3HHGA

Structure of crga, a lysr-type transcriptional regulator from neisseria meningitidis.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
293
structure length
293
Chain Sequence
b'KTNSEELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTEEGAQYFRRAQRILQEMAAAETEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEELG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LysR family
publication title The structure of CrgA from Neisseria meningitidis reveals a new octameric assembly state for LysR transcriptional regulators
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription regulator
total genus 69
structure length 293
sequence length 293
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hhgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhgA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhgA02
1G3TA 5CMKA 3WE2A 5D6EA 4IXAA 4RGXA 1V3FA 2PI0A 5AIQA 1MQIA 3LAPA 1R6ZA 5E17F 1BI3A 4UA8A 1MXYA 1POTA 3PGFA 3FXQA 1YIOA 4PGHA 3PPPA 3QPTA 2Y7WA 3MVWA 1DPEA 1ZTYA 2PT2A 5LBQA 4N9IA 3KG2A 3KEIA 4PZJA 4DLDA 1B1BA 1KQ9A 5EEGA 1CF7A 4QRZA 2O1LA 3H92A 5B7DA 3UGWA 1FTMA 3KP3A 3MFKA 1OQHA 3QXMA 1F9NA 2VGQA 1XN7A 1MH4A 1QVSA 1O7FA 4BAYA 2XGXA 1YO5C 5I2KA 5B70A 1Z7UA 2R6GE 2Z8DA 1JVXA 3DP7A 4JDFA 5CM6A 2I3VA 3F72A 4CHUA 1P4XA 4G68C 4R6YA 1R7JA 4XLPF 4E0XA 2CFXA 2FNPA 2FYIA 2PVUA 1EH3A 2HR3A 3BPVA 5DCMA 1MY1A 1US5A 1K78A 4KYEA 4KD5A 1RZ4A 2HKXA 4H0WA 4KCCA 4KYSA 1B5IA 2IJLA 1XVXA 3CUQC 1YAEA 3SQNA 1SFXA 3KZGA 1SI0A 2VT2A 5DUIA 3KZYA 4LQ5A 3H03A 2A5TB 3MW0A 3T9HB 4KT5C 2DVZA 1L3LA 1R5HA 1M5EA 4U1ZA 1NFTA 3KFMA 5LGNA 3TPAA 2J5OA 1US4A 1R9QA 1MQHA 1HSTA 1SAXA 3B6QA 1ZLJA 4YFKF 4WXCA 5F1QA 4M4GA 4NF8B 4R79A 2V3UA 5I56A 1PC3A 1AWCA 3ULQB 3G3HA 2F5EA 1P6RA 5JK4A 3M3LA 5KDTB 3FMQA 2REGA 3G7WA 3IRRA 5BPIA 4NWCA 4LZ7A 4E70A 3HHHA 1FOKA 4Q5TA 2EFQA 3KGCA 3SETA 4AB5A 1YLFA 3E3VA 3UIFA 2FE3A 1AL3A 2PFBA 4DXCA 1JHFA 2MLGA 4AIHA 3OEMA 4HF2A 1IXCA 2JZYA 2XD3A 3QPHA 1MXVA 2CYYA 4ELRA 3PQJA 4OESA 4YKKA 2P4WA 5LLQA 4MTDA 4ESXA 3V5AA 3IJOB 1XMAA 1T6SA 1L5TA 3MCZA 2D2WA 2F36A 1ATGA 2VT3A 3T9XB 3U8QA 2PMUA 1ZBMA 2VD2A 3N6UA 4ZYDA 4YG2F 5BOXA 1ZHFA 2RKHA 2CSOA 1S29A 2L01A 2XD2A 4O3BA 2ZXJA 5IT9Z 2XVCA 5ILUA 1I6QA 5CLSA 1OYIA 5ILVA 1IN6A 1O3TA 3DFGA 3JAMZ 1LBCA 5CMMA 1YS7A 2NRAC 5JR3A 2H6CA 5DEQA 3FF5A 3WGIA 3C35A 1UTBB 1O57A 1D9YA 1Y3QA 1B59A 4F3BA 2KJBA 2ZNTA 1AOYA 4ASNA 2HOEA 1XCBA 3E6BA 4PFYA 4LFUA 1NNKA 3TDUC 3O6BB 3ILUB 1GVCA 1R5GA 3WG9A 4Q5SF 4R9FA 3RTRA 5L9MA 1R1NA 2LDUA 1PDAA 1G6NA 2IPQX 3E97A 1FTJA 4JWOA 4PQJA 2HWVA 2HYFA 4ESBA 4MQ9F 3C31A 1D3YA 3FXRA 2RKMA 3FJ7A 3L09A 4ND9A 3T8TA 4QSEA 2REJA 1CF7B 4EMSA 1UFMA 3RQTA 3KFWX 3T22A 1JE8A 1FX7A 1EU8A 1M5DA 3S9NC 2AYSA 1O3QA 3EHUA 1XGSA 2ONKE 5IT9K 3I5UA 3Q27A 2TDXA 4RY1A 4A6EA 2A5SA 2OLBA 5ICCA 4U7BA 4KYDA 1A04A 5I2KB 4U0WA 5ICTA 5CJ9A 3F8MA 3JAMK 2O7IA 3LAJA 4I8CA 1JXSA 5LGTA 2JPBA 4NF5A 3GUDA 1B58A 1LFHA 3JW4A 1LFGA 2XXXA 4G6QA 5DCMB 2FRHA 1HQCA 2GWRA 1LB2A 4IVNA 2JTVA 2FA7A 1IEJA 1G3WA 3RT6B 2DO7A 1P99A 4CYDA 1B5JA 5IKBA 3SXYA 1GR2A 3ZS6A 3LSFB 2L02A 1R9LA 1ODDA 4C0RA 1YG2A 3FGSA 3AXFA 2BJJX 3GWZA 5J8FA 4RB0A 3PMVA 5JTYB 4BDOA 4BDMA 4OIQF 3P9KA 3BY6A 3R60A 3KEQA 3D4CA 4PFWA 1U6GA 2O68A 4BQAA 3MQ9A 5CC2A 3FJGA 1RKMA 3F6OA 2AL4A 2PBIA 4G7ZF 1FSEA 2P8TA 5EHMA 4L5IA 3CRBA 4M72A 3REOA 3L7WA 4QFNA 5DYMA 3MZYA 2Q2CA 1A54A 4G68A 4ENMA 3V8JA 1HKTA 5TRDA 2OBPA 4UHTA 3KP7A 4F39A 3KSJA 3KLOA 2OU2A 3GX4X 2H98A 2ISYA 4UVAA 2Z23A 5H8NB 3SEXA 4DCYA 1WI9A 2ZXTA 3CUQA 5TP9A 2F97A 2XXVA 5KVRA 1XS5A 3B02A 3TTKA 1URDA 4EF1A 3QYTA 2EFWA 5AA1A 2M1BA 3WTSC 4S05A 3R61A 4JQFA 3G3FA 3K6WA 1LDKB 2RN7A 1Y9UA 4YMBA 1W7PB 1T2KA 2LAOA 1UTHA 2Y7IA 2NXOA 2A61A 2WKYA 4HF0A 1MQDA 4I09A 2GXBA 1M5CA 2K27A 2IT0A 3T8RA 3P7IA 3DP6A 1UQWA 1QUKA 5TPAA 1HXDA 1LVAA 3RYPA 3Q25A 3O97A 1P4AA 1T0FA 4EGYA 4QF9A 3GFJA 1ZRFA 1R22A 3IX1A 1BC8C 1NH7A 2DXRA 4POWA 4EQ9A 1HKQA 2NNNA 4F7ZA 3GZ6A 1S3JA 1SYHA 3V8LA 2XAJA 3IB2A 5DVFA 1WRJA 2DLLA 4KR5A 5F64A 1MM7A 1VFEA 1WDNA 2ALUA 2XX8A 3B7DA 1FTOA 4IHTA 3FX3A 2JPCA 4ZEFA 3VDFA 3LSXA 4I7HA 3E6CC 4YB6A 2EWNA 1AOVA 4Y17A 2XKOA 4BHPA 3RI4A 3GVAA 1IXGA 1PDNC 2ISZA 1DPRA 1H44A 3SEYA 2JRTA 1QUIA 2QS2A 2OBGA 2H25A 3L00A 3I58A 1ZH5A 3TCFA 1QW0A 1QGPA 4L9VA 4GXAA 2QS3A 2M5WA 2XAFA 3ZMSA 3U9GA 2M30A 3TELA 3K00A 4RPOA 4G8MA 4LZ5A 4NTLA 5J1DA 3FVOA 4MBPA 4WWCA 4A5NA 4U1OA 5I57A 1NKXA 4DE8A 1XC1A 3HRSA 5FLXZ 3NRVA 1MM6A 3RT8A 1AH5A 4FAJA 1LAXA 3EHSA 4ECFA 3U2RA 5J8CA 1FCKA 4FJPA 4NF5B 2Y7PA 1I1SA 1SD3A 3FMSA 2D21A 3G3GA 3RKXA 1R23A 1SD4A 4G8NA 2XXUA 4R8HA 4H1XA 3IO4A 4WX9A 4HS7A 4LP2B 2DQVA 5ED4A 3WU0A 2QQAA 2KIMA 1JVYA 3UK4A 2OQGA 2YPRA 2O51A 2E7WA 3PFIA 4NB5A 1ZREA 2KIUA 4KNYA 4GL8A 5I2NA 3GXOA 1V4RA 3OO9A 2ELHA 4E0WA 4N0BA 2ANJA 1UCRA 2QUFA 1J2XA 1XGNA 1YW9A 2LF7A 3V8XB 2FNAA 1LLSA 1QJMA 1QZYA 4LK1F 4WCGA 1RUNA 1LB8A 4I98B 3DV8A 2QMWA 1ZRDA 4ESFA 2DBBA 4C1UA 3EHTA 3IHUA 2DW4A 1IQ7A 4WKMA 5FHMA 3C4MA 3MZ1A 1SW4A 1MG1A 2D5WA 3KP4A 1B4AA 2E0SA 2JT1A 1ULYA 3B6TA 3KN7A 1IXIA 1OIBA 1IN7A 3PQKA 4IF4A 5FLXK 1Y4CA 3R0AA 3CUQB 1U5TB 2RF1A 