3HHGA

Structure of crga, a lysr-type transcriptional regulator from neisseria meningitidis.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
293
structure length
293
Chain Sequence
KTNSEELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTEEGAQYFRRAQRILQEMAAAETEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LysR family
publication title The structure of CrgA from Neisseria meningitidis reveals a new octameric assembly state for LysR transcriptional regulators
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription regulator
total genus 69
structure length 293
sequence length 293
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hhgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhgA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhgA02
1L0OC 3F8MA 3OELA 2Q89A 1VE4A 4HTGA 1QPMA 3V4GA 4O3AA 1W7PA 2PFBA 4GGGA 1XHYA 5JK4A 2UZKA 1LNWA 5LOMA 1US5A 1B1XA 4HDVA 2K4BA 1XSXA 4MNUA 4IO3A 4FECA 2DPUA 2Z99A 4GL8A 5AA2A 1RUNA 1IRGA 4POXA 1UIVA 2AS5F 1SYHA 4P11A 3M8UA 1P4WA 5A5XA 4GYIA 3ERED 1O3QA 1XGMA 3IB2A 3LSXA 2A3SA 4HLYA 3PPRA 4Q48A 4BNCA 2FRHA 1B5IA 3IX1A 4RA1A 4F22A 4R2FA 1EV7A 2WKYA 1YLFA 3H7MA 2NXOA 1TBXA 3KP7A 2NS0A 2Z5UA 4GYGA 3VFJA 1ULYA 5CYVA 3ECOA 1H76A 2HXWA 4MTDA 3MZBA 3R0AA 1ELJA 2IRFG 1HSTA 3S9MC 1LJ9A 2VD3A 3RT6B 3HV1A 3LBSA 4RXLA 2BBYA 4R79A 3C4MA 1YW7A 3HTSB 4HF2A 2EFNA 4HQEA 1Q1HA 1XD7A 1S6LA 3BJ6A 3HSRA 3LQQA 5LEKA 2AL4A 4X9TA 3FXQA 2JPBA 3HHFA 2YU3A 3MW0A 3GBAA 2QS2A 3TCFA 1P1UA 3LUYA 2QRYA 3TO7A 1EH3A 3HUGA 3Q25A 4OMZA 3G3GA 1JW1A 4U0VA 1LVAA 2A6EF 4YMBA 1IN7A 3Q9VA 4GXOA 2HCAA 1CB6A 3OO7A 1LLSA 4PDKA 3ZP5A 1MQJA 2XXPA 4CZZA 6PAXA 1RYOA 4YZZA 5TP9B 2ACJA 4AQ4A 3N5LA 4POWA 3P7NA 3N94A 1MQDA 3I59B 4KYWA 2QENA 4N13A 4UXNA 3TEPA 2QZ8A 4KI0E 1TQIA 3QYTA 3C3WA 2GA1A 3FMQA 4LONB 1K78B 2G9WA 2Q2EA 5D8LB 2NWJA 1JE8A 4RK9A 3H3UA 3E6CC 3JAMZ 4Q5TA 2G29A 4D0PA 4QSCA 1TFAA 1MGTA 2E0SA 4WK8F 1D9YA 3KEQA 2UYFA 3KP6A 1ONVA 4THIA 3HTUA 1BC7C 2P2AA 1IXCA 2LKPA 1XGOA 2L54A 3GVAA 2XXYA 1KYWA 3TOAA 2F5FA 3D4GA 3FD3A 4IGTA 1PDNC 1USSA 3FV1A 4RJZA 5M2VA 2F7AA 1J1NA 3KEOA 3MQ9A 4FJPA 2FBIA 1H0MA 5L3EA 3U1OA 1OYYA 1D9VA 5HM4B 3PMWA 3FM3A 2Z22A 5BPDA 1ZRCA 1FTJA 3K0LA 3IR1A 2DE2A 5AIPA 3VE1B 2BEOA 3G3ZA 1MQIA 4A5MA 1QULA 5ED4A 2PQ8A 3F6VA 3CG3A 1WQ2A 2OQGA 2HQ0A 3RN8A 2K86A 2NNNA 3JYRA 2XVCA 1S7AA 4R8HA 4ZYEA 2YPNA 1TXFA 4ENNA 3T22A 4BHPA 1YCJA 3G3FA 2DP8A 1A04A 4X1BA 3TGNA 1LCTA 2AIXA 3IL1B 3J81Z 4OMBA 1TQMA 2BGCA 2B3BA 2DXRA 4IXAA 4DNCA 1NNFA 2M45A 4RB0A 1ZIUA 4ZEFA 4U1ZA 2HTJA 1MKMA 2F5EA 5H8FA 5ITPA 2QS4A 1V4RA 4LFUA 1G3YA 5K5OA 1R36A 1RKMA 1GTKA 1B59A 3TUSA 3JZJA 1G3WA 3F22A 4UV9A 3ZMDA 2FEZA 4HOBA 2CGPA 1U78A 1P4AA 1WRJA 4C0RA 4LB5A 3E97A 2DTRA 4QFNA 2ADUA 3L6HA 1MY1A 4ENJA 2VONA 1LCFA 2XXRA 4OINF 5L9MA 1TLHB 4MEXF 4HBLA 1UTBB 5D4RA 3T93B 2DU9A 1PP7U 3VODA 1J9IA 3FX3A 3HSFA 3I54A 4LMYA 2XD2A 2RCBA 3SESA 3PUZE 2EWNA 4YIFA 3VVDA 5J8FA 1P1NA 2YX7A 3O66A 3ZMTA 3B02A 5BMZA 3MPKA 4FEDA 4EJVA 2EFPA 2BJJX 4OEUA 3IRRA 1II5A 4R73A 4G94A 4PFWA 2HYGD 2ALUA 3UGWA 3M9AA 3WTYC 2K02A 3FWEA 1BI2A 2D1HA 4Z2YA 5K1YA 2OWTA 3MPLA 1NH7A 1FX7A 2Z8FA 5I57B 3V8XB 1ZRDA 3RPQA 2M30A 3KN8A 3BFUA 4H6DA 1KGSA 3MCZA 1OYIA 5HLHA 2RCAA 4PCQA 3PFIA 1HKSA 2O69A 2D1VA 3I4PA 4KMFA 1EZ9A 2DE3A 1W4MA 1B9NA 1KQ0A 3V7CA 2VODA 3FGSA 2V3QA 3W6JB 4FE8A 4RNSA 1XVXA 3N4MA 3RNNA 3WTSC 1MXZA 1ZG5A 2CSOA 5CRYA 2GA2A 4HX4A 3QAXA 1WDNA 2P7CB 4Z7EA 3TODA 4QHQA 1A99A 4KUMA 3LFKA 1DTGA 4TV7A 5L9SA 1NNKA 4EJTA 3RTRA 3TTLA 2QUFA 2AL5A 4MTEA 3TELA 3H06B 2BYVE 1PEBA 4Y17A 5E8IA 2F5CA 3O9PA 2K4JA 4NF6B 3ULQB 2R71A 4G8MA 2H98A 1HW1A 3PUXE 4ELQA 3W15C 4IHTA 2GFEA 1B32A 5ILSA 5EHMA 3V5AA 3CIJA 4NHJA 4YAHX 3R7XA 3OSRA 3B73A 5DEXA 1U6GA 4A12A 3PQKA 5E8GA 2LAOA 2QJEA 4U7DA 2XAQA 3BPVA 1FNNA 1MJ9A 2P5LC 4DDDA 3RY3A 1P2FA 2ZMEA 1BI1A 3FV2A 1GV8A 3IHUA 2QQAA 4LGWA 1BC8C 4R9GA 3U9GA 2QMXA 4KIGA 2X26A 3K2DA 5H8HA 5ICQA 1FTOA 3TQWA 4KFQA 3V7RA 1LAFE 2IT0A 3Q26A 2M1BA 3N26A 3V83A 4HS7A 5DUIA 3HCQA 3S9EA 1LB2A 5LRRA 2FYIA 1O7TA 1HXDA 5H8SA 1U2WA 4F1UA 4LG0B 2GXBA 2OAZA 4M72A 4IHSA 4BLAA 4HF0A 1B1BA 1U5TA 1IN5A 4EJOA 2NNYA 1PB9A 3Q29A 3VV5A 4PZJA 2VHAA 4YB5A 1I5ZA 2IP2A 3F23A 1MZBA 3L09A 5I59A 2MA3A 1MH4A 3EYYA 4EXKA 4IB2A 3WG9A 4A2UA 4ECFA 3SERA 4BDQA 3M3FA 3HSEA 3KJTA 2DT5A 4UHTA 2P6SA 5DEQA 1FT9A 2WV0A 3DFGA 1VSOA 2VC0A 3VLVA 3BOQA 3QU3A 4L9VA 5FHMA 4LK1F 1YTYA 1S7OA 2RINA 1Y9UA 4GFRA 2XROA 1FLIA 5FTIA 3N97A 5LHHA 1VR5A 3TKYA 4PFYA 5FB2A 2XKOA 2PX1A 2XXVA 3C34A 4ZEKA 2FMYA 2ESHA 4ZH4F 3NEUA 3GFIA 2E1NA 1MM6A 4DIGA 3JTHA 4FT8A 1P1OA 2FSWA 4DCXA 4ZEIA 1FTMA 3GZ5A 2QSXA 2F6GA 1MPDA 3KFWX 4KIBA 5E20A 1O3SA 3LSWA 4YB7A 3HRSA 5L3GA 4UVCA 4CHUA 5E17F 3RYRA 1VTNC 4ZYDA 4Y15A 4WXJA 2F6PA 4G6QA 1ZLJA 3LSLA 4F7ZA 4DQ2A 1FZPB 4I98B 1KA8A 1SI1A 4NF8A 4BQAA 1JEVA 3C36A 1IXRC 1R00A 2H94A 2HQRA 3TO6A 1TW2A 3PUVE 1GXQA 2Y84A 3PPNA 2OBPA 1SW4A 3G3KA 2JTVA 2Y48A 3K1NA 3JW4A 3LA7A 3FXUA 3K9TA 2GIVA 4NWCA 4ISUA 1FYMA 2Q8KA 3HSTA 5E18F 4YFKF 2CYYA 4O6JA 3SHFA 5FLXZ 3U93A 2HZTA 2GH9A 1U3EM 4WWCA 2VD2A 2KIUA 3N6TA 1I6AA 