3HHGA

Structure of crga, a lysr-type transcriptional regulator from neisseria meningitidis.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
293
structure length
293
Chain Sequence
KTNSEELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTEEGAQYFRRAQRILQEMAAAETEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, LysR family
publication title The structure of CrgA from Neisseria meningitidis reveals a new octameric assembly state for LysR transcriptional regulators
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription regulator
total genus 69
structure length 293
sequence length 293
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hhgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhgA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhgA02
2XXYA 1B3EA 2OZUA 4ZZLA 1TNTA 4RAZA 3J80K 5AA2A 2LKPA 4IVNA 2FU4A 4KI0E 2DTRA 1MPCA 1OLAA 5H8FB 3EYYA 2MA3A 3FX3A 1XDUA 4IHTA 1N04A 2LDUA 1DOTA 3IJXB 1Y3QA 5AA4A 1BI0A 1YYVA 4U7BA 2GA1A 4AWXB 1IF1A 3E4RA 4OMBA 4P0GA 2CQKA 3K6XA 3VXCA 3O97A 2HFHA 4BHCA 3HV1A 1NNTA 4BHPA 4NF5A 2ZMBA 4PFUA 3PV0E 1OLCA 4WF2A 4MLQA 4FX4A 1Z05A 2BJJX 4HQMA 4BNCA 1XVXA 4DCXA 5D8KB 4A0XA 4RYAA 2P0SA 5L8DA 5DV5A 1QPMA 1ZGAA 2XIGA 1N0TA 4EGZA 2CGPA 3T1BA 3GO5A 5CBSA 2P6SA 2KKOA 5CMCA 3UP9A 1DP7P 2FMYA 4EJWA 3T9VA 2H98A 5CBRA 4P5OA 4L0ZB 1YTYA 2E7XA 3L9FA 4I62A 4YMBA 3FVNA 3VFZA 4L5JA 1SYHA 4LZ8A 4Z2YA 3G3JA 3DPTA 3DPLC 1Q1KA 3ECHA 2CZLA 1WQ2A 1DDNA 4X48A 5H8NA 2ABHA 2DLLA 2XV4S 3R0JA 2A69F 3RKXA 1O57A 2V25A 3IJOB 4TLLB 4FT8A 1P1OA 3I54A 3RYPA 3RPUA 2E1NA 2D5WA 4JBZA 3M8EA 1A55A 2FBHA 4OETA 1G3YA 3BY6A 3HOSA 1B4ZA 4GO1A 1A54A 4AB6A 1ZG1A 4MBPA 1WSUA 1C0WA 1I27A 3G3GA 1MY2A 3L6GA 3LR1A 1MQGA 1M5DA 5DEXA 3IWFA 2DK5A 3K0LA 1AOVA 4XRFA 2VD3A 3RKWA 4RXLA 1JXSA 3RT6B 2O6AA 3K1PA 2Y0MA 4KUMA 2JTVA 2WTEA 2HXWA 2Q88A 3R26A 4U4SA 1Z7ME 3VV5A 1FYMA 1DPRA 2LNBA 3J80Z 4F2OA 2F7BA 5FFZA 3TCFA 1I69A 4FATA 3K6VA 3I5OA 1P6RA 1D3YA 4JSOA 3K02A 1IXHA 2F6PA 1Z9CA 1ZTYA 2BV6A 1WWXA 5AA2B 4G8NA 1XGNA 1E2XA 3N26A 3CG1A 4GL8A 4ND9A 4U1ZA 4DXUA 2ZFWA 2GH9A 3TQNA 1FTMA 2G93A 4I9DA 1MGTA 3O6IA 3T96B 4GYGA 2VP1A 1B3HA 3P9CA 5AA4B 4THIA 5BPDA 3F22A 1FBQA 2F78A 2QMXA 2CW0F 3BBRA 1IUYA 4NF5B 2HKOA 4FIMA 5E8GA 2F36A 2FBKA 1B05A 2R6GE 2Z3YA 5LEJA 2VOZA 4RGUA 3CTAA 3DV8A 5TRDA 3F8BA 3LAPA 3I59B 2NXOA 2DVZA 3O6GA 1J59A 1MM7A 4QLCU 1J9IA 3MQ0A 3RYRA 3PPNA 4KIBA 1PB8A 4M9ZA 3NEUA 1B9JA 2RV8A 2ESHA 2XAJA 5KK1A 3KEOA 1AOYA 2M5WA 3R6UA 2PT2A 3H06B 1PP7U 2HTJA 1R1NA 1DUXC 2P7CB 2XX7A 1FT9A 3C35A 3N6UA 3FGSA 1MQHA 2LF8A 1IN7A 1B6HA 4P9UA 4YKIA 4MQVA 4HX8A 3PPRA 3WGIA 1W7PB 4TOZA 4UACA 2XD2A 2GA2A 4OTEA 4P9FA 3QUJA 3MFKA 2JRTA 2L01A 3TO9A 1MZBA 1AH5A 2F6GA 2Q89A 3GW2A 3QSLA 1YS6A 1USTA 4G8HA 2VBXA 2HR3A 1HW1A 4GOTA 4KQPA 5J8FA 5DEXB 1TTYA 3KJ7A 3CUQC 3BDDA 2IP2A 4ZYHA 5KZTA 4DXCA 1IW7F 3FXRA 4XSXF 4HAMA 2HEUA 1BOAA 4POWA 3D0SA 3FJMA 3FVKA 1QGPA 1B2HA 5FO5A 1U6GA 2R7FA 2UZKA 2O03A 1DSNA 2EFWA 1R5GA 1PEBA 4LMYA 1TWYA 1BKAA 2EA4A 2A5TB 1W5SA 2F34A 5TP9A 3PD9A 3COAC 5CM6A 3TTKA 3V5AA 3O9PA 3CLOA 1ON1A 1USYE 4UV8A 4LB5A 3T8RA 4WXDA 2DPUA 2Z5UA 1JW4A 1BJAA 3G3KA 3MCZA 1HQCA 4YIIA 3QK6A 4B8XA 1YW8A 1MH3A 1KU9A 4YB7A 4AVPA 3UK4A 5AA1A 1GVJA 3HCQA 5IT3A 3WTSC 3ZKKA 1SW1A 3W9VA 3CR9A 4NTLA 1LBCA 3LA3A 1SW4A 3KLNA 1IEJA 3PPOA 3Q26A 3FASA 1SD7A 3L7WA 4QFLA 3FMRA 3MQ9A 2J5PA 3RT8A 2EB7A 1T39A 4U4XA 4B09A 1ZH5A 2Z99A 3V7CA 1H9TA 1B59A 5HVQC 4ZEFA 1FTOA 3MZ9A 2R7DA 3RIRA 4OIRF 2R9JA 4DIGA 2H6BA 1LDKB 1ATGA 4HX4A 2J5OA 4ZE8A 1TW2A 2O3FA 3E6BA 3WTUC 3QUFA 3IRRA 3CFLA 3GFIA 3SEVA 2DW4A 1NNFA 4U0VA 2NNNA 3L09A 2OAZA 4A0YA 2VONA 3TCHA 3W6KB 3IHUA 3MVWA 1KU7A 3QYTA 3KN3A 4ZEBA 4LG0B 1IN8A 2P7VB 5DCMA 3M8UA 1A99A 4PE5B 2PMUA 2L4MA 3DP8A 2O51A 3TUSA 4G6QA 4HDUA 5AA2D 1Z7NE 1FTJA 1SI1A 3OMBA 1US5A 2F97A 3MWBA 5ITOA 1NH7A 5CVVA 1QKBA 3M3FA 4O6JA 2XXUA 3G3HA 2ISZA 2VOPA 1B1XA 2ONRA 2VE8A 3JSOA 4RJZA 4PFTA 4ZYDA 3KSXA 1WODA 3JZJA 1DPPA 2H25A 3UA8A 3EQLF 1GR2A 5K2XA 3ELKA 2EA2A 2HFBA 4CICA 4ELRA 5ISUA 2F2EA 2EV0A 2Y7IA 3C4MA 1R00A 5ILUA 2XXVA 2RGVA 1EH8A 5LHIA 5TPAA 2XVCA 5DD4A 1NMUA 1ZBMA 2QQ9A 1N7WA 1M5EA 5FHOA 3EUHA 1PC3A 3FXUA 2GHBA 5ITPA 1MRPA 4UA8A 4ENMA 4I02A 1QNTA 1F9NA 1ZRFA 1KGSA 3LBSA 2ZXJA 1H0MA 5L9SA 4TQUQ 2ZYNA 2PVUA 1URGA 1B40A 1UTHB 4GL0A 4N07A 3T9UA 3THIA 3HHGA 2AYSA 5AIPA 