3LSLA 2W84A 4GF8A 3PUZE 1B51A 3IJXB 1RNLA 4ZYGA 1BLFA 3V83A 2A07F 1Q1KA 1WWXA 1RUOA 4EM1A 1MPCA 3OV8A 5FHNA 2YX7A 1HSJA 3V7CA 1EH6A 3R7XA 5HPQA 2K4BA 3E5QA 4LMYA 1LCFA 4GLIA 1IUDA 5JEIA 2XUBA 4H0EA 5KZTA 1R00A 1LAGE 1P1NA 3ZP5A 4F22A 4Q48A 4YZZA 1QBJA 2P6TA 3R26A 3UP9A 4WXDA 1FNNA 2ZNUA 2ONRA 1MGTA 4ENNA 2PJPA 4F19A 1RYXA 1R36A 4G6DA 3C3WA 3FM5A 4HW0A 2HQRA 3T93B 1JW1A 2XHKA 4M1VA 2V25A 2RQPA 2P1SA 1PB7A 4OZ9A 3F8NA 1B46A 1FQDA 1KQ8A 2A5YB 3RGYA 1MY0A 4QSCA 2KKOA 2A5TA 4F1VA 1O3SA 4LB5A 1FBQA 5ICEA 1MDMB 2V6CA 5HS8A 3TO7A 4RK2A 4GXSB 3K02A 1FWZA 2YPNA 1IRFA 4FX0A 4NF8A 4G7OF 5I58A 2F8DA 1VFDA 4L9TA 2UVGA 4FATA 2ZYKA 2VODA 3FJMA 4FORA 4ESWA 1MJAA 2ETHA 3IOVA 3WTWC 3FD3A 3H6UA 3HRTA 4GYGA 4ENKA 4GVOA 1W5SA 4KMFA 3DXJF 1LQ1A 1LDDA 5DVIA 2Y75A 2CW0F 3QSLA 3I53A 3S4UA 2UYFA 3O9PA 1LEAA 1Y3NA 4FX4A 3MZHA 5M2VA 1WODA 4KUMA 3UA8A 1FP1D 2HGCA 5JI6A 2VONA 3O2AA 4JWXA 3HSTA 4IY6A 4G77A 4I62A 4BDLA 5DYHA 2OQRA 1J1NA 4HW8A 3F3XA 1SFEA 5H20A 4PCQA 4GQOA 2RCBA 3JTHA 3LQQA 1Y20A 3PPRA 3SDFA 4PFTA 4FEBA 2DE4A 3IWZA 4K3FA 1B05A 1BIAA 2O7UA 3O6IA 1TQMA 1G3YA 1SMTA 1ZAOA 4EJTA 3N5LA 2NYXA 3H6VA 4I0AA 1YCJA 5I59A 1WVJA 3TKYA 2RCAA 4IO7A 3C7JA 4Q8RA 1SD7A 4WF2A 2J5PA 3QUJA 5H8FA 5ILSA 5BQTA 3IL1B 2IP2A 1OR7A 1P4WA 1I6BA 4F1UA 2QQBA 2H27A 4FE8A 4LATA 4ZE9A 2KIFA 1OLAA 3WU1B 2L3DA 1TQPA 3RJPA 1PP7U 4XLNF 1T38A 4DNCA 1UTBA 3RLFE 4HAMA 3WTYC 4KYWA 1BN5A 1FTKA 4BDNA 3DLNA 5AA4A 3KJ7A 1FP2A 1B1HA 1BBYA 4I9DA 2ABHA 2BBYA 3HIFA 2DK8A 3KEOA 1I27A 2UXAA 3T9VA 4A0YA 2QM3A 1A55A 1B7UA 3M9AA 1ZMGA 4PP0A 1W7PD 1FYKA 3MAJA 4HX4A 5L3BA 3U92A 5I84A 1DPUA 4NWDA 2F6PA 3ZMDA 5E8GA 3LA7A 3CTAA 3IC7A 2V1XA 4GWOA 4R2BA 1RIOH 1ZU0A 1B7ZA 3RPUA 4UNOA 3BFUA 1XD7A 5L3DA 2QYOA 4QFPA 1OQGA 2XAQA 4NF4A 3DM0A 3O3KA 4PE5B 4R2FA 4RGSA 1H3DA 5DEXB 3PPQA 3E5UA 4A0ZA 2NWJA 4UUVA 2DE3A 1Z1DA 4Y15A 3HCQA 2K4JA 3HHGA 5LEKA 3GZ5A 3J80Z 5HLHA 1B7HA 2DYXA 2P7VB 1SD5A 2PQ8A 1TBXA 1HSLA 1DTGA 1OMIA 4HOBA 3GBAA 1GXQA 4LG0A 2HS5A 4WEDA 3TQLA 2IA0A 1N04A 2O8XA 3P9CA 4UXNA 3L6GA 3T66A 2O84X 4R6KA 4MGRA 5EEHA 2YLNA 4IO5A 4ISUA 4XTCQ 2E7XA 2QENA 1HKSA 1UIVA 2F5CA 1GV8A 1U5TC 3OO7A 3E4RA 1D3KA 2HTJA 1JETA 4G8HA 2Z9OA 4P55A 3TTNA 2ZMBA 5JTYA 4YIIA 4N6PA 3VVDA 4BLAA 3T96B 2BGCA 3C34A 1B6AA 2Q9TA 4U21A 2QZ8A 5D5UB 4ZDMA 3CVGA 4DIGA 3CJNA 4R9GA 4OQOA 3I0TA 3ZSFA 2R71A 5I58B 1LNWA 4YMAA 2Q0OA 2Z33A 3HOTA 1H0MA 2F7AA 2HYGD 2P7CB 4G94A 3TTLA 2AS5F 4EXLA 1RI7A 5CVIA 2MLKA 1TFAA 1FYMA 4ZZEA 1B5HA 1IITA 5E1XA 5D4SA 4JSOA 4GXOA 2EFOA 5H8NA 3S9LC 5CRYA 3LR1A 4IB2A 3A3UA 4KFQA 5FD6A 3FV1A 2DS9A 3PUVE 4HBLA 4EDPA 3C9HA 4GIZA 3CLOA 2X0LA 6PAXA 4F1YA 2F2EA 2QLZA 2HZKA 4ZEKA 5LRRA 2VOPA 3ODBA 3K6VA 5HS9A 3QIMA 1IZ1A 1B9MA 2VBYA 1W7PA 3H3UA 3BBRA 3IB0A 1MJBA 5CYVA 3T5XA 1MD0A 4QSDA 3ZMUA 2VOZA 5E1WA 1LCTA 1YS6A 4O5VA 4IGRA 3CG3A 2D1HA 5I59B 1ZIUA 3UORA 4ZZAA 1QQIA 3FXUA 2VC0A 3GEZA 1NMUA 3SEUA 3P7NA 5H8FB 4F31B 4GL0A 4DXUA 4RAYA 1Y0UA 2HZTA 2EB7A 5HM4B 1I6XA 4HDVA 4OEUA 2DAOA 4H5GA 3QUFA 4QFKA 5LHGA 3IORA 1BIBA 3E9XA 5AA4B 2X7PA 3F8BA 3BJ6A 4K2EA 3WGHA 2EK5A 2ZFWA 1O7LA 3WGGA 1FLIA 3VLUA 2GRVA 4EVIA 4IGTA 4F3GA 3DKWA 4ZE8A 2WTEA 3VE1B 5K1YA 4MQVA 3CO7C 3S2WA 1Y3PA 1TQIA 2W25A 4YIFA 3DQVC 1MXWA 4I1DA 1IW7F 2VE8A 1N7WA 1AMFA 1GGGA 5AA2B 3WTVC 3EETA 1JNFA 2XXYA 1H45A 2ZNZA 4EJWA 1XCVA 2PEXA 2DXYA 2G29A 1CGPA 4NF4B 3RN8A 3VXBA 4UVBA 4Y13A 2AL5A 2K02A 2Z5UA 4U88A 2ZKZA 4LB6B 4YFXF 1IAWA 2DVCA 1QZZA 2XXPA 3G3KA 4POXA 1P1UA 2X7QA 5ERIA 3GFIA 4PDKA 3ZN0A 5AIPA 4KCDA 1MXUA 2THIA 4OEVA 4LG0B 3LA2A 2LKPA 1SVXB 1TFDA 2ZYOA 1MDQA 2P5LC 3IOTA 3MP8A 5K5OA 1LB9A 5EYFA 3L2CA 5CMBA 4B8XA 4BDQA 1KQ0A 5FGMA 3S9EA 4IRHA 1NL5A 3VVEA 1KYZA 1DTZA 1J0RA 3MP6A 3THIA 4ETSA 1O64A 1D8JA 1M5BA 3CSBA 5BUUA 5LRSA 1NNPA 3EQLF 4U7DA 2UZKA 2Q88A 4XRFA 3BROA 3K1PA 3PMWA 3FMRA 3K6UA 3OD7A 1LAHE 1JGSA 3E6MA 3QU3A 2PYYA 1YFHA 2YX4A 1FQEA 2PN6A 3GLBA 5DVJA 2AIXA 4YFNF 4KIBA 4X48A 4F29A 4DXBA 4L17A 3S9MC 3WTUC 1PEBA 1U78A 4EJOA 2R7DA 2BV6A 5FD5A 4ELPA 1A7LA 3OO8A 1REPC 1YQAA 2IRFG 1XSVA 4IO2A 5ICGA 4CGZA 4DDDA 4JBZA 1U5TA 5IAIA 2HCAA 3DP8A 2JSCA 3MBPA 1FY7A 4H5FA 4HQMA 2W7YA 4CXFA 3I54A 3F22A 4G4PA 3TGNA 4MLQA 3N97A 1OYYA 3LBSA 1UB9A 1D8KA 3V89B 4KI0E 1S6LA 2CWEA 4JK1X 3EUHA 2DI3A 4WXJA 2FNCA 2NOOA 1FC3A 1WQ2A 4KN4X 2FXAA 4RA1A 4FEDA 1I1GA 2EJRA 5BMZA 2HEOA 5DCFA 3IRQA 1IUYA 3RPWA 2Y0MA 3V7RA 2O0YA 3W9WA 2DU9A 2R9JA 2DWIA 4NEDA 4RAZA 1ZGJA 5H8HB 1DP7P 1IF1A 2D1VA 3ZQ7A 1OVTA 3E3KA 2OK2A 2XXHA 3DF8A 2VHAA 3MPKA 2DFIA 5LHHA 1ON2A 3E6DA 4HTGA 1LGBC 2G7HA 3JV9A 2ZMEB 4F2QA 1PB8A 4CDGA 3BOQA 2KJCA 2ACJA 4BHCA 2B3FA 3FIRA 4DQ2A 2H9BA 4EF2A 1XDSA 1BKAA 1IN5A 3EN3A 1FSHA 1N76A 2OZ6A 1UHWA 3HYIA 3N4MA 2HXWA 1SW1A 4HV6A 1B3EA 2B0LA 3K9TA 2OA4A 3U93A 1VSOA 4CO8A 2MH2A 4XKRA 2XIGA 1MDMA 3KBRA 3Q26A 1F4KA 4MNUA 4R74A 3K1MA 3CI8A 3CUOA 4LZ8A 3WTZA 4X1BA 3SEWA 3H3ZA 2I4BA 2RGVA 2K86A 3BPXA 3FZVA 4RPNA 2QQ9A 1IRGA 5AA3A 2GA2A 3FWEA 4U4SA 3RTFB 4OIPF 4LQ2A 5H8QA 2GFEA 4YICA 5DDGA 3J7AO 3C36A 4KA4A 3DEUA 1TW2A 4Z2YA 3LWFA 2EV6A 2HQ0A 3N94A 2D45A 5CVJA 3U1DA 1MPDA 3FM3A 2FBKA 3ZMTA 4QFLA 3ZKLA 4OHNA 2GHAA 