3MC2A 1BTJA 2DOJA 1B3EA 3CVGA 4G68C 2FNPA 3HRMA 3BWGA 3R6SA 1LAXA 5D4SA 1FQBA 3MVZA 5E1XA 1M5CA 1HQCA 5JHUA 5LGNA 1EZPA 3ECRA 4NEDA 2EA4A 1NHAA 5EEGA 2IA2A 5AA4B 2ZBKA 1Z6RA 1A54A 2R7DA 3DELB 2VBXA 2IA0A 3WTVC 1Z05A 5TU0A 4L9NA 1GXPA 2IEEA 5JTYA 1BKAA 3KBRA 5D6FA 4MHGA 1UHMA 5TJJA 3O6IA 2UVHA 1RUOA 3T8TA 4E0WA 2O0YA 5HS8A 4IRGA 3F72A 2VE9A 2F7BA 2VBWA 1D8KA 2YJPA 3C9HA 2L02A 4I0AA 1T38A 2STTA 1J7KA 3TYHA 1TWYA 4KPTA 2QL3A 3PPOA 3K1MA 4CGZA 4XTCQ 3TDUC 3MQ0A 5L3CA 3WTTC 3WGIA 4MQ9F 1B3GA 3RTWB 2DSFA 2Y7WA 2ONSA 1WKMA 1JQFA 3QPHA 4DXUA 1OVTA 4RS8A 3M8EA 3WTZA 2DWAA 5H8NA 2Q2AA 3BDDA 4S05A 1FQCA 1DPRA 1PC3A 5HDKA 2ZMBA 3HPIA 4G68A 1JNFA 3RPWA 1B5HA 3S2VA 4F18A 5H8QA 4F31B 4XIGQ 5D5UB 4IO7A 2VT2A 1IITA 3T1BA 3IO6A 2M8EA 4GVOA 5TPAA 1ANFA 3KP5A 2OD5A 3GZGA 1L3LA 3KZYA 3LSFB 5H20A 3D0SA 2P0SA 4R9FA 4IPAA 1TQPA 4EF1A 3BZ6A 3N6UA 2RN7A 3WODF 3RKWA 3ONMA 5FTHA 1A8FA 2OQRA 5BPIA 3I53A 4RAYA 2HZLA 3PQJA 2P1SA 4AIHA 3T96B 3LA2A 3F3XA 3U2RA 2ZXJA 2V1UA 1F1ZA 1R6ZA 4AWXB 1LQ1A 1SD7A 1TT1A 4XBFA 5D5WB 1QNTA 5K5QA 3S2WA 3KP3A 3RJPA 2DK5A 2XGXA 4WCGA 2UVGA 1AL3A 2DWHA 3FJ7A 5I56B 2V3TA 3MVWA 1GGGA 4ESBA 5FFXA 1B51A 1Z91A 1B3LA 5AA1A 4GOTA 5I2NA 4LUBA 1HKQA 4B09A 1WODA 4ZS9A 2XXXA 3HYIA 1O3TA 3I58A 3K69A 4OERA 3P9IA 3VDFA 1N7WA 2HEUA 1HSEA 3EHSA 3W6KB 2CWEA 2CMOA 4PETA 5LGUA 4G7HF 1QKAA 1MDQA 1XCBA 2HKOA 4XLNF 1Y20A 2EV5A 1CGPA 3JSPA 1RNLA 3LAPA 4YIIA 3BJOA 4L0ZB 1UTHA 1Z7NE 5HLIA 1B4AA 1ZTYA 4YB6A 4ONYA 1Z1DA 4B8XA 1B1HA 2F8DA 2D2WA 3ABUA 3DP6A 1N76A 1KQ8A 1BIBA 4ON0A 3GW2A 4L5IA 4N07A 4OIOF 1D3KA 5J8CA 4M74A 4R75A 4QSDA 5BOXA 5IT3A 2FU4A 3HN0A 2ANJA 2HWVA 3RQTA 4RAZA 1XGNA 1QKBA 4C1UA 1JHHA 4JWYA 4OENA 4UVBA 3H92A 2V79A 2PVUA 4ZZLA 4JB7A 3VEPA 3J81K 2FA7A 2H09A 4UVAA 2X4HA 2XHDA 2YPRA 3SEWA 4RGRA 3MEXA 2Y7IA 4U22A 2DI3A 4E70A 5DCMB 1MY4A 4U23A 1XT8A 3OO8A 2O7UA 2UXAA 4N9IA 1WSUA 4KR5A 3L9FA 1B7UA 5DCFA 3VFZA 1B58A 4Q8RA 3B7DA 1N84A 3MZYA 4KN4X 3MUQA 5I58A 1W7PB 3K6XA 1PB8A 3TDZC 3KEIA 2CO5A 2REGA 3JV9A 2QPQA 4GLIA 4I62A 4U1OA 3H3GA 1ON2A 3P9KA 5AA2B 4EJWA 1PB7A 4RGUA 2MLKA 4RB2C 2I48A 4O5VA 4NWDA 4U0YA 3TZAA 3EQLF 3KN3A 1A7LA 4G4PA 4EM2A 3OV8A 5A5XB 3O6BB 5ICEA 5K2XA 1B9JA 2IPQX 1NKXA 2V6CA 4KT5C 1IN8A 4DXCA 5DV5A 2DFIA 2KRFA 3ZN1A 1MDP1 4OWDA 1EH8A 3VXCA 4FAJA 3ZMUA 2DS9A 1ZKBA 1B5JA 2A5YB 2A5TA 3ZQ7A 4OIQF 1OIBA 4Q47A 2R7FA 3T9VA 2PN6A 3K6UA 4KDPA 1UB9A 4RPOA 4IO2A 2A69F 1FP1D 4F1YA 3WGGA 4R72A 1IZ1A 1JXSA 4PGGA 4F3GA 2XX9A 3PPPA 2XD3A 5FHNA 1T6SA 4HZFA 4JBZA 4OXVA 1HW5A 1STZA 1MJAA 2DQVA 2V1XA 2VXZA 1YW9A 3EHTA 5B7DA 1FBUA 4U4SA 3RIRA 2P4WA 3C1DA 1HKTA 3HO7A 4ND9A 4ASNA 4NF5A 4O3BA 4ZE9A 2L4AA 5LBQA 4TQUQ 3KGCA 3I64A 2XAFA 3O97A 2A61A 2DK8A 1A55A 2HAUA 3QK6A 1FBSA 3IOWA 4BDOA 1J59A 2O1MA 3MAJA 2I0CA 1NH8A 3L7WA 1J5YA 2HKXA 5JFRA 2OA4A 4DE8A 2QS1A 4R2BA 3GBBA 1XVYA 3F8FA 3RDIA 5F1QA 4GD5A 4OFLA 5KVRA 3B6QA 1YAEA 4LQ5A 1B46A 2H25A 4I2OA 2GHBA 2PBIA 3THIA 2XXTA 1IUYA 4EM0B 1B52A 2WC2A 3U1DA 3H3ZA 2CG4A 2JRTA 5AA3A 1N0TA 3H6UA 5KDTA 1YG2A 5CVRA 1NL5A 3QUJA 5LHIA 1N04A 2XX8A 1R5GA 2UWMA 3E6MA 4ETSA 1MY0A 3FHZA 1S50A 1OR7A 2THIA 3DP4A 1ZYRF 4XLPF 3QOPA 1B7ZA 1LAGE 3K2ZA 1I6XA 3M1EA 2L4MA 1R1TA 4XRFA 4GWOA 3SFZA 3T9XB 1JHFA 3G73A 5DVJA 2P5KA 4R6KA 5KK1A 1QUIA 1B4HA 4NF4A 3PD8A 3MVYA 2XAGA 2COMA 4ESWA 3T8RA 4BH9A 1AOYA 3AXFA 2FBKA 3RI4A 3FVGA 2MLGA 4KMUX 4F3BA 3V8KA 2JSCA 3M3LA 2ZYKA 3VVEA 1USYE 1POY1 2LF7A 5EYFA 3L2CA 1O7LA 1FOKA 5DTBA 4IO5A 1T0KA 2CW0F 4OTEA 4OFOA 1LAHE 2AYSA 2HOEA 4WEPA 4L0YB 4WX9A 1LEAA 4HQMA 2HEOA 3IJOB 1Z9CA 2XXHA 2ZJ2A 3IKVA 3J7AO 4KYEA 1I6BA 2R9JA 2R6GE 4AD9A 3LA3A 2ZNYA 1Y0UA 1Y3PA 4XSXF 1ZAOA 1LB8A 3FASA 1LFHA 3HOTA 4G9YA 5CVIA 2X7PA 5K5RA 2QLZA 2RC4A 5LRSA 5ITOA 3SZTA 3S9LC 3KP2A 1QJMA 5KCJA 3SEXA 5F7VA 2W24A 3KSXA 2R3SA 4F39A 1SW5A 3FZVA 2OBGA 2OZZA 3MVXA 2QBYA 4U0WA 1A8EA 1FY7A 1URSA 5H8FB 1U5TC 1PUEE 4KCDA 1F4KA 5JVTA 4H5GA 3LSTA 2DYXA 2OZUA 1DDNA 2PI0A 4G8HA 4NB5A 5L9OA 4F2QA 3GX4X 3OO9A 4ZZEA 2F5DA 2DO7A 3EQ1A 2RKMA 2LSOA 5D5VB 3GWZA 4RB1A 3CFZA 2W7YA 3F8CA 3ECHA 1M5FA 1S29A 1IN4A 1SFUA 1ZREA 1OQGA 2B0LA 3O2PE 5AIQA 2DPDA 3A3UA 3FVKA 3MP1A 4RPNA 3O28A 2Q9TA 1BIYA 4HX7A 2I4CA 4G6DA 1MXWA 4LJZF 4CYDA 4YICA 2RF1A 5JR3A 3H6WA 2NRAC 1BIAA 4EGYA 3EPEA 5FFZA 3I3VA 3CG1A 4IGRA 3UK4A 3ELKA 1ZGAA 1D3YA 3V8JA 2FNAA 4ZYGA 3DM0A 1F5TA 2HGCA 4NTLA 3KOTA 3CUQC 1W5SA 2PMUA 4Q0CA 3O2AA 3F21A 4F19A 1DUXC 1MPBA 4TLMB 2UXNA 2NOOA 4I7HA 4ENKA 4RY1A 2GWRA 2DVZA 5FLXK 3I0TA 4JSDA 5ICGA 1JGSA 4IRHA 4M1VA 2YX4A 5ICFA 2V9VA 4HV5A 4RB3C 3TAJA 1H9GA 1RIOH 3VVFA 3SEVA 3BY6A 3T5XA 1QO0D 1EU8A 2OK2A 2TDXA 5J1DA 5FGMA 3DPTA 3ZMSA 2ZXTA 3B6TA 2W57A 3EN3A 3IWFA 3IL2A 2A07F 2O7IA 4JSOA 2DBBA 4ZYHA 2XXIA 2Q8JA 1OPCA 1L5TA 1XMKA 3DV8A 3SXYA 2F35A 3J80Z 2V25A 1G3SA 3E13X 4RGXA 4X48A 3QU6A 4P55A 4KCCA 4EUOA 1TTYA 2XAJA 2E1CA 2F34A 3HOSA 2D21A 1SD6A 3FF5A 3RYPA 1H45A 2V93A 3Q28A 2A68F 1VFEA 1BM9A 4IY5A 1UCRA 2UXXA 3O3KA 3R26A 3S4UA 2ONKE 3LAJA 1MDMA 2DWJA 2EFQA 1G3TA 2FMLA 3EYIA 4KIFA 4HCWA 5TRDA 4QRZA 2RC7A 3MAMA 2NYXA 3CUQA 4UA8A 1PDAA 2O84X 2YR2A 4KD5A 5DEXB 4FEBA 1DSNA 4R1HA 