSB 1C9PA 3ESTA 1TPAE 1K21H 4B2AA 1K1MA 1UTOA 3MI4A 1DT2A 1EOLA 4IBLH 3LC5A 1O3LA 3VB5A 4MVNA 2ZC9H 4ISHH 1SGQE 5A0CA 1H4WA 5T3HA 2ZU5A 2LNCA 2QXHA 3KNXA 3GCTG 2F43B 1W11U 1W14U 1YLDA 2AGIX 2B0FA 3A89A 2XNDD 4CRFA 2G4UA 3U98H 4CBOA 1EP5A 1VITH 2P3FH 1XM1A 1AWHB 3QLPH 4K8YA 1F2SE 1H8HD 2ZDNA 1GHWH 1V3XA 5EQQA 1O2QA 4UE7H 1EB2A 1F5KU 1ANBA 1T4UH 1EKBB 1W7XH 2ZGHA 4INLA 1O3AA 5A0BA 2Z94A 3A7TA 1K9OE 3KGPA 5EW2H 4AG2A 3LJJA 5ESBA 2GT8A 2XC0A 1DY8A 1SG8B 5EJZA 1O5EH 3HGPA 2FTMA 2SGAA 2ZGBH 4K69A 3N7DA 1TX8A 2NU2E 3PLBA 1XUKA 4CR9A 4Y71A 1IQEA 1O3FA 2BOHB 2A4OA 2G51A 1C5XB 2XWBI 4A92A 2PR3A 1HB0B 4ZXXH 1TAWA 1T32A 1J8AA 4ZKRU 4U2WA 4MG3A 1O2HA 3BTWE 1AWFH 2PKAA 4E05H 1DUAA 3DFLA 3UY9A 3ZZ9A 5EQRA 1GCTC 3BEFB 2CN0H 2VVCA 4Y10E 2FDAA 5DP6A 3SI3H 2VBCA 3OSYA 5F8TA 5CHAC 4YOJA 4K3JA 3HK3B 1GHBG 3SW2B 1M9UA 3OY5U 3RU4E 2A1DB 1GI5A 3GDUA 1MTNC 3UREA 2NU0E 4UDWH 1O5BB 2ILNA 1GBCA 1GHXH 2O8UA 4UONA 1MZDA 4GHQA 1EUFA 3GDSA 1WCZA 1C2LA 4INHA 3GCHB 1ELFA 1QRWA 4Q7XA 2V6NA 1O3CA 4Y76A 4MNXA 5E2PA 1EX3A 5DG6A 2ALVA 4ABDA 1HAZB 1PQ8A 3ZVAA 1BMLA 1LO6A 3PV2A 3STJA 1GBTA 3PM3A 1DSTA 1TMTH 3RXEA 1HUTH 4ZHMU 1WDIA 1ZJKA 2P8OC 2GP9B 1H1BA 5L30H 4LZ1H 5E0GA 2R9PA 1YPEH 3P17H 3TH2H 4INKA 4WWYA 4XSKU 4B6EA 4UD9H 1ELAA 2ANWA 3BSQA 1SHHB 1YBWA 2WPJS 3NKKA 3M61U 1TABE 2BDBA 5C1YA 3RXJA 4NIYA 1A0HB 2BXTH 4RN6A 3S7HB 2ZFSA 3OE7D 1KXBA 5E0JA 1K22H 4K1EA 1TRMA 3ITIA 4NIWA 3P6ZB 2D26C 1Y59T 1LKAA 3FZDA 4LK4A 1MKWH 1MQ6A 4X1NU 5EJLA 1EXFA 1GJBB 5IDKA 1LQEA 5F8ZA 1A5GH 5T6DA 1RGQA 3BTFE 3VB3A 5SGAE 1MAXA 1C5LH 4ZH8A 4CBNA 1ELEE 1TLDA 1PQ7A 3C1KA 1GI6A 4ISNA 4FUEA 3HPTB 1G36A 1C5NH 1SOTA 3FKSD 4Q63A 1GWAA 4WXVA 4Y0YE 2STAE 3NZIA 1VJAU 1H8IH 1W2KH 2B9LA 5L6NH 3KL6A 3MH6A 5E2OA 2FM2A 1Y5BT 1UVTH 2TPIZ 1NN6A 3FP7E 1JIRA 3A7VA 4TYDA 3F68H 3PB1E 4CRCA 5C17A 1UTJA 1MTUA 1CA0B 3A87A 4X2YA 5GWZA 1K1JA 1P2IA 2F83A 1O2GH 3E3TA 3PMHB 3RXTA 1HV7A 1HIAA 3MU8A 1JWTA 3SNEA 1LVOA 1QNJA 5GJ4B 4GLYA 1GHVH 4ASHA 1CVWH 1KXDA 1MD7A 2WUBA 2JDID 3TGIE 3EGKH 1QHRB 3ENSB 3QX5H 2BD4A 3EE7A 1OWEA 3DFJA 4Y11E 1HAIH 1WOFA 3V3MA 4E06H 3RC4A 1GI4A 5DKMA 4TWWA 2OBOA 2WV9A 3E0PB 1A5HA 2FLRH 3UPEA 1MH0A 2ZIQH 1O3OA 2ZU1A 4I31A 4ZHLU 4A7IB 3RXFA 1BMNH 3LPRA 2Z9JA 4AORA 1PQAA 3T27A 2QY0B 2WPIS 1GJ7B 2BZAA 1G9IE 3TJOA 4SGBE 5HGGA 1YPLH 2XBVA 3O8BA 5AFYH 2XXLA 5FBIA 3G01A 2A4QA 3LOXA 5H4IB 1BTYA 3SYJA 3TNTA 4ABGA 3A82A 3SN8A 1RTFB 5EQSA 1P9UA 4MQAA 1KXEA 1FX0B 5C3NA 3MHWU 2STBE 4D9RA 3D49H 1UVOA 4JYVH 1ANCA 4Y8ZA 2P3UB 1DANH 1CHOF 4I32A 1GMCF 2TGDA 3LGTA 2BQ6B 1HIAB 3LDXH 3A84A 3BF6H 1DOJA 1SGTA 2O9QA 3CENA 5LGOA 3UQVA 1ORFA 1K0HA 1S6LA 3Q3XA 3RXHA 1G3DA 2A7CA 1YCPM 2J95A 1NU7B 1Q31A 1W0JD 2FP7B 3AW0A 3SU3A 3VPKA 3ZZ3A 1KXAA 2A0QB 5T6GA 4AFQA 1HJ9A 1BRBE 5J4SA 2GZ7A 1Y3WA 1ELGA 2P93A 4K60A 2UUFB 1O3JA 4ABEA 1P02A 1WSSH 3JZ1B 2BVRH 2PGQB 