1Z7ME 3MP1A 3M1EA 3O29A 1W4MA 4P5OA 2I49A 4U23A 1KA8A 4IRIA 3R0JA 4YKPA 2QWWA 3RYRA 5CVUA 3SZPA 4L5JA 1OVBA 2NAZA 2WWYA 2UYEA 4R73A 1DDNA 3NQOA 1LEBA 4KPTA 1L0OC 3L9FA 1B3LA 4EQBA 3HUGA 4EXKA 2H94A 1QKBA 2O6GE 5H8SA 2LF8A 1B4ZA 5FB2A 2VD3A 3IOWA 1GVJA 2DK5A 2RVCA 1VE4A 1PBQA 3F23A 2IA1A 2DE2A 3ECRA 2FSWA 1TW3A 4DZ1A 1AIVA 4F18A 3M8EA 4UV8A 2YR2A 3I59B 3EYYA 2DT5A 4RGRA 5E8IA 4Q4ZF 4OFOA 3S2VA 4M9XA 1TXFA 2XV4S 2O61A 2PMSA 1LAFE 1SDXA 2G9WA 3RTWB 3TCGA 3TKDA 2UXXA 4NQWA 1PP8F 3HHFA 2IW5A 2PMHA 4A0XA 1EZOA 2YU3A 1P1WA 1ZG1A 1BI0A 1DMBA 2O6AA 4OMZA 1OKRA 1LFIA 5IT3A 1HBXG 5L3CA 3W6JB 3KETA 2ESNA 3VFZA 4EV0A 1IIWA 3GLXA 3K2ZA 3ISPA 3ERED 4EUOA 1JW5A 3A09A 1R1VA 3C1DA 2PG4A 4OFJA 5DEXA 3W15C 3MZ9A 3JTGA 1LSTA 1BI1A 5A2QZ 4LLGF 4A5MA 1XOCA 4N9HA 1ELJA 2A6EF 1P1QA 1BTJA 3GO5A 1MQGA 3OO6A 5CI5A 1YYVA 1KU2A 3JSOA 2Q8JA 4HA8A 4G7HF 1SW5A 3OMBA 2F35A 4ELQA 4MTEA 4PFUA 3TOAA 4LUBA 1USSA 4HDUA 3QK6A 2QPQA 1GTKA 2PBWA 2C6YA 2Y84A 4FHTA 3T1BA 5LHIA 4XBFA 1BJAA 1IXHA 1I69A 2YJPA 3O6HA 5AA2D 3LUYA 4KDPA 1MY2A 3ECOA 4YAHX 5TU0A 1YPNA 3GW2A 1Q35A 3RDIA 3JYRA 3I3VA 1S9TA 3OSQA 3NEUA 4R6HA 2OWTA 3DP4A 2EV5A 3H06B 2FMYA 2D3IA 1H43A 2OCUA 3DPTA 4I2OA 1MY4A 5ICFA 2MD5A 1NH8A 2VE9A 3PD9A 3EPEA 3IOUA 3WAEA 2GAUA 4DCXA 3PU5A 5H8QB 5A2QK 1SD6A 1FZPB 3MC2A 4LD5A 3MUQA 5KCJA 4MFIA 3D0SA 3V7SA 3RKYA 1PB9A 5CVVA 2XAHA 1DPPA 1H9GA 3PMXA 1CE2A 1I6AA 3VEPA 2M8CA 4A2UA 5CVRA 3PV0E 2STTA 1B40A 5E18F 4Z7EA 4FIMA 3TYHA 2DWHA 3HSRA 3GYHX 2V3QA 3R4KA 3BKIB 4L0YB 1FBSA 4KFCA 2EA2A 4LA9A 2F5XA 3T0YA 2UXNA 3RIRA 2HQNA 4P9FA 3KP5A 1TWYA 3QAHA 2H6BA 5A5XB 2R3SA 2VOOA 1XVYA 2CGPA 5DD8A 3VLWA 1B2HA 4LLLA 1ZRCA 1ZKBA 5FFXA 3Q29A 4MF3A 2M8EA 3MQ0A 4CZZA 3CFZA 5J6XA 3JSPA 2RV8A 1NNTA 4O6JA 1QO0D 1NNFA 3K0VA 3IKVA 3QP6A 5DD4A 5HDKA 3MZBA 2M45A 5L8DA 3CSGA 1Z6RA 3OOPA 3H7MA 5DUKA 4EQ7A 2OZZA 2RINA 2RC8A 1CB6A 4MEXF 1FT9A 3TO6A 1N84A 1DUXC 3C32A 1J5YA 1BC7C 2ZJ2A 5KK1A 3RY3A 3I6VA 4AD9A 1K6OA 3IK6B 3K1NA 1SW2A 3Q28A 5AONA 1FTLA 1P1OA 1Y4TA 2I0BA 3VB2A 4HV5A 5AA2A 1URSA 2GHBA 4EM2A 3N26A 5HOOA 4BDRA 3KOTA 4WK8F 3G3IA 2BEOA 2HTSA 2UWMA 4QLCU 4LK0F 3FHZA 1F9BA 4OFLA 1MZBA 1LJ9A 4HCYA 2WV0A 1U3EM 1TLHB 2I48A 1J59A 2AXLA 4EGZA 3SESA 1WSUA 4FT8A 3EQ1A 2E1NA 4Q47A 2V3TA 3E13X 1Y1ZA 1B52A 3PUWE 4RXLA 2M87A 2QL3A 2L4MA 2DWAA 1W5TA 1SBPA 1USTA 3F8FA 3BZ6A 1UHMA 1DSNA 1BIYA 3OXNA 5D8LB 2GQQA 1D4NA 4LVQA 4OOIA 4O3AA 5CMCA 3K4UA 4XKPA 3TZAA 4X9TA 1Z9CA 2W24A 3CR9A 2V1DA 4L0ZB 3TFLA 3AAFA 3JZJA 3LC8A 1OLCA 2QJEA 1Z91A 4KN7X 2QVOA 5HDNA 3HSFA 2IEEA 3LQRA 3M8UA 1LDJA 4HX8A 2CMOA 2HAUA 4JXIA 3HOSA 1MPBA 4GFRA 2H4IA 3HRMA 1E2XA 4ZYHA 1EH8A 1XGOA 1XMKA 2L4AA 5LGUA 4QWQA 3M3FA 4WEPA 1ANFA 4XIGQ 5HS7A 3OSRA 3I5OA 5E20A 4P0IA 3TODA 2BYVE 1ZYRF 4ZEIA 1XSXA 2Q8KA 1KU7A 1FQFA 1J9IA 4GYIA 3J80K 3F6VA 5KCJB 4KQPA 1ON1A 4H8JA 1LBBA 3G3ZA 1IN4A 1IN8A 2I6EA 2L54A 2B65A 3M7GA 2BE5F 3TDJA 1YTVA 4NF6B 1JEUA 5CBRA 2B3BA 1XB4A 1K7AA 3VVFA 1TNTA 1QULA 4KMUX 2QS4A 1E17A 1H9TA 3A3CA 1FQCA 2GXGA 3BDDA 1KWHA 1QNTA 3K69A 3COAC 4TV7A 2XROA 3MVXA 4Z0IA 4ZZLA 3HRUA 2O69A 5FTHA 4L9JA 4L18B 1USYE 3KN8A 1T39A 4THIA 3TTRA 4QFOA 2OAZA 2Z99A 2DP8A 5TJJA 1JQFA 2Z8EA 2YSRA 4RGUA 3ELKA 4G8XA 4OU0A 3OENA 1H76A 1O63A 5H8HA 2EFNA 1R1TA 3PUXE 5ELVA 3TQNA 3MVZA 1B32A 5K5RA 4OWDA 4H65A 1GXPA 3TUSA 2ZMEA 2NVUB 3WE3A 3VV5A 4F2OA 4KICA 2ZYNA 4RB3C 1MKMA 3FVNA 1T98A 4EM0B 3WODF 3IL2A 1BP5A 4P0GA 3IB1A 2COMA 5D8KB 4OENA 2LNBA 3G3JA 5ITOA 4OIRF 4YKJA 1JW4A 2CZLA 1QKAA 3V8KA 2MH9A 1Z6TA 1Z7NE 4JB7A 3FV2A 4OMBA 4LONB 5AE4A 3VFJA 3MEXA 2GH9A 3B6WA 3U1OA 1KYWA 3I71A 4M9ZA 2QBYA 1VTNC 1MXXA 1ZARA 2G7UA 1B9NA 3CIJA 2F5FA 1S7YA 3KZZA 4GRKA 1P2FA 4PGGA 3EF7A 1XGMA 3B73A 1ZLQA 2EV0A 2RC7A 4I02A 4S04A 2UVJA 3R6SA 1FW0A 3KN3A 2V9VA 4EJUA 3PD8A 5D6FA 5HVQC 2DTRA 2RNJA 2V84A 4C1TA 1URGA 5FTIA 2NS0A 3WTTC 2HAVA 2V79A 4H6DA 3TOBA 4AWXB 3KCCA 2K7LA 2ZYMA 4XSZF 4UACA 2PLYA 1BM9A 3KE2A 4O3MA 2R7FA 4OIOF 1EZ9A 1RYOA 3MVYA 3M3KA 3QAXA 4AIKA 1FBUA 1TTYA 2E1SA 3E5XA 4HLYA 4ELOA 2XRNA 3K01A 3KP2A 2XHDA 2CG4A 5L9OA 2NNYA 1S7AA 1K78B 1ZLKA 4OERA 1S50A 3MJNA 4EQQA 4ZYEA 5LEJA 3IR1A 2PX1A 2H99A 3EYIA 4LLNA 1ZJLA 5ISUA 2F5DA 2ZNSA 4HLXA 4HYEA 1GHCA 3I4PA 4IO4A 5ICQA 1U2WA 3I59A 3TMGA 3U72A 1B4HA 2A69F 1UIUA 2O3FA 5JHUA 2XKPA 1A40A 3RUMA 4TLMB 4AQ4A 1MS7A 4XSXF 4EJVA 2E1CA 3DELB 3FASA 3SKPA 3T9UA 3N6TA 5I56B 4M71A 1D9VA 1O3RA 4R72A 4XKNA 4JBAA 1S8NA 3KJTA 3FVGA 2F7CA 4U0VA 3KLNA 3OEKA 1I5ZA 1EH7A 2FF4A 3D4GA 4ZS9A 1WKMA 2HFHA 2PT1A 2DQRA 4Q30B 4P11A 2VBWA 3WTXC 4A12A 2HEUA 1OPCA 4I0BA 4RK9A 1ZG3A 1G4DA 1HW5A 2CO5A 2RC4A 4NHJA 2Q2AA 1POY1 1SFUA 1MRPA 5F1RA 4ZZDA 2H09A 2DOJA 2ZBKA 1G3SA 4LJZF 1Q1HA 2F34A 5K2XA 3VLVA 1F5TA 2P0SA 1JEVA 4UVCA 5L3GA 2P2AA 4IO6A 4L9NA 3QU6A 2DPDA 3K6XA 4BYYA 1FQBA 1F1ZA 2XASA 2ADUA 2Z8FA 3SERA 1VR5A 3H6WA 4PETA 5JFRA 2XXIA 5H6RA 5EHSA 3TDZC 2GA1A 1MJ9A 2Q89A 3L6HA 3K2DA 3UN6A 1ZG5A 1SYIA 4IHSA 1A8FA 2OWSA 4YB7A 4LGWA 3ZPLA 3RNNA 3I64A 3RKWA 2MBFA 1ZN2A 5F6FA 2QRYA 2FU4A 2QS1A 2VN2A 5HLGA 1O7TA 4O3CA 1R58A 2FBIA 5K5QA 4GO1A 2Z3YA 4IY5A 2RC9A 4FECA 2X4HA 1C0WA 2ZO4A 2GZWA 4TQUQ 