4EXLA 4OIPF 2QWWA 2VOPA 2H9BA 1CF7A 3T9UA 5CI5A 4U21A 5LLQA 2O51A 5I2KA 4OHNA 4DZ1A 2DAOA 2ZMEB 1LB9A 1SW2A 4LB6B 4R74A 3ZKLA 3TCHA 3LC8A 5H8HB 3ZKKA 4PE5B 5L3BA 3IWZA 1ATGA 2W85A 4ELOA 1FPQA 4HYEA 1UQWA 2XRNA 4A5NA 1JW5A 2WWYA 3TO9A 4QLCU 1MM7A 4OQOA 4MFIA 3MP8A 1IIWA 2H6CA 4YFNF 3K1PA 3E3KA 2VBYA 1R5HA 3ISPA 1F9BA 1HSLA 4HV6A 4L5JA 1AH5A 1DPUA 2GAUA 3RTFB 4YKPA 4GF8A 2C6YA 2EV0A 1LFGA 1Y4TA 2XASA 4UUVA 2Q2CA 3KJ7A 5I59B 2B65A 4MF3A 3WAFA 2F97A 2RC8A 3FVOA 1AOVA 4PQJA 2IJLA 4LLLA 1C0WA 1JETA 1FQDA 2DLLA 1ZG1A 2ZYOA 2V1DA 1SQYA 3C33A 3TOBA 3W9WA 2NAZA 2QMWA 5HS7A 3CJNA 4OOIA 2RGVA 4N9HA 2DE4A 1Z6TA 1IXHA 1YPNA 2VT3A 3HHHA 2J5OA 1M5BA 3C31A 4XKRA 3RLFE 3WE3A 3EUHA 1SBPA 2PEXA 3I5OA 2BE5F 1R1NA 3ZMZA 2F36A 3PU5A 1B9MA 3QIMA 2ISYA 1YS6A 1QBJA 3KG2A 3CDHA 4N0BA 3M7GA 1P99A 3KLNA 4I01A 1JW4A 1W7PD 2EFOA 5BS6A 2PMSA 2K27A 3F8BA 3DF8A 3V8LA 2FA5A 1SD4A 4LVQA 5HVQC 3Q27A 3CSBA 4BHBA 3TPAA 3VB2A 4HF1A 5AA2D 1XDSA 3BKIB 1J0RA 4M9SA 1FQFA 4H67A 1GVJA 3MWBA 5F1RA 4I09A 4E0XA 5ISUA 1LDDA 3R4KA 4QFLA 4AIJA 4NF8B 3IOUA 4YU0A 4CO8A 1TW3A 4R6HA 2UVJA 5BQTA 3FUZA 4K2EA 2KIMA 4I9DA 3K01A 2CFXA 2Y75A 3WTUC 1ZBMA 2DWIA 2ZNTA 1QVSA 5DUKA 4HW0A 3PMVA 1R1VA 1MXVA 1J2XA 3JSOA 2ESNA 1MXYA 3BBRA 4JXIA 3GLBA 3R60A 3ZPLA 5CLSA 2O6GE 3HIFA 3FJMA 4CDGA 3NQOA 1SFXA 3OOPA 4WXDA 1XC1A 5IKBA 3AAFA 3VXBA 3QAHA 1SD5A 2LNBA 3KN7A 4PP0A 3IB1A 3SQNA 3GUDA 4NMYA 4YKKA 2FQ3A 3IORA 1BBYA 1S3JA 2P8TA 4C1TA 3TQNA 2XXQA 3MWMA 4ENMA 2MD5A 1PBPA 2GRVA 4BAYA 3ZSFA 1SYIA 2PJPA 1B05A 1RI7A 5L8DA 4H8IA 2ZNUA 3USDA 5FHOA 3D5LA 3DLNA 3K4UA 2M8CA 5JTYB 2FBHA 5HBCA 3RGYA 4H8JA 1FTLA 4HDUA 2VBZA 4OETA 4P0IA 3QP5A 4ZZAA 3O6GA 2HAVA 3DKWA 3TCGA 1ZLKA 1MQGA 2Y7KA 1IRFA 3L00A 3WTXC 1YFHA 4U7BA 1U8RA 1PBQA 3SDFA 4M6YA 1FYKA 3MFKA 4LZ7A 4WEDA 3QXMA 3T9HB 5FD6A 3PUWE 1MD0A 1P1WA 4X1DA 1IN6A 2IA4A 5H8NB 5LHGA 5ILUA 3ZS6A 3G7WA 3CO6C 4G68B 2OLBA 3K00A 4XSZF 4P96A 1ZRFA 1FQAA 4JDFA 4U2RA 5H8QB 5CMKA 5IAIA 3G3JA 1OLAA 4WXHA 1S8NA 3PMXA 5TPAB 5TP9A 1N3XA 2K7LA 1XOCA 3UIFA 1LSTA 1VFDA 2RKHA 3I59A 1Q1KA 3E5QA 1NFTA 4KFCA 1O63A 3OENA 1RYXA 1S7YA 4Q30B 1K78A 1I69A 5ILVA 1KU3A 3EETA 5A2QZ 3BP8A 4A0XA 5H6QA 1DPEA 2ONRA 1D4NA 4IY6A 3FVNA 3G3IA 1ODDA 4LA9A 1Y4CA 2RVCA 1W5TA 3H6VA 3UORA 2XXWA 1R22A 2KKOA 4DXBA 3WE2A 5CBSA 4UNOA 3DPLC 5CBRA 3FMSA 4OZ9A 3HHGA 3U92A 2FXAA 1KQ9A 3KLOA 3GF2A 1R58A 2Z9OA 3OXNA 1R23A 4M9XA 1SI0A 2DQRA 3TTKA 5I2NB 5LGTA 1S9TA 5HLGA 3NRVA 4KA4A 4OFJA 1HBXG 1LEBA 2H27A 3E4RA 1LBCA 3IB0A 3O29A 1OVBA 1XSVA 4EJUA 4FHTA 4HW8A 3QP6A 2VOZA 4UACA 2EV6A 2D5WA 2L3DA 1FCKA 4JK1X 5D8KB 3GFJA 1BN5A 3C18A 4KYDA 1B3FA 3KZGA 2HTSA 4O3MA 1MJBA 3BJAA 1FYLA 4ELPA 5F64A 2XXUA 4BDRA 1B7HA 2DXYA 2PMHA 4G7ZF 3TTRA 1KU2A 1R1UA 3GYHX 2ZYNA 3S9NC 1BI3A 1SAXA 2ZFWA 1US4A 1UTHB 4LLGF 3GZ6A 2H4IA 2UVIA 5LEJA 1TFDA 4M6XA 3GXOA 2EK5A 1D5VA 2RV8A 3PGFA 5IT9Z 3VOEA 4R6YA 3P9CA 1ON1A 1GR2A 3CR9A 2PLYA 5BWJA 2DQLA 2RQPA 4XKQA 3F8NA 1FSHA 3GEZA 1NMUA 4S04A 3ABTA 5BUUA 1E2XA 2ZNZA 4OMYA 3TQLA 3C7JA 2QQBA 4MEYF 5HDNA 3MZ9A 4GL0A 2L01A 3IRQA 2PG4A 1TNTA 4JQFA 1T39A 1EH6A 1WVJA 1MY2A 2XV4S 4EDPA 4EQ7A 4YKIA 2O3FA 5CMBA 1XDUA 4M9ZA 3QPTA 4FX4A 2X7QA 2RDPA 4QSEA 4EMSA 5D5XB 4I0BA 3RUMA 1USYH 3I5UA 5DDGA 2D45A 4G7OF 3KSJA 1UTBA 1Y1ZA 1QQIA 4PFUA 4IO4A 5I58B 2HDCA 3IAZA 1OMIA 5HPQA 2E7XA 2Z3YA 3QUFA 1X3UA 4I8CA 5JEIA 4WXCA 4ESFA 4YFXF 3JTGA 3MJNA 4K3FA 3SEYA 2ELHA 1I1GA 3R6UA 4ZZDA 4JBAA 3CI8A 2GZWA 2PBWA 2ZNSA 1A40A 4A6DA 1FC3A 4EM1A 2JT1A 2I3VA 3PD9A 4EVIA 1M5EA 1F9NA 1USTA 1I27A 2OCUA 3SKPA 1GHCA 3E5XA 4GXSB 3SEUA 5I57A 1MPCA 2CZLA 4ESXA 2KJCA 1ZARA 2KLFA 3CFXA 3ZN0A 4CICA 2A5TB 1R7JA 3DQVC 4NE4A 4LK0F 1YTVA 2HYFA 2W84A 4M71A 1HW2A 2HR3A 1URDA 5CVUA 3FATA 2JPCA 3F6OA 4ESJA 3TDJA 3GO5A 4ZEDA 5F6FA 2FNCA 4G2ZA 4BDMA 3KFMA 5CVJA 3HRTA 4KNYA 2I0BA 3P7IA 4F2OA 1IQ7A 2QQ9A 5H6RA 1SDXA 1SW1A 2Z8EA 1DP7P 1MS7A 5AONA 3IK6B 3TTNA 1DMBA 2I49A 1YQAA 4NF5B 3GLXA 3KZZA 1R9LA 4NF6A 4QWQA 2ZKZA 3E6DA 5EHSA 4MGRA 3TFLA 1SFEA 5CJ9A 5DYMA 3J80K 2EA2A 4RYAA 3VLWA 3A3CA 3B6WA 3SZPA 1E17A 5HS9A 3DP7A 2VOOA 2PT2A 3PV0E 4FIMA 1WI9A 1P1QA 2PYYA 2G93A 5FO5A 5DVIA 5EEHA 1B0HA 3V89B 1I1SA 4PFTA 2KIFA 1B2HA 2YLNA 3KCCA 5KDTB 4LQ2A 3T0YA 1G4DA 4P5OA 2HFBA 2O1LA 4LD5A 3U8QA 1BI0A 3QSLA 4IO6A 3CLOA 3EF7A 3OD7A 2UYEA 3MZHA 2A5SA 1OQHA 4RGSA 3H4ZA 3UA8A 2QS3A 2H99A 3OEKA 1ZJLA 3ML6A 3E3VA 1MH3A 1B0LA 1T98A 4LG0A 2VP1A 2HQNA 4XKNA 4NF4B 4FX0A 5CVVA 4H0EA 4HX8A 1K79A 4GO1A 1UHWA 4QF9A 3IOTA 1XSDA 2Z8DA 1FBQA 1T0FA 3K02A 2DVCA 1OMPA 1DPPA 2QVOA 5DT6A 1IXSB 2IVMA 3CTAA 3KETA 1IUDA 3FIRA 1P92A 2XKPA 3DEUA 3WU0A 3FJGA 3CO7C 2I6EA 2Q0OA 4Q5SF 2EB7A 4Z0IA 1UFMA 2O03A 1B6AA 2HZKA 1EH7A 3RKYA 3E5UA 3FM5A 1BP5A 4FORA 2F2EA 1NNPA 3TKDA 1AIVA 1IEJA 4MLVA 2NUVA 1LDKB 1FTKA 2P5VA 1QUJA 4EQBA 3IKTA 4OIRF 3H03A 5ICCA 4G8XA 3RKXA 5FD5A 2ABHA 2PT1A 1MQHA 1QUKA 2OJTA 1ZLQA 2VGQA 4A6EA 5L3FA 4HAMA 2ISZA 1T2KA 5KCJB 4HCYA 2GQQA 1O64A 2JZYA 2O6AA 2KJBA 3CUOA 4EQQA 1B4ZA 3BFTA 2V3UA 4LZ8A 1V3FA 4CXFA 2QBYB 1QZYA 4JWXA 5DD8A 5KZTA 4I02A 3VLUA 5JI6A 3EDPA 3D4CA 2O8XA 1LBBA 4BXUA 4BDNA 2WTEA 5ELVA 