3PQJA 1Y1ZA 5DT6A 4IXAA 4KCCA 4G77A 3C36A 3GBBA 3MVYA 5A5XB 2XASA 2DQRA 2YPRA 4M72A 3OD7A 1VTNC 1O3QA 1S7YA 2HGCA 5EEHA 4XTCQ 5F1QA 3HYIA 4ZEDA 2E7WA 4BQAA 4YKKA 2DQLA 3FUZA 3SHFA 2DBBA 4YU0A 4RB0A 4A2UA 4OU0A 4D0PA 3MZBA 3Q9VA 4BH9A 1B7ZA 2L3DA 2IW5A 4HF0A 2DOJA 4JQFA 1UQWA 1ON2A 4QFNA 3BFTA 2ADUA 3JTHA 2UXXA 4N9IA 4L9TA 4QFOA 3BZ6A 3T93B 4G8MA 4XKRA 1ONVA 1BI2A 2QSXA 3FVGA 4XLPF 4G4PA 4PFYA 2V1XA 4PZJA 4EF2A 1LQ1A 1F5TA 3ABUA 1FWZA 3NRVA 2D1HA 4I0BA 1P1UA 4RY1A 2YSRA 2NYXA 5LRRA 1SW5A 5BWJA 3J7AO 1T98A 2ALUA 2ANJA 2OWTA 4OIPF 4EDPA 2ZNZA 2I3VA 3V4GA 2NWJA 3MZYA 2X7QA 3FWEA 4JXIA 1FQAA 3OEKA 1Y1MA 1MJBA 1FSHA 3KP7A 4ONYA 1FOKA 3IL1B 1XT8A 3Q5FA 2M30A 4ASNA 3ISPA 1IXIA 1S8NA 1B3GA 1ZLQA 4O3AA 2QYOA 1LNWA 2I0CA 4G7HF 2XROA 4LA9A 2K7LA 3MZHA 4R79A 4HLXA 3GXAA 3S9NC 3PD8A 1GXPA 1ULYA 3UORA 4CYDA 3CO7C 2P4WA 2DYXA 5IT9K 5ICTA 2L02A 1B46A 1R23A 1B52A 3K69A 5K1YA 1ZLJA 2Z8DA 2UVHA 1J1NA 3Q27A 3HSRA 1BP5A 4IPAA 2XAGA 1U2WA 1IIWA 3TDJA 1W4MA 5KCJA 2E1CA 1I6BA 3HO7A 4AQ4A 4R9GA 2PMSA 5HOOA 1ZU0A 1H76A 1N84A 4WK8F 2OCUA 3C9HA 4ESXA 5D5UB 3B02A 1IXCA 4HF1A 4FX0A 2FRHA 1A8FA 5HPQA 1K7AA 1J5YA 2V9VA 2QRYA 4GIZA 3TTLA 2H99A 1J2XA 2UVIA 1DPEA 1K78A 1PB9A 3P7NA 3KN7A 1L5TA 4ZZAA 4K2EA 4NWCA 4KCDA 2PEXA 1RUOA 4Q47A 3M3KA 4NF4A 1B3LA 4L9JA 4YZZA 5FTIA 1FNNA 1ZYRF 2FNAA 1YLFA 2Y84A 1HW2A 2AS5F 2V79A 1WDNA 2Q9TA 4YFXF 1OR7A 2XAQA 5J8CA 5L3FA 4OEVA 1H3DA 2I4CA 4R72A 4QFPA 4WEPA 3CUQB 3IKVA 5ICQA 1R7JA 3H6WA 4O3BA 2B3FA 2YU3A 5AA3A 2OJTA 3S9EA 2AL4A 4XBFA 2RCBA 3U72A 5I84A 2EFPA 1SD3A 3M1EA 2O69A 4OFLA 4BHBA 4P96A 2G7HA 2RKMA 1RYOA 3MVZA 2OK2A 2RF1A 1PBQA 2O68A 1XMAA 4XLNF 2XX8A 2PJPA 1FYKA 2EV6A 5I2KA 4EQ7A 5I58B 4OIQF 1Q1HA 5EYFA 2AXLA 3Q28A 5KDTA 1XS5A 2LAOA 1IUDA 3ZMTA 2XKPA 4LJZF 2E1SA 3FVOA 2L4AA 3ILUB 4K3FA 2ZNTA 5FTHA 1O3SA 2R3SA 4IO2A 3TCGA 1LDJA 3IRQA 5I57A 4H8IA 1M5CA 1QBJA 4ZZEA 2OU2A 4HW0A 5IT9Z 5D5XB 3TOBA 3VEPA 3GVAA 2OLBA 2KJCA 4S05A 1N3WA 4NEDA 2HOEA 2Q2CA 1P4AA 3G73A 4HBLA 2Z22A 1CB6A 3PQKA 4JBAA 1MDMA 4FAJA 4YKJA 1KWHA 2ZBKA 2H4IA 2O8XA 3REOA 2THIA 1B6AA 1RUNA 3TQWA 1ELJA 4N6PA 2RCAA 3O6BB 1MY0A 4OQOA 2YPNA 4JWYA 4RPNA 5D4SA 5I59B 5KCJB 4CDGA 1NL5A 2O7UA 2QM3A 1WI9A 4GYIA 4I7HA 3SZPA 3ODBA 3UN6A 1D9YA 3U1DA 3E5UA 3KP2A 5CJ9A 3WTZA 2FYIA 3I3VA 3M7GA 4Y15A 1MPDA 3OENA 4L18B 5AE4A 2K4JA 4C1TA 4YMAA 1MY3A 3E13X 2HZKA 4IHSA 1VR5A 1T0FA 1K78B 3SEXA 4YFKF 3GFMA 3QP5A 2ZYOA 2FQ3A 3FM3A 4UVCA 3QU6A 2H27A 3I5UA 2MLKA 1BLFA 5B70A 1HSLA 3ZMZA 3LUYA 1B58A 2DI3A 2W7YA 3TELA 2CFXA 1IN4A 5AIQA 1CGPA 3B6TA 3DKWA 3VLUA 4M71A 4GQOA 4EJOA 3DP7A 2DAOA 3VOEA 4C0RA 3H92A 1JNFA 4MHGA 4M1VA 4R2BA 4XSZF 1LAGE 2A07F 1SVXB 2BEOA 2F7CA 1GV8A 4MTEA 5CLSA 3SEYA 1UCRA 3GUDA 4LQ2A 3TO6A 4PCQA 3RN8A 4H5FA 4G8XA 4NQWA 3H6UA 1JVYA 1OIBA 1KQ0A 1BIYA 1AWCA 1GVCA 2UXAA 3S4UA 3LQRA 3R0AA 1PP8F 3F23A 4EM0B 4PGHA 1MPBA 2XUBA 4EXLA 1GGGA 2D45A 2X26A 4GGGA 1B0HA 4KFCA 2GZWA 3PMWA 4EM2A 4EUOA 3HTSB 2X7PA 4ZH4F 3GWZA 1MQIA 2QLZA 4QSEA 2NUVA 4O3CA 5HS9A 1EH3A 1OQGA 1XSVA 1QW0A 3GBAA 3ECRA 2XHKA 4JDFA 2QPQA 5I57B 2K02A 3MZ1A 2XKOA 4RK2A 1YO5C 2RC9A 2H9BA 3S9LC 2IA4A 3QAXA 1W5TA 4LZ5A 4KIFA 4RB1A 3R6SA 2DP8A 1LVAA 2A68F 5LLQA 5FD6A 1IXRC 5H6QA 4BDOA 5IKBA 1UFMA 1A8EA 4RAYA 3QIMA 4F18A 1LGBC 3OO9A 1I6QA 1NFTA 5DCFA 3WTTC 4I0AA 2Q0OA 3RTWB 3WGGA 3CFZA 1XD7A 3E5XA 2VHAA 4ON0A 1QUJA 2YX7A 1IRGA 3KGCA 1V4RA 4MEXF 1TBXA 4Y17A 1POTA 2V1UA 3M8FA 1FQEA 4G6DA 2JPCA 3V8JA 3CO6C 3MBPA 4BAYA 3KG2A 3DFGA 4CHUA 1B32A 1Y4TA 3KSJA 4CZZA 2HWVA 3T9HB 3PMVA 1EV7A 3EF7A 4HOBA 1RIOH 4LLGF 5ICCA 4EMSA 3PUWE 4OESA 2DS9A 2CYYA 4F39A 3KP6A 2KJBA 3TFLA 4DZ1A 1VE4A 3O2PE 1NHAA 4JB7A 1TNSA 3E9XA 2HDCA 2GQQA 3S2WA 3A09A 3OSQA 1WRJA 2I4BA 1R9QA 3EPEA 4LQ5A 5BS6A 4P11A 5H8NB 5ELVA 3QPHA 2UWMA 1D8KA 1N7XA 1OYWA 3DQVC 1U8RA 3K4UA 2CSOA 3WGHA 2Z33A 1BC7C 3P7IA 3HSEA 1FLIA 1YAEA 5K5RA 3F21A 5JEIA 3O6HA 2B0LA 2OQRA 4KMFA 4RGRA 5FGMA 2ZO4A 2LF7A 1ZG3A 3PUZE 3KP4A 1FBUA 2ZJ2A 5H8QA 1M5BA 1B0LA 1B3FA 4G7OF 2QUFA 3KE2A 1QUKA 3IO6A 4BDQA 3GZ5A 4M74A 1MQJA 5DYHA 3IOUA 3F8FA 3HIFA 5L3DA 2TDXA 2ONSA 3WG9A 4F19A 3F8NA 1UTBA 2PYYA 1TXFA 1SD5A 3H6TA 3IOVA 3Q25A 3IX1A 1Q35A 4U21A 2OQGA 4GWOA 3KLOA 5F1RA 1D9VA 1FCKA 1TFAA 4MH5A 2QVOA 5LGNA 5H20A 4LUBA 4ZECA 1IXSB 1HSEA 1P4XA 2XXPA 3ML6A 3FJ7A 1FP2A 3K2ZA 2WC2A 3BJ6A 2PFBA 3W9WA 2P6TA 3IWZA 1MH4A 2HQNA 5BUUA 