3GFMA 5F7VA 5BWJA 1YW7A 3ZN1A 4JWYA 2QBYB 1N0TA 2W85A 4F3SA 2OZUA 4N13A 1ZGAA 3HTUA 5D4RA 5ITPA 3ZMZA 2Y7KA 4ZEDA 1MQJA 3HPIA 4ZEBA 5LOMA 3BJOA 4MLVA 1MXZA 2DWJA 3CFLA 5DV5A 4A6DA 1BI2A 4ONYA 4ZH4F 1QUJA 5BPDA 3VOEA 3EDPA 2W57A 1Z05A 5H6QA 1J7KA 3HTSB 4B09A 1HW2A 3ECHA 3GFLA 2I0CA 1M5FA 2FBHA 2EA4A 4YU0A 1XSDA 4R1HA 4U0YA 3CG1A 2VBZA 1EV7A 3HO7A 3PPOA 2ZCWA 2MC3A 1B3GA 3Q5FA 2IA2A 2MA3A 2IVMA 5A5XA 3H6TA 4OVJA 1A8EA 4P9UA 4OTEA 4IPAA 1II5A 3HN0A 5HBCA 4I01A 3VXCA 4RJZA 2V1UA 5L9SA 1B9JA 3ROUA 4KHZE 4AIJA 3M8FA 3LA3A 4IJAA 4M74A 4JSDA 4U4XA 4KIGA 2GIVA 4OMYA 4OETA 4RYAA 2RDPA 1R1UA 2XX7A 3O28A 2FOKA 3QRFF 4Q0CA 1HW1A 3TAJA 3BP8A 2F7BA 2V93A 2P5VA 2XAGA 2FEZA 3GF2A 4RB1A 3TCHA 1YTYA 2LSOA 3LFKA 2O03A 4H8IA 4HX7A 4D0PA 3TQWA 3MWMA 3BWGA 3Q9VA 3OELA 3QOPA 3R6UA 4G68B 2A6HF 3LSTA 3ZMVA 3MPLA 4HCWA 4X1DA 3GZGA 2KRFA 4TLLB 1NHAA 4P96A 2FA5A 2XXTA 2ESHA 5DT6A 3CFXA 2HKOA 5JVTA 3D5LA 4G2ZA 1B0HA 3TO9A 3C33A 3ABUA 2IA4A 2O1MA 3H4ZA 3QP5A 5TP9B 4GD5A 3PUYE 2F6GA 1J75A 1N3WA 4KIFA 1BOAA 5L3EA 4GOTA 4NMYA 5D5XB 2G93A 1B1XA 3W6KB 5BS6A 1B3HA 4XKQA 3BFTA 3C18A 2UVIA 4IRGA 5E1ZB 4IO3A 4WXHA 3FVKA 2NUVA 2QSXA 3J81Z 1B6HA 4MEYF 1UTHB 1KU3A 4BHBA 5D5WB 3Q9SA 1JHHA 1T0KA 2HDCA 1SI1A 3IKTA 3IWFA 4M6YA 4BH9A 2WC2A 5TPAB 3ML6A 3TTMA 1OMPA 3RPQA 1STZA 1SQYA 4N07A 3U94A 1ONVA 4TOZA 1FQAA 4ON0A 4BXUA 3G73A 3IO6A 3F11A 3BJAA 4AB6A 3O6GA 3SHFA 3MAMA 2ZNYA 1KGSA 1DOTA 4AVPA 2DPUA 3CO6C 3KSXA 5CBSA 1P92A 3O66A 2Y48A 3F21A 4XXUA 3P9IA 2VBXA 5D5VB 3WAFA 1A99A 3MWBA 4U2RA 3LSWA 4HF1A 4M6XA 4OINF 3OOAA 1S7OA 1B0LA 3F8CA 2A68F 1XT8A 1IXSB 3TEPA 4RB2C 3J81K 4OXVA 3ONMA 3DPLC 3VODA 2I58A 4YB5A 1TT1A 1PUEE 2XXQA 4OYVA 2CQKA 5FHOA 4HZFA 5KDTA 2STWA 1B3FA 1HSEA 2FQ3A 1MY3A 4NF6A 4G9YA 3O2PE 3H3GA 4R75A 5K2YA 5L3FA 2P5KA 3GBBA 2QMXA 5I57B 4MH5A 3FATA 1IXRC 4F3PA 2ONSA 2Y7RA 4MHGA 3SEVA 3USDA 4CICA 4ZECA 2FMLA 1USYH 2UVHA 4M9SA 3SZTA 3W9VA 2XX9A 2EFPA 1Y1MA 4H67A 4M73A 1OYWA 2OJTA 1N7XA 1MDP1 2XXWA 5HDGA 1D5VA 3HV1A 3IAZA 5FFZA 1K79A 4NE4A 2VXZA 1QPMA 5HLIA 2XXRA 1YW8A 4ENJA 1XDUA 2VC1A 2Q2EA 5I2NB 4GGGA 4RS8A 3PPNA 2X26A 3ZKKA 2F78A 3ABTA 2I4CA 2DSFA 2HFBA 3ILTB 2VP1A 2H5YA 2A3SA 2P6SA 1X3UA 1MH3A 3HSEA 5DTBA 3CDHA 4RNSA 1SMYF 3FUZA 2HZLA 4ESJA 4UV9A 4U22A 3V4GA 5FO5A 3GXAA 1FPQA 2Z22A 3KOSA 1PBPA 1N3XA 1U8RA 1EZPA 4QHQA 3KP6A 1TNSA 2OD5A 4BNCA 2KLFA 4HQEA 1FYLA 3SFZA 2DQLA 1KU9A 4GCVA 4YKIA 1XHYA 3K0LA 2I3WA
chains in the Genus database with same CATH superfamily
3K4NA 1G3TA 1Z3YA 5CMKA 3WE2A 5D6EA 4J00A 4IXAA 5B5EC 4RGXA 1V3FA 2PI0A 1N25A 1Z0XA 4ZJZA 5AIQA 1MQIA 2O7OA 2XDVA 4PFIA 3LAPA 2HQAA 1R6ZA 5E17F 1BI3A 4PCDA 4UA8A 3LNQA 1FPDA 1MXYA 1POTA 2F4IA 3PGFA 3FXQA 2M9HA 2R8TA 1YIOA 4PGHA 4BQNA 3BQYA 3QPTA 2EPFA 4AM3A 3DEEA 2Y7WA 3MVWA 3PPPA 1DPEA 1N77A 1ZTYA 4HNUA 4I6ZA 2PT2A 4X6AJ 2KMUA 2K5CA 4LN5A 5LBQA 4N9IA 3KG2A 2X1CA 3KZIC 4PZJA 1B1BA 1KQ9A 1LVKA 4GFBA 3KEIA 4DLDA 5EEGA 1CF7A 4QRZA 2O1LA 1PJRA 3H92A 2CMPA 5DS9A 3UGWA 5B7DA 1FTMA 3KP3A 3MFKA 1OQHA 3QXMA 2LG4A 4XIDA 1F9NA 2VGQA 1XN7A 1MH4A 3QWLA 2M0CA 4NF0A 1QVSA 2ZXHA 1O7FA 4BAYA 3DBRB 2XGXA 2ZC2A 3W6VA 4DI3D 1YO5C 5I2KA 3ONQA 5B70A 3ZQFA 4E7ZA 1FIAA 1Z7UA 1A31A 4Y52J 1JVXA 3DP7A 2R6GE 2Z8DA 4JDFA 5CM6A 2I3VA 3F72A 4CHUA 1P4XA 4G68C 4R6YA 1R7JA 3JR9A 4XLPF 4E0XA 2CFXA 2DT7B 4A3GJ 2FNPA 1HDDC 1RKWA 2FYIA 3JRCA 2PVUA 2DDAA 1EH3A 2HR3A 3BPVA 1W5CC 3BTLA 5DCMA 3PSIA 1K78A 1MY1A 1US5A 4NG7A 3ZOBA 4KYEA 5F27A 4CZCA 4KD5A 2O8KA 1HDPA 1RZ4A 2HKXA 2JK3A 3BTCA 4H0WA 4KCCA 1B5IA 4KYSA 1LFPA 2IJLA 1IUFA 3CUQC 1XVXA 1YAEA 3SQNA 1SFXA 4H4KC 3KZGA 4XORA 1SI0A 2VT2A 2EZKA 5DUIA 2H8WA 4HSRA 3KZYA 3HOUJ 3H03A 2A5TB 3MW0A 4LQ5A 3T9HB 1ETYA 4MNPA 5CPRB 2F5VA 4KT5C 2DVZA 1WJ5A 1L3LA 1R5HA 3H3VK 1YIJI 1M5EA 4U1ZA 1NFTA 3KFMA 3ERMA 3AG3H 5LGNA 3TPAA 2J5OA 1US4A 1X19A 1R9QA 1MQHA 1HSTA 1YYZA 1SAXA 3B6QA 1ZLJA 2JUCA 4YFKF 1RR7A 3EUHC 4WXCA 5F1QA 1HOMA 4M4GA 4NF8B 4R79A 2K9NA 3GTPJ 2V3UA 5I56A 4XN3A 1OCCH 1PC3A 3OIQA 4ABZA 3CC4I 3TP0A 1AWCA 2HPMA 3ULQB 3DBLB 3G3HA 2XC7A 2F5EA 1P6RA 4AS5A 5JK4A 3M3LA 5KDTB 3LMMA 1X1CA 3FMQA 3K4LA 2CUFA 2REGA 4B4CA 4DYQA 3IRRA 3G7WA 5BPIA 2CW8A 4NWCA 3OR2C 4LZ7A 4QIWN 2E5NA 1T0FC 1BW6A 1ETXA 3HHHA 4E70A 1FOKA 4Q5TA 2R7QA 2EFQA 1MMSA 3KGCA 3SETA 1OFCX 4AB5A 1YLFA 3E3VA 3QYBA 2FE3A 1VQPI 4BGDA 1AL3A 3UIFA 2PFBA 1TT5B 2NVYJ 3D1RA 4DXCA 4LG3A 1JHFA 1NG6A 2MLGA 4AIHA 4CH7A 3OEMA 4HF2A 3CHGA 1IXCA 2JZYA 2JUGA 2GXAA 2XD3A 3QPHA 1MXVA 2CYYA 4IO9F 4ELRA 3PQJA 3HOYJ 4OESA 4YKKA 2P4WA 4BJ6C 5LLQA 3PO2J 1RDXA 4MMPA 4MTDA 4ESXA 1X58A 3V5AA 3IJOB 1XMAA 1T6SA 1VFCA 1L5TA 3MCZA 1ETQA 1W1WE 2D2WA 4DBQA 3DU5A 5T3JA 2F36A 1ATGA 2VT3A 4BDYA 2DTZA 3T9XB 5B3SH 3U8QA 1BR2A 2EH3A 2PMUA 1ZBMA 2QVUA 4ZYDA 2VD2A 3N6UA 4YG2F 5BOXA 1ZHFA 2NVQJ 2R7TA 2RKHA 1RESA 4ZDOA 4PJ0C 2XWIA 2CSOA 3HC7A 1S29A 2L01A 4IHWA 4C2UA 2XD2A 4O3BA 2ZXJA 3BQZA 3S16J 5IT9Z 2XVCA 5ILUA 1TC3C 3DCFA 1IMFA 1XG1A 5E3OA 1I6QA 5CLSA 1OYIA 2DMUA 3B50A 5ILVA 4PC9A 1IN6A 1O3TA 3DFGA 2IGKA 3JAMZ 2M4KA 1LBCA 5CMMA 1FOWA 1YS7A 2VI6A 5HNFA 1YZ0A 2NRAC 5JR3A 2H6CA 1NI9A 4NN3A 3AKZA 4IR8A 5DEQA 3FF5A 