3SV8A 4AFZA 4MDSA 4BTIB 3KYFA 2FOBA 3OFND 5HMAA 4Y8XA 1HJ8A 2A4GA 4GUXA 1DFPA 1SI5H 4E7NA 1W7GH 5FAHA 1S0QA 2GCHF 2ZI2H 5HM9A 3LIWA 4XD7D 1HJAC 1QQ4A 1TB6H 3E90B 2ZDLA 2XRCA 5C94A 1HNEE 4I33A 5C0TA 1KIGH 2ZGCA 1DWCH 3DCLA 4CREA 3ZVFA 4DG4A 1QFKH 1FY3A 2AMDA 2ODQA 3MH7A 3QDZB 4NIXA 1KTSB 5DO4H 1NFUA 1O35A 5A8YA 5J4QA 4IC5A 3UNQA 4H4FA 1A4WH 1ZTJA 1VITF 4MPVA 1CBWB 1WTHD 2AGEX 3SV7A 4FUCA 1EOJA 1JBUH 1DWDH 1C5TA 3F3BA 2C8WB 3M5LA 7LPRA 2FXRA 1E38B 3ATWA 3SUDA 4K1TA 1GMHF 4ACAA 3RXBA 1O3KA 3M3SA 1OP8A 1KXFA 1W3CA 1AKSA 3T26A 1EAIA 1NRPH 2AGGX 4DT4A 4B74A 4CRAA 1ZPCA 2TGAA 3FAOA 2F91A 9LPRA 1BHXF 5FCRA 1OPHB 3FP6E 3GY4A 4Y6DA 3SUEA 1YPHE 4MPXA 1PJPA 3K6ZA 4JK6A 1YCPH 1GBEA 3MO6A 3UR6A 3GISB 2Q1JA 3W1EA 2A45B 2R0KA 2RDEA 2ANKH 1O2MA 1NC6A 5FPTA 2CHAC 4DOQA 1P9SA 1VGCC 1SLXB 4NZQA 1QJ1B 4XDEA 1JMOH 1TA2A 1XUHA 2GV6A 1PPBH 1TBQH 3URDA 1C5RA 2B5TB 2FTLE 1NS3A 1JRTA 3TPIZ 5C1XA 1AQ7A 1GI7B 4MPWA 3BEUA 2IPHA 4WH8A 3RUOA 1SGFA 1P3CA 3UAIC 1MD8A 3I78A 2BD5A 1JIMA 3SNBA 2Q6FA 1AKSB 2PSXA 3GYLB 2H5CA 3ELAH 1ARCA 5JB8S 4KTSA 2Z3CA 1D3TB 3TGKE 1GJ5H 2Q6DA 1SSXA 1KLJH 4BNRA 3LGVA 3Q00A 1HGTH 1A61H 4Y8YA 1OWJA 1ZGVA 1V2NT 5JBCS 1LCYA 1UTLM 2NU4E 1K1PA 1C2IA 3SQHE 3SV2H 2BZ6H 2ZFQH 1FN6A 4ABBA 1C5WB 5CHBA 1YGCH 4AFSA 4ASUD 3U9AH 1ZLRA 1IQJA 3PLKA 1UK3A 1WTGH 4FUBA 4LXBH 1HAHH 3PV4A 1HAOH 4DGJA 1GVLA 3SNAA 2V3MA 3F9EA 1FZZA 2BM2A 3HKIB 1C2GA 1FONA 2BD8A 2KCOA 1L2EA 4RKOB 2OC0A 4PROA 3PWCA 1RTLA 4TPYA 1SPJA 4K5ZA 1MTNB 1H8ED 4F49A 1H9LB 1OYQA 5EPNA 2C8XB 4RSPA 1XVOA 4WXIA 1G37A 1ZHPA 1RD3B 1C1QA 4WF8A 1ZPZA 2KFWA 3Q76A 2OBQA 1V2UT 6GCHF 3DA9B 1C2MA 1H9IE 3F2HA 4TSFD 2EA3A 3ZVCA 3O8RA 1P3EA 3A7WA 4O9VA 1XUJA 3TITA 3URCA 1AU8A 3QGJA 2V3OH 2RDLA 2FOFA 1Q3XA 1QZ8A 2P8OB 4WJG2 1F0UA 4YOGA 1NM6A 2IJD1 3BN9A 1UHBB 1GVZA 4Q2KA 4JYUH 1TNHA 1UTQA 4X6OA 3ZZ8A 5EW1H 1DLKB 3F9FA 3WY8A 4VGCC 2PHBA 3PLPA 3RDZA 2HNTE 2HRVA 1EJNA 1GJ4H 3MU0A 4BTUB 5LH8A 1L1NA 2D2DA 1B0FA 3N99A 4NWLA 3SGBE 3U1IB 1C5PA 2UUYA 3UNSA 1QCPA 2V7QD 1GBLA 4THNH 4YOIA 1XUFA 1A0JA 1O2UA 1SR5C 1NFXA 2A32A 3SU4A 4YM9A 4B6FA 3RMNH 5A8XA 1SGIB 2XYAA 1ZSKA 1GGDC 2ZHEH 3Q77A 3SJOA 4IC6A 3GOVB 1Y3UA 3ZIAD 4BOHA 2FWWA 3A88A 4XRNA 4X8SH 1GI0A 1VCWA 2YMSC 5BRRE 3AK5A 4Y79A 3N7EA 1N6XA 1WU1A 4XFQA 4ABJA 2PUQH 1ZRKA 5C0UA 3PMBB 5FPSA 1UK2A 4ZXYH 2BQ7B 1V6DA 2QF3A 5AHGH 3UUZA 1EJAA 4TT3D 1AUTC 4A1VA 1QL9A 2VIOA 1UTMA 2FEQH 2ZDVH 1MBMA 2O8WA 4U01A 1P2QA 1GBDA 1SC8U 3BG4C 1PYTD 4FVBA 4D76A 2M2AA 3FANA 1S6HA 4LOYH 1T7CA 1D3QB 1C1UH 2W5EA 3RC6A 2ZF0H 4BXWA 3TVJB 2EEKA 1YPJH 1P0SH 1C1VH 4I86A 3ZV8A 3ZYDA 1YM0A 3WWFA 1UVSH 2G4TA 1GDUA 1VR1H 2QIQA 1UJ1A 2UWOA 1DS2E 4TY7A 4B76A 1P12E 2XTTB 2YNAA 3IG6B 2VB0A 4RT0A 4E7RG 2AFQB 1EFRD 2F9OA 1O3EA 4UFGH 1EZXC 2XCNA 3T62A 4DT7B 4CRBA 1O2XA 2QA9E 2ZPSA 1GHYH 2BD2A 4X6MA 5HXFA 4Z0KA 5CE1A 4IS5A 1FQ3A 