4C1UA 1O3RA 2Y7PA 2EV5A 1NKXA 1RZ4A 1XDSA 3ZN1A 2KIMA 5D6EA 1BBYA 1R1TA 4ENNA 3KZYA 3IO4A 1D3KA 5LBQA 1H43A 4Q5SF 4N9HA 2ZNUA 1FQCA 3I71A 1I6AA 1IAWA 4DE8A 1ANFA 4Z7EA 4FORA 4HDVA 5DVJA 1OYYA 1LLSA 5E18F 1O7TA 1EZPA 4HTGA 1MXWA 1MDP1 1FQDA 4PGGA 3TKDA 3SXYA 5D6FA 5CVJA 2EFQA 4GXSB 4RNSA 1QZZA 3TGNA 2Z8EA 3RNNA 1LSTA 1R9LA 1BI1A 4I98B 3GZ6A 3ZMSA 1BIBA 3CSGA 2F7AA 4EJUA 3B6QA 3V7SA 3ILTB 2GRVA 1T2KA 4KYDA 4F1YA 2MC3A 4OHNA 4ZYGA 3U9GA 3PPQA 2FNPA 5HS8A 2VC1A 3ECOA 1UHWA 4QFKA 1R22A 5ERIA 4QF9A 4O5VA 5CC2A 2R71A 2K27A 3O66A 1Y0UA 5JFRA 3IL2A 3WE3A 3C34A 1IN5A 4I2OA 2F5EA 4DLDA 3A3CA 4UNOA 3DF8A 4WXJA 2NAZA 1Z6RA 2IT0A 2EK5A 2JZYA 3FATA 4HCWA 2FSWA 3TEPA 1B5HA 3TYHA 4R1HA 4TLMB 4I8CA 3LQQA 3SDFA 4RB2C 2Q2EA 1U78A 2VT3A 3MJNA 4OMYA 1ZKBA 5L3BA 4AD9A 4MEYF 2DVCA 1ZRDA 2X4HA 2X0LA 1BC8C 1FQBA 3O3KA 4M9XA 2PMHA 1Z1DA 3IOWA 5LHHA 2M45A 4KFQA 4AB5A 4HA8A 5B7DA 4A6DA 3R61A 3GLBA 2PLYA 4L0YB 1UTBB 2QS3A 2NS0A 2QWWA 4DQ2A 2CMOA 1G3WA 2CWEA 3HN0A 1B51A 1JGSA 1JEVA 3HRSA 3SEWA 1P99A 2B3BA 3OOAA 4YICA 5TP9B 4IGRA 4UUVA 3OSRA 4Q5TA 3IAZA 4R2FA 4KN4X 1FY7A 4DXBA 1YQAA 2GXBA 3T22A 2CO5A 2A6EF 1YW9A 1XSXA 1P2FA 1B1BA 4KD5A 1K79A 5L3CA 4EQQA 1SFEA 2I58A 1YPNA 1QQIA 3FXQA 2UVJA 4BXUA 4H1XA 3PUXE 4GF8A 2ZNSA 3HUGA 1NNKA 4GCVA 3MC2A 1AL3A 3DXJF 1XB4A 5ICEA 1YCJA 2BE5F 5CMKA 3RY3A 3WTVC 2M8CA 3U94A 2DFIA 3FV2A 1DTZA 3LSLA 5CVIA 3GXOA 4I1DA 1IXGA 3K00A 1YG2A 1LAHE 5DYMA 5HM4B 5LGUA 1RI7A 3BPXA 3M3LA 3SEUA 3IB2A 3ZMDA 5JHUA 2DU9A 5ED4A 4LLLA 4NMYA 4EQ9A 5BPIA 4GRKA 3EHUA 4ELOA 4GD5A 2QJEA 3UIFA 3DLNA 4H0EA 5DTBA 5E1WA 3G7WA 2FF4A 5EEGA 2G29A 3HHHA 3VODA 5DUIA 5I2NA 1IN6A 1ZLKA 2AIXA 1REPC 3QXMA 5JTYA 1U5TA 4FJPA 3L2CA 4YAHX 5DCMB 1BTJA 4NF8A 4IRHA 1EH7A 2M8EA 4KHZE 1H44A 1SDXA 1KQ8A 4NE4A 3AXFA 4O3MA 3VVDA 5CRYA 2LSOA 4U7DA 3OEMA 1QZYA 4FE8A 1WKMA 2W57A 3RPWA 2V1DA 4MNUA 3ULQB 2Y75A 4I09A 3PGFA 3SFZA 2DE4A 3TZAA 2ZXTA 4U88A 4IO6A 4RGXA 4NF6A 1PB7A 1B9NA 5ILSA 4NB5A 4M73A 4MGRA 2QENA 1J7KA 1MY1A 1I6XA 2EJRA 1LB9A 3VB2A 1IITA 3Q29A 2XHDA 3LSTA 1B7HA 3N4MA 1FBSA 2RDPA 1ZIUA 4R8HA 1S50A 1MQDA 3JYRA 2QS1A 2PT1A 2VODA 5F7VA 2H94A 5TPAB 3W6JB 3D4GA 2WV0A 1S7AA 1R1UA 4EVIA 6PAXA 3EQ1A 3ZS6A 3CI8A 1I5ZA 4S04A 1K6OA 3WTWC 4R73A 2DT5A 3JAMK 1JE8A 3LA7A 5FHMA 1SFUA 1II5A 3I53A 3ONMA 5FHNA 3T0YA 4WKMA 3LC8A 1XN7A 4BDNA 2I49A 4BDLA 3T8TA 1JHFA 2K4BA 4HLYA 3H3ZA 1XGSA 1ODDA 2XAHA 1XOCA 1FTKA 4BDRA 2P1SA 2V3UA 4P0IA 2A61A 5H8HA 1XCVA 2HKXA 3BJAA 1YTVA 5IAIA 1J75A 3I58A 4H5GA 4Q0CA 3MAMA 3C18A 1NH8A 4L5IA 2ZYMA 2JT1A 1JEUA 2Y7KA 4JWXA 2DQVA 2FNCA 4F2QA 3F72A 5HLGA 3V8XB 1MS7A 4HF2A 2STTA 2QL3A 4F1VA 2A3SA 3KFMA 3MVXA 3KP3A 2FMLA 5HDGA 3H6VA 1ZMGA 3S9MC 3R4KA 5CVRA 5DEQA 3G3IA 4X1DA 4Q8RA 5I2NB 3QP6A 3KCCA 4ENKA 4OZ9A 3ZPLA 1HSTA 4LK0F 2E0SA 5JVTA 3RKYA 3KBRA 3LSFB 1AIVA 3B73A 2Y7WA 4GFRA 2P5LC 1P1NA 2VXZA 1G4DA 1OPCA 1USSA 4YKPA 3P9IA 1N76A 4ESBA 2A5YB 4XKQA 1STZA 4Z0IA 4A5NA 3TTRA 2IJLA 5D8LB 4BDMA 4HQEA 4KPTA 1YIOA 3BOQA 2PI0A 1DTGA 4R75A 4LZ7A 1NNPA 4MFIA 3N5LA 4YB5A 1P1WA 3E6DA 3C33A 1HKTA 2PBWA 2UYEA 5F64A 2ELHA 4FEDA 2VE9A 4ENJA 3EHTA 4EQBA 5I56A 1HW5A 1XSDA 5FD5A 3RJPA 3FJGA 5DDGA 4KYSA 3CDHA 3D4CA 3JAMZ 2VD2A 1IRFA 1FW0A 2O7IA 4KMUX 4H6DA 3W15C 1D8JA 1R6ZA 3KOSA 4IO4A 4RK9A 5AONA 2OD5A 3MWMA 1LAFE 4F29A 2REJA 2P8TA 5E17F 2F8DA 1MY4A 2OWSA 1MD0A 3H3GA 3TDZC 4RA1A 3DELB 4UVAA 5EHMA 4CXFA 3U1OA 3EETA 4F7ZA 3FHZA 2V3TA 3KEIA 1MXXA 4G68C 2IEEA 4KICA 3N94A 5HLHA 1CE2A 1P1QA 4H67A 3HSTA 4NF4B 2VN2A 1XGMA 2NNYA 2L54A 3GFJA 4Y13A 1L3LA 4N13A 2KRFA 1R5HA 5H8HB 1RYXA 2FA5A 4A0ZA 2QS2A 2DE2A 3V83A 3DEUA 2GWRA 2QMWA 4AIKA 2GIVA 1R1VA 4IO5A 2UVGA 2DWJA 4IGTA 1HSJA 3LSWA 1ZJLA 1UHMA 4IRIA 1LJ9A 2O84X 3WAFA 2DWAA 2HS5A 3TODA 4YIFA 1B5JA 3ZMUA 1MDQA 1I1GA 1MJ9A 1SYIA 3DM0A 4EV0A 2RC7A 3I59A 5ICFA 4FEBA 3L6HA 2ACJA 2G7UA 2HQ0A 4M4GA 4OERA 3U8QA 1TFDA 3K9TA 4WCGA 1US4A 3OOPA 2I6EA 4H0WA 4KDPA 4KT5C 1A04A 4YG2F 3U2RA 4U2RA 1X3UA 2OZ6A 2P2AA 3BKIB 5I2KB 3QPTA 2OBPA 2BBYA 2RC4A 1F9BA 1P92A 5KDTB 3JV9A 4A12A 2XXQA 2Q2AA 2XRNA 5M2VA 2FEZA 3SZTA 1FC3A 2PG4A 2W85A 1LFGA 4IB2A 1KU3A 4MF3A 3ERED 3F8MA 2XX9A 1I1SA 4Q4ZF 1MXVA 1S6LA 3KZZA 1W7PA 3E3VA 2PQ8A 4JSDA 4F31B 1B4HA 2XXXA 1PDNC 4A5MA 3SQNA 2Q8KA 2XXIA 2RN7A 2REGA 1QVSA 2K86A 2G9WA 5JK4A 1J0RA 1FX7A 3MP8A 3E6CC 1LCFA 1XVYA 3CSBA 1M5FA 1GTKA 1MDMB 5I56B 2NOOA 