1YW8A 4YG2F 2LF8A 1FW0A 1OLCA 3A09A 4XXUA 1IF1A 3O6HA 1R9QA 2F78A 4QFPA 4U88A 4OVJA 3K6WA 3OOAA 2P6TA 1REPC 1ZGJA 3DXJF 1JVYA 4LATA 2RNJA 2QYOA 1B6HA 5DVFA 1N7XA 5K2YA 5CMMA 5I84A 4M4GA 1WWXA 2ZYMA 4JWOA 4TOZA 1O57A 4OYVA 4HLXA 1FQEA 2FOKA 2X0LA 3M8FA 2XHKA 4O3CA 2EJRA 4PGHA 3T66A 3FMRA 4F29A 3ILTB 1FWZA 1Y1MA 1Z7ME 1JEUA 4F1VA 4KQPA 2G7UA 4U4XA 3ODBA 1ZU0A 3WTWC 4ZECA 1SD3A 1IAWA 1KU9A 3K6VA 1POTA 3F11A 3WAEA 3DP8A 4N6PA 4ZE8A 3E6BA 2G7HA 1YO5C 4GCVA 1IXGA 1ZH5A 5AE4A 2MH2A 5AA4A 1ZG3A 4MQVA 3L6GA 5E1ZB 3R61A 2M5WA 5CM6A 2E1SA 3H6TA 3Q9SA 4A0ZA 4MLQA 1OKRA 1XCVA 1QW0A 2OWSA 4MH5A 3LR1A 2MBFA 1IXIA 4GXAA 5HDGA 4OEVA 1KU7A 1U5TB 4QFOA 4AIKA 1XN7A 3CRBA 3TTMA 4L18B 4EGZA 3MP6A 2H5YA 4M73A 4KN7X 4OESA 1LDJA 3LWFA 2ETHA 1K7AA 3C35A 1GVCA 4YMAA 3ROUA 1FSEA 4BYYA 4AVPA 2W25A 4LZ5A 1MXXA 4L9JA 1Z7UA 1SMYF 3I6VA 5DD4A 2XIGA 3E9XA 3KE2A 1P6RA 4P9UA 3REOA 2O68A 2GXGA 2MH9A 3IC7A 5CMCA 2IA1A 2Y0MA 2STWA 4QFKA 1J75A 1MDMB 4NQWA 2NVUB 3KP4A 4WKMA 1H44A 1N3WA 2CQKA 5DYHA 1ZN2A 5HOOA 3CUQB 4DLDA 3BROA 3I71A 2FF4A 5B70A 1O7FA 1HSJA 3OMBA 2OU2A 3IOVA 1MXUA 4F3PA 4H0WA 3KOSA 2I4BA 1QZZA 1CF7B 1I6QA 1KWHA 4AB6A 1K6OA 2B3FA 3IJXB 3BPXA 2E7WA 1Q35A 2QM3A 1AMFA 5I2KB 1BJAA 2P7VB 2DW4A 4BHCA 5CC2A 2F5XA 2XX7A 1RZ4A 1SMTA 5ERIA 4EV0A 2RC9A 1XGSA 3MBPA 3MZ1A 1LFIA 2HFHA 2I3WA 3RT8A 3UN6A 2V84A 3WGHA 3TMGA 4L17A 1XS5A 3IO4A 3FXRA 1ZHFA 2VN2A 1KYZA 4Q4ZF 4BDLA 3ILUB 4IRIA 4KHZE 4TLLB 3OSQA 3PPQA 4P9FA 4GQOA 1MY3A 4AB5A 4YKJA 4LP2B 5I56A 4H65A 2YSRA 1DTZA 1D8JA 1TNSA 4IVNA 5A2QK 4G8NA 1YIOA 4A0YA 3G3HA 1LGBC 2HS5A 4IF4A 1EZOA 1M5DA 2A6HF 4EF2A 3WU1B 2VC1A 1BOAA 3C32A 4GIZA 4F3SA 2Z23A 2IW5A 3UP9A 1MG1A 1P4XA 1DOTA 4I1DA 1B3HA 1MRPA 1URGA 2O61A 4KYSA 2M87A 4LLNA 2F7CA 3W9VA 2VE8A 2MC3A 1YYVA 5J6XA 2XAHA 1AWCA 2I58A 3GFMA 4RK2A 2REJA 5E1WA 2J5PA 4WF2A 1B40A 4EQ9A 4XKPA 3COAC 4MBPA 4L9TA 4GRKA 3LQRA 1H9TA 3CSGA 4HA8A 1H43A 4OU0A 3R0JA 2ZCWA 2GHAA 4H1XA 3GXAA 2OZ6A 3PUYE 3U94A 2Y7PA 2Y7RA 4FATA 2D3IA 2Q88A 4Y13A 3M3KA 3OEMA 1O3RA 1XB4A 3HRUA 2LDUA 4G77A 1Y3QA 2BV6A 1JVXA 5D6EA 3U72A 5L3DA 1SVXB 5ICTA 3K0VA 4ZDMA 1YS7A 1OYWA 3ZMVA 4P0GA 4H5FA 1XMAA 4IJAA 4ZEBA 1G6NA 1ZMGA 2EFWA 4KICA 5IT9K 4DCYA 4UV8A 1Y3NA 1FP2A 2XUBA 3SETA 3CFLA 1NNTA 3Q5FA 1H3DA 3V7SA 4ELRA 2FE3A 1PP8F 2Z33A 1BLFA 2H6BA 2AXLA 3QRFF 1UIUA 1CE2A 1QGPA 3JAMK 5DCMA 1IW7F 2ZO4A 3RPUA 3EHUA 3OO6A 3GFLA
chains in the Genus database with same CATH superfamily
2R0QC 1L0OC 2P0WA 1EKEA 3F8MA 5GTIC 3OELA 1TT0A 2Q89A 5EQ8A 2LY2A 1VE4A 4HTGA 1FIPA 1QPMA 2WAQN 2E34A 2YS9A 1W7PA 3V4GA 2R8TA 4O3AA 3HXLA 2PFBA 4GGGA 1XHYA 3B50A 2V4JC 2UZKA 4IHVA 5JK4A 1LNWA 2JUCA 5LOMA 1US5A 1ZK8A 4KISA 2DN0A 5ET6A 4UUSB 1B1XA 4HDVA 2K4BA 1XSXA 4MNUA 4IO3A 4FECA 2DPUA 4Y3OA 2Z99A 4GL8A 5AA2A 1RUNA 4D5FA 1IRGA 4XLFA 3HJEA 5F1JA 4POXA 1UIVA 2AS5F 1ORKA 3VWBA 4IHYA 1SYHA 4P11A 3M8UA 1P4WA 5A5XA 4GYIA 1R71A 3ERED 1D9QA 1E3HA 1O3QA 1XGMA 2X6XA 3ZQCA 3IB2A 1EZ9A 1QZEA 3LSXA 4N15A 2A3SA 3TP3A 4HLYA 3A2KA 3PPRA 2LKSA 4Q48A 4BNCA 2FRHA 1B5IA 3IX1A 1HDDC 4RA1A 4F22A 4R2FA 1EV7A 3O8GA 1BL0A 2WKYA 1YLFA 3H7MA 2NXOA 1TBXA 1YZ0A 4PJLA 3KP7A 2NS0A 2Z5UA 4GYGA 3C2HA 1ULYA 5CYVA 3VFJA 3S3OA 3ECOA 2WB1A 1H76A 2HXWA 4MTDA 3MZBA 1LAGE 4I6ZA 3R0AA 1ELJA 2IRFG 1HSTA 3S9MC 1LJ9A 2VD3A 3RT6B 4PJJA 3HV1A 3LBSA 2L5QA 1YX5A 3AG1H 2BBYA 4RXLA 5I56B 4R79A 1OCOH 4ZDOA 3C4MA 1U0JA 2KRCA 1YW7A 5F27A 5E3NA 1YJ9I 1KA0A 3HTSB 2E2IJ 4HF2A 2EFNA 4HQEA 1Q1HA 1XD7A 1S6LA 3BJ6A 3HSRA 4ZJZA 3M07A 3LQQA 5LEKA 2AL4A 2CV2A 4X9TA 3PNVA 1IV6A 3FXQA 2JPBA 3HHFA 2NOGA 1IRXA 2YU3A 3MW0A 3GBAA 2QS2A 3BIHA 3TCFA 1P7IA 1P1UA 3LUYA 2QRYA 4I76A 2X6WA 3TO7A 1EH3A 4MNCA 3HUGA 3LSKA 2DMUA 3Q25A 4OMZA 3G3GA 1JW1A 4U0VA 1LVAA 3KYLA 2A6EF 4YMBA 1WJFA 3PL8A 1IN7A 2E60A 3Q9VA 4GXOA 3PFYA 2HCAA 1CB6A 3OO7A 1LLSA 4PDKA 3ZP5A 1MQJA 2XXPA 4CZZA 6PAXA 1RYOA 3Q0WA 2XSDC 4YZZA 1FOYA 2ZXHA 4GWXA 5TP9B 2ACJA 5I5PA 4AQ4A 3N5LA 2N8GA 2OPTA 4POWA 4MHFA 3P7NA 3N94A 2V4CA 1X19A 3K10A 1IO2A 1MQDA 4PAFA 5B70A 3I59B 4KYWA 2QENA 4N13A 2EZKA 4X8RA 4UXNA 3TEPA 2QZ8A 2KISA 1TQIA 3QYTA 4KI0E 3C3WA 2GA1A 2MGQA 3EUKL 3FMQA 2DJIA 4A93J 4LONB 2ZJPF 4A3JJ 1K78B 2G9WA 2Q2EA 5D8LB 3HEFA 1JE8A 4OANA 2JMWA 4RK9A 3H3UA 3E6CC 3JAMZ 5EG0A 2FBPA 2G29A 1IJWC 4Q5TA 4D0PA 3JRBA 4QSCA 4ZDPA 2KRHA 1IMAA 1TFAA 1MGTA 2E0SA 4BJTA 4WK8F 5CQEA 1EF4A 3KEQA 1D9YA 2DTZA 5IOZA 2UYFA 4KXPA 3KP6A 1ONVA 4THIA 2HOAA 3HTUA 4P1EA 1BC7C 2W00A 1IXCA 2LKPA 2PMZN 4A3IJ 1XGOA 2P2AA 2WADA 2L54A 3GVAA 4V2FA 2XXYA 1KYWA 3TOAA 2F5FA 3OYLA 9ANTA 3D4GA 3FD3A 4IGTA 2CUFA 5TISC 1PDNC 1USSA 1WVRA 3FV1A 1ZR2A 4NGUA 4RJZA 5M2VA 3FXKA 1J1NA 2F7AA 5J40A 3KEOA 3MQ9A 4FJPA 2FBIA 4JOMA 1H0MA 5L3EA 5JVGF 3U1OA 1OYYA 5EYGA 1D9VA 2X9DA 1DBZA 5HM4B 1HDPA 1VDWA 3FM3A 3PMWA 2Z22A 3GTQJ 4GBWA 1SC7A 5BPDA 3I3LA 1ZRCA 1VQ5I 1FTJA 3K0LA 3IR1A 2DE2A 5AIPA 1H88C 4GWUA 4JX4A 4N4UA 3VE1B 2BEOA 3G3ZA 1MQIA 3H35A 4A5MA 1K9YA 1QULA 5ED4A 2PQ8A 2XPWA 3F6VA 1G8XA 3OR2C 3CG3A 1WQ2A 3HGGA 2EPFA 2HDDA 2OQGA 5LTCA 2HQ0A 1T95A 3RN8A 2K86A 2NNNA 2XWOA 5CKTA 3JYRA 2XVCA 1S7AA 1HC8A 4R8HA 4ZYEA 2YPNA 3A0BC 