3RMOH 5JYIA 1FPCH 4H6TA 1FY1A 2NU1E 1DXWA 1CO7E 1P11E 2W26A 1O3MA 1UW7A 2SGFE 1C5OH 1DUEA 1WV7H 2F4LA 1O3IA 2BDCA 6LPRA 3OY6U 2GZ9A 2GV7A 3T25A 1J17T 3LJOA 3UNRA 5DPAA 5JBAS 3ZZDA 2VJ1A 1UO6A 5C2ZA 3MTYA 3M5NA 4MNYA 1PYTC 2C8YB 1BRAA 2KCYA 5A0AE 1KDQA 1XMNB 2RCEA 3RU4D 4BTTB 1ELVA 3BTHE 1QGFA 2XWAA 3U69H 1EPTC 1PPZA 1CQQA 3KN2A 1V2VT 3VXEH 3V0XA 4X8UH 5DP7A 1ZMLA 1OHHD 3TK5A 3LGUA 1BOQA 2FOMB 3KEEA 1RIWC 3SU2A 4JCNA 1J16A 2P3TB 1GJAB 3UTUH 3UIRA 1L1JA 4OM9A 1UMAH 2PFEA 5DP8A 1QB1A 1EZSC 2GDEH 4FU9A 4M9FA 1AO5A 5C20A 2R0LA 2BVSH 3GY7A 1EB1H 1W10U 5DGJA 1GI2A 1MTSA 4TY6A 3TIUA 1P2JA 4FU8A 1EZQA 3IITA 5CMXH 3QUMP 1OS8A 1C2EA 1G3CA 3PO1C 1HJAB 3DHKH 3QTOH 3BTEE 2A5IA 2VWNA 1O2WA 3E6PH 2FS9A 1YPKH 2CK3D 2J9NA 1ZRBA 2I6SA 1MUEB 2Z7FE 1GL1A 1S85A 2J2UA 3R0FA 3TK9A 4JK5A 4NG9H 1HXEH 4ISLA 2QYIA 1K1OA 4YLQH 1KDQB 1O36A 5EXNA 1HRTH 1DVAH 4YO9A 4ABHA 2Y81A 2XBYA 1WUNH 2WUCA 5GCHF 1OWDA 3TJNA 1C4U2 3S69A 1C4V2 3LH3A 3T5FH 1BITA 1CGJE 1RFNA 3MO9A 4NZLA 1TNJA 1QA7A 1QBNA 2PGBB 3BTME 2FX6A 2VH0A 1CGHA 5B6LA 3MYWA 2D8WA 1QQUA 1W13U 2AMQA 5ETXA 2QXGA 1D3DB 2ALPA 3NWUA 3F2FA 1SGNE 1YWUA 1C2DA 1Y3VA 2HWLB 4B2CA 1SVPA 2A2QH 1X7AC 3EA8A 1SHYA 1GMDG 1GHAF 2OQUA 1C5UA 5BPEA 2C93B 4I8GA 2Y82A 3KQDA 3P8FA 1OP0A 1EASA 2BX4A 1FY4A 2R3UA 2UWPA 1BTHH 2H5DA 1Z6EA 2BB4A 2WZQA 1O2SA 3GY3A 4BAOB 2UUKB 4FUJA 2ZU4A 3PV5A 4DY7B 2QF4A 4FUIA 1MTWA 2ZHDA 2ZNKH 5HYOA 4A5TS 3KCGH 3FOAA 3RXUA 1UCYE 1BUIA 1P09A 2CHAB 1C5SA 2BDHA 1EP6A 2QGRA 5HM2A 4AGJA 3TJVA 2FIRH 4NFFA 1VGCB 4WVPE 4X2XA 4RI0A 4Q4LA 3LGYA 4U30A 1V2PT 2OLGA 8GCHG 1PPCE 1SOZA 1O2RA 5ESTE 5ABWA 1BRCE 6CHAC 2Q6GA 4BAQB 3H7OA 5EXMA 3M37A 1C5QA 1T8MA 3EAJA 1PPHE 2JH5D 3F9HA 3M7QA 2G5NA 1DLEA 3TJUA 4IMZA 1LTOA 2AMPA 2GCTC 4GHTA 4O3UA 4BXSA 1RRKA 3MMGA 2FOHA 2TIOA 4M7GA 5TJXA 2H6MA 1H8DH 1AVXA 2B7DH 3SU5A 3T28A 3S9CA 3PRBA 3GCTF 2BD7A 2ESTE 3RXQA 1E34B 2XNIA 2G81E 5GNDA 1O2JA 1B7XB 4AOQA 2OUAA 1O34A 2J4IA 2EI6A 2WV5A 3S9AA 2ZHFH 1AI8H 1YPMH 1BCUH 3OEED 3D23A 3SNCA 4KKDA 2J92A 2PV9B 1DICA 5E0HA 2QXIA 2AIQA 1GJ6A 1P06A 3VEQB 1IQFA 3LH1A 3V12A 4JZEH 4AZ2B 4Y7AA 1WBGB 3MH4A 1CU1A 1DXPA 1DPOA 4Y7BA 3ZZCA 2QV1A 1O2IA 4O03A 2OK5A 5FCKA 2J5UA 2FI5E 4DIHH 3K2UA 3HGNA 1AN1E 1ELBA 4KTUA 1IQNA 5KGOA 1GJ8B 1SGCA 1NBME 3TGJE 4RKJB 1S83A 1NO9H 2VVVA 4HI3A 2ZWLH 4DJZB 1MZAA 2BOKA 2AHME 1TYNA 2BX3A 1T8OA 4XOJA 1SQTA 1P03A 1O3BA 1IQGA 2AYWA 2NWNA 2OC1A 2XC5A 3OTPA 3ZZBA 1GBIA 4XBDA 4AG1A 1YF4A 1IHTH 2P16A 3MO3A 1C2HA 2WINI 2PSYA 5JB9S 5E8EH 2KAIA 4X2VA 3UQOA 3KIDU 5LPFA 2ASUB 1IQIA 3MNBA 1KMHB 1GHBF 2HLCA 4I7YH 2ULLA 1C1MA 3SJKA 1HAPH 2IPQX 2Z6BD 1J15A 1KYNA 4UFFH 2F3CE 4U32A 3SI4H 3WWBA 4DVAU 3WW7A 3VFEA 3BIUH 1GG6C 2BY8X 3EYDA 4VGCB 2FYQA 3U8OH 1ZHMA 4AB9A 2IOTA 1ZZZA 5FX6A 1SLUB 2ZO3H 2FOEA 2GX4A 1NROH 3RXLA 4LZ4B 3N7OA 3VB6A 1YLCA 1GJDB 1ZTKA 3RC5A 2ZP0H 