5FRNA 4V2GA 3WGIA 3C35A 3CQZJ 1YE9A 1O57A 1D9YA 2VPRA 1UTBB 1Y3QA 1B59A 4F3BA 2KJBA 4PSWA 3KC1A 4XLAA 3HDDA 1OCZH 3QODA 2ZNTA 1AOYA 4ASNA 3GTQJ 1WPKA 1NTCA 2HOEA 1XCBA 4GRIA 1MIJA 3E6BA 1SFOJ 4PFYA 5A5LA 4LFUA 3S93A 1NNKA 3TDUC 3LSRA 3O6BB 3ILUB 1GVCA 1R5GA 2R93J 3WG9A 4Q5SF 4R9FA 3RTRA 1P7IA 5L9MA 1R1NA 2E71A 2LDUA 1JKPC 1JKOC 3J7YJ 1G6NA 2IPQX 3K2AA 1PDAA 3E97A 3FBNB 2E2JJ 1FTJA 4JWOA 2HWVA 2HYFA 4ESBA 4MQ9F 3C31A 4PQJA 4DYCA 2OPTA 3BCBA 1D3YA 2GOXB 3FXRA 2RKMA 3FJ7A 4XRMA 3L09A 4ND9A 3T8TA 4MEVA 2REJA 4QSEA 3U1KA 1CF7B 4EMSA 1UFMA 3RQTA 3KFWX 2FQ4A 3ZGKA 5GAEJ 3T22A 1FJLA 2LR8A 1BR1A 1FX7A 1JE8A 3HGGA 1EU8A 1M5DA 3S9NC 2AYSA 1I50J 2KDZA 1O3QA 2VPNA 1XGSA 1NV5A 2XPVA 2ONKE 3EHUA 5IT9K 3I5UA 3Q27A 2TDXA 1V5FA 4NAPA 4RY1A 4A6EA 1XI6A 2A5SA 2OLBA 5ICCA 4U7BA 4KYDA 4PGPA 1A04A 5I2KB 3KYLA 1FPBA 4U0WA 1AKHA 5ICTA 5CJ9A 4MHFA 2Y31A 2V6EA 2GLOA 3F8MA 3JAMK 2O7IA 3E1SA 3LAJA 4I8CA 1JXSA 3DTIA 5LGTA 3H9GA 2JPBA 2VKVA 4NF5A 3GUDA 2ECCA 1B58A 1LFHA 1XS9A 3JW4A 3DTEA 1LFGA 4KITB 2XXXA 4G6QA 5DCMB 3FDYA 2X6WA 2FRHA 1HQCA 4XNFA 2FD5A 2GWRA 1LB2A 4IVNA 2JTVA 2FA7A 1IEJA 1G3WA 3RT6B 2DO7A 1P99A 4CYDA 1B5JA 5IKBA 3SXYA 1GR2A 3LL7A 3ZS6A 3FXLA 3LSFB 2L02A 4F52A 1R9LA 2W1OA 4PJNA 4A3CJ 4A3EJ 4RAFA 1ODDA 4C0RA 1YG2A 3FGSA 2WBDA 3AXFA 3M4OJ 1FBCA 4M3DA 3GWZA 2BJJX 5J8FA 2EIKH 4RB0A 4D7MA 3PMVA 5JTYB 4GWYA 4BDOA 4BDMA 2F48A 2DFHA 3BY6A 3P9KA 3R60A 4E7LA 1VQOI 2E2HJ 3KEQA 4OIQF 2KR0A 3D4CA 3SDBA 4PFWA 1U6GA 1SANA 4BQAA 2O68A 3MQ9A 4GBWA 4X1EA 5CC2A 4FASD 2I8DA 2W82A 3FJGA 5FLVA 1RKMA 4OVSA 3F6OA 2AL4A 2PBIA 4G7ZF 1FSEA 2P8TA 1VNDA 4A3KJ 5EHMA 4L5IA 2IS2A 3CRBA 4M72A 3REOA 3L7WA 4QFNA 5DYMA 2PFYA 2R7RA 2R92J 3MZYA 2Q2CA 1A54A 1POGA 4G68A 5GAHJ 2W48A 4ENMA 3V8JA 4B44A 1HKTA 2Z16A 3FIWA 5TRDA 2OBPA 4UHTA 2DOFA 1D0YA 3KP7A 4F39A 3B6CA 4NC7A 3KSJA 3KLOA 3S2HJ 2OU2A 3GX4X 1DCUA 2H98A 2ISYA 4UVAA 2Z23A 2XXKA 4XRSA 5H8NB 2V26A 3SEXA 4DCYA 2VLAA 3BLYA 4RLQA 3VYUB 5GTHC 1WI9A 4D7NA 2M7BA 3CUQA 2ZXTA 5TP9A 2NVXJ 1MBHA 3FHNA 2F97A 1W0UA 2XXVA 5KVRA 1XS5A 3OL4A 3B02A 3TTKA 1URDA 2X6YA 3UNGC 5IP7J 4EF1A 3QYTA 2LY1A 2EFWA 2R7ZJ 5AA1A 2M1BA 3WTSC 4XL9A 4S05A 1RETA 4A3LJ 5IP9J 3R61A 4JQFA 3S8PA 3G3FA 3K6WA 3EPZA 4PAFA 1LDKB 2RN7A 1Y9UA 4YMBA 1W7PB 1T2KA 2LAOA 4PFBA 3OYHA 1UTHA 1SVOA 5EGOA 2Y7IA 2NXOA 2A61A 2XB0X 4JP0A 4M3FA 2WKYA 2LY2A 3HKZA 4HF0A 1MQDA 4I09A 2GXBA 1ZKGA 1M5CA 1BOBA 5EQ7A 2K27A 2IT0A 3T8RA 2HYJA 3P7IA 3DP6A 1TL8A 2KIQA 2EBIA 1QUKA 1UQWA 5TPAA 3CDIA 1HXDA 1LVAA 3MKLA 3RYPA 3Q25A 3O97A 2XF7A 3NAUA 3IFAA 1P4AA 1T0FA 4EGYA 1FMVA 4QF9A 3GFJA 2BHYA 1ZRFA 2WY8Q 3E78A 4PK4A 5JTYA 5J16A 4NC8A 1R22A 3IX1A 1BC8C 2Q8MA 4JYKA 1NH7A 2DXRA 2DFEA 4POWA 3OMYA 3LSKA 4AUXA 1FBHA 1WFXA 4EQ9A 1HKQA 2NNNA 3DKYA 4F7ZA 3BR1A 3GZ6A 1S3JA 1MSFC 3CCEI 1SYHA 3V8LA 2XAJA 3IB2A 3PL8A 5DVFA 1WRJA 1JT0A 3AL0B 2DLLA 5IY5H 5E3LA 1Z21A 2CQ7A 4HG2A 4HPQA 5F64A 1MM7A 4KR5A 5JLWA 1VFEA 1WDNA 2JSPA 2M34A 2UV1A 2ALUA 2XX8A 3B7DA 4PBQA 1FTOA 3H9QA 4E4HA 1KA0A 4IHTA 3FX3A 4LOCA 1ERDA 2JPCA 4A3IJ 2P81A 4ZEFA 3VDFA 4CYCA 4JVIA 3LSXA 4I7HA 3E6CC 3HPHA 3FXOA 3A1YA 2EWNA 4AVZA 4YB6A 1AOVA 4M3GA 4Y17A 5EEAA 5LDZA 1ACIA 2XKOA 3PJRA 4F91B 4BHPA 3RI4A 3GVAA 1IMDA 1IXGA 3CCUI 1PDNC 2ISZA 1DPRA 3OOUA 1H44A 1QA6A 3SEYA 2JRTA 1X1DA 2L5QA 1QUIA 2QS2A 2OBGA 2H25A 3L00A 3I58A 1ZH5A 1LBVA 5J47A 1QW0A 2CU7A 1QGPA 3TCFA 4L9VA 4GXAA 1X4OA 4BQQA 2M5WA 2XAFA 3BR0A 5K7ZA 3ZMSA 2QS3A 3U9GA 2M30A 3TELA 3K00A 2TCTA 2DMPA 3MMYB 3PIPF 4G8MA 4LZ5A 5FKOA 2OUMA 1RRJA 4NTLA 5J1DA 4KISA 3FVOA 2Q1ZB 4WWCA 4A5NA 1S72I 4MBPA 4U1OA 5EQ8A 5F24A 5I57A 2D5VA 1NKXA 4DE8A 3ZQQA 1W36C 1XC1A 1OR7C 3H36A 3HRSA 2R5YB 5FLXZ 2W7NA 3NRVA 1V54H 2WAQA 3CDLA 1MM6A 3RT8A 3UKGA 2ME6A 1AH5A 4FAJA 1LAXA 3EHSA 4ECFA 3U2RA 1JTYA 5J8CA 4I99C 4ZC3A 1FCKA 2EZLA 4FJPA 1DU6A 4NF5B 2Y7PA 1I1SA 1SD3A 3FMSA 2D21A 3G3GA 3RKXA 1R23A 4YELA 1SD4A 4G8NA 2XXUA 2R4GA 4R8HA 4H1XA 1MBFA 1APLC 1X4PA 4DJAA 4WX9A 3IO4A 4HS7A 4LP2B 2DQVA 5ED4A 3WU0A 2XWVA 4O7IA 2QQAA 4BQOA 2KIMA 4PSXA 1NUZA 1WI3A 2GM4A 5K7FA 1JVYA 2HDDA 3UK4A 3JRHA 3VDXA 2OQGA 2YPRA 3FKJA 3VYRB 3DKXA 2O51A 2E7WA 3PFIA 4NB5A 1X3ZB 1UZCA 2KIUA 2OV7A 1ZREA 4KNYA 4GL8A 5I2NA 3GXOA 1V4RA 3G2BA 1FBGA 3OO9A 2ELHA 3E0JB 4N0BA 4E0WA 2ANJA 1S9HA 1UCRA 2QUFA 2LBFA 3K4KA 1J2XA 1XGNA 1YW9A 4FISA 2LF7A 2WB1N 2HPIA 3V8XB 1ZTRA 5FBPA 4XKVA 2KZGA 2FNAA 3ABMH 1LLSA 1QJMA 4YIRX 4QTRA 1QZYA 4LK1F 1WJFA 4WCGA 1RUNA 2V7FA 4PDDA 1LB8A 4I98B 3DV8A 2QMWA 3H1CA 1EJ9A 1ZRDA 1FBDA 4XLFA 4ESFA 4OA4A 4MO7A 3Q0UA 2DBBA 4C1UA 3EHTA 3G1MA 3IHUA 2DW4A 1IQ7A 4WKMA 5FHMA 3C4MA 3MZ1A 1SW4A 1MG1A 2D5WA 3KP4A 1B4AA 2E0SA 2JT1A 1ULYA 3B6TA 3KN7A 2DA5A 1IXIA 1DK4A 1OIBA 1IN7A 2F3BA 3PQKA 4IF4A 2CV1A 5FLXK 1Y4CA 3R0AA 3CUQB 1MBKA 2FHYA 1U5TB 1SAUA 2RF1A 3LSLA 2W84A 4F55A 2B4LA 2L5VA 3PUZE 2LP0A 4GF8A 1B51A 3IJXB 1RNLA 4ZYGA 5HODA 3OL3A 2A07F 1BLFA 2JA7J 4OVTA 3V83A 4M6VA 2F4MB 1MSEC 1Q1KA 2Q88A 1WWXA 4MNIA 4P3LA 4DIQA 1RUOA 4EM1A 1MPCA 3OV8A 5FHNA 1B72A 2YX7A 1HSJA 3V7CA 2QA4I 3JRBA 1EH6A 3R7XA 1NV3A 3L2UA 5HPQA 2K4BA 3E5QA 4LMYA 4CA0A 4M3BA 1KA1A 4W1UA 4F93B 5EGOB 4GWWA 