1FP1D 3WU0A 1H45A 1OMPA 2O0YA 2W84A 4IO7A 4ZEIA 3CUOA 1SMTA 5L9OA 2NVUB 4OYVA 4DCYA 3AAFA 2DWHA 3TO7A 4HZFA 1SAXA 2PX1A 4F22A 4JK1X 2UYFA 3A3UA 4KNYA 1OVBA 3OV8A 3K01A 2VBWA 2FE3A 1CF7A 4KN7X 4OMZA 1KQ9A 5FB2A 1U3EM 3L00A 1XC1A 1JVXA 2RNJA 2Z9OA 2A5TA 3MUQA 3JSPA 2OZZA 4OIOF 4OFJA 1EU8A 4R6KA 4NHJA 2ZNYA 1URSA 2JPBA 3P9KA 4ISUA 3TTMA 3HPIA 1QKAA 2XD3A 1SMYF 2JSCA 1O63A 1JW5A 3ZKLA 1G3SA 1IZ1A 3C1DA 1GHCA 3G3FA 1VFEA 2EFOA 4LK1F 5D4RA 3WU1B 4H8JA 3GZGA 1HXDA 4LD5A 2ZMEA 3MEXA 2Q8JA 3LWFA 4U22A 3RLFE 2H5YA 4QHQA 5H8SA 3H7MA 2HTSA 3HRUA 2FXAA 1LBBA 2KLFA 3C32A 4YB6A 2D21A 4KR5A 2DO7A 1YFHA 2MBFA 5HDKA 4QSDA 4FECA 5LGTA 2F5XA 4UVBA 4L17A 1YS7A 5F6FA 3O29A 1O64A 4RPOA 1BN5A 1ZG5A 3MP6A 4IY6A 3M9AA 5BMZA 2ONKE 3H03A 1FQFA 3E3KA 5K2YA 2VT2A 3QU3A 4WXHA 3FF5A 3GYHX 2OBGA 4ZS9A 4ELPA 3MW0A 4IO3A 4LB6B 1KYZA 4KA4A 4ELQA 4OVJA 4OENA 1OKRA 4POXA 2IVMA 2ZCWA 2VC0A 3E97A 3KEQA 4G94A 2QBYA 2DSFA 3IKTA 2HAVA 4ESWA 1LFHA 4L9VA 3Q9SA 4M6XA 3JW4A 3B6WA 4I01A 4DDDA 3BJOA 4LG0A 2O61A 2CG4A 2IA2A 1SD6A 4RB3C 3IR1A 4G68A 3GEZA 1D5VA 2RINA 2Y7RA 3LSXA 4MTDA 1XGOA 3BROA 2XXWA 1MM6A 3OO8A 4WWCA 1SBPA 3GLXA 3RDIA 1B1HA 1U5TC 1BM9A 3LFKA 1T0KA 3EHSA 2O6GE 3HRTA 5LRSA 2A5SA 2I0BA 2XGXA 1B7UA 3VE1B 4EXKA 2VOOA 1MXZA 1N3XA 3KETA 3VXBA 3RTFB 4L9NA 4H65A 2HYFA 4LVQA 3DP6A 3FMQA 2Z8FA 3ZP5A 4PFWA 1LFIA 2FOKA 5HLIA 3V8KA 4E0XA 1URDA 1CF7B 1POY1 5A2QK 3F6OA 2O1LA 4EJVA 3VLVA 4IRGA 4M6YA 1GXQA 1ZRCA 1Z6TA 1TQIA 4HS7A 3E6MA 3K1MA 2AL5A 4BLAA 3N6TA 3ZMVA 1SQYA 3LAJA 4P55A 2HCAA 3I0TA 3J81K 1QJMA 2D1VA 3KP5A 2BGCA 4HYEA 1EZ9A 3D5LA 2GHAA 3HHFA 1B4AA 3HOTA 4XKNA 1EH6A 3OELA 1FSEA 1UTHA 4GXAA 4ZZDA 3RI4A 4U0YA 3RPQA 3F6VA 1USYH 5DVIA 3CVGA 3KJTA 1S7OA 5LOMA 4U1OA 2QQBA 2ZMEB 5A5XA 2M1BA 1EZOA 1O7FA 1QULA 2ETHA 4KYWA 2ISYA 1Z7UA 4CGZA 3NQOA 3G3ZA 2STWA 3OO6A 3O28A 5K5QA 1FPQA 3FV1A 4UV9A 3MPKA 5E8IA 4U23A 3KZGA 3K1NA 4F3SA 3IORA 4E70A 3RQTA 2XXHA 4TV7A 3RTRA 2HZLA 1XCBA 5L9MA 3I4PA 4F3PA 5J1DA 3WTXC 3KN8A 1LAXA 4LATA 1MKMA 4R6YA 2H09A 4ESJA 2W25A 3F3XA 5CYVA 1UIUA 4LLNA 5H8QB 1LCTA 3C7JA 3PU5A 2QBYB 4KIGA 1SFXA 2QS4A 5K5OA 2XXTA 1HKQA 4EJTA 4G68B 4HV6A 1TW3A 3TQLA 4UHTA 3U92A 1VSOA 3KOTA 3I64A 3GF2A 3K6UA 4PDKA 4HCYA 4HV5A 2Z23A 1OMIA 3PFIA 4RGSA 1ZARA 1OQHA 4OINF 4XKPA 2YLNA 1Y9UA 2P5KA 2XAFA 3VFJA 2V84A 4NWDA 2QQAA 4OFOA 3V89B 3F8CA 3RUMA 5D5VB 1Y3PA 1JW1A 3DP4A 5CMBA 4R9FA 3QRFF 2BYVE 5A2QZ 4E0WA 2RVCA 3ZQ7A 5ICGA 4HW8A 5E1ZB 1ZREA 1Y4CA 1B9MA 1MXUA 4G7ZF 2HAUA 1ZAOA 3O2AA 2VBZA 4WXCA 5CMMA 5DVFA 4EF1A 3J81Z 4OEUA 3F11A 2DXRA 2MH9A 1R36A 3S2VA 3C31A 3FD3A 4F1UA 2IRFG 4PQJA 2HZTA 4MQ9F 1TLHB 2XXRA 3IOTA 3KFWX 4A6EA 2ZYKA 2GAUA 1ZHFA 1LEAA 2W24A 2DPDA 2EWNA 3T66A 3U93A 1PBPA 1FZPB 1YW7A 5FLXK 3PUVE 2GFEA 3HRMA 3MAJA 4ZYEA 3R7XA 4LONB 5TJJA 3H3UA 4M9SA 2DXYA 1JETA 3CG3A 1W7PD 3CJNA 3WTYC 4EGYA 5BOXA 1BIAA 4UXNA 4DNCA 1L0OC 3JTGA 1ZGJA 2MLGA 3BP8A 2M87A 3B7DA 4GVOA 2ZKZA 3HTUA 1JQFA 4IF4A 3CUQA 3TTNA 2KIUA 1G6NA 5HS7A 1TQMA 2PBIA 1QUIA 1OVTA 4ESFA 1VFDA 3GX4X 1LDDA 2UXNA 2F5CA 2C6YA 3BFUA 3USDA 5L3EA 2YJPA 4WEDA 3ABTA 1KYWA 3C3WA 4YFNF 1RKMA 3VDFA 4LP2B 4IY5A 3CFXA 1S29A 4CO8A 1XMKA 3IB0A 3BWGA 5J6XA 1LEBA 3IB1A 1G3TA 1FYLA 5CI5A 5I58A 5KVRA 3WE2A 2B65A 3SERA 2YR2A 3ROUA 2MD5A 3FMSA 3QAHA 1KU2A 2HYGD 1DPUA 5E1XA 1F1ZA 2VBYA 2F35A 1KA8A 1HKSA 4IJAA 1O7LA 1V3FA 3PUYE 3SKPA 1SW2A 4PETA 3RGYA 1MXYA 3TDUC 3GFLA 3QOPA 1XHYA 1BI3A 1PDAA 2FA7A 2WKYA 4Q30B 4U0WA 4G9YA 4ECFA 3CRBA 2NRAC 1TT1A 4GLIA 1Y3NA 4GXOA 2QZ8A 4HX7A 3MPLA 4MLVA 1MJAA 2GXGA 5DUKA 2V93A 3PPPA 2RKHA 4OXVA 1HBXG 4XIGQ 5I59A 5H6RA 1O3TA 2RQPA 3CIJA 4QRZA 1OYIA 3TMGA 4F3GA 1T6SA 2F5DA 4QWQA 3SESA 1A40A 5H8FA 2KIFA 2V3QA 4KYEA 1P4WA 4OOIA 1FTLA 3FZVA 5FLXZ 3VVFA 3IK6B 4RS8A 3OXNA 2ESNA 3IC7A 2H6CA 4EM1A 3BPVA 1A7LA 3UGWA 3MP1A 2EFNA 5JI6A 5HDNA 5FFXA 4ZDMA 1DMBA 2V6CA 2O1MA 3E5QA 1E17A 1UB9A 1H9GA 5CVUA 2HQRA 1JHHA 3EN3A 4AIHA 2D2WA 3WAEA 2DE3A 2HEOA 4LGWA 3H4ZA 3TAJA 2IPQX 2PN6A 1AMFA 5LEKA 2VGQA 1LB2A 2F5FA 5JTYB 1U5TB 1B5IA 4Q48A 3N97A 1SI0A 4JWOA 1T38A 4ZEKA 4NF8B 4R74A 1LB8A 2D3IA 1UIVA 1D4NA 1R58A 3HSFA 2YX4A 3EYIA 4BYYA 4ZE9A 3VVEA 3V8LA 5L3GA 3K2DA 3I6VA 2FBIA 2I3WA 1TQPA 2COMA 4R6HA 3ZSFA 3R60A 5TU0A 5JR3A 2WWYA 3FM5A 2OA4A 4NF6B 3K0VA 4LFUA 3SETA 2A6HF 2RC8A 5BQTA 1ZN2A 4ETSA 4F3BA 1IQ7A 2I48A 3WODF 2IA1A 4X9TA 3TOAA 5LHGA 1S3JA 3TKYA 3OO7A 1MG1A 3FIRA 3LA2A 3EDPA 2DK8A 5EHSA 2DWIA 2Y48A 1QO0D 1SD4A 1S9TA 3T5XA 1RNLA 4QSCA 4X1BA 1WVJA 1PUEE 2P5VA 4OWDA 3T9XB 3K6WA 3V7RA 1Z91A 1Y20A 4AIJA 3ZN0A 1F4KA 4G2ZA 2IA0A 4XXUA 5E20A 5ILVA 5DD8A 5D5WB 5HBCA 4N0BA 3TPAA 4FHTA 4WX9A 3PMXA 2MH2A 3VLWA 4PP0A
