3HGWA

Apo structure of pseudomonas aeruginosa isochorismate-pyruvate lyase i87t mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
93
structure length
81
Chain Sequence
KTPEDCTGLADIREAIDRIDLDIVQALGRRMDYVKAASRFKAAMLPERARWAEENGLDAPFVEGLFAQIIHWYTAEQIKYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analyses of isochorismate-pyruvate lyase from Pseudomonas aeruginosa suggest differing catalytic mechanisms for the two pericyclic reactions of this bifunctional enzyme
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
molecule keywords Salicylate biosynthesis protein pchB
total genus 32
structure length 81
sequence length 93
chains with identical sequence B, C, D
ec nomenclature ec 4.2.99.21: Isochorismate lyase.
pdb deposition date 2009-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.59.10 Mainly Alpha Up-down Bundle Chorismate Mutase Domain, subunit A Chorismate mutase 3hgwA00
3NVTA 2H9CA 2VKLA 5CKXC 1ECMA 3REMA 3RMIA 3HGWA 2QBVA 2W1AC 2H9DA 2D8DA 3HGXA 1YBZA 3RETA 2D8EA 2W19C 2GTVX 3TFCA
chains in the Genus database with same CATH superfamily
3RMIA 1ECMA 3HGXA 2H9DA 3NVTA 2E89A 3HGWA 1YBZA 3RETA 3TFCA 2D8EA 2D8DA 2W19C 2E21A 2H9CA 1WY5A 3A2KA 2QBVA 2W1AC 1NI5A 2VKLA 5CKXC 3REMA 2GTVX
chains in the Genus database with same CATH topology
3NVTA 2H9CA 2VKLA 5CKXC 1ECMA 3REMA 3RMIA 3HGWA 2QBVA 2W1AC 2H9DA 2D8DA 3HGXA 1YBZA 3RETA 2D8EA 2W19C 2GTVX 3TFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVT A;  2H9C A;  2VKL A;  5CKX C;  1ECM A;  3REM A;  3RMI A;  3HGW A;  2QBV A;  2W1A C;  2H9D A;  2D8D A;  3HGX A;  1YBZ A;  3RET A;  2D8E A;  2W19 C;  2GTV X;  3TFC A; 
#chains in the Genus database with same CATH topology
 3RMI A;  1ECM A;  3HGX A;  2H9D A;  3NVT A;  2E89 A;  3HGW A;  1YBZ A;  3RET A;  3TFC A;  2D8E A;  2D8D A;  2W19 C;  2E21 A;  2H9C A;  1WY5 A;  3A2K A;  2QBV A;  2W1A C;  1NI5 A;  2VKL A;  5CKX C;  3REM A;  2GTV X; 
#chains in the Genus database with same CATH homology
 3NVT A;  2H9C A;  2VKL A;  5CKX C;  1ECM A;  3REM A;  3RMI A;  3HGW A;  2QBV A;  2W1A C;  2H9D A;  2D8D A;  3HGX A;  1YBZ A;  3RET A;  2D8E A;  2W19 C;  2GTV X;  3TFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...