4DZJA 1LCFA 1MNEA 4GLIA 1IUDA 5JEIA 2XUBA 4H0EA 5KZTA 1R00A 2R7SA 1LAGE 1P1NA 3ZP5A 3J7ZI 2BZTA 4F22A 4Q48A 1K9ZA 3PTYA 4YZZA 1QBJA 3HG9A 2P6TA 3R26A 2Y2ZA 1JKQC 3ASNH 3UP9A 2XAUA 3E79A 1DGRM 4WXDA 3OYGA 1FNNA 5EJCA 2ZNUA 1R9TJ 4IQ4A 2ONRA 1MGTA 4ENNA 5C4XJ 1CQTA 2ID3A 2PJPA 4XMYA 2KPMA 4F19A 1RYXA 1R36A 4G6DA 3C3WA 3FM5A 4Y3OA 4BACA 4HW0A 2HQRA 1QGXA 1JW1A 4H45A 2XHKA 4M1VA 3T93B 2V25A 2ZZWA 2RQPA 3BZCA 2P1SA 3BG6A 1PB7A 4OZ9A 1LPQA 3ZQCA 3F8NA 1B46A 1QRYA 1FQDA 3PNYA 1KQ8A 2A5YB 3RGYA 1MY0A 4QSCA 2KKOA 2A5TA 2FIXA 4F1VA 1O3SA 4LB5A 4C3JJ 1FBQA 4OAZA 3VYSB 4PJJA 5LFAA 5ICEA 5GPCA 2V6CA 1MDMB 5HS8A 3TO7A 3GTJJ 4RK2A 3H35A 3KC0A 4GXSB 1NV4A 4IL6C 3K02A 1FWZA 4HSTA 1IRFA 1DBZA 1DP3A 2VUMJ 2YPNA 2M7AA 4FX0A 4NF8A 4G7OF 4GBVA 4BEHB 3IP4B 5I58A 4CCLA 2F8DA 1VFDA 4L9TA 2UVGA 3MYUA 4FATA 2X1DA 2ZYKA 2VODA 3FJMA 4FORA 4ESWA 4XONA 1S7EA 2H1KA 1MJAA 2ETHA 3IOVA 3WTWC 5IZ3B 2V9PA 3FD3A 3H6UA 4I40A 1G0IA 2DA4A 3S1QJ 4NBQA 3CZ6A 1FBFA 3HOXJ 3HRTA 4GYGA 4ENKA 4GVOA 1YX3A 1W5SA 4KMFA 3ESWB 4HNVA 1FJ6A 3DXJF 1LQ1A 1VQ6I 1LDDA 5DVIA 1JJ6C 2Y75A 2CW0F 3QSLA 3I53A 3M1CA 2WX9A 4DOZA 1ZR2A 4P1WA 3S4UA 2UYFA 3O9PA 3LSGA 1LEAA 4RAGA 4FX4A 3MZHA 1Y3NA 1WODA 5M2VA 4KUMA 3UA8A 1FP1D 4FQGA 2HGCA 1FOXA 5JI6A 2QF7A 2VONA 2ZMEC 3O2AA 4JWXA 3BR5A 3HSTA 4MFEA 5M3MJ 4IY6A 4G77A 4I62A 4BDLA 5DYHA 2OQRA 1J1NA 4HW8A 1FOYA 3AL0C 3F3XA 4E7KA 1SFEA 3FXJA 5H20A 4PCQA 4GQOA 5M5YJ 1V5EA 3JTHA 3LQQA 3OYDA 1Y20A 2RCBA 3PPRA 3SDFA 2DA6A 4PFTA 4FEBA 2DE4A 3IWZA 1X2MA 4K3FA 1B05A 1BIAA 2O7UA 3O6IA 1TQMA 3HB9A 2CV0A 3C2BA 2ZSIB 3AFHA 1I3QJ 1X3WB 2QSFX 2MC4A 4X04A 1G3YA 4CCOA 1SMTA 5K7HA 1ZAOA 4EJTA 1UELB 3N5LA 1K4SA 2NYXA 3H6VA 4I0AA 1FEXA 2BY2A 3BG9A 1YCJA 3K10A 5I59A 1WVJA 2DA2A 3TKYA 2VJIA 2RCAA 3C7JA 4IO7A 1YJNI 1FPGA 4Q8RA 1SD7A 4A3BJ 4WF2A 2J5PA 3QUJA 5H8FA 2DMTA 1A6IA 2L9RA 5ILSA 5BQTA 4AC0A 3RZDJ 2DDKA 2HVQA 3IL1B 2IP2A 1OR7A 1P4WA 2KQRA 1I6BA 4PF6A 4F1UA 2QQBA 3LSMA 4LITA 2H27A 4FE8A 3RCOA 4LATA 2KIFA 3CLQA 1EA3A 3WU1B 1OLAA 4ZE9A 2L3DA 3S32A 1TQPA 2RNGA 3RJPA 1PP7U 1VQ5I 5JLXA 3O8HA 4XLNF 2OCEA 4DNCA 1T38A 1UTBA 3RLFE 4HAMA 1ZK8A 5HLTA 3WTYC 4KYWA 1BN5A 1XC5A 1FTKA 4BDNA 1D1BA 3DLNA 3KBZA 3KJ7A 5AA4A 1FP2A 4OANA 4XQFA 3VSLA 1BBYA 1DQUA 5KCMA 3HOVJ 1B1HA 3DPUA 2ABHA 4I9DA 2CZHA 2BBYA 3HIFA 2DK8A 3KEOA 1I27A 4NQWB 2UXAA 3T9VA 4A0YA 2QM3A 4V19K 1A55A 3M9AA 1B7UA 1ZMGA 4PP0A 1W7PD 3QOEA 1OCPA 1FYKA 3MAJA 4HX4A 5L3BA 2MFZA 1GDTA 3U92A 1ETWA 5I84A 1DPUA 4NWDA 2F6PA 3ZMDA 5E8GA 3LA7A 3S3NA 3CTAA 3IC7A 2V1XA 1RDZA 4GWOA 4R2BA 5GP9A 1B72B 1RIOH 4QBAA 3SEZA 1ZU0A 2LKXA 1B7ZA 3W3CA 1TP4A 4BJ5C 4U87A 3RPUA 3ZCOA 4UNOA 3BFUA 1GT0C 4C1TA 1XD7A 3TL4X 5L3DA 2QYOA 2M3AA 4QFPA 2K9LA 1OQGA 2XAQA 4NF4A 1JUSA 3O3KA 3DM0A 4PE5B 4R2FA 4RGSA 1H3DA 1R6RA 5DEXB 3PPQA 3E5UA 4A0ZA 2NWJA 3C2GA 1F36A 2HXIA 4KT6A 4UUVA 2DE3A 1Z1DA 4Y15A 3HCQA 2K4JA 4UUTA 4O7MA 3HHGA 5LEKA 4HE2A 3GZ5A 3J80Z 1Y8RB 5HLHA 1B7HA 1D9QA 2DYXA 2P7VB 1SD5A 2PQ8A 1TBXA 1HSLA 2JA8J 4CCMA 1DTGA 1OMIA 1QVTA 4HOBA 3GBAA 1GXQA 4I3EA 2MKZA 1HA8A 3MKWB 4LG0A 2HS5A 1T08B 2ZXWH 4WEDA 4YKPA 4Y7NJ 5IZ1A 3OWTA 3TQLA 2IA0A 1N04A 2O8XA 3P9CA 4UXNA 3L6GA 3T66A 3S14J 4P47A 2YS9A 2O84X 4R6KA 1G0HA 3OS2A 4MGRA 5EEHA 2JVHA 3GZNB 2YLNA 4IO5A 4ISUA 4XTCQ 2E7XA 3VWBA 4OWRB 2QENA 1HKSA 2K9MA 2F5CA 1UIVA 5IM2A 1GV8A 3U65A 1U5TC 2HU9A 3OO7A 1U0JA 3E4RA 1Y1VJ 2HTJA 1D3KA 2CFOA 1JETA 2ZFUA 4G8HA 2Z9OA 4P55A 3KIOA 3TTNA 4DYRA 4V2FA 4G61A 3BG3A 1I3AA 2ZMBA 4BKXA 4YIIA 1X1PA 3OYCA 1PYVA 4N6PA 4P8BA 3VVDA 2LYCA 5C44J 3T96B 4BLAA 4P1EA 1Y6IA 2BGCA 3C34A 3NOHA 1B6AA 2Q9TA 3MKZA 4U21A 2QZ8A 5D5UB 4ZDMA 3CVGA 4XOPA 4DIGA 3CJNA 1NUWA 4R9GA 4OQOA 3I0TA 3ZSFA 4PJMA 2R71A 5I58B 2DYRH 1LNWA 4YMAA 1EKEA 2Q0OA 2Z33A 3HOTA 1H0MA 2F7AA 2HYGD 5IOYA 2P7CB 4G94A 3TTLA 2AS5F 4EXLA 1RI7A 5CVIA 2MLKA 4B3AA 1YJ9I 2G0EA 1FYMA 1TFAA 1B5HA 4RPOA 4ZZEA 1IITA 5E1XA 5D4SA 4JSOA 4GXOA 2EFOA 3TBIA 1R4MB 1V5GA 4JX4A 5CRYA 3LR1A 5H8NA 3S9LC 3LUZA 4IB2A 3A3UA 4L5EA 4KFQA 5FD6A 3FV1A 3HEFA 2DS9A 3PUVE 3HKZN 4JVDA 4O8MA 4HBLA 4EDPA 3H5AA 3C9HA 4GIZA 3CLOA 2X0LA 1SC7A 6PAXA 2IS4A 4F1YA 3KX2A 2F2EA 3I3LA 2QLZA 2HZKA 4ZEKA 1R4NB 5LRRA 3SFIA 2VOPA 3QMFA 4PF8A 5EZGA 3ODBA 3K6VA 1RR8C 2HPGA 5HS9A 3QIMA 1IZ1A 1Y1WJ 1B9MA 2OWZA 3ROJA 2NXNB 4MFDA 2VBYA 2GBYA 4DW6A 1W7PA 3H3UA 2WBBA 3BBRA 3IB0A 1MJBA 5CYVA 1A35A 3T5XA 1QVUA 1MD0A 2E35A 4QSDA 3GTKJ 3ZMUA 1IO2A 5GTIC 1WGXA 2VOZA 5E1WA 1G59A 1LCTA 1NV2A 2E36A 3HOWJ 1YS6A 4O5VA 4IGRA 2XSDC 3CG3A 1SVMA 2D1HA 2FOWA 1UG2A 5I59B 1ZIUA 3UORA 4ZZAA 1AWBA 3JRFA 3H5RA 1QQIA 3FXUA 1NK3P 2VC0A 4PFOA 3GEZA 1NMUA 3SEUA 1S5LC 4CUGA 4J19A 3P7NA 5H8FB 4F31B 4GL0A 2LOOA 4DXUA 4RAYA 1Y0UA 4BE0A 3S15J 2HZTA 2EZHA 1NV6A 2EB7A 2ZSHB 1YRNA 5HM4B 1I6XA 5IPAA 4HDVA 4OEUA 1K83J 2DAOA 4H5GA 2E1MC 2XF5A 3QUFA 4QFKA 5LHGA 3IORA 1BIBA 2IXSA 2XB5A 4N81A 3E9XA 2HDWA 2UUZA 5AA4B 2X7PA 1TZLA 3F8BA 3AG4H 3BJ6A 4K2EA 2EK5A 2ZFWA 3WGHA 5KHDA 5ET6A 1O7LA 3RQIA 3WGGA 1FLIA 2GRVA 3VLUA 4EVIA 5IYCJ 4IGTA 4F3GA 2K40A 3DKWA 4ZE8A 2WTEA 3VE1B 2CQQA 3IAM2 4XLCA 4MQVA 5K1YA 2L2OA 2TRTA 1VQNI 3CO7C 3S2WA 1Y3PA 1TQIA 