1MBGA 1OLTA 1TXFA 4BU2A 4ENNA 1AA7A 3T22A 4BHPA 1YCJA 1MBFA 3G3FA 2DP8A 1A04A 4XL9A 3VSKA 4X1BA 3TGNA 2R5ZB 1LCTA 2AIXA 3J81Z 3IL1B 4OMBA 3FXMA 1TQMA 3OIOA 4C2UA 1X1CA 2BGCA 4NC8A 2B3BA 2OX3A 1Q1VA 5EZHA 4XK4A 2DXRA 2TCTA 4IXAA 4DNCA 2M45A 4RB0A 1NNFA 1ZIUA 4WEPA 4ZEFA 4XLCA 2VPLA 1S7EA 1NG7A 1YRNA 2R7WA 2X85A 2HTJA 3RZOJ 4U1ZA 1MKMA 2F5EA 1A6IA 2CEXA 3AKZA 5H8FA 5ITPA 3CESA 2QS4A 1MBHA 1V4RA 2E5ZA 4LFUA 1D0YA 1G3YA 5K5OA 3BLYA 1R36A 1TWCJ 1WJBA 1RKMA 4RMNA 1MIJA 1GTKA 1B59A 1JTYA 1MBEA 3L2RA 3TUSA 3JZJA 1G3WA 3MKYB 3F22A 1LE8B 4UV9A 1JGGA 3ZMDA 3ZQIA 5KAIC 4A3DJ 2IS6A 2FEZA 4Y7NJ 4HOBA 3G1MA 2CGPA 1U78A 1P4AA 1WRJA 4AM3A 3BQZA 4C0RA 4LB5A 3E97A 2DTRA 3KZGA 2LVSA 2ADUA 3LSIA 4CYCB 3L6HA 4QFNA 1MY1A 1WPKA 1G0HA 4ENJA 2VONA 1LCFA 4BJ5C 2AHQA 3H3VK 4PJNA 4OINF 2XXRA 2CJJA 1FTZA 5L9MA 1TLHB 4MEXF 4HBLA 3D1NI 4B44A 5D4RA 1UTBB 4GWZA 3T93B 1JJ6C 2R7UA 2DU9A 1PP7U 3VODA 2WAQA 1J9IA 3FX3A 3HSFA 3I54A 4LMYA 4PF8A 2GQ1A 2XD2A 2RCBA 3SESA 3PUZE 2EWNA 4YIFA 3VVDA 5J8FA 1P1NA 2YX7A 3O66A 2K5CA 3ZMTA 3B02A 5BMZA 3S3NA 2F4OB 3MPKA 3LSRA 4EJVA 4FEDA 2EFPA 2BJJX 4OEUA 4PE3A 3IRRA 3TP0A 1II5A 4R73A 4G94A 2NS8A 4PFWA 2HYGD 2ALUA 1FPLA 1YYZA 3UGWA 3M9AA 3WTYC 4UB8C 1NV2A 2K02A 1V55H 1BI2A 2D1HA 3FWEA 4Z2YA 5K1YA 2OWTA 3MPLA 3HM5A 2ZMEC 3MKZA 1FX7A 1NH7A 2Z8FA 4PF6A 5I57B 3V8XB 4JP0A 1ZRDA 3RPQA 2M30A 3KN8A 1FPIA 3TW7A 1DCUA 3BFUA 4H6DA 1KGSA 3MCZA 1OYIA 5HLHA 4D5CA 3BR2A 2RCAA 2F48A 3UR3C 4PCQA 3LV0A 3PFIA 1HKSA 2O69A 2D1VA 3I4PA 1BR2A 4KMFA 2OJED 2VKHA 1W4MA 1B9NA 1KQ0A 4FQGA 4XRSG 4CCJA 3V7CA 4DW6A 5M5YJ 4N81A 4DLDA 2VODA 3FGSA 2V3QA 3W6JB 3K4NA 3OYEA 4FE8A 4RNSA 4M3BA 2R7SA 1XVXA 2PCRA 3N4MA 3FXOA 3RNNA 3HKZN 4OVQA 3WTSC 1VI0A 1ZG5A 2CSOA 1MXZA 4H65A 5CRYA 2E2HJ 4PK4A 2GA2A 4BGDA 4HX4A 5TGTA 3QAXA 4PFIA 1WDNA 2P7CB 2Q8MA 1X4PA 3CDLA 3TODA 4Z7EA 4QHQA 4PGNA 1A99A 4KUMA 4XLAA 4OAYA 3LFKA 1DTGA 4TV7A 5L9SA 1NNKA 4EJTA 3RTRA 4J00A 3TTLA 2QUFA 3BTJA 1NV0A 4P1WA 2AL5A 2XF5A 4MMPA 4MTEA 3TELA 3H06B 2BYVE 1NG6A 1PEBA 3BG3A 3MYUA 3H5AA 1WH5A 4Y17A 5E8IA 3CCMI 2F5CA 5C3EJ 2K4JA 1X2MA 3O9PA 2QVVA 4NF6B 3ULQB 1INPA 2R71A 1Y39A 4C30A 1HW1A 1DQUA 2H98A 2Z2SB 4G8MA 2X6YA 3PUXE 4ELQA 3MKLA 3W15C 4IHTA 2DA3A 2GFEA 4MX6A 1X1DA 1B32A 5GP9A 5ILSA 4XIDA 2LD5A 5EHMA 3V5AA 3CIJA 2VASA 3C2BA 4NHJA 4YAHX 1D1BA 5F0FA 2BW3A 3OSRA 3R7XA 2WAFA 4CCOA 3B73A 2M34A 5KAFC 2L5VA 3FXJA 5DEXA 1U6GA 1Y8RB 4A12A 3PQKA 2KZVA 5E8GA 1B72B 1YOVB 2LAOA 2QJEA 4NX1A 4U7DA 2XAQA 2DDBA 3BPVA 1FNNA 2JA2A 1LBYA 1RKTA 1FBHA 4CCLA 4LIVA 3BR1A 1MJ9A 3O8HA 2P5LC 2YU9J 4DDDA 3LL7A 3RY3A 1P2FA 3E1SA 2ZMEA 1BI1A 3D5SC 1EJ9A 3FV2A 4C2TA 3IHUA 1GV8A 1PUFB 2QQAA 4LGWA 1BC8C 4R9GA 3CJRB 2GOXB 2F4IA 3U9GA 4KIGA 4BL0B 1QPIA 2QMXA 2X26A 1FTOA 3K2DA 5H8HA 3TQWA 4M6VA 4UY8I 4KFQA 3TBIA 3V7RA 3DPUA 1LAFE 2IT0A 1UMQA 3Q26A 2M1BA 3N26A 3V83A 4HS7A 5DUIA 5E79C 4ZTFA 3HCQA 3S9EA 1LB2A 1D1AA 5LRRA 2PMZA 2MG4A 2FYIA 2QFLA 1O7TA 1HXDA 3SDGA 5H8SA 1U2WA 4F1UA 4LG0B 3IP4B 2OAZA 4M72A 5B5EC 4IHSA 4HF0A 2GXBA 4XF5A 1B1BA 1U5TA 1IN5A 4EJOA 2NNYA 2PJRA 1PB9A 3I56I 3Q29A 4PZJA 3VV5A 4AS4A 2VHAA 4YB5A 1I5ZA 4XM3A 2IP2A 3F23A 2MC4A 1MZBA 2LRDA 3L09A 4HPQA 4Y4RA 3S17J 5I59A 2MA3A 5B1BH 1MH4A 2GBYA 3EYYA 1X1AA 4A3KJ 4IB2A 4EXKA 4I3EA 3WG9A 1DP3A 4A2UA 4ECFA 2DDAA 4MLOA 3SERA 4BDQA 3M3FA 3HSEA 3KJTA 2DT5A 4UHTA 2P6SA 3KIOA 5DEQA 4C3IJ 1MMNA 1UZCA 3CMAI 3KC1A 1MBKA 3ABMH 1FT9A 2WV0A 3DFGA 1VSOA 2VC0A 1FPEA 3VLVA 3RKQA 1BW5A 3BOQA 3QU3A 4L9VA 5FHMA 1R49A 4LK1F 1YTYA 1S7OA 1QVUA 4XOTA 1K83J 2RINA 5KHDA 1Y9UA 1X4OA 1WJCA 1IMCA 2VI6A 4GFRA 1GV5A 2XROA 1FLIA 4N91A 5FTIA 5E3MA 2R5YB 3N97A 5LHHA 1VR5A 3TKYA 4PFYA 5FB2A 4RAGA 5J3LA 2XKOA 2PX1A 2XXVA 3C34A 2UV1A 2CEYA 2FMYA 2ESHA 4ZEKA 4ZH4F 4CZCA 3NEUA 4IL6C 2E1NA 3GFIA 1MM6A 4DIGA 3JTHA 4FT8A 1P1OA 2FSWA 4DCXA 4ZEIA 1WI3A 2WEFA 1FTMA 3PIOF 2Y9ZA 4N8YA 2HZDA 3GZ5A 2QSXA 2F6GA 1MPDA 3KFWX 4KIBA 1WJDA 5E20A 1O3SA 3LSWA 3HRSA 5L3GA 4X04A 4UVCA 4YB7A 4IKFA 4CHUA 5E17F 3RYRA 1VTNC 4ZYDA 4Y15A 4WXJA 2F6PA 4G6QA 1ZLJA 3LSLA 4F7ZA 4DQ2A 1IV8A 3L2UA 2VL8A 2BVMA 1FZPB 3L2VA 4I98B 1KA8A 3DTEA 3N05A 4BQAA 1JEVA 1SI1A 1IXRC 1VZ0A 1R00A 2TRTA 5GPAA 4B1RA 3C36A 2H94A 2HQRA 2VT5A 3EUAA 3JREA 2VQHA 3TO6A 1TW2A 2B7EA 3SFIA 3PUVE 3AG2H 4BY7J 3I55I 3CCLI 1GXQA 1K4TA 5IZZA 2Y84A 3PPNA 2OBPA 1SW4A 1D1CA 3G3KA 5IGAA 2JTVA 3EHUA 2DXIA 3ZRGA 2Y48A 3K1NA 4LG3A 3PO3J 3JW4A 3LA7A 2DA1A 3FXUA 2QVUA 3U65A 3K9TA 1XG1A 2GIVA 4NWCA 4ZYAA 2O8KA 2MFZA 2XGDA 4DZPA 3OSFA 4A69C 1FYMA 1RDXA 2Q8KA 3HSTA 1WHUA 2CQNA 5E18F 4YFKF 2CYYA 4O6JA 3SHFA 5FLXZ 3U93A 1N75A 2HZTA 2GH9A 4PBQA 4DZJA 1U3EM 4WWCA 4BE2A 2KIUA 2X51A 2VD2A 3N6TA 3VSLA 1I6AA 3MC2A 1BTJA 2DOJA 1B3EA 3CVGA 2A6TA 4KJZA 2JA6J 5IY5H 4G68C 2V9PA 2FNPA 3RYDA 5IP6A 3HRMA 3BWGA 3H9GA 4C2MJ 3R6SA 1LAXA 5D4SA 1FQBA 3MVZA 5E1XA 1M5CA 1HQCA 5JHUA 5LGNA 1EZPA 3ECRA 2ID6A 2K9SA 5IP9J 3FK6A 4NEDA 5HODA 2EA4A 1NHAA 1WCMJ 5I7IA 5EEGA 2IA2A 3W2VA 1OFCX 5AA4B 2ZBKA 1Z6RA 2HNHA 1ZELA 2R7DA 2CU7A 1U8BA 2KP6A 4A3GJ 2R7TA 1A54A 2DE3A 2CZHA 3DELB 2VBXA 2IA0A 3WTVC 2Y5LA 1Z05A 5TU0A 4L9NA 1POGA 3U1KA 2I5UA 3JRGA 