1B5GH 2VWMA 1YP9A 2Y6TA 4JZ1A 2D1JA 3MU1A 3A86A 3ZZ4A 2ZU3A 4NIVA 3VXFH 1D3PB 1O2KA 2BDAA 3LKWA 2ZTZA 2JETB 1CE5A 4GCHG 4X6NA 1NRRH 2GT7A 3RXVA 1GGDB 3O8DA 3P8GA 4DW2U 2XCFA 4JZDH 4MNWA 4ZKSU 3ZZAA 2V3HH 4AYYB 7GCHG 2BY6X 2BDGA 2GTBA 1BBRE 1WXRA 3A7XA 1GBMA 1HAXB 4FUHA 2YMSB 1O2VA 4CH2B 4AYVB 3ZVDA 3RXPA 2HVYB 2H9TH 3A8CA 1TWXB 2KAIB 4F48B 1LHFH 1HFDA 1TGNA 2J94A 1K1NA 4HG6A 4DIIH 1K1IA 2GDDA 1SLWB 3BG4B 1VCQA 1EZUC 1K28D 1AVGH 1PQ5A 3B23B 4JMYA 1YY3A 2L74A 3UWIA 3HK6B 3MU5A 3U8RH 1Z8JB 3LGWA 4OS2A 4YXWD 3BEIB 2LP6A 1A0LA 4XBCA 3RXCA 2Y7ZA 1GI1A 1O3HA 1SKYE 2ZCHP 3MOCA 2W7SA 2OXSA 1ABIH 1S6FA 2VWLA 1QIXB 1TPOA 3OYPA 2F9VA 1FPHH 1GDNA 4FOUC 4CRDA 1XKAC 2OINA 2I6QA 3ZYEA 3RXAA 3PMAB 3HATH 2HLDD 5DN6D 3SZEA 3PMJA 4CR5A 1ZYOA 3BG8A 2J97A 4IW4E 1ZMNA 2Z9LA 1ZGIA 2SFAA 1EJMA 1W0KD 1QB6A 1F5RA 1BTPA 1O5AB 2AH4X 3DSGA 2ZFRH 3LGIA 1QJ7B 4OS7A 2G55A 2CXVA 4GPGA 3LT3A 2ZZUH 3A7ZA 1NY22 4MTBA 3S0NA 4WMFA 3KQCA 1ZMJA 1DDJA 1PPEE 2OC7A 3BTQE 2BYAX 1AIXH 2F9PA 1THSH 1Y3XA 1VCPA 3ODDA 1RXPA 4SGAE 2OCVB 3EA9A 3B8JA 1K1LA 1OWKA 1XKBC 2ZDAH 4CHAC 2ZFTA 1ZJDA 1GBFA 3CS0A 3SBKA 1JRSA 1AVWA 1OWIA 1UHBA 5C67A 2BDIA 2A5KA 5LPEA 4X6PA 2YOLA 2RFKC 1JXPA 1QR3E 4F55A 4P00A 2BMGB 4KP0A 1C1OA 1V2OT 3E0NB 1RIWB 2PWXA 1GCTB 4BAMB 1CA8B 5CHAB 5L2YH 1C1TA 1GI9B 2BQWB 8ESTE 1Z8RA 1J14A 3MNSA 1T4VH 4B71A 3GY2A 3OX7U 4RT1A 4TWYA 1T8NA 2ZHQH 2KR7A 3FFGA 1SBWA 2XOKD 1BA8B 1UTKA 3ATIA 1C4Y2 3KQBA 2FLBH 3KYGA 1D6RA 1SGFG 1FAKH 5F6MA 2FZZA 2A5AA 3IWMA 1ESTA 1UCYH 2Z3DA 3PO1B 3BTGE 1ZOMA 1BJUA 3GYMA 2LPRA 3A83A 1BTWA 2SGQE 3ZVBA 2QXJA 2AERH 2KX4A 2Z9KA 4TPIZ 5AFZH 3RXIA 3TK6A 1EAUA 1FLEE 5K0HA 1AB9C 1FI8A 1TGSZ 5EGMA 2Y5GA 7KMEH 4P02A 3AASA 1YYY1 1V2JT 2UUJB 3U28C 3RXRA 5GDSH 3QTVH 2R2MB 3RLWH 2Y80A 1BTZA 2G8TA 2KM0A 4B2BA 1ELCA 5LPRA 5A2MH 2FX4A 2ODPA 2IN2A 1PPGE 2PUXB 3P8NA 1L0ZA 5EPYA 4AFUA 5DP5A 4NA8A 1G32B 2BY5X 3U1JB 2FI3E 2FOGA 4FU7A 1C9TA 2RA3A 4AGKA 2C3SA 1AFQC 4HGCA 4X1PU 4K1SA 1NZQH 1PFXC 2EI8A 3E91A 3B9FH 3F9GA 2C8ZB 2TRMA 1O30A 1CT2E 2TBSA 1A5IA 1O2NA 1CSOE 1LHCH 2VIWA 2PP6A 1TMUH 1SQAA 2R3YA 1CT0E 1LHEH 1C1SA 1ANEA 1TALA 5KEDA 1V2MT 1HAVA 5JPMH 5DK1A 1ESAA 2CF9H 5G4BA 1IQHA 2W6JD 4OS5A 3ZVGA 3ATLA 1SGDE 2ZA5A 2L6OA 1ZR0A 1H9HE 1IQMA 4OS1A 3GY5A 3AW1A 1HYLA 6CHAB 2WYGA 1Z71A 1O33A 3CP7A 4GSOA 1AGJA 2QF5A 5EOKA 4IGDA 4MPUA 1Z8GA 2GCTB 5I25A 1KLIH 3EDXB 4UEHH 1O2YA 4OGYA 1L4DA 3H5CB 4K2YA 2B8OH 5HIYA 1OYTH 4NCYA 1F0SA 2PW8H 4WMDA 2OC8A 2RG3A 3SGAE 1YC0A 3QWCH 4MNVA 1LVYA 1UCYK 4Y0ZE 8KME2 1SGPE 2BY7X 1O2PA 4A1TA 4OS6A 1ETTH 2V0BA 2XBXA 1COWD 2ZEBA 3QGNB 4FXGH 1V2TT 1ZSLA 3M36A 4I8LA 4D7FA 5B6OA 1EAXA 5JDUB 1VJ9U 3SJ9A 3O8CA 1ELTA 1NTPA 1AZZA 2DE8A 1C2FA 3TLOA 2QCYA 2FODA 1HAVB 1C5VA 2BLQA 3RU4T 1O3NA 1Q2WA 4UFDH 1GL0E 1S5SA 1O38A 2WPMS 1QRXA 5GXPA 2ZFFH 3M3VA 4YT7H 2QE7D 5C5NA 1F0TA 3DUXH 