chains in the Genus database with same CATH superfamily
1X3ZB 3JRFA 1B3EA 2XXYA 2OZUA 4XXUA 4ZZLA 2DTZA 1TNTA 4RAZA 3I4NJ 3VYRB 3J80K 2BVMA 5AA2A 2LKPA 4YIRX 2FIEA 4X0GA 2QVRA 2CQ7A 4HSRA 2FU4A 4IVNA 3MD2A 4KI0E 4MMPA 2DTRA 5LDZA 1QHHD 1YE9A 1MPCA 2FX0A 1NUYA 1OLAA 5H8FB 2XPUA 1ZTRA 3EYYA 2ID3A 2MA3A 3FX3A 1MBGA 4E7JA 2VT5A 1XDUA 1TWAJ 1B72A 4IHTA 1NG7A 4W97A 2LDUA 4A69C 1DOTA 1N04A 2JA6J 1Y3QA 3IJXB 5EYGA 5AA4A 1BI0A 1YYVA 4U7BA 2GA1A 4AWXB 1IF1A 2CZIA 3E4RA 4OMBA 4P0GA 2CQKA 3K6XA 4PE3A 3NAUA 2HFHA 4BHCA 2R5YB 3P5JA 4BHPA 1NNTA 3HV1A 2ZMBA 4YELA 4NF5A 2CV1A 2NVXJ 3PV0E 1OLCA 2W7NA 1T08B 4WF2A 4MLQA 3DU5A 4FX4A 3JRAA 1Z05A 1G0IA 2BJJX 4HQMA 5EGOB 5I2NB 4BNCA 1XVXA 4DCXA 5D8KB 4A0XA 2NOGA 4RYAA 3C2HA 2P0SA 5L8DA 5DV5A 1VF9A 1Z21A 1QVTA 1NK2P 1QPMA 1ZGAA 2XIGA 2VLAA 1N0TA 4EGZA 2CGPA 3T1BA 3GO5A 4GWWA 5CBSA 1D1AA 2P6SA 2LR8A 3K4CA 2KKOA 5CMCA 1FIPA 3CJTB 1DP7P 3UP9A 2FMYA 4EJWA 2E2JJ 1K4SA 3T9VA 3RPLB 1NV5A 2H98A 5CBRA 4P5OA 3GTMJ 2XDVA 4L0ZB 1MMDA 2E7XA 3L9FA 1YTYA 4I62A 4YMBA 3TL4X 3VFZA 1BR4A 2WAEA 4L5JA 1SYHA 3FVNA 4LZ8A 4Z2YA 3IH4A 3G3JA 3DPTA 3DPLC 3LSRA 3L2UA 1Q1KA 3ABMH 3ECHA 2CZLA 1W36D 2EZLA 2M4GA 4V2FA 1WQ2A 3CCJI 1DDNA 4X48A 5H8NA 3JRGA 2ABHA 2DLLA 2XV4S 3R0JA 2A69F 3RKXA 1O57A 2V25A 1NUXA 3IJOB 4XICA 1KA1A 4TLLB 4FT8A 5I7IA 1FPGA 1P1OA 2BHYA 2DOAA 3I54A 3RPUA 2M2EA 3RYPA 2DDBA 2E1NA 2D5WA 4JBZA 3M8EA 1A55A 2FBHA 1VFCA 4OETA 1G3YA 3BY6A 4RLFA 3HG9A 5FRNA 4XFEA 2QVVA 5HODA 4DYCA 3HOSA 2GLOA 4AM3A 2BOLA 1B4ZA 4GO1A 2F3BA 1A54A 4AB6A 1ZQ3P 1ZG1A 5KHDA 4MBPA 2EBIA 4XORA 2LC2A 1WSUA 1C0WA 1N77A 3S3NA 1I27A 3G3GA 1MY2A 3L6GA 2IS6A 1MQGA 3LR1A 1PUFA 1M5DA 3LUZA 5DEXA 3C2BA 4GWSA 3IWFA 2DK5A 4BY1J 3K0LA 1AOVA 4BJ6C 4XRFA 2VD3A 1GV2A 4C2MJ 3RKWA 4RXLA 5IP6A 2CUZA 3W3CA 1JXSA 2O6AA 3A2KA 3K1PA 3PFYA 3RT6B 2Y0MA 4KUMA 2JTVA 2WTEA 1HLVA 2HXWA 4XOPA 2Q88A 1Z7ME 3R26A 4U4SA 5J4YA 1FYMA 3VV5A 1DPRA 2LNBA 3J80Z 3W6VA 4F2OA 2F7BA 5FFZA 3TCFA 3MMYB 1I69A 4FATA 2WEFA 2EH3A 3I5OA 1P6RA 1D3YA 3K6VA 2KRHA 4JSOA 3K02A 2XPVA 1MMSA 4XNFA 3LSPA 2CV2A 1IXHA 3AKZA 2HPIA 3OOUA 2F6PA 1Z9CA 2D5VA 1ZTYA 2BV6A 1WWXA 4NC7A 5AA2B 3DLLF 1XGNA 4NC6A 1E2XA 4HNTA 3RKQA 1RRJA 2M4KA 4G8NA 5I59A 3N26A 3VSLA 2WY8Q 3CG1A 4GL8A 4ND9A 4U1ZA 2NWJA 2ZFWA 4DXUA 2GH9A 2CRGA 3TQNA 4KISA 1FTMA 2G93A 4I9DA 2M8GX 3M07A 4EEFG 4HXVA 1MGTA 3CDLA 3BCAA 3O6IA 3T96B 4GYGA 4MFEA 2VP1A 1B72B 3DLAA 1B3HA 2BY2A 1V54H 3P9CA 3D5RC 2CZHA 2E34A 4THIA 5AA4B 2P81A 5FKNA 1FBQA 3PNYA 3F22A 2KISA 5BPDA 4NBQA 2R7VA 4X6AJ 2CW0F 2QMXA 3BBRA 1IUYA 2P0WA 3CF2A 4NF5B 5FKKA 3BG6A 2HKOA 4X1EA 5E8GA 2TCTA 3EPZA 2F36A 2FBKA 3JRCA 1FJ6A 3CMYA 1B05A 2E1MB 2R6GE 3K4NA 2Z3YA 5LEJA 2VOZA 4RGUA 3MKYB 3CTAA 3L2RA 2FHYA 2E5ZA 3DV8A 5TRDA 3F8BA 3TQLA 2ICWG 3LAPA 1LFBA 1Y8RB 3I59B 1D0YA 3RQ4A 4AC0A 2DVZA 1J59A 2NXOA 3O6GA 3HPHA 1MM7A 4QLCU 1SPIA 3MYUA 3MN2A 1GDTA 1J9IA 3H1CA 3MQ0A 3RYRA 1D1CA 3M1CA 2KDZA 4KIBA 3PPNA 2E71A 4DZPA 2JA7J 1PB8A 4M9ZA 1Q9DA 3NEUA 1B9JA 2RV8A 1FPJA 4NF0A 2ESHA 3TP3A 2XAJA 4BDYA 1X1BA 4B44A 4RAFA 2EIKH 3HPGA 5KK1A 3KEOA 1AOYA 2M5WA 1MBEA 2VKHA 3R6UA 2PT2A 3H06B 1PP7U 2HTJA 1R1NA 1DUXC 2P7CB 3PIPF 4ANJA 2XX7A 1FT9A 2F3DA 3C35A 3N6UA 3FGSA 1FTZA 1MQHA 2LF8A 1IN7A 2HYJA 2WB1N 1B6HA 4P9UA 4YKIA 4MQVA 1FEXA 4HX8A 3PPRA 1K6YA 1W7PB 4UUSA 3ZQIA 3WGIA 4TOZA 4UACA 2XD2A 2JA5J 2GA2A 2LREA 4OTEA 1XG1A 4P9FA 3QUJA 5J40A 4P56A 3MFKA 2XPWA 2K9QA 2JRTA 2L01A 3TO9A 1MZBA 1AH5A 2F6GA 2Q89A 1YXIA 1LBVA 3GW2A 1P7JA 1JJ6C 3QSLA 4DBRA 3KZIC 4D5FA 2VQGA 1YS6A 1USTA 4G8HA 4N8YA 2VBXA 2QQ8A 2HR3A 1HW1A 2BZTA 4GOTA 4I6ZA 4KQPA 5J8FA 2BXYA 1TTYA 4B4CA 3KJ7A 5DEXB 2XF5A 3CUQC 2BY3A 3EUAA 3FDYA 3BDDA 3MKZA 2IP2A 4ZYHA 5KZTA 2FJ1A 4DXCA 1IW7F 3FXRA 4XSXF 4HAMA 1IMFA 2HEUA 1BOAA 1WJFA 4POWA 3D0SA 4HNVA 1AA7A 4BY7J 3U65A 3FJMA 3FVKA 5EEAA 1QGPA 4LITA 1B2HA 4A93J 5FO5A 1U6GA 2R7FA 2UZKA 2O03A 1DSNA 2DMPA 3RZDJ 3QYEA 2EFWA 3SFIA 1R5GA 1PEBA 3CMEI 4LMYA 5EJCA 1TWYA 1BKAA 1DBZA 2EA4A 4MJOA 2A5TB 1W5SA 1IMDA 2F34A 5TP9A 3PD9A 4FIMA 3COAC 5CM6A 3TTKA 3VYUB 3V5AA 3O9PA 4JVDA 4A3DJ 3CLOA 