1GXPA 2Y2ZA 1JTXA 3OYJA 2IGKA 2IEEA 1BKAA 5JTYA 3KBRA 5D6FA 4HG2A 4MHGA 3VYRB 4C3HJ 5GPCA 4HEA2 1UHMA 3HKZA 5TJJA 3O6IA 2UVHA 3A1YA 1MMSA 1RUOA 3CQZJ 1JKPC 1QU3A 3T8TA 4E0WA 2K9QA 2O0YA 3S93A 3CCQI 5HS8A 4IRGA 2L7MP 3F72A 5ET8A 1VQPI 4S0HB 2VE9A 2F7BA 2VBWA 2QSFX 2JA8J 1D8KA 2YJPA 3C9HA 1TZLA 2L02A 4I0AA 1T38A 2STTA 1J7KA 5C4JJ 2HPGA 2GOMA 1XX5A 2X6OA 2LLKA 1TWYA 2Y5KA 4KPTA 3TYHA 2Y30A 1IRZA 2QL3A 3PPOA 3K1MA 2ZJQF 4CGZA 1RC9A 4XTCQ 1GUUA 3TDUC 4DGWB 3BG6A 2OV7A 3H1CA 3MQ0A 5L3CA 1FBEA 2VIXA 3WTTC 1ZR4A 3WGIA 4MQ9F 1VQMI 1B3GA 3RTWB 2DSFA 1Z21A 1NK2P 2Y7WA 1APLC 2ONSA 1WKMA 3LSGA 5GADJ 4NQWB 1JQFA 3QPHA 4DXUA 1OVTA 2OC6A 4RS8A 5HNFA 3PO2J 3DWLE 3M8EA 3WTZA 2DWAA 5ET5A 5H8NA 3G1LA 1XPXA 2EBIA 3ERMA 2Q2AA 3BDDA 4F91B 4S05A 1FQCA 1DPRA 1PC3A 5HDKA 4NBQA 3IUOA 2ZMBA 3HPIA 4G68A 3MN2A 1JNFA 1B5HA 3RPWA 3S2VA 1KA1A 5H8QA 4F18A 4F31B 4XIGQ 5D5UB 4IO7A 2VT2A 1IITA 3T1BA 3IO6A 2M8EA 4FBPA 4GVOA 5TPAA 1ANFA 3KP5A 2OD5A 4RM2A 3GZGA 5LDZA 1L3LA 2E5NA 3KZYA 3LSFB 5H20A 3D0SA 2P0SA 2WBDA 4R9FA 4IPAA 1TQPA 4EF1A 3BZ6A 3N6UA 4NDLA 3TEDA 2RN7A 4XKCA 3RKWA 3WODF 1Y0NA 3ZCOA 4BKXA 1A8FA 3H9JA 3ONMA 5FTHA 2OQRA 4XR6A 5BPIA 3I53A 4RAYA 2HZLA 3PQJA 2P1SA 4AIHA 3T96B 4QPOA 3LA2A 3M4OJ 1SEUA 4ISUA 3F3XA 3U2RA 1JJ8C 2M0MA 2VJ5A 2ZXJA 2V1UA 1F1ZA 5GAGJ 4AWXB 2G0EA 1LQ1A 2H8RA 1R6ZA 1SD7A 1TT1A 4XBFA 3CCEI 3A4CA 2BY3A 5D5WB 1QNTA 2ID3A 5K5QA 4AC0A 4N4OB 3S2WA 3KP3A 3RJPA 3HDDA 1QHGA 2DK5A 2XGXA 4GX4A 2DJNA 4WCGA 2L7FP 4NN3A 2UVGA 1N77A 2XXKA 1AL3A 2DWHA 2H1LA 3FJ7A 5IZ3B 1OCPA 2ZB9A 1IMEA 2V3TA 1JT0A 3LUZA 4MO7A 3MVWA 3SEQA 1GGGA 4XQFA 4ESBA 4MNPA 5FFXA 1B51A 2KFDA 1A35A 2HXOA 1Z91A 1B3LA 2HPMA 5AA1A 2EZHA 4GOTA 2WYPA 1JP4A 4LUBA 1HKQA 4B09A 5I2NA 4I99C 1WODA 4ZS9A 2VUMJ 2XXXA 3HYIA 4PFPA 3LNQA 3TL4X 4Z6YA 1O3TA 3G4SI 2KQZA 5FJ8J 2IGOA 3I58A 3K69A 3KX2A 4OERA 4B43A 3P9IA 2LREA 3VDFA 1Z0XA 1N7WA 2HEUA 1HSEA 3EHSA 4BQOA 3W6KB 5H2FC 4XKBA 2CWEA 2CMOA 1IUFA 4PETA 5LGUA 4G7HF 1FOXA 1QKAA 1MDQA 1XCBA 2HKOA 4XLNF 1Y20A 2EV5A 1CGPA 1SAUA 3JSPA 2FIEA 2QVRA 1WZ2A 2CZIA 3AL0B 1RNLA 3LAPA 4E7LA 2M9HA 4YIIA 3BJOA 4L0ZB 4MAGA 1JI8A 1UTHA 1Z7NE 5HLIA 5IYCJ 1B4AA 1ZTYA 4YB6A 4HNTA 4ONYA 4BACA 1Z1DA 1AKHA 4B8XA 1B1HA 2F8DA 2D2WA 3ABUA 3DP6A 1N76A 1KQ8A 1BIBA 4ON0A 3GW2A 2WA0A 4L5IA 1X2NA 3CHGA 4G12A 4N07A 2VPNA 4MFDA 4HSTA 4AIDA 4OIOF 1D3KA 5J8CA 4M74A 4R75A 4QSDA 2JJ7A 5BOXA 3K70D 4M3FA 5IT3A 2FU4A 3HN0A 2ANJA 2HWVA 3RQTA 4RAZA 1XGNA 1QKBA 4C1UA 1JHHA 1PJRA 4JWYA 4OENA 4UVBA 3H92A 2V79A 4DBQA 2PVUA 1LKXA 4ZZLA 4JB7A 2BVLA 3VEPA 3J81K 2H09A 2FA7A 4UVAA 2Y69H 4NQ8A 2X4HA 1IMFA 3KPHA 3OS0A 2XHDA 2YPRA 3SEWA 3H36A 3OIPA 4RGRA 3MEXA 1IMDA 1B8IB 2Y7IA 4U22A 3VYTB 3PUFA 2DI3A 3S2DJ 4E70A 4IZZA 5DCMB 1SFOJ 1MY4A 4U23A 1XT8A 3OO8A 2O7UA 2UXAA 4EEFG 3UKGA 5EGOB 4N9IA 1MNEA 1LVKA 4FE7A 4RLFA 2IAIA 1WSUA 5EYHA 4KR5A 3L9FA 1B7UA 5DCFA 3VFZA 1B58A 4Q8RA 3B7DA 1N84A 3MZYA 4KN4X 4F52A 3MUQA 2MKZA 3DKXA 1QRYA 1W7PB 3K6XA 5I58A 4ABZA 3LSMA 1PB8A 3Q0VA 3TDZC 3KEIA 4XN0A 2CO5A 2REGA 3JV9A 5JLWA 2QPQA 4GLIA 3OYCA 3QMFA 4I62A 4U1OA 2IEKA 4AU7A 3H3GA 1ON2A 3P9KA 2QSGX 4JVCA 5AA2B 4EJWA 1FPGA 4RGUA 2MLKA 1PB7A 3KC0A 4RB2C 2ECBA 2I48A 2XWIA 4O5VA 4NWDA 4P3LA 4U0YA 3DU6A 3CJTB 3TZAA 3EQLF 2DCEA 3KN3A 3DKYA 1A7LA 5EQ9A 4G4PA 4EM2A 1CNQA 3OV8A 1IDZA 5A5XB 3O6BB 5ICEA 3PTYA 5K2XA 1B9JA 2IPQX 3JR9A 1NKXA 4BEHA 4HNVA 3QYBA 2M4GA 2V6CA 3BCBA 5B3SH 4KT5C 1IN8A 3HOVJ 5HNHA 3CDIA 5DV5A 2B63J 4DXCA 1R9TJ 2DFIA 2VB6A 1MSFC 4N6KA 2KRFA 2JN6A 4UABA 3ZN1A 3BZCA 4BE0A 1OR7C 1ACIA 1T56A 1MDP1 4OWDA 1EH8A 3VXCA 5HLTA 4FAJA 3ZMUA 2DS9A 1ZKBA 1B5JA 2A5YB 2A5TA 5EYRA 2XF7A 2DMPA 3ZQ7A 4OIQF 1FMWA 5BNGA 1OIBA 4Q47A 2R7FA 4NG7A 3QPLA 3T9VA 2PN6A 3OMYA 4KDPA 2XA5A 3K6UA 1UB9A 4RPOA 4IO2A 3QPSA 2A69F 4H46A 3ZQLA 1FP1D 2R7ZJ 4F1YA 3WGGA 4R72A 1IZ1A 2L7ZA 2EINH 4FE4A 1MNMC 1JXSA 4PGGA 5DW8A 4F3GA 1ZKGA 2M8GX 3FHNA 1Y1WJ 2XX9A 3PPPA 2JJKA 2XD3A 5FHNA 1T6SA 4HZFA 4JBZA 2Y31A 1HW5A 1R5ID 1STZA 4F92B 4O7MA 1MJAA 2DQVA 3T0JA 2V1XA 2VXZA 3CMMA 1YW9A 3EHTA 5JHFA 4JVDA 1FBUA 2EQRA 3S1RJ 5B7DA 4U4SA 3RIRA 3OY9A 2P4WA 3C1DA 1HKTA 2VPOA 3HO7A 5LD2C 4ND9A 1F43A 4ASNA 2P81A 4NF5A 4KT6A 4O3BA 4ZE9A 2L4AA 1I39A 5LBQA 4TQUQ 3KGCA 3I64A 2XAFA 3O97A 2A61A 2DK8A 4DYRA 1A55A 2HAUA 1FBSA 3HUGB 3IOWA 3QK6A 1J59A 3FXLA 3QOEA 3CC7I 3K2AA 2O1MA 3MAJA 1YHQI 3K4CA 2I0CA 1NH8A 4HE2A 3L7WA 1J5YA 2HKXA 1I50J 5JFRA 2EZLA 2OA4A 4DE8A 2QS1A 4R2BA 1TL8A 4A3LJ 3GBBA 1XVYA 4CH7A 3F8FA 3RDIA 5F1QA 4GD5A 4OFLA 3BZKA 5KVRA 3B6QA 4MFEA 1YAEA 4LQ5A 1B46A 2H25A 1ZTRA 4I2OA 2GHBA 2PBIA 3THIA 2XXTA 1IUYA 2ZZWA 4EM0B 1B52A 2WC2A 3U1DA 3H3ZA 2CG4A 2JRTA 4O94A 5AA3A 1N0TA 3H6UA 5KDTA 1YG2A 5CVRA 3W6VA 1NL5A 3QUJA 3IFCA 5LHIA 2Y0SN 3JRHA 2Q2EB 1N04A 2XX8A 1R5GA 4NUBA 2UWMA 3E6MA 4ETSA 5EG0B 1MY0A 3FHZA 1S50A 1OR7A 1BR1A 4N6DA 1LBZA 2THIA 3DP4A 5C4XJ 1ZYRF 4XLPF 1T33A 5F0CA 1M1EB 3QOPA 4G6TB 2VLAA 2BXYA 1I6XA 3K2ZA 2L4MA 3M1EA 1B7ZA 1R1TA 3S3MA 3IFAA 4XRFA 4GWOA 3SFZA 4P56A 4JX5A 3DLAA 3TMOA 3T9XB 1JHFA 3HOWJ 3G73A 3QQAA 2PFZA 5DVJA 2P5KA 2CH0A 1ITYA 4R6KA 1IGNA 5KK1A 1QUIA 1P7JA 3BT9A 