1NT1A 4YT6H 1BBRH 2BTCE 1G30B 1UTNA 2GGVB 2QF0A 2ZPQA 1BQYA 1LPGB 3F0PA 3QZQA 5DP9A 1TPPA 4O3TA 4NA9H 1P10A 2HGTH 1W12U 1Y5AT 1CHOG 1GMCG 1KSNA 1O37A 2ZCKP 3I29A 2EI7A 2ZPRA 4ABIA 4K8BA 2O8TA 4DCDA 4IN2A 1SQOA 2WPKS 2SGDE 1MAYA 3L6PA 4GVUA 4H6SB 1ETRH 3VGCC 1OXGA 4IN1A 1NESE 2ZTYA 3GCOA 2H9EH 2P94A 1GCDA 1LQDB 1N8OC 4WH6A 3SUFA 1Z7KA 3DD2H 3TH3H 2VNTA 1GJCB 1VKYA 5TCCA 2W3KA 4HZHA 2CGAA 1O5DH 3RLYH 5K7RA 4ISOA 1D9IA 1EAWA 1TOMH 3BTTE 3EQ0H 1NRQH 2WV4A 1GBJA 1O32A 1LHGH 2HALA 4NFEA 3SJ8A 2JH6D 3MFJA 1GG6B 2KZ4A 1TE0A 5C5OA 1EATA 1HAGE 4FVDA 1DITH 1BIOA 1MU8B 2JJ2D 1Y3YA 4NGAH 4FETA 4FUFA 5GIBA 6ESTA 1NRNH 1OOKB 2GCHG 1RJXB 2SNWA 1SFQB 1Z1JA 2NU3E 2AS9A 5EU8A 3RM0H 1E1RD 1SB1H 3GCNA 3A85A 1T8LA 1O2LA 3A7YA 5AVDA 4ZKOU 2WSSD 2WHXA 3AAVA 3RXSA 5IK2D 2J38A 4ZKNU 1DSUA 2K0QA 4O97A 3W95A 1MABB 2G00A 1K2I1 2JH0D 1W0YH 1VITG 2EY4C 2GMTC 1ACBE 3SHAH 1ABJH 1MTVA 4J1YA 5DJ7A 2KCAA 3PYHA 3M35A 3FO8D 1A2CH 1TNIA 3SNDA 2W7UA 3M7TA 1FN8A 5JBBS 1HXFH 1KY9A 1BRUP 4NWKA 1TNGA 1DY9A 2PKAB 1SQRA 1GMHG 1O2OA 1N1LA 3RXKA 3A80A 2FO9A 1Y5UT 3T2NA 3T29A 2BY9X 1P04A 2VGCC 3VG8A 1FAXA 2TGTA 3M5MA 4B1TA 2QAAA 1C1RA 1QL8A 3OEHD 1C1NA 4NA7A 5FL7D 5EJ1A 1BHXB 1TGTA 3L3TA 3RMLH 2GKVE 3ZV9A 2VIPA 2G5VA 2SNVA 5EIYA 3GY8A 2OTVA 3FP8E 1FNIA 3QO6A 3ZZ5A 1FUJA 3K9XB 1BBRK 2H2ZA 1DWBH 3PTBA 3E16B 1XXDA 2F9NA 3TH4H 2VIQA 2P95A 1KTTB 1YLNA 5AF9H 2UWLA 1TQ0B 4GAWA 1TNKA 1GHZA 4FUGA 1HPGA 1G3BA 5A8ZA 3OAAD 1SGRE 5FHTA 3F6UH 3ZZ7A 1TRNA 3E1XB 4ZUHA 2GVFA 1THRH 1GBKA 3RM2H 3DSPA 1XUIA 1ZTLA 2IJOB 2O8MA 2ZFPH 1Z8IB 5HKKD 4Q80A 1HLTH 1OSSA 3DT0H 4MLFB 2PKSC 4B73A 2F9UA 2DE9A 2DUCA 1F7ZA 2CJIA 2THFB 2XC4A 3AAUA 3SUGA 3FZZA 3F1SB 5PTPA 1LPZB 1MMJN 4CHAB 1NBMD 1BDAA 1A46H 4JZFH 1RTKA 4ZCNA 2J34A 1E0FD 1D4PB 5DSFA 4CRGA 1P01A 2JIZD 2VWOA 2LELA 4X1SU 2G52A 1VZQH 1GPZA 2ANMH 2Z3EA 3PRDA 1TGCA 1TPSA 3R3GB 3Q3YA 3EA7A 2SGPE 3KQEA 4ZMAH 3NPSA 1XUGA 3SGQE 1JOUB 4F4OC 1S84A 3MH5A 2ZQ1A 3E8LA 1OX1A 4IMQA 4Q7YA 4XE4A 2OP9A 4JYTA 3ZZ6A 1TOCB 3NCLA 1GI3A 2GZ8A 7ESTE 3P95A 3MU4A 3UR9A 4WMEA 2YNBA 1QURH 1NU9A 1YPGH 5GPIB 3RMMH 3RXGA 3H09A 4KTCA 2ODYB 1V2KT 2BD9A 5DP4A 5T6FA 4QT8C 2BLVA 1C2KA 2CF8H 1A3BH 3NRLA 3NUMA 4I8JA 3P70B 1A7SA 4X1QU 1E35B 2A4RA 1BZXE 3PWBA 5EXLA 1C1WH 3KHVA 2XW9A 5FXLA 1AB9B 4YESB 1DX5M 1NFWA 3ZVEA 1AMHA 1XXFA 1P2OA 2A2XH 1MKWK 3V7TA 1ZSJA 6GCHG 2C90B 2ZDMA 1QB9A 1SGEE 4X1RU 1F5LA 1O3GA 3A8DA 1AFEH 4R8TB 1O3DA 1QA0A 1IAUA 3TNSA 3A81A 3ATKA 5EG4A 1P57B 1BB0B 2VIDA 5FPYA 4D7GA 1SFIA 1TIOA 3LONA 2ZQ2A 2EQNA 1O0DH 2K1QA 3MNCA 1LPKB 1DE7H 1CT4E 1GJ9B 2KCPA 3GCHC 5DP3A 4BAHB 1P2MA 5EODA 3W94A 1FMGA 2EC9H 3BV9B 2PTNA 4ESTE 1O5CB 4A1XA 4B75A 1MCVA 1AFQB 1XX9A 4ABAA 2ZKSA 3SO3A 5HIZA 2ZU2A 1FIZA 3UFAA 1NFYA 2Z9IA 1OP2A 8LPRA 1S0RA 1UVUH 5F53A 3UOPA 3SJIA 2M5TA 3I77A 1T31A 2VINA 1ZPBA 2Y5HA 4DURA 4KGAA 2PLXA 