3VXCA 1ON1A 2VPRA 3SEQA 2EQRA 1USYE 4UV8A 4LB5A 4CSWA 3T8RA 4WXDA 2DPUA 2Z5UA 1JW4A 2LY1A 1BJAA 5FKMA 5KAFC 3G3KA 3MCZA 4CCNA 1HQCA 4YIIA 3QK6A 4B8XA 1YW8A 1MH3A 1KU9A 3HGGA 4PJLA 4YB7A 4AVPA 2B7EA 3UK4A 5EDNA 5AA1A 2IEKA 4M3FA 1GVJA 1NV0A 2WAQA 3HCQA 5IT3A 3WTSC 3GLLA 1FJLA 1LVKA 3ZKKA 1SW1A 2L9RA 3W9VA 2QF7A 3S14J 3CR9A 4NTLA 1LBCA 2HXOA 2DFEA 3LA3A 1SW4A 1NI9A 2WX9A 2DFHA 3KLNA 5IPAA 1IEJA 4A3GJ 3PPOA 2OV7A 3QQAA 3Q26A 3FASA 3GTQJ 1SD7A 3L7WA 4QFLA 1WHUA 1YJNI 4GWUA 3FMRA 3MQ9A 2J5PA 3RT8A 2EB7A 1T39A 1XC5A 2HQAA 4U4XA 4B09A 3ZR8X 1ZH5A 2H8RA 3A03A 2XGDA 2Z99A 3V7CA 2DT6A 2OCEA 1H9TA 1B59A 5HVQC 2MG4A 3PM1A 4ZEFA 2OTJI 1FTOA 3MZ9A 2R7DA 3RIRA 2CS3A 2IGOA 4OIRF 3RQIA 2R9JA 4DIGA 2H6BA 4QBAA 1LDKB 1ATGA 4HX4A 2J5OA 4N91A 3ZXSA 4ZE8A 2F5VA 1TW2A 4PK4A 2O3FA 3E6BA 2OUMA 3WTUC 3IRRA 4XN0A 3QUFA 4GWZA 5KCMA 2CUEA 5GTIC 2YU9J 3CFLA 2WV1A 3GFIA 2B4LA 2DW4A 3SEVA 2VQHA 1YRNA 1NNFA 4U0VA 2LY9A 2NNNA 5IOYA 3L09A 2OAZA 4A0YA 3L2QA 2VONA 3TCHA 3W6KB 3IHUA 3MVWA 1LE8A 1U9NA 3G1MA 1KU7A 3QYTA 3KN3A 2JK3A 4ZEBA 4LG0B 1IN8A 2P7VB 5DCMA 3M8UA 2CEYA 1PJRA 2K40A 1A99A 4PE5B 2PMUA 2L4MA 4G12A 3W2VA 3JRIA 3DP8A 4NN3A 1HC8A 2O51A 3TUSA 1ETQA 4G6QA 2HHMA 1U0JA 1G59A 4HDUA 1JI8A 1FBFA 5AA2D 1Z7NE 1FTJA 1SI1A 3OMBA 5C4JJ 1US5A 1FOWA 2F97A 3MWBA 5ITOA 1HOMA 5CVVA 1NH7A 5IP9J 1QKBA 1WVRA 3M3FA 4O6JA 2XXUA 3G3HA 2ISZA 2VOPA 4QPOA 1B1XA 2CMPA 2E2HJ 4OVRA 1I39A 2CQXA 2ONRA 5EQ8A 2VE8A 3JSOA 3S93A 1D5YA 4PFTA 4RJZA 4ZYDA 3KSXA 1WODA 3JZJA 1DPPA 2H25A 5EQAA 3UA8A 3EQLF 1GR2A 5K2XA 3ELKA 2HVSA 3FHNA 2EA2A 2HFBA 4CICA 3H9QA 4F92B 2F2EA 2IGMA 4ELRA 4I3EA 2VQCA 2EV0A 2Y7IA 5ISUA 3C4MA 1R00A 5ILUA 1FBEA 2XXVA 2RGVA 1EH8A 5LHIA 5DW8A 2QCOA 5TPAA 4MLOA 2XVCA 2KDOA 2Y0SN 5DD4A 3ZQGA 1NMUA 5LD2C 1ZBMA 1VQNI 1IJWC 2QQ9A 1N7WA 1M5EA 5FHOA 3EUHA 1PC3A 3FXUA 3KEYA 2GHBA 5ITPA 3GTKJ 1MRPA 4D9JA 4UA8A 4ENMA 4I02A 2MSYA 1QNTA 1F9NA 1ZRFA 1KGSA 1WJ5A 2CQQA 3LBSA 2ZXJA 1H0MA 4KJZA 5L9SA 4TQUQ 4U87A 2ZYNA 2PVUA 1URGA 1B40A 1UTHB 4GL0A 1BJZA 3ZQLA 1YYZA 4N07A 4IX7A 3T9UA 3THIA 2Y31A 3HHGA 3OYCA 2AYSA 5AIPA 2HU9A 2O7OA 2X48A 3PQJA 1Y1ZA 5DT6A 4IXAA 4IOAF 4KCCA 4G77A 3C36A 2DMUA 3OYNA 3GBBA 3MVYA 1IO2A 5A5XB 2XASA 2DQRA 2YPRA 3LSMA 4M72A 4O7MA 3OD7A 4XL9A 1VTNC 1O3QA 1S7YA 2HGCA 5EEHA 3PSFA 4XTCQ 5F1QA 3HYIA 4MAGA 2P3NA 1JKOC 2E7WA 4BQAA 4ZEDA 5E79C 4W1UA 2DJNA 3RPUD 4YKKA 2DXIA 2V1NA 3F0CA 2DQLA 3FUZA 2DA5A 1F36A 2DBBA 5GPAA 3SHFA 4YU0A 4YRVA 4IHYA 4RB0A 3SDGA 4A2UA 4OU0A 2LTPA 4D0PA 3MZBA 3LSKA 3Q9VA 4BH9A 1QPIA 2L3DA 1B7ZA 2IW5A 1R4NB 4HF0A 2DOJA 4JQFA 1UQWA 1ON2A 3CC2I 1NV3A 4QFNA 3BFTA 2ADUA 5ESYA 3JTHA 2UXXA 4N9IA 3S17J 4L9TA 4QFOA 3BZ6A 3T93B 4G8MA 4XKRA 1ONVA 1BI2A 1YRNB 2QSXA 3OR1C 2CV0A 4XLPF 3FVGA 4G4PA 3OYFA 4PFYA 2AQFA 2V1XA 4PZJA 4EF2A 1LQ1A 1F5TA 3ABUA 5CPRB 1FWZA 3NRVA 2D1HA 4I0BA 1LE8B 1P1UA 2YSRA 2NYXA 5LRRA 3H5NA 1IRZA 1SW5A 4RY1A 5BWJA 5M5YJ 3J7AO 1T98A 2ALUA 2ANJA 3PO2J 2OWTA 4OIPF 4EDPA 2ZNZA 1UZCA 2I3VA 3V4GA 1E3OC 1R5ID 1Z67A 3MZYA 2VKVA 3FWEA 2X7QA 1FQAA 1VQOI 2VJ4A 1Y1MA 3OEKA 4JXIA 2LG4A 1MJBA 1FSHA 3KP7A 4ONYA 1FOKA 2R7ZJ 5HLTA 1XT8A 3IL1B 1Y1VJ 3G1LA 3Q5FA 2M30A 3BR2A 4ASNA 3ISPA 4GDFA 1IXIA 2DDKA 1VQPI 1S8NA 1B3GA 1ZLQA 3NOHA 4O3AA 2QYOA 1X4PA 1LNWA 2I0CA 4G7HF 2XROA 4LA9A 2K7LA 1ETKA 3FKJA 3MZHA 2CU7A 4R79A 2R7UA 4HLXA 3GXAA 4O7IA 3S9NC 1T95A 4PFOA 5IYDJ 3PD8A 3BTCA 1GXPA 1ULYA 3BZKA 3UORA 4CYDA 2ZC2A 3BZCA 3GCMA 4M6VA 4F91B 2E19A 2P4WA 3CO7C 4HE2A 2DYXA 1LBYA 4BBSJ 3QODA 4ZDOA 5IT9K 4YMAA 5ICTA 3JREA 2DYRH 2L02A 1B46A 1R23A 3H36A 5GP9A 1B52A 3K69A 2EPFA 5K1YA 2B63J 1ZLJA 2Z8DA 2UVHA 3QWLA 3VSKA 2BVLA 4XKVA 1J1NA 4P8BA 3Q27A 4DYQA 1BW6A 3HSRA 3Q0VA 4IPAA 5GPCA 1IMCA 1BP5A 2XAGA 1U2WA 2F6CA 1IIWA 2FIXA 2P3VA 4HE1A 3DBHB 3TDJA 2LLKA 1W4MA 2ZXHA 5KCJA 2E1CA 1I6BA 3HO7A 5TISC 4AQ4A 1WJAA 4R9GA 3OYGA 2PMSA 5F27A 5HOOA 1H8AC 1OISA 1ZU0A 1EKEA 1H76A 4BGDA 4WK8F 1N84A 2I5UA 2OCUA 3C9HA 4ESXA 5D5UB 3B02A 1IXCA 4PJMA 4HF1A 4FX0A 3BT9A 2FRHA 1A8FA 2E2IJ 1RR8C 5HPQA 1K7AA 1J5YA 2V9VA 2QRYA 4GIZA 3TTLA 2H99A 1J2XA 2UVIA 1DPEA 4PGPA 4IL6C 3Q0UA 1K78A 3P7NA 1PB9A 3KN7A 4I3YA 2XWIA 4K2EA 4MNIA 4NWCA 4ZZAA 4KCDA 2VXDA 2L5QA 2PEXA 1RUOA 4XLEA 4Q47A 4G6TB 3M3KA 4NF4A 1B3LA 4L9JA 4P9KA 5B5EC 1G2HA 1Z77A 2AHQA 2QKMB 4YZZA 5FTIA 1FNNA 2MFZA 3S16J 2NS8A 1ZYRF 2FNAA 2DDAA 1YLFA 1X1CA 2Y84A 2QA4I 1HW2A 