3ZQFA 2NVTJ 1B4HA 3AG4H 3PD8A 3MVYA 4NF4A 3PNTA 2XAGA 2COMA 4ESWA 3T8RA 3G2BA 4BH9A 1NH3A 1AOYA 1FBPA 2L9RA 1LBVA 3AXFA 4LN5A 1QHHD 2FBKA 1OCTC 3RI4A 2VQLA 3FVGA 4OVTA 2X1CA 3RQ4A 2MLGA 4KMUX 4F3BA 3V8KA 2JSCA 1VQ7I 3M3LA 2ZYKA 3VVEA 5JLXA 2QSHX 1USYE 1POY1 1W36D 2LF7A 2M4KA 5EYFA 4H4KC 3L2CA 1O7LA 1FOKA 1EYJA 5LFAA 5DTBA 3CP8A 1H8AC 3Q0UA 4IO5A 1T0KA 2CW0F 4OTEA 4OFOA 1LAHE 2AYSA 2HOEA 3ABLH 4E7SA 4L0YB 4WX9A 1LEAA 1QGXA 4HQMA 3W3CA 2HEOA 1IMBA 3IJOB 3GLLA 2WY8Q 1Z9CA 4PSWA 2XXHA 1G2HA 2ZJ2A 3IKVA 1FPBA 2IGNA 3J7AO 4KYEA 3G6EI 1I6BA 2R9JA 2R6GE 4AD9A 3LA3A 2ZNYA 1Y0UA 1Y3PA 4XSXF 1ZAOA 1LB8A 3FASA 3DLLF 1LFHA 2QF7A 3HOTA 4GWYA 4G9YA 5CVIA 2X48A 2X7PA 5K5RA 3BR3A 3IAS2 2QLZA 2RC4A 2ZSIB 2VJIA 2WAEA 3SEZA 3SZTA 5LRSA 5ITOA 3S9LC 2NOJB 3KP2A 1QJMA 2XWKA 3SEXA 5C44J 5KCJA 5F7VA 2W24A 3UNGC 2R7XA 5J1UA 2VQCA 1MBJA 3KSXA 3FDYA 2LFBA 2R3SA 3OYIA 4F39A 1SW5A 2XPUA 3FZVA 2OBGA 2CQXA 2OZZA 1JUSA 4PBHA 3MVXA 1YRNB 2QBYA 2RAEA 4U0WA 3NWTA 1A8EA 4I3YA 1FY7A 1URSA 3K4LA 5H8FB 1U5TC 2DYRH 1PUEE 3MD2A 4KCDA 1F4KA 2Z1DA 5JVTA 5IM2A 4H5GA 2ZXIA 3LSTA 5M5WJ 2DYXA 4GRIA 4EATA 3ZGKA 2OZUA 1DDNA 2PI0A 4G8HA 4NB5A 5L9OA 4F2QA 4Y52J 1BJZA 3GX4X 3OO9A 4ZZEA 2F5DA 3GBGA 2DO7A 3EQ1A 2RKMA 2LSOA 1TWGJ 1X58A 3GWZA 5D5VB 4RB1A 3QYEA 2H1KA 3CFZA 3FBPA 3JRFA 4O8MA 2W7YA 1DGRM 3F8CA 3ECHA 3J7YJ 3OYNA 1M5FA 1S29A 1SVLA 1UELB 1IN4A 1SFUA 1ZREA 5GTHC 2B0LA 3O2PE 5AIQA 2DPDA 1OQGA 3A3UA 3FVKA 3MP1A 1Z77A 4PAKA 3O28A 2Q9TA 1BIYA 4HX7A 4RPNA 2I4CA 4G6DA 1MXWA 1UHSA 4LJZF 4CYDA 3PUBA 3OIQA 2RF1A 5JR3A 3H6WA 2K9LA 4YICA 5FROA 2NRAC 1BIAA 4EGYA 1LBWA 1JT6A 5FFZA 3EPEA 4NF8A 3I3VA 3CG1A 4HXVA 4IGRA 3UK4A 3ELKA 1ZGAA 1D3YA 2DA7A 4LITA 2FNAA 4XNFA 3V8JA 4ZYGA 4BY1J 3DM0A 3AG3H 1F5TA 5EQ7A 1NV3A 2HGCA 4NTLA 3KOTA 1GVDA 3CUQC 1W5SA 2PMUA 1CQTA 4Q0CA 3O2AA 5T3JA 2MABA 3F21A 5J47A 4F19A 2W82A 3GTPJ 3ONQA 1OQYA 3OL4A 1DUXC 1MPBA 4TLMB 2BXZA 2UXNA 2NOOA 4I7HA 3ASOH 2DMQA 3H0GJ 3PSIA 4ENKA 1J09A 4RY1A 4NC6A 2GWRA 2DVZA 3QWLA 2LY9A 1IC8A 5FLXK 3I0TA 1Y1VJ 4JSDA 4MIJA 5ICGA 3GZNB 1JGSA 3ZOBA 4IRHA 4M1VA 5GAHJ 2YX4A 5ICFA 2V9VA 4HV5A 4RB3C 3TAJA 1H9GA 4D7MA 1RIOH 3VVFA 3ZR8X 3BY6A 3T5XA 3SEVA 3ZQQA 1QO0D 2ZC2A 1EU8A 2OK2A 2TDXA 5E3OA 5J1DA 5FGMA 3DPTA 3ZMSA 2ZXTA 3B6TA 4GFBA 1ETQA 2W57A 3EN3A 3IWFA 3IL2A 2A07F 2O7IA 4JSOA 2DBBA 4ZYHA 2XXIA 3HOUJ 2Q8JA 3TW6A 3AFHA 1OPCA 1L5TA 1XMKA 1TWAJ 5F08A 4GWSA 3DV8A 3L2WA 3SXYA 1E0EA 2F35A 2KLOA 3J80Z 1G3SA 2V25A 3E13X 4RGXA 4X48A 4AVZA 3QU6A 3OYGA 4P55A 4KCCA 4EUOA 1TTYA 3JRCA 2XAJA 4PAIA 2E1CA 2F34A 1OJLA 3HOSA 2D21A 1SD6A 3FF5A 2IGMA 3RYPA 3RSNA 1H45A 2V93A 3Q28A 2A68F 2VPRA 1VFEA 1BM9A 1MMDA 4IY5A 1GDTA 1UCRA 2V7FA 4PSXA 4E4HA 2UXXA 2M0CA 4XN3A 1XI6A 4E7ZA 3A0HC 3O3KA 3R26A 2CUEA 3S4UA 2ONKE 1X1PA 3PIPF 3LAJA 1MDMA 1W5CC 1Z3XA 2E1MC 1RDZA 5DS9A 2DWJA 2EFQA 1G3TA 2FMLA 2FUG2 2DOAA 3EYIA 4KIFA 1MNDA 5TRDA 4HCWA 2BW3B 4QRZA 3EUHC 4CUGA 3HPGA 4H45A 2RC7A 3MAMA 2NYXA 1XTAA 3CUQA 3B6CA 3OYHA 4UA8A 1PDAA 4BLAA 2O84X 2KL4A 2L9NA 2YR2A 3MZ8A 4KD5A 2BY2A 5DEXB 3OOUA 4F3QA 4FEBA 1DSNA 4R1HA 4EXLA 4OIPF 4U87A 2LBFA 2QWWA 3BG7A 2E35A 2VOPA 2H9BA 1Z67A 5CPRB 1CF7A 3T9UA 3PNYA 2FHYA 1K6YA 2KZGA 3GYYA 4U21A 5CI5A 5LLQA 2O51A 5I2KA 4OHNA 4P8BA 4DZ1A 2QKMB 2DAOA 2ZMEB 3QYFA 1LB9A 3BG5A 3FKJA 2Y0SA 1WFXA 1SW2A 4LB6B 3EKIA 4R74A 2JQ7A 3TCHA 3ZKLA 3LC8A 5H8HB 3A03A 5IP7J 3ZKKA 4IHWA 4PE5B 1O4XA 2DODA 5L3BA 3IWZA 1ATGA 2W85A 4ELOA 1FPQA 4HYEA 1NUWA 2XRNA 1UQWA 3NAUA 5EEAA 2HU9A 4A5NA 3CMYA 2ELJA 1JW5A 2WWYA 2LKXA 5IYDJ 4BXFA 2CFOA 3TO9A 4QLCU 1MM7A 4OQOA 3ABKH 4MFIA 4BDOA 3MP8A 1IIWA 2EIMH 2H6CA 4YFNF 3OS1A 3K1PA 5ET7A 3K7AJ 3E3KA 4P47A 2VBYA 1R5HA 3ISPA 1F9BA 1GLNA 1HF0A 1VQ6I 1HSLA 4HV6A 3OYAA 4L5JA 5ESYA 2ECCA 2PJRB 1AH5A 1DPUA 3FIWA 2GAUA 3RTFB 4YKPA 4GF8A 4Z0IA 1FTAA 2C6YA 2EV0A 1LFGA 1Y4TA 2XASA 4UUVA 2Q2CA 3KJ7A 5I59B 5J16A 1ETKA 2B65A 4MF3A 4QBAA 4XKVA 3WAFA 5DM6F 2FVZA 3HBLA 2F97A 2RC8A 3FVOA 4JVIA 1AOVA 4PQJA 2IJLA 4LLLA 1H89C 1C0WA 1JETA 1FQDA 2DLLA 3J7ZI 1ZG1A 1E3OC 3M3YJ 2ZYOA 2WBMA 2V1DA 2F3DA 1SQYA 3C33A 4OXVA 3A01A 4II2A 2XPVA 3HGYA 3TOBA 4BE1A 2NAZA 2QMWA 3W9WA 5HS7A 3CJNA 5F0HA 4OOIA 2RGVA 4N9HA 2KQRA 4D1QA 2JK3A 2DE4A 1Z6TA 1IXHA 3IAM2 5GAEJ 1YPNA 2VT3A 3DBRB 3HHHA 2J5OA 4M3GA 4GX6A 1M5BA 3C31A 4XKRA 3RLFE 1SVOA 3WE3A 3EUHA 5A5LA 1SBPA 2PEXA 3I5OA 2BE5F 2R4GA 1R1NA 3ZMZA 3RPUD 2F36A 2KIQA 3PU5A 1B9MA 3QIMA 2ISYA 1YS6A 1VQ8I 1QBJA 1Z7LA 3KG2A 1RR7A 2NS7A 1KONA 3CDHA 4N0BA 3M7GA 1P99A 1TT5B 3KLNA 4I01A 1JW4A 4OVPA 1W7PD 2EFOA 5BS6A 2PMSA 2K27A 3C2GA 3DF8A 3F8BA 3FBNB 2FA5A 1SD4A 3V8LA 4LVQA 2VKVA 3BR0A 5HVQC 3OYMA 4NF0A 4BBRJ 3Q27A 4YRVA 3CSBA 4BHBA 3PJRA 3TPAA 3VB2A 4ZC3A 1V5GA 1SANA 2IS1A 4HF1A 5AA2D 1XDSA 4FETA 3BKIB 1J0RA 3CP2A 2AQEA 4M9SA 4B48A 1FQFA 4H67A 1GVJA 3RPLB 3GTMJ 3MWBA 2EILH 1V5EA 4RLQA 5F1RA 4I09A 1AU7A 4E0XA 2COBA 3BCAA 1LDDA 2ME6A 3R4KA 5ISUA 4QFLA 4XRMA 4AIJA 4JX6A 4NF8B 3IOUA 3GTLJ 3K4MA 4CO8A 1TW3A 4R6HA 2UVJA 3OYBA 3K6GA 4YU0A 5BQTA 4GWWA 3HC7A 3FUZA 4K2EA 2KIMA 4I9DA 3K01A 3S15J 2NVQJ 2CFXA 2DT7B 2Y75A 3B6AA 1Q9DA 3WTUC 1ZBMA 2DWIA 2ZNTA 