1QY6A 1TMBH 4H42U 1SGYE 2FPZA 1LHDH 1XVMA 1GBHA 1P2KA 2A7JA 4I8KA 2XBWA 2Z9GA 2QN5T 3FN8A 5IYTA 4ABFA 3C27B 1AE5A 1SLVB 3BTDE 1GMDF 1TX6A 1AHTH 1ETSH 1P8VC 2O8LA 1ANDA 1GBAA 3NXPA 1BT7A 1HBTH 1G2MA 4J2YB 1MU6B 1EPTA 2WPHS 4HFPB 4ACBA 3QN7A 1ELDE 1LKBA 3SU6A 1MBQA 1W0ZU 1C1PA 2JKHA 2OQ5A 4AX9H 4D8NA 1C5YB 2FMJA 1GVKB 1O5GH 2ZDKA 4X8VH 1F0RA 1A1RA 2FOAA 1C2JA 1U6QA 3ATMA 3RXMA 3FVFB 3QK1A 1DWEH 5FBEA 4AN7A 3OU0A 3A8BA 1TNLA 8GCHF 4BAKB 1CA0C 2GD4B 1YPHC 1RS0A 1ARBA 1TFXA 3LC3A 1V2RT 3KQ5A 4FUDA 5CDFE 1BTUA 1LVBA 4Z1MD 1TRYA 2ZG0H 2ZHWH 1TONA 4AB8A 1BMAA 2JJ1D
chains in the Genus database with same CATH topology
1HCGA 1AD8H 1E37B 1O2ZA 1MKXH 3D62A 1GBBA 2FESH 2A31A 1KXCA 5A09A 2ZTXA 4YLUA 3TU7H 4YTAA 1O5FH 5I46H 1QL7A 3Q3KA 4CH8B 1LDTT 1E36B 1S81A 2ZGXH 3RP2A 1QRZA 2ZECA 5F8XA 2BHGA 5L2ZH 1EPTB 2FI4E 1HAYB 3JZ2B 4KELA 1O39A 5TCAA 1UTPA 1D6WA 1SL3A 2Y7XA 1BTXA 3SU1A 3M3TA 3S7KB 3P92A 1SMFE 3GY6A 2A7HA 1L4ZA 2HPQH 3VGCB 2PTCE 1QJ6B 2R2WU 2VVUA 1N8OB 3CS7A 4WY3A 3HKJB 1N6YA 1YKTA 3UOUA 2ZCLP 1FY8E 1FV9A 2BXUH 4I8HA 2BDYA 2V35A 2CV3A 2C4FH 2FS8A 3H7TA 4X8TH 2H1UA 1FIWA 3RXDA 1THPB 3MNXA 3EE0B 4Q7ZA 2HVXA 3QZRA 3K6YA 9ESTA 3V13A 1BMMH 1QBVH 2FYRA 1Z6JH 3SHCH 4Z6AH 2FOCA 1J9CH 5FX5A 1W8BH 1LMWB 1FXYA 3PROA 1ID5H 1O31A 1V2LT 1B0EA 1TA6A 3M7UA 2Y5FA 3SQEE 3SV9A 2AEIH 4XBBA 4A6LA 4ZAEA 1F92A 4X0WU 4HTCH 3M5OA 3VB4A 1NPMA 1G2LA 1TX7A 3RXOA 1WQSA 1EQ9A 2BLOA 1MQ5A 1WAYB 1IHSH 2OD3B 3P8OA 3STIA 1WQVH 3SOSA 3BIVH 3A8AA 1CHGA 3SZNA 3VB7A 1S82A 4R0IA 4UFEH 1YCPK 5GCHG 1HDTH 1C5MD 1TGBA 1Z1IA 3KF2A 1KLTA 2GMTB 3SU0A 4OGXA 1V2ST 1TQ7B 1P05A 1FDPA 2HNTF 2VH6A 1FJSA 4JZIA 3GICB 4OS4A 1MCTA 3L33A 1QBOA 1L1GA 1AE8H 3ODFA 1WYKA 1ZHRA 4GCHF 1CGIE 1DM4B 3AVZA 5F03A 1AZ8A 1TBZH 1TBRH 3S9BA 1V2QT 2QC2A 1MKXK 4ISIH 1FY5A 1QTFA 2HNTC 1PPFE 2VGCB 3UWJH 4D9QA 7GCHF 3SORA 1CBWC 2ANYA 2P59A 1IQLA 2BVXH 2SGEE 2JETC 3LU9B 1NRSH 1GHAG 1AUJA 2CMYA 1A3EH 2VU8E 1LVMA 2WPLS 1AY6H 5C1UA 3PTNA 5JBTA 1OWHA 1BJVA 2AIPA 1GDQA 1V2WT 1O3PB 1INCA 4ZROA 4X2WA 3K65B 3NK8A 4BANB 3U8TH 3D65E 1IOEA 2VIVA 3GDVA 1O2TA 4NSYA 2BD3A 2WYJA 1UK4A 1G3EA 2ZGJA 2W3IA 3OTJE 2HPPH 3SV6A 2H9HA 3MWIU 1GI8B 1UVPA 4ZHAA 2HOBA 1OKXA 1IQKA 2BLWA 2RA0A 3BTKE 2F9BH 1Y8TA 1ESBA 1C5ZB 4YZUA 4NSVA 1P2NA 2TGPZ 2PKSB 1C9PA 3ESTA 1TPAE 1K21H 4B2AA 1K1MA 1UTOA 3MI4A 1DT2A 1EOLA 4IBLH 3LC5A 1O3LA 3VB5A 4MVNA 2ZC9H 4ISHH 1SGQE 5A0CA 1H4WA 5T3HA 2ZU5A 2LNCA 2QXHA 3KNXA 3GCTG 1W11U 1W14U 1YLDA 2AGIX 2B0FA 3A89A 4CRFA 2G4UA 3U98H 4CBOA 1EP5A 1VITH 2P3FH 1XM1A 1AWHB 3QLPH 4K8YA 1F2SE 2ZDNA 1GHWH 1V3XA 5EQQA 1O2QA 4UE7H 1EB2A 1F5KU 1ANBA 1T4UH 1EKBB 1W7XH 2ZGHA 4INLA 1O3AA 5A0BA 2Z94A 3A7TA 1K9OE 3KGPA 5EW2H 4AG2A 3LJJA 5ESBA 2GT8A 2XC0A 1DY8A 1SG8B 1O5EH 3HGPA 2FTMA 2SGAA 2ZGBH 4K69A 1TX8A 2NU2E 3PLBA 1XUKA 4CR9A 4Y71A 1IQEA 1O3FA 2BOHB 2A4OA 