2KHMA 2AS5F 2V79A 1WDNA 2Q9TA 4YFXF 1OR7A 2IAIA 2K85A 2XAQA 1Z0XA 3H9JA 5B66C 5J8CA 5L3FA 4OEVA 1JKQC 3CCRI 1H3DA 4J01A 1JP4A 2I4CA 1IMAA 4QFPA 4R72A 3CUQB 4WEPA 3IKVA 4ZTJA 2B9SA 5ICQA 2WA0A 1R7JA 1NG6A 3H6WA 5JLXA 1FTAA 2B3FA 3GBGA 4O3BA 3KYDB 2YU3A 2TRTA 5C44J 5AA3A 2OJTA 3S9EA 4BQQA 3TW6A 2AL4A 4XBFA 2RCBA 2V9KA 1X2MA 3U72A 4XKBA 2DA7A 1T33A 3LV0A 5I84A 2EFPA 1SD3A 3M1EA 2O69A 4OFLA 1I50J 4BHBA 2JVHA 4P96A 2G7HA 2RKMA 1RYOA 3MVZA 1Y39A 2OK2A 2RF1A 1PBQA 2O68A 4PFIA 1XMAA 5JLWA 4XLNF 2XX8A 3ZQFA 2G0EA 2PJPA 4FASD 1FYKA 2EV6A 5I2KA 4EQ7A 3CESA 5I58B 4OIQF 1Q1HA 5EYFA 2AXLA 3SJMA 1LFPA 3Q28A 1XS5A 2LAOA 5KDTA 4XLHA 1IUDA 3K6GA 3ZMTA 2XKPA 5E3NA 4LJZF 2E1SA 3W2WA 1KZ8A 4RMNA 2L4AA 2R7WA 3FVOA 3ILUB 5FROA 4K3FA 3KC1A 3FXMA 2ZNTA 5FTHA 1FBDA 2BY1A 1O3SA 1A6QA 2X1CA 2R3SA 3FXOA 4IO2A 5AE4A 2K9MA 3TCGA 1LDJA 1SVMA 3IRQA 1WCMJ 4H8IA 5I57A 1M5CA 1QBJA 4ZZEA 3HXLA 2OU2A 1JJ8C 4RM3A 3CCEI 4HW0A 5IT9Z 2MGQA 5D5XB 3TOBA 3VEPA 3GVAA 2GBYA 2OLBA 2K9LA 2KJCA 4S05A 3D1NI 3CCSI 1N3WA 2PJRA 4NEDA 4XMYA 2HOEA 2VL8A 4BE0A 3E0JB 4XRSA 1P4AA 2FBPA 3G73A 2Q2CA 4HBLA 2Z22A 1CB6A 3A01B 3PQKA 4MIMA 4E7LA 3MZ8A 4JBAA 1F43A 1MDMA 4FAJA 3G2BA 2GM4A 4YKJA 1KWHA 2ZBKA 2KR0A 2H4IA 2O8XA 3REOA 2THIA 1B6AA 3CP2A 1RUNA 2KL4A 3TQWA 4II2A 1ELJA 4N6PA 4JP0A 1OCRH 4A3IJ 2DT7B 2F78A 3O6BB 1MY0A 2RCAA 4OQOA 3BG9A 2YPNA 4JWYA 4RPNA 5D4SA 5I59B 5KCJB 4CCKA 4CDGA 2DA6A 3B8BA 2IGKA 1V5FA 1NL5A 1M1EB 2QM3A 2O7UA 1WI9A 4GYIA 4I7HA 3SZPA 3ODBA 3UN6A 1D9YA 1TZLA 5F0FA 3U1DA 3E5UA 1IUFA 2BY0A 3KP2A 5CJ9A 3WTZA 2K9SA 2VPLA 3BR0A 3M7GA 4Y15A 1MPDA 4L18B 2FYIA 3I3VA 2K4JA 3OENA 2HOTA 2EZHA 1MY3A 2COBA 3E13X 4H46A 4C1TA 4NUBA 3U1KA 3HOUJ 4PDHA 1N25A 2HZKA 4IHSA 4HEA2 1WJCA 3K4LA 1VR5A 1T0FA 1GT0C 1K78B 3SEXA 3KIOA 4YFKF 4IOCF 1W0TA 3GFMA 2M9HA 3BR5A 3QP5A 4XKWA 2LKSA 5EYRA 3CF5F 4NAPA 2ZYOA 3BR1A 3UR3C 2FQ3A 3FM3A 4UVCA 5E3MA 2X6WA 5HNHA 3QU6A 1BOBA 2H27A 3I5UA 2MC4A 2MLKA 1BLFA 5B70A 4CH7A 1HSLA 3ZMZA 1CQTA 3LUYA 2HOSA 1WJDA 1B58A 2DI3A 2W7YA 3TELA 2E5NA 2CFXA 1IN4A 5AIQA 1VQ8I 1CGPA 3B6TA 3DKWA 3VLUA 4M71A 4GQOA 4EJOA 3DP7A 2DAOA 3VOEA 4C0RA 3H92A 1JNFA 4MHGA 4M1VA 4R2BA 3GTLJ 4XSZF 1LAGE 3DEWA 2A07F 2R7OA 2L9SA 1SVXB 2BEOA 4BEHB 2F7CA 3PTYA 1GV8A 1GVDA 5CLSA 4MTEA 1INPA 3SEYA 1UCRA 2OJED 3GUDA 2ZB9A 3S3MA 4LQ2A 3TO6A 4PCQA 3RN8A 3CJRB 4H5FA 4G8XA 4NQWA 3H6UA 1JVYA 4XN3A 1OIBA 1KQ0A 1FBGA 1BIYA 2JVGA 1AWCA 1GVCA 2UXAA 3S4UA 3JRBA 3LQRA 1VQ7I 2WYKA 2F4MB 3R0AA 1PP8F 3FBIB 3F23A 4EM0B 4PGHA 1MPBA 2XUBA 3F9KA 4EXLA 3MVPA 2R7QA 1Y8QB 3CJQB 3CLQA 3SEZA 1GGGA 2D45A 2X26A 4GGGA 1B0HA 4KFCA 2W82A 2GZWA 3AG1H 2W48A 3PMWA 3HOZJ 4EM2A 2KZVA 4EUOA 3AG3H 3HTSB 2X7PA 3FXKA 1TT5B 4BJ5C 1Q1VA 2DOFA 2JSPA 4ZH4F 3GWZA 3QYFA 2QLZA 4RBOA 4MFDA 3EUKL 1T8IA 1MQIA 4QSEA 1JTYA 2NUVA 4N6KA 2XWOA 4O3CA 5HS9A 1EH3A 4FTHA 1XSVA 1OQGA 1QW0A 5M3FJ 4O94A 3GBAA 3QMFA 1QA6A 3KX2A 3ECRA 2XHKA 3LFUA 1YHQI 4JDFA 2QPQA 5I57B 2K02A 3MZ1A 3G71I 2XKOA 4PFRA 2NVTJ 4RK2A 3S32A 4MO7A 4UY8I 1YO5C 2RC9A 4PJNA 3G4SI 2H9BA 1DK4A 3JR9A 3S9LC 1FMWA 2IA4A 3ZQCA 5B3SH 4XLFA 5E3LA 3QAXA 1W5TA 3DPUA 4KIFA 4LZ5A 4RB1A 1R71A 4G61A 2KP6A 3R6SA 2DP8A 5CKTA 1LVAA 2A68F 1U9OA 5LLQA 4PFUA 2M0MA 5FD6A 1IXRC 5H6QA 1IGNA 1E0EA 4BDOA 2LMDA 1VQKI 1ETOA 5IKBA 1UFMA 1A8EA 4RAYA 3HL2A 3QIMA 4F18A 1LGBC 3OO9A 1I6QA 1NFTA 3BCBA 5DCFA 3WTTC 4I0AA 4AYBA 1IV8A 1UMQA 2Q0OA 3RTWB 1SVLA 3WGGA 3CFZA 1XD7A 3E5XA 2VHAA 4ON0A 1N75A 1QUJA 2YX7A 1IRGA 3KGCA 1V4RA 4MEXF 1TBXA 4Y17A 1POTA 2DMQA 2V1UA 3M8FA 1FQEA 1UAAA 4G6DA 2PFZA 2JPCA 4FBPA 3V8JA 4GFBA 3CO6C 5C3EJ 4QXDA 1RC9A 3MBPA 4BAYA 1CNQA 3KG2A 1OCPA 2X6YA 3DFGA 4CHUA 1B32A 4UB8C 1MBHA 1IV6A 1Y4TA 5ET5A 3KSJA 4CZZA 2QFLA 2HWVA 3T9HB 2A05A 2O9LA 3PMVA 1EV7A 4HRIA 4A3MJ 3EF7A 4HOBA 1RIOH 3FXJA 1DQUA 2JMWA 4L5EA 1OCTC 5IZ3A 2V9PA 3O97A 4LLGF 5ICCA 4EMSA 2ZSHB 1ENHA 3JRDA 1FPLA 4M3EA 1DU6A 2DS9A 3PUWE 4OESA 2CYYA 4F39A 3KP6A 2KJBA 4MCOA 2FD5A 2PMZA 3TFLA 3EUHC 4JVCA 2R7RA 1RKTA 4GX3A 4DZ1A 1VE4A 1Y6IA 2DOEA 3O2PE 1NHAA 4JB7A 3E7LA 4XRSG 1TNSA 1IG7A 3E9XA 5FJ8J 2HDCA 2L2OA 2GQQA 3S2WA 3A09A 3OSQA 3UNGC 1WRJA 2I4BA 1R9QA 3EPEA 1FTTA 5BS6A 3MKLA 2XSDC 4LQ5A 4P11A 5H8NB 5ELVA 4CUGA 1W0UA 1TWCJ 3QPHA 4V19K 2UWMA 3GYYA 1D8KA 4IKFA 1N7XA 1OYWA 3CZ6A 3DQVC 4O8MA 3BQZA 1U8RA 3K4UA 1IC8A 3K10A 1NUZA 1X1AA 2CSOA 5E3OA 3WGHA 2Z33A 1BC7C 3CHGA 