2W25A 4YIFA 3DQVC 5EQAA 2IGNA 2K9SA 1MXWA 4I1DA 1IW7F 3PUBA 2VE8A 1NV7A 1HCRA 2KHMA 3QPLA 2VKHA 1AMFA 1GGGA 1N7WA 5AA2B 1ETVA 3EETA 3WTVC 2BVMA 1JNFA 2XGEA 2XXYA 2WAQN 1H45A 2ZNZA 4EJWA 1XCVA 2PEXA 2DXYA 2G29A 1CGPA 2DXIA 4NF4B 4OAYA 3RN8A 4UVBA 2ZZVA 4Y13A 3IFCA 3VXBA 2AL5A 2K02A 2Z5UA 4U88A 2ZKZA 1VI0A 1G2HA 2ECBA 4LB6B 4YFXF 2WBMA 1IAWA 1LBYA 4LIUA 5J1YA 1AHDP 2DVCA 1QZZA 2XXPA 3G3KA 5M5WJ 4POXA 2VKEA 1R71A 2XA5A 3K70C 1T8IA 1P1UA 4GWUA 2X7QA 5ERIA 3GFIA 4PDKA 2R5YA 2JJ7A 3ZN0A 2P3NA 5AIPA 4KCDA 2X1EA 1MXUA 2THIA 3ZR8X 4OEVA 4LG0B 3LA2A 2LKPA 1SVXB 1TFDA 2ZYOA 1MDQA 2P5LC 3IOTA 3MP8A 5K5OA 1LB9A 3S1MJ 4PBHA 5EYFA 1E0EA 3L2CA 3A03A 5J1RA 1OJLA 4B8XA 2R7WA 5CMBA 2DJIA 4BDQA 4NC6A 1KQ0A 4Y33A 5FGMA 2QSHX 3S9EA 4IRHA 1NL5A 3VVEA 1YHQI 2LLKA 2KISA 3JRDA 1KYZA 1KZ8A 1DTZA 5ET8A 2BXZA 1J0RA 3MP6A 3THIA 3N05A 2M4GA 4N4OB 4ETSA 1H89C 1O64A 2WEFA 1FTAA 1D8JA 1M5BA 3CSBA 5BUUA 3PIOF 5LRSA 1NNPA 2GOMA 3EQLF 4U7DA 1Y0NA 1ETKA 2NS8A 2UZKA 4XRFA 3BROA 3K1PA 3A0BC 2IAIA 4N4NB 3PMWA 3FMRA 3K6UA 3BG7A 3OD7A 1LAHE 1MW7A 1JGSA 3E6MA 3QU3A 2PYYA 1YFHA 2YX4A 5FROA 1FQEA 4XEQA 1LBZA 2PN6A 2E34A 2L7FP 3GLBA 5DVJA 4MAGA 3H5NA 2AIXA 4YFNF 3K6GA 2X85A 4F3QA 1EYJA 4KIBA 4X48A 4F29A 5HNHA 4DXBA 4L17A 3S9MC 1TT0A 3WTUC 1PEBA 1U78A 4EJOA 2MD0A 2BV6A 2R7DA 5FD5A 4ELPA 2MSYA 1A7LA 3OO8A 4NX1A 2DDBA 1REPC 1YQAA 3FXKA 1WZ2A 1NV1A 2IRFG 2M2EA 1XSVA 4IO2A 5EQ9A 5ICGA 3SJMA 2KT0A 4CGZA 4JBZA 4DDDA 1BW5A 1U5TA 5IAIA 4B3XA 2HCAA 3DP8A 2JSCA 1FBEA 3DWLE 3MBPA 1FY7A 1NV0A 4H5FA 4HQMA 2W7YA 2DODA 3QPSA 3I54A 3K4JA 4RM3A 4CXFA 3F22A 4G4PA 3TGNA 4MLQA 3N97A 1OYYA 3S1RJ 3MN2A 2OF7A 3LBSA 1UB9A 2ME0A 1D8KA 1Q1VA 1JKRC 5BNGA 3V89B 4KI0E 3LSJA 1S6LA 2CWEA 4JK1X 1ORKA 1UHSA 3EUHA 2DI3A 4CCNA 4WXJA 2FNCA 2YUSA 2NOOA 1FC3A 1WQ2A 4KN4X 2FXAA 4RA1A 4FEDA 1I1GA 2EJRA 5IYBJ 3H0DA 5BMZA 2HEOA 4HRIA 5DCFA 3IRQA 2ZXIA 1W0TA 1IUYA 3RPWA 2Y0MA 3V7RA 2O0YA 3W9WA 2X51A 2DU9A 3O8GA 3I4MJ 2R9JA 2DWIA 2XRLA 4NEDA 2PX9A 1U9OA 4RAZA 1ZGJA 3LSPA 5H8HB 1DP7P 1IF1A 2D1VA 3W2WA 1IMAA 1JP4A 3ZQ7A 2BHZA 4B43A 1MMNA 1OVTA 3ZQHA 3E3KA 2OK2A 1YRNB 2XXHA 3DF8A 3FBIB 1IRZA 2VHAA 2DFIA 2LK2A 5LHHA 1ON2A 3E6DA 1VQKI 4IHVA 3MPKA 4HTGA 2LKSA 1XPXA 2G7HA 3SZGA 2ZMEB 1LGBC 3MKYB 1PB8A 3GCMA 3JV9A 4F2QA 4CDGA 3BOQA 2KJCA 4C3HJ 4BHCA 2ACJA 1T33A 2B3FA 3FIRA 1JI8A 4NHBA 2B9SA 1BL0A 4DQ2A 3JRGA 2H9BA 4EF2A 2VXDA 1XDSA 1BKAA 1IN5A 3EN3A 2I10A 3IH4A 1FSHA 4FETA 1N76A 2OZ6A 1UHWA 3HYIA 3N4MA 2HXWA 1SW1A 4HV6A 1B3EA 2B0LA 1TWGJ 4RDUA 3ABKH 3K9TA 2LH9A 2OA4A 3EUAA 3U93A 1VSOA 1U9NA 5CQEA 4CO8A 2MH2A 2ZJQF 4XKRA 2XIGA 1MDMA 3KBRA 3Q26A 3K4MA 3OS1A 4P56A 1F4KA 5JVGF 4MNUA 2BY3A 4R74A 3K1MA 3GTOJ 3CI8A 5GAGJ 1QHGA 3CUOA 4F92B 3MZ8A 4BEHA 4UUSB 2CEXA 5ESYA 4LZ8A 3WTZA 2FVZA 1E3OC 3H3ZA 2I4BA 5FKMA 4X1BA 3SEWA 1NUXA 2RGVA 2K86A 2AQFA 3BPXA 3FZVA 4RPNA 5IZ3A 1O4XA 2QQ9A 5IGAA 4PFPA 1IRGA 5AA3A 2GA2A 3FWEA 4U4SA 1OCOH 3GLLA 4OIPF 3RTFB 4LQ2A 4I76A 4BXFA 5H8QA 2GFEA 2KP6A 5DDGA 3CCLI 2LMDA 3J7AO 3C36A 4YICA 2DT6A 4S0HB 4KA4A 1NK2P 3DEUA 1TW2A 3L2WA 3CCQI 4Z2YA 3LWFA 3D1NI 3CCSI 1FPIA 3GYYA 2EV6A 2HQ0A 3N94A 1IDYA 2D45A 5CVJA 3U1DA 1MPDA 3FM3A 2FBKA 3ZMTA 3OS0A 4QFLA 2X6OA 3ZKLA 4BBSJ 4OHNA 2GHAA 1Z7ME 3MP1A 3M1EA 4IOAF 1IJWC 2CJJA 3O29A 1W4MA 4P5OA 2I49A 4U23A 1KA8A 4IRIA 1BR4A 3R0JA 2QWWA 3RYRA 5CVUA 2QCOA 4L5JA 3SZPA 1OVBA 4XKBA 2Y5KA 2A05A 5J3LA 3ZQGA 2LY9A 2NAZA 2WWYA 2ZB9A 2QGUA 1VZ0A 2UYEA 4R73A 3DU6A 4FE4A 1DDNA 3NQOA 2LD5A 4N15A 1LEBA 3CP8A 4KPTA 1FTTA 1L0OC 3WHCA 1LFUP 3L9FA 1B3LA 2QKLB 2DFFA 4BY1J 4EQBA 3HUGA 4EXKA 2H94A 1QKBA 2O6GE 5H8SA 2LF8A 1B4ZA 5FB2A 2VD3A 3IOWA 1GVJA 5J40A 2CEYA 4H46A 2DK5A 1QPIA 4RMNA 2RVCA 3I9V2 2QKMB 1VE4A 2EINH 1PBQA 3F23A 1LKXA 2IA1A 2DE2A 3ECRA 2FSWA 1TW3A 4DZ1A 1AIVA 4NDLA 4F18A 2XWOA 3M8EA 5E3NA 4MNCA 2N8GA 4RA2A 2YR2A 4UV8A 3MVPA 2DMNA 3I59B 3EYYA 2DT5A 4RGRA 5E8IA 4Q4ZF 3I56I 4IKFA 4HXVA 4M9XA 2DOEA 4OFOA 1TXFA 3S2VA 2XV4S 4XM3A 2O61A 2PMSA 1LAFE 1SDXA 1T56A 2G9WA 3RTWB 3TCGA 2HOSA 3TKDA 2UXXA 4NQWA 1PP8F 2BXYA 3HHFA 2IW5A 2PMHA 4A0XA 1UJ8A 1EZOA 2YU3A 1P1WA 2L9NA 1ZG1A 1BI0A 2XPUA 1DMBA 4OMZA 1ZGWA 1OKRA 2O6AA 4BBRJ 1LFIA 1UMQA 5IT3A 1HBXG 5L3CA 1FPFA 3W6JB 3KETA 2ESNA 2FJ1A 3VFZA 4EV0A 1IIWA 3GLXA 1E3PA 4PUSA 3K2ZA 3ISPA 1XMXA 3P5JA 3ERED 2Y0SA 4MCOA 4EUOA 4E7HA 3BC8A 4OVPA 2CQXA 1JW5A 3A09A 1R1VA 3C1DA 2MABA 1SVLA 2PG4A 4GWZA 1W36D 4OFJA 5DEXA 3W15C 3MZ9A 3I4NJ 2PMZA 3HZJA 3JTGA 1EF4A 2WYPA 1OISA 1LSTA 1BI1A 5A2QZ 4LLGF 4A5MA 1XOCA 1QZEA 4N9HA 2HI3A 1ELJA 1BK4A 2A6EF 4PAKA 1P1QA 1BTJA 3GO5A 1MQGA 3OO6A 5CI5A 3CCJI 2K9QA 1YYVA 3LSHA 1KU2A 3JSOA 4ZTFA 4AIDA 4HA8A 2Q8JA 1V55H 4G7HF 4XOTA 1SW5A 2O5RA 5F0HA 3OMBA 2F35A 5EF6A 4ELQA 1WHUA 4MTEA 4PFUA 2IBDA 2L9SA 3TOAA 5EDNA 4LUBA 4A3JJ 1A5JA 1USSA 2DJNA 4D5CA 1AA7A 1MMAA 4HDUA 1GTKA 2C6YA 2PBWA 2QPQA 2Y84A 3QK6A 4FHTA 3T1BA 5LHIA 4XBFA 1I6HJ 4JOMA 1D0XA 2PJRA 1DU0A 1BJAA 1IXHA 1I69A 2YJPA 1RDYA 3O6HA 3OYJA 5AA2D 1TWAJ 4B47A 3RPUD 3LUYA 4KDPA 3JCUC 1MY2A 3ECOA 4YAHX 5TU0A 2BVLA 1YPNA 3GW2A 1Q35A 3RDIA 3KYDB 3JYRA 1K4TA 3I3VA 1ZR4A 1S9TA 3OSQA 3NEUA 4C30A 4R6HA 2OWTA 