2G51A 1C5XB 2XWBI 4A92A 2PR3A 1HB0B 4ZXXH 1TAWA 1T32A 1J8AA 4ZKRU 4U2WA 4MG3A 1O2HA 3BTWE 1AWFH 2PKAA 4E05H 1DUAA 3DFLA 3UY9A 3ZZ9A 5EQRA 1GCTC 3BEFB 2CN0H 2VVCA 4Y10E 2FDAA 5DP6A 3SI3H 3OSYA 5F8TA 5CHAC 4YOJA 4K3JA 3HK3B 1GHBG 3SW2B 1M9UA 3OY5U 3RU4E 2A1DB 1GI5A 3GDUA 1MTNC 3UREA 2NU0E 4UDWH 1O5BB 2ILNA 1GBCA 1GHXH 2O8UA 4UONA 1MZDA 4GHQA 1EUFA 3GDSA 1WCZA 1C2LA 4INHA 3GCHB 1ELFA 1QRWA 4Q7XA 2V6NA 1O3CA 4Y76A 4MNXA 5E2PA 1EX3A 5DG6A 2ALVA 4ABDA 1HAZB 1PQ8A 3ZVAA 1BMLA 1LO6A 3STJA 1GBTA 3PM3A 1DSTA 1TMTH 3RXEA 1HUTH 4ZHMU 1ZJKA 2P8OC 2GP9B 1H1BA 5L30H 4LZ1H 5E0GA 2R9PA 1YPEH 3P17H 3TH2H 4INKA 4WWYA 4XSKU 4UD9H 1ELAA 2ANWA 3BSQA 1SHHB 1YBWA 2WPJS 3NKKA 3M61U 1TABE 2BDBA 5C1YA 3RXJA 4NIYA 1A0HB 2BXTH 4RN6A 3S7HB 2ZFSA 1KXBA 5E0JA 1K22H 4K1EA 1TRMA 3ITIA 4NIWA 3P6ZB 2D26C 1Y59T 1LKAA 3FZDA 4LK4A 1MKWH 1MQ6A 4X1NU 1EXFA 1GJBB 5IDKA 1LQEA 5F8ZA 1A5GH 5T6DA 1RGQA 3BTFE 3VB3A 5SGAE 1MAXA 1C5LH 4ZH8A 4CBNA 1ELEE 1TLDA 1PQ7A 3C1KA 1GI6A 4ISNA 4FUEA 3HPTB 1G36A 1C5NH 1SOTA 4Y0YE 1GWAA 4WXVA 2STAE 3NZIA 1VJAU 1H8IH 1W2KH 2B9LA 5L6NH 3KL6A 3MH6A 5E2OA 2FM2A 1Y5BT 1UVTH 2TPIZ 1NN6A 3FP7E 1JIRA 3A7VA 4TYDA 3F68H 3PB1E 4CRCA 1UTJA 1MTUA 1CA0B 3A87A 4X2YA 5GWZA 1K1JA 1P2IA 2F83A 1O2GH 3E3TA 3PMHB 3RXTA 1HV7A 1HIAA 3MU8A 1JWTA 3SNEA 1LVOA 1QNJA 5GJ4B 4GLYA 1GHVH 4ASHA 1CVWH 1KXDA 1MD7A 2WUBA 3TGIE 3EGKH 1QHRB 3ENSB 3QX5H 2BD4A 1OWEA 3DFJA 4Y11E 1HAIH 1WOFA 3V3MA 4E06H 3RC4A 1GI4A 5DKMA 4TWWA 2OBOA 3E0PB 1A5HA 2FLRH 3UPEA 1MH0A 2ZIQH 1O3OA 2ZU1A 4I31A 4ZHLU 4A7IB 3RXFA 1BMNH 3LPRA 2Z9JA 4AORA 1PQAA 3T27A 2QY0B 2WPIS 1GJ7B 2BZAA 1G9IE 3TJOA 4SGBE 5HGGA 1YPLH 2XBVA 3O8BA 5AFYH 2XXLA 5FBIA 3G01A 2A4QA 3LOXA 5H4IB 1BTYA 3TNTA 4ABGA 3A82A 3SN8A 1RTFB 5EQSA 1P9UA 4MQAA 1KXEA 5C3NA 3MHWU 2STBE 4D9RA 3D49H 1UVOA 4JYVH 1ANCA 4Y8ZA 2P3UB 1DANH 1CHOF 4I32A 1GMCF 2TGDA 3LGTA 2BQ6B 1HIAB 3LDXH 3A84A 3BF6H 1DOJA 1SGTA 2O9QA 3CENA 5LGOA 3UQVA 1ORFA 3Q3XA 3RXHA 1G3DA 2A7CA 1YCPM 2J95A 1NU7B 1Q31A 2FP7B 3AW0A 3SU3A 3VPKA 3ZZ3A 1KXAA 2A0QB 5T6GA 4AFQA 1HJ9A 1BRBE 5J4SA 2GZ7A 1Y3WA 1ELGA 2P93A 4K60A 2UUFB 1O3JA 4ABEA 1P02A 1WSSH 3JZ1B 2BVRH 2PGQB 3SV8A 4AFZA 4MDSA 4BTIB 2FOBA 5HMAA 4Y8XA 1HJ8A 2A4GA 4GUXA 1DFPA 1SI5H 4E7NA 1W7GH 5FAHA 1S0QA 2GCHF 2ZI2H 5HM9A 3LIWA 1HJAC 1QQ4A 1TB6H 3E90B 2ZDLA 2XRCA 1HNEE 4I33A 1KIGH 2ZGCA 1DWCH 4CREA 3ZVFA 4DG4A 1QFKH 1FY3A 2AMDA 2ODQA 3MH7A 3QDZB 4NIXA 1KTSB 5DO4H 1NFUA 1O35A 5A8YA 5J4QA 4IC5A 3UNQA 4H4FA 1A4WH 1ZTJA 1VITF 4MPVA 1CBWB 1WTHD 2AGEX 3SV7A 4FUCA 1EOJA 1JBUH 1DWDH 1C5TA 2C8WB 3M5LA 7LPRA 2FXRA 1E38B 3ATWA 3SUDA 4K1TA 1GMHF 3RXBA 1O3KA 3M3SA 1OP8A 1KXFA 1W3CA 1AKSA 3T26A 1EAIA 1NRPH 2AGGX 4B74A 4CRAA 1ZPCA 2TGAA 3FAOA 2F91A 9LPRA 1BHXF 5FCRA 1OPHB 3FP6E 3GY4A 4Y6DA 3SUEA 1YPHE 4MPXA 1PJPA 3K6ZA 4JK6A 1YCPH 1GBEA 3MO6A 3UR6A 3GISB 2Q1JA 2A45B 2R0KA 