3HSEA 3GTPJ 1FLIA 3P7IA 5LFAA 2Z16A 3OS1A 1YAEA 1DGWY 5K5RA 3F21A 4J00A 2WBDA 1ZK8A 3O6HA 5JEIA 2JQ7A 1YX5A 2B0LA 2MYSA 2OQRA 4KMFA 5IYBJ 2L7FP 1FPEA 4RGRA 2QVUA 2E1OA 5FGMA 2ZO4A 4BQNA 2LF7A 1ZG3A 4A3BJ 3PUZE 1RESA 3KP4A 1X2NA 1FBHA 2XRLA 1FBUA 1B8IA 2ZJ2A 5H8QA 1PUFB 2EIMH 4E7HA 1QU3A 1M5BA 1B0LA 1XX5A 1B3FA 4G7OF 3PL8A 2QUFA 3KE2A 1LBWA 1QUKA 2CZKA 3CCUI 3IO6A 4BDQA 3GZ5A 2DJIA 4M74A 1ZR2A 3GZNB 4BXXJ 1MQJA 4PC9A 3IOUA 5DYHA 3F8FA 3HIFA 2LP0A 3K4BA 5L3DA 2TDXA 2ONSA 3WG9A 3VDXA 4F19A 3PUFA 1AU7A 3F8NA 1UTBA 2PYYA 1TXFA 1SD5A 3MKWB 3H6TA 3IOVA 3IX1A 1Q35A 3Q25A 4Y52J 4U21A 2OQGA 4GWOA 3KLOA 5F1RA 1D9VA 1FCKA 2LD5A 1TFAA 4MH5A 2QVOA 5LGNA 5H20A 4LUBA 4BS9A 4ZECA 4OWRB 1IXSB 1HSEA 1P4XA 2XXPA 5EG0A 4MHFA 3ML6A 3LSGA 3FJ7A 1FP2A 3K2ZA 1ZGWA 5A5LA 2WC2A 2HNHA 2CUJA 2Z1DA 2PFBA 3BJ6A 2P6TA 1MH4A 3IWZA 2HQNA 3W9WA 5BUUA 4C1UA 1O3RA 2Y7PA 2EV5A 1NKXA 1RZ4A 4N4OB 1XDSA 3ZN1A 2KIMA 5J4VA 5D6EA 1BBYA 1R1TA 4ENNA 3KZYA 3IO4A 4PJJA 1D3KA 2DA3A 5B1AH 4ITVA 5LBQA 1H43A 4Q5SF 4N9HA 2ZNUA 3DEEA 5J1YA 2W4SA 4PAIA 1FQCA 2DA4A 2FOWA 4A3FJ 3I71A 1I6AA 2ZXWH 3CP8A 1IAWA 4DE8A 2AO9A 1HDPA 1ANFA 1EYKA 4Z7EA 1ITYA 4FORA 4B3AA 5FLMJ 4HDVA 5DVJA 4XQFA 1OYYA 4A3LJ 4XM3A 2WAQN 1LLSA 5E18F 4UABA 2HPMA 2V4JC 3FIWA 1O7TA 1EZPA 4HTGA 5IZ3B 1G0HA 1MXWA 4QTRA 1MDP1 1FQDA 4PGGA 1TWGJ 2Z2SB 2V4CA 5D6FA 5CVJA 3SXYA 2EFQA 3TKDA 4GXSB 5IM2A 2M3AA 4E4HA 4RNSA 1QZZA 3TGNA 1IMBA 4B43A 2Z8EA 3RNNA 1LSTA 3DTIA 1R9LA 3OYEA 1BI1A 3RZOJ 4I98B 2GIZA 3GZ6A 3ZMSA 1BIBA 1AKHA 2F7AA 4EJUA 3CSGA 3B6QA 3V7SA 3ILTB 2GRVA 3HKZA 2K3FA 3OSFA 3OWTA 1T2KA 4KYDA 4F1YA 2MC3A 4OHNA 4ZYGA 4F93B 3U9GA 3PPQA 2FNPA 3GTGJ 5HS8A 2VC1A 3ECOA 3BLYA 3H9GA 1UHWA 4QFKA 3ZQHA 1R22A 1MMAA 1DU0A 1YJ9I 5CQEA 5ERIA 4QF9A 4O5VA 5CC2A 2R71A 2K27A 3O66A 5GAEJ 1Y0UA 2XB0X 3AG2H 1X1PA 5JFRA 3IL2A 1D9QA 3HZJA 3WE3A 4UUSB 1IN5A 4I2OA 1JUPA 2F5EA 3C34A 4DLDA 2VI6A 4UUTA 3DF8A 4UNOA 3A3CA 2NAZA 4WXJA 1Z6RA 1EYIA 2IT0A 3BG3A 3BTJA 2EK5A 2JZYA 3DBLB 3FATA 2FSWA 4HCWA 3TEPA 1B5HA 3TYHA 4B47A 4R1HA 2R7XA 5GADJ 4TLMB 3CCLI 4I8CA 3LQQA 1N78A 3SDFA 4RB2C 1OR7C 2Q2EA 1U78A 2VT3A 3U21A 1H89C 3OR2C 1B8IB 2LBFA 3MJNA 4H4KC 4PUSA 4OMYA 1ZKBA 4HG2A 1TP4A 5L3BA 3UKGA 4AD9A 4DI4B 4MEYF 2DVCA 1ZRDA 2X4HA 2X0LA 3ZCOA 1BC8C 1FQBA 3O3KA 4M9XA 2PMHA 1Z1DA 2BW3A 2Y2ZA 5IOZA 3IOWA 1FOYA 5LHHA 2M45A 4KFQA 1S7EA 4AB5A 4HA8A 1S72I 5B7DA 4A6DA 3R61A 3GLBA 4BJTA 2PLYA 4L0YB 1UTBB 2LVSA 2QS3A 2NS0A 4PBQA 2KMUA 3K4KA 2QWWA 5EZHA 4DQ2A 2CMOA 1G3WA 2CWEA 3HN0A 1B51A 1JGSA 1JEVA 3HRSA 3SEWA 1P99A 3QPLA 2B3BA 3BG5A 3OOAA 4YICA 1YI2I 1APLC 5TP9B 4IGRA 4UUVA 4BE1A 3OSRA 4Q5TA 3DBRB 3IAZA 4C2TA 4XLAA 4R2FA 4KN4X 3J7YJ 1FY7A 3BIHA 1VZ0A 1EYJA 4DXBA 1YQAA 2ELJA 5J47A 3CCYA 3PJRA 2GXBA 3T22A 3H3VK 3X2QH 2CO5A 2A6EF 1YW9A 1XSXA 4CCJA 2XXKA 1P2FA 1WH5A 1B1BA 2K3PA 4KD5A 1X3WB 2W00A 2BHZA 1K79A 3D5SC 5L3CA 2IGNA 4EQQA 2IS4A 1TL8A 1SFEA 3OYLA 3J7AY 1G8XA 2I58A 1YPNA 1EF4A 1QQIA 3FXQA 2UVJA 2X51A 4BXUA 4H1XA 2DA1A 2XB5A 3PUXE 2VJ5A 2ZNSA 4GF8A 3HUGA 1NNKA 4GCVA 2KRCA 3MC2A 1AL3A 3DXJF 1XB4A 5ICEA 1YCJA 2BE5F 5CMKA 4RAGA 4P1EA 3RY3A 3WTVC 2HI3A 2M8CA 3U94A 2DFIA 3OYMA 3FV2A 1DTZA 3LSLA 5CVIA 4OVSA 4RLQA 3GXOA 5JVGF 1IXGA 2ZXIA 1YG2A 3K00A 4I1DA 4MEVA 5C4XJ 1RPWA 5DYMA 1LAHE 4CYCA 5HM4B 1KONA 3IUOA 2X1EA 5T3JA 5LGUA 1RI7A 3BPXA 3M3LA 2DA2A 4XF5A 3SEUA 4AU7A 3IB2A 3ZMDA 5JHUA 3DTEA 2DU9A 5ED4A 1AKHB 4GWYA 2WADA 4LLLA 3QPSA 4NMYA 2E60A 3VWBA 2ECBA 4EQ9A 5BPIA 4GRKA 3EHUA 1WJEA 4ELOA 4GD5A 2L9VA 2QJEA 1H88C 3BIGA 1PYVA 3UIFA 3DLNA 2WY7Q 4H0EA 5DTBA 5E1WA 1NUWA 5K7HA 3G7WA 2FF4A 5EEGA 2G29A 2HDWA 3HHHA 3VODA 5DUIA 5I2NA 1IN6A 1T0FC 3LOCA 1ZLKA 2AIXA 2JJKA 1REPC 2CW8A 3QXMA 4N81A 5JTYA 1U5TA 2F48A 3PNTA 4FJPA 4JX5A 1W5CC 3L2CA 1YITI 5DCMB 4YAHX 1ETXA 1BTJA 4IRHA 4NF8A 1EH7A 2QSHX 2M8EA 4H45A 1NV4A 1ERDA 4KHZE 3QYBA 1H44A 1SDXA 1KQ8A 4NE4A 3AXFA 4O3MA 3VVDA 5CRYA 2LSOA 3DWLE 1FRPA 5I5PA 4U7DA 3OEMA 1HA8A 1QZYA 4FE8A 4RM2A 1WKMA 3NWTA 2W57A 2LBFB 3RPWA 1YIJI 2V1DA 4MNUA 3ULQB 5DTDA 2Y75A 4I09A 4A3JJ 3SFZA 4DYRA 1BL0A 3KC0A 2DE4A 3PGFA 3BQYA 3TZAA 2ZXTA 4U88A 4FETA 4RGXA 4IO6A 2HXIA 1PB7A 4NF6A 1B9NA 2IS2A 3CMMA 1BA5A 5ILSA 4NB5A 4M73A 4BBRJ 4MGRA 4F3QA 1HCRA 2W1OA 2QENA 4PCDA 1J7KA 1MY1A 3HJEA 3ROJA 1I6XA 2EJRA 1S9HA 5LTCA 5IGAA 2LFBA 1LB9A 3VB2A 4PSWA 1IITA 3Q29A 2XHDA 3LSTA 1B7HA 2VKDA 3N4MA 