2W4SA 5F1JA 2EV5A 2CUJA 2FMYA 3DP4A 2D3IA 3H06B 4N8GA 1H43A 3BIHA 2OCUA 3DPTA 1G8XA 4I2OA 1MY4A 3QQAA 5ICFA 2MD5A 2V1NA 1NH8A 2VE9A 2JRMA 3PD9A 3EPEA 3IOUA 3WAEA 2GAUA 5F0CA 4DCXA 3PU5A 4BY7J 5H8QB 2E1MB 5A2QK 1SD6A 1FZPB 3CC2I 3MC2A 3JRIA 4LD5A 3MUQA 2KDOA 2Y69H 4MFIA 4N8YA 5KCJA 3D0SA 2MGQA 4ZTJA 4UB6C 4UY8I 3V7SA 3RKYA 1PB9A 1FPLA 5CVVA 2XAHA 4PAIA 3FXMA 4NNJA 1H9GA 1DPPA 2BOLA 3PMXA 1CE2A 1Y8QB 1I6AA 3VEPA 1ZELA 2M8CA 1P7JA 4A2UA 5CVRA 3FK7A 3PV0E 4BDZA 2YU9J 3PUFA 2HOTA 2STTA 2XPWA 5E18F 1B40A 4Z7EA 4FIMA 3TYHA 2DWHA 3HSRA 3GYHX 2V3QA 3R4KA 3BKIB 4L0YB 1FBSA 4KFCA 2EA2A 4LA9A 2F5XA 1LE8B 2R7XA 4I3YA 3T0YA 1P9QC 4GDFA 2UXNA 3RIRA 2HQNA 4P9FA 3KP5A 5FKKA 1TWYA 3QAHA 4A3DJ 2VB6A 2H6BA 2FUG2 2Y30A 5A5XB 5M3FJ 2R3SA 2VOOA 3HUGB 3PO3J 2CGPA 1JTXA 5DD8A 2BW3B 5E79C 1SEUA 1XVYA 3VLWA 1B2HA 4LLLA 1ZRCA 1ZKBA 5FFXA 3Q29A 4MF3A 2M8EA 2OTLI 1VQ8I 3OYNA 3MQ0A 4BE2A 4CZZA 3CFZA 3H9JA 5J6XA 3JSPA 2RV8A 4OVQA 1NNTA 4O6JA 1QO0D 5J4YA 1NNFA 3K0VA 3IKVA 5DTDA 3QP6A 3FXBA 5DD4A 2VKDA 5HDKA 3DLLF 3MZBA 2M45A 3DBHB 3V42A 5L8DA 3CSGA 1Z6RA 3A02A 3OOPA 2E19A 5DUKA 4E7IA 2OZZA 2RINA 2RC8A 3H7MA 4EQ7A 3TMOA 1NH3A 1WJEA 2L0KA 1CB6A 4MEXF 1FT9A 2ELKA 2CH0A 1Z67A 3TO6A 1DUXC 1N84A 3C32A 4KJZA 1J5YA 3G71I 2B7EA 1BC7C 2ZJ2A 5KK1A 3FBPA 3RY3A 3S3OA 3I6VA 4AD9A 3PFYA 3SEQA 1K6OA 2X9DA 3K1NA 1Y39A 1SW2A 3IK6B 1YJWI 3Q28A 2OC6A 5AONA 1FTLA 1K6YA 1P1OA 3NARA 1Y4TA 2I0BA 3VB2A 4G6TB 4HV5A 5AA2A 1URSA 4NUBA 2GHBA 4EM2A 3N26A 5HOOA 1VQ7I 3KOTA 1PVEA 4BDRA 4WK8F 3G3IA 2BEOA 2HTSA 2IGOA 2UWMA 4JX5A 4QLCU 3H0GJ 4LK0F 3FHZA 3FKIJ 2AXTC 2K3FA 1F9BA 4G12A 3OYIA 4OFLA 1MZBA 1MMGA 1LJ9A 4HCYA 2WV0A 1U3EM 4D5FA 1MNMC 1TLHB 2ELJA 1KZHA 2I48A 1J59A 2AXLA 3BG5A 4EGZA 3SESA 1WSUA 1Z7LA 2Q74A 4FT8A 3PNVA 1WJDA 3FISA 2VPOA 3EQ1A 4AQ4A 2E1NA 1XX5A 4Q47A 4X0GA 2V3TA 3E13X 2JJKA 2DOAA 1Y1ZA 1B52A 3PUWE 4E7SA 4RXLA 2Y9YA 1M1EB 2JVGA 2M87A 2QL3A 5IOZA 1VQ9I 1IDZA 1SPIA 1QHHD 1NG7A 2L4MA 3UR3C 2DWAA 1W5TA 4II3A 2DA3A 1SBPA 1USTA 1H88C 3F8FA 3BZ6A 1UHMA 4MLOA 1DSNA 4M3EA 1K9YA 1T95A 3CD6I 1BIYA 3OXNA 5D8LB 2GQQA 1D4NA 4LVQA 4OOIA 4O3AA 5CMCA 1QU3A 3K4UA 1YITI 1ZQ3P 2PJRB 4XKPA 3NWTA 3TZAA 4X9TA 3HGYA 2WADA 1Z9CA 2W24A 3CR9A 2V1DA 4L0ZB 3TFLA 3AAFA 3JZJA 2JA6J 3LC8A 1OLCA 2QJEA 4E7JA 1Z91A 3C2HA 4KN7X 2ICWG 2QVOA 1JGGA 4P9KA 5HDNA 3HSFA 2IEEA 5GADJ 4XLEA 3LQRA 3M8UA 3TP3A 1FIPA 1LDJA 1MBEA 3BR3A 4HX8A 3ZRGA 2CMOA 2HAUA 2NOJB 4JXIA 3HOSA 1MPBA 4GFRA 4QXDA 3CP2A 2H4IA 3HRMA 1E2XA 4ZYHA 1EH8A 1XGOA 1XMKA 2L4AA 1FTZA 5LGUA 4QWQA 1OQYA 1FPEA 3M3FA 5J1UA 4GWSA 4WEPA 1ANFA 3PSFA 4EEFG 3X2QH 4XIGQ 5HS7A 3OSRA 3I5OA 5E20A 4P0IA 3TODA 2BYVE 1ZYRF 4ZEIA 1JUPA 1XSXA 3B6AA 3GBGA 2Q8KA 3A01B 1WJAA 3S2DJ 2X6XA 3K4BA 1KU7A 1FQFA 3RPLA 2AHQA 1LBWA 1J9IA 4GYIA 4ITVA 3F6VA 2H1LA 2WAEA 3J80K 2KRCA 1ON1A 4EATA 3W2AA 4H8JA 4KQPA 5KCJB 2P0WA 2CV2A 5EG0A 1LBBA 1DGWY 3G3ZA 1IN4A 4QSHA 4J01A 1IN8A 2I6EA 2L54A 2QSGX 2B65A 2QVVA 1Q9DA 1RKTA 2VQHA 2B63J 1X1AA 3M7GA 2RREA 2BE5F 3G1OA 2KQZA 3TDJA 4AU7A 1FRPA 1YTVA 4NF6B 9ANTA 1JEUA 5CBRA 1WJBA 2B3BA 1XB4A 1K7AA 5LD2C 3VVFA 1TNTA 1QULA 2OTJI 2R5ZB 2HVSA 4KMUX 2QS4A 1E17A 1H9TA 3CJTB 3A3CA 1FQCA 2GXGA 3BDDA 1KWHA 4NQ8A 1QNTA 3K69A 3COAC 3TEDA 4TV7A 2XROA 2FX0A 4A93J 3CF2A 1VDWA 3MVXA 4ZZLA 3HRUA 4Z0IA 2O69A 5FTHA 1IV8A 4L9JA 4L18B 1USYE 3KN8A 5FKLA 1T39A 3L2VA 4THIA 1INPA 3TTRA 4QFOA 1WH5A 2OAZA 4MJOA 2Z99A 2DP8A 5EYHA 3Q0VA 5CQGA 5TJJA 1JQFA 2Z8EA 2YSRA 4XLHA 1N75A 4PFRA 4RGUA 2CS3A 3ELKA 4G8XA 1UAAA 4OU0A 3OENA 3IAS2 1H76A 1O63A 5H8HA 2EFNA 2WY7Q 4HEA2 4RLFA 1R1TA 4CCJA 3ZQIA 3PUXE 5ELVA 2JQ7A 3TQNA 4N4UA 4A69C 4BS9A 3GTGJ 1B32A 5F08A 5K5RA 3MVZA 4OWDA 3SDGA 2IS1A 2DMQA 2Q2EB 1GXPA 4H65A 3TUSA 5GPAA 2ZMEA 2BY0A 3HL2A 2R7OA 2NVUB 3OYAA 3WE3A 3VV5A 4F2OA 4NGUA 4KICA 3SYTA 2ZYNA 4RB3C 2QFLA 1MKMA 5LTCA 3FVNA 1T98A 4EM0B 2PFZA 3G6EI 3WODF 3IL2A 1BP5A 2LRDA 4P0GA 3VPRA 3IB1A 2COMA 3BIGA 5D8KB 3QYFA 2LNBA 3G3JA 4OENA 5ITOA 5F04A 3CF5F 4OIRF 4YKJA 1JW4A 1NUYA 2CZLA 2V4CA 2HOAA 4XICA 1QKAA 4UABA 3V8KA 1ETOA 2MH9A 1Z6TA 3CCVI 1Z7NE 4JB7A 1I39A 5I3SA 3FV2A 4OMBA 4LONB 5AE4A 3VFJA 2A5WA 3MEXA 2GH9A 1VF9A 3QYEA 2CZKA 3JRAA 3B6WA 3U1OA 2DN0A 1KYWA 3I71A 4M9ZA 4UUSA 2EZIA 2XF6A 3Q3SA 2QBYA 1VTNC 4FTHA 1ZARA 2G7UA 1B9NA 3VYTB 1PUFA 3IH2A 5FRMA 1MXXA 3CIJA 1IV6A 4BJTA 2F5FA 1YXIA 1S7YA 3AG1H 3F9KA 3KZZA 4IZZA 2AQEA 1P2FA 4GRKA 4PGGA 2DA1A 3EF7A 1XGMA 3B73A 1ZLQA 1LBXA 2E5ZA 2EV0A 3W2VA 2RC7A 4PTKA 5JHFA 4BE1A 4I02A 4S04A 2UVJA 4X8RA 3R6SA 1FW0A 2BY1A 2WV1A 4DBRA 5J4VA 3VSKA 2VT5A 3KN3A 2V9VA 4DZPA 4EJUA 2V9KA 1FPJA 3E7LA 4XF5A 2KL4A 3PD8A 5D6FA 5CKTA 3L2QA 5HVQC 4OVRA 2DTRA 3M8JA 2RNJA 1EYKA 1SFKA 1WJCA 4IHYA 1URGA 2V84A 4XFEA 2NS0A 3WTTC 5FTIA 1GV2A 3OR1C 3HXLA 2HAVA 3OIPA 1IC8A 1E3HA 4RBOA 1YOVB 4D9JA 2V79A 4H6DA 5TISC 3IUOA 3TOBA 4AWXB 3DEWA 2K7LA 3KCCA 2IS6A 1B8IA 1FJ9A 2ZYMA 4XSZF 4GX4A 1GV5A 4LIVA 4UACA 3KYCB 3OYBA 2PLYA 1BM9A 3KE2A 4XRSG 2R7FA 1JJ8C 4O3MA 4OIOF 5B1BH 3ZQLA 1EZ9A 1RYOA 4AIKA 3M3KA 3QAXA 5ET5A 3HPGA 4N91A 3HBLA 1FBUA 2FIEA 1TTYA 1VQLI 3M07A 4HE1A 2VIXA 2E1SA 4HE0A 3E5XA 4O94A 4HLYA 2CW7A