2ANKH 1O2MA 1NC6A 5FPTA 2CHAC 4DOQA 1P9SA 1VGCC 1SLXB 4NZQA 1QJ1B 4XDEA 1JMOH 1TA2A 1XUHA 2GV6A 1PPBH 1TBQH 3URDA 1C5RA 2B5TB 2FTLE 1NS3A 1JRTA 3TPIZ 5C1XA 1AQ7A 1GI7B 4MPWA 3BEUA 2IPHA 4WH8A 3RUOA 1SGFA 1P3CA 1MD8A 3I78A 2BD5A 1JIMA 3SNBA 2Q6FA 1AKSB 2PSXA 3GYLB 2H5CA 3ELAH 1ARCA 5JB8S 4KTSA 2Z3CA 1D3TB 3TGKE 1GJ5H 2Q6DA 1SSXA 1KLJH 4BNRA 3LGVA 3Q00A 1HGTH 1A61H 4Y8YA 1OWJA 1ZGVA 1V2NT 5JBCS 1LCYA 1UTLM 2NU4E 1K1PA 1C2IA 3SQHE 3SV2H 2BZ6H 2ZFQH 1FN6A 4ABBA 1C5WB 1YGCH 4AFSA 3U9AH 1ZLRA 1IQJA 3PLKA 1UK3A 1WTGH 4FUBA 4LXBH 1HAHH 3PV4A 1HAOH 4DGJA 1GVLA 3SNAA 3F9EA 1FZZA 2BM2A 3HKIB 1C2GA 1FONA 2BD8A 1L2EA 4RKOB 2OC0A 4PROA 3PWCA 1RTLA 4TPYA 1SPJA 4K5ZA 1MTNB 4F49A 1H9LB 1OYQA 5EPNA 2C8XB 4RSPA 1XVOA 4WXIA 1G37A 1ZHPA 1RD3B 1C1QA 4WF8A 1ZPZA 3Q76A 2OBQA 1V2UT 6GCHF 3DA9B 1C2MA 1H9IE 2EA3A 3ZVCA 3O8RA 1P3EA 3A7WA 4O9VA 1XUJA 3TITA 3URCA 1AU8A 3QGJA 2V3OH 2RDLA 2FOFA 1Q3XA 2P8OB 4WJG2 1F0UA 4YOGA 1NM6A 3BN9A 1UHBB 1GVZA 4Q2KA 4JYUH 1TNHA 1UTQA 4X6OA 3ZZ8A 5EW1H 1DLKB 3F9FA 3WY8A 4VGCC 2PHBA 3PLPA 3RDZA 2HNTE 2HRVA 1EJNA 1GJ4H 3MU0A 4BTUB 5LH8A 1L1NA 2D2DA 1B0FA 4NWLA 3SGBE 3U1IB 1C5PA 2UUYA 3UNSA 1QCPA 1GBLA 4THNH 4YOIA 1XUFA 1A0JA 1O2UA 1SR5C 1NFXA 2A32A 3SU4A 4YM9A 3RMNH 5A8XA 1SGIB 2XYAA 1ZSKA 1GGDC 2ZHEH 3Q77A 3SJOA 4IC6A 3GOVB 1Y3UA 4BOHA 2FWWA 3A88A 4X8SH 1GI0A 1VCWA 5BRRE 4Y79A 1N6XA 1WU1A 4XFQA 4ABJA 2PUQH 1ZRKA 3PMBB 5FPSA 1UK2A 4ZXYH 2BQ7B 1V6DA 2QF3A 5AHGH 3UUZA 1EJAA 1AUTC 4A1VA 1QL9A 2VIOA 1UTMA 2FEQH 2ZDVH 2O8WA 1MBMA 4U01A 1P2QA 1GBDA 1SC8U 3BG4C 1PYTD 4FVBA 4D76A 3FANA 1S6HA 4LOYH 1T7CA 1D3QB 1C1UH 2W5EA 3RC6A 2ZF0H 4BXWA 3TVJB 2EEKA 1YPJH 1P0SH 1C1VH 3ZV8A 3ZYDA 1YM0A 1UVSH 2G4TA 1GDUA 1VR1H 2QIQA 1UJ1A 2UWOA 1DS2E 4TY7A 4B76A 1P12E 2XTTB 2YNAA 3IG6B 2VB0A 4E7RG 2AFQB 2F9OA 1O3EA 4UFGH 1EZXC 2XCNA 3T62A 4DT7B 4CRBA 1O2XA 2QA9E 2ZPSA 1GHYH 2BD2A 4X6MA 5HXFA 4Z0KA 5CE1A 4IS5A 1FQ3A 3RMOH 5JYIA 1FPCH 4H6TA 1FY1A 2NU1E 1DXWA 1CO7E 1P11E 2W26A 1O3MA 2SGFE 1C5OH 1DUEA 1WV7H 6LPRA 1O3IA 2BDCA 3OY6U 2GZ9A 2GV7A 3T25A 1J17T 3LJOA 3UNRA 5DPAA 5JBAS 3ZZDA 2VJ1A 1UO6A 5C2ZA 3MTYA 3M5NA 4MNYA 1PYTC 2C8YB 1BRAA 5A0AE 1KDQA 1XMNB 2RCEA 3RU4D 4BTTB 1ELVA 3BTHE 1QGFA 2XWAA 3U69H 1EPTC 1PPZA 1CQQA 3KN2A 1V2VT 3VXEH 3V0XA 4X8UH 5DP7A 1ZMLA 3TK5A 3LGUA 1BOQA 2FOMB 3KEEA 1RIWC 3SU2A 4JCNA 1J16A 2P3TB 1GJAB 3UTUH 3UIRA 1L1JA 1UMAH 2PFEA 5DP8A 1QB1A 1EZSC 2GDEH 4FU9A 1AO5A 5C20A 2R0LA 2BVSH 3GY7A 1EB1H 1W10U 5DGJA 1GI2A 1MTSA 4TY6A 3TIUA 1P2JA 4FU8A 1EZQA 3IITA 5CMXH 3QUMP 1OS8A 1C2EA 1G3CA 3PO1C 1HJAB 3DHKH 3QTOH 3BTEE 2A5IA 2VWNA 1O2WA 3E6PH 2FS9A 1YPKH 2J9NA 1ZRBA 2I6SA 1MUEB 2Z7FE 1GL1A 1S85A 2J2UA 3R0FA 3TK9A 4JK5A 4NG9H 1HXEH 4ISLA 2QYIA 1K1OA 4YLQH 1KDQB 1O36A 5EXNA 1HRTH 1DVAH 4YO9A 4ABHA 2Y81A 2XBYA 1WUNH 2WUCA 5GCHF 1OWDA 3TJNA 1C4U2 3S69A 1C4V2 3LH3A 3T5FH