2R92J 1QVSA 5DUKA 4HW0A 1VQLI 1ERDA 3PMVA 1R1VA 1MXVA 1J2XA 4M3DA 2NWJA 1BW6A 3JSOA 2ESNA 1Y56A 1MXYA 2CW7A 3BBRA 2DMNA 1VQOI 1JKOC 1MMGA 4JXIA 3F9KA 3GLBA 3R60A 3ZPLA 2YUSA 5CLSA 1MSEC 1EYIA 2Z16A 1LUJB 3Q3SA 2O6GE 3HIFA 3FJMA 4CDGA 3OWTA 4N17A 2WX9A 2ZJRF 3NQOA 1SFXA 3OOPA 4WXDA 3HL2A 1XC1A 3BTLA 4E7HA 2R7QA 2QA4I 5IKBA 3MMYB 3AAFA 3VXBA 4FCYA 1OCRH 3QAHA 3FK7A 4UUSA 1SD5A 2LNBA 3HPHA 3KN7A 4PP0A 1WJAA 3M1CA 3IB1A 3SQNA 3ESWB 3GUDA 4NMYA 4YKKA 2FQ3A 3IORA 3LFUA 1FJ9A 1BBYA 1S3JA 3L2QA 1ETWA 1FIAA 2P8TA 4DYCA 4C1TA 3FISA 3TQNA 2XXQA 3MWMA 4ENMA 2MD5A 1PBPA 2GRVA 1SFKA 4LIUA 2V26A 2RREA 4BAYA 2MD0A 2E71A 3ZSFA 4E7KA 4PTKA 1SYIA 2PJPA 4MCOA 3GTGJ 1B05A 1RI7A 2VXDA 4H8IA 2ZNUA 5L8DA 3USDA 3CC2I 5FHOA 3D5LA 3DLNA 3K4UA 2M8CA 5JTYB 1PVEA 2FBHA 5HBCA 3RGYA 4H8JA 1FTTA 4YELA 4HDUA 1FTLA 2VBZA 4XICA 1UG0A 2OTJI 3BQYA 1YI2I 5FBPA 2HPIA 4OETA 4P0IA 4PUSA 4D7NA 3QP5A 2MSYA 2KPMA 4A3EJ 4ZZAA 3O6GA 2BY0A 2HAVA 4FISA 3W2WA 2RQQA 1EYKA 3DKWA 3HZJA 3TCGA 5ICQA 1VQKI 2R93J 1ZLKA 1MQGA 1DK4A 2Y7KA 1IRFA 3L00A 1XS9A 1LFPA 3WTXC 2DOEA 4BBSJ 1YFHA 1WGXA 4D9JA 4U7BA 1U8RA 1G59A 1PBQA 3SDFA 2ZFUA 5IYBJ 4M6YA 2VJJA 2ZXWH 4C3JJ 1FYKA 2ZZVA 3MFKA 4LZ7A 1FBCA 4WEDA 4B4CA 1NTCA 2LK2A 3QXMA 3T9HB 5FD6A 3PUWE 1RETA 2FD5A 3V42A 3K4BA 1X3WB 4ZTJA 4DIQA 1MD0A 1RPWA 4DOZA 1P1WA 4X1DA 5FRMA 1IN6A 2BY1A 2IA4A 5H8NB 5LHGA 5ILUA 4MEVA 2BOLA 1N25A 3ZS6A 1BR4A 4XEQA 4ANJA 3G7WA 2A5WA 1V54H 3E7LA 4RAFA 3CO6C 1W0TA 2HHMA 3CZ6A 2VJ4A 4V19K 2OLBA 3K00A 3RQIA 4G68B 3E78A 4QPQA 4XSZF 4P96A 1ZRFA 1FQAA 4JDFA 4U2RA 5H8QB 5CMKA 5IAIA 2CQQA 3G3JA 1OLAA 4WXHA 1S8NA 3PM1A 3FKIJ 3PMXA 5TPAB 3ZQGA 2NXNB 1N3XA 1FPFA 5TP9A 1R6RA 1WJEA 2K7LA 1XOCA 4IQJA 3P5JA 1LSTA 3UIFA 1VFDA 5F24A 3HB9A 2F3BA 2RKHA 3I59A 4XMYA 4LOCA 1Q1KA 4X1EA 3E5QA 1NFTA 4KFCA 1O63A 3OENA 4B3XA 2FJ1A 1RYXA 1S7YA 4Q30B 1K78A 2DFEA 4L5EA 1I69A 5ILVA 1E3PA 1GT0C 1NUYA 1KU3A 1Z3YA 3EETA 3BP8A 4A0XA 5A2QZ 5H6QA 3ZXSA 1DPEA 2ONRA 1D4NA 4IY6A 3FVNA 4OAZA 3G3IA 1K61A 3F0CA 2AO9A 1ODDA 1T08B 5J1YA 3LSPA 1Y4CA 2RVCA 4LA9A 1W5TA 3H6VA 2WY7Q 3UORA 2XXWA 5B66C 1R22A 2CQ7A 2KKOA 4IOCF 4BDZA 4DXBA 3WE2A 5K7FA 1ZQ3P 1D0ZA 2JUGA 5CBSA 3CC4I 3L1PA 4UNOA 1FPDA 3DPLC 5CBRA 3FMSA 4OZ9A 3HHGA 3U92A 5IPAA 4GBVA 2FXAA 1UJ8A 2HVSA 1KQ9A 3KLOA 4PFRA 3GF2A 1U9OA 3W2AA 2LP0A 1VQ9I 1R58A 2Z9OA 4PC9A 3OXNA 4FASD 1R23A 4M9XA 1SI0A 2DQRA 3TTKA 2ICWG 5I2NB 5LGTA 1K9ZA 1S9TA 5HLGA 3NRVA 4KA4A 1LPQA 4OFJA 1HBXG 1LEBA 2H27A 3DCFA 1LBCA 3E4RA 3IB0A 3O29A 3ASNH 1OVBA 5FLVA 1XSVA 4EJUA 4FHTA 4HW8A 3QP6A 2VOZA 4UACA 4B47A 1JKQC 2EV6A 2D5WA 2L3DA 1FCKA 2GIZA 3S1NJ 4JK1X 5D8KB 3CLQA 3GFJA 1BN5A 2CUJA 3C18A 3JRDA 1B3FA 4KYDA 2EIKH 2HTSA 4O3MA 1MJBA 3GCMA 3BJAA 4BDYA 1FYLA 2GLOA 4FTHA 5F64A 4ELPA 2XXUA 1XC5A 4BDRA 1B7HA 2DXYA 2PMHA 4G7ZF 3TTRA 1KU2A 2AXTC 1R1UA 3GYHX 4OA4A 2ZYNA 3S9NC 1VQ4I 1JUPA 1BI3A 1SAXA 4E7IA 3K70C 3VYSB 2ZFWA 1YIJI 2OTLI 1TC3C 1US4A 1UTHB 3CJQB 4LLGF 3GZ6A 2H4IA 2UVIA 5LEJA 1TFDA 4M6XA 3GXOA 2EK5A 1D5VA 1AKHB 2RV8A 3PGFA 5IT9Z 2R5ZA 2DFFA 2ZSHB 3VOEA 1NUXA 3P9CA 4R6YA 1ON1A 1GR2A 3CR9A 2PLYA 5BWJA 2DQLA 2V6EA 2RQPA 2VQGA 3DEEA 2CV1A 4XKQA 3MVPA 3F8NA 1FSHA 3GEZA 1NMUA 1FMVA 4S04A 3HOYJ 4UUTA 3ABTA 4OVRA 5BUUA 2BHZA 1E2XA 2ZNZA 4OMYA 3TQLA 3C7JA 2XC7A 2QQBA 4MEYF 5KCMA 5HDNA 3MZ9A 4GL0A 2L01A 2DA5A 3IRQA 3KBZA 2PG4A 1TNTA 4JQFA 1T39A 1EH6A 4PFOA 2KDZA 1WVJA 1MY2A 4DI4B 2XV4S 5FKOA 4EDPA 1RRJA 4HSRA 4YKIA 2O3FA 2JRMA 1LE8A 4EQ7A 2L7KA 5CMBA 1XDUA 3S1MJ 4M9ZA 2KMUA 4X0GA 3QPTA 2CV0A 4FX4A 2X7QA 2RDPA 4QSEA 1A6QA 2HXIA 3NWSA 4CYCA 4EMSA 5D5XB 1NI9A 4I0BA 1ZGWA 3RUMA 2W1OA 1USYH 3CCUI 3I5UA 5DDGA 2D45A 3ROJA 4G7OF 3KSJA 1UTBA 5J1RA 1Y1ZA 1QQIA 3SDBA 4IO4A 4PFUA 2I8DA 4CCKA 5I58B 2HDCA 3IAZA 1OMIA 3A29A 5HPQA 2E7XA 1OCCH 2R7RA 2Z3YA 3QUFA 1X3UA 4KITB 3DTIA 4I8CA 1A36A 5JEIA 4WXCA 3HG9A 4ESFA 4YFXF 3JTGA 3MJNA 4K3FA 3SEYA 2ELHA 5FKKA 4GX3A 1I1GA 2L9SA 4ZZDA 4JBAA 3CI8A 3R6UA 2GZWA 2PBWA 3BTIA 2GM4A 2ZNSA 3CF2A 3LMMA 1A40A 3QODA 3LSJA 2BZTA 2KT0A 4A6DA 1FC3A 2DT6A 4AYBN 2JT1A 4EM1A 2I3VA 3PD9A 4EVIA 1M5EA 1F9NA 1USTA 1AHDP 1I27A 2OCUA 3SKPA 3BG9A 4BEHB 3WG7H 3E5XA 1GHCA 4GXSB 3SEUA 4M3EA 5I57A 4I40A 1MPCA 2CZLA 4ESXA 4IQ4A 2KJCA 4P9KA 1ZARA 2KLFA 3CFXA 3ZN0A 1YX3A 2HI3A 4CICA 2A5TB 1R7JA 3DQVC 4NE4A 4LK0F 4N8GA 1YTVA 2HYFA 5IOYA 2W84A 3KYDB 4M71A 1HW2A 2B4MA 2HR3A 1URDA 1LEVA 5CVUA 2XAUA 3FATA 2B4LA 2JPCA 3F6OA 4XORA 4ESJA 3GO5A 1YJNI 3TDJA 1BOBA 4ZEDA 1NV5A 5F6FA 1VQNI 1RR8C 2FNCA 4G2ZA 1RDYA 3S2HJ 3KFMA 4BDMA 2DA4A 2LMDA 3M8JA 5CVJA 3HRTA 2KDOA 1ETOA 2HVRA 4KNYA 2I0BA 3P7IA 1T0FC 1IQ7A 2QQ9A 5H6RA 4F2OA 1SPIA 1SDXA 1SW1A 2Z8EA 3BR5A 1DP7P 1MS7A 2CZKA 1HA8A 3S32A 2XGEA 3G1OA 5AONA 3IK6B 1LFUP 3DBHB 3TTNA 1DMBA 2I49A 1YQAA 4NF5B 2LTPA 3GLXA 1ENHA 3H5NA 4V2GA 2P3VA 3KZZA 1UAAA 1R9LA 3BTCA 4NF6A 2GXAA 2XF6A 2EIJH 2FQ4A 4QWQA 2ZKZA 3E6DA 4DJAA 2XGCA 5EHSA 4MGRA 3TFLA 1SFEA 5CJ9A 5DYMA 4NHBA 3J80K 1X1BA 5E3LA 2EA2A 2VKEA 4CCMA 3HFUA 4RYAA 3E79A 3VLWA 4DBRA 2JVGA 3A3CA 1R4MB 3B6WA 5J4YA 3SZPA 1A5JA 1E17A 5HS9A 3DP7A 2PX9A 2VOOA 2PT2A 3PV0E 4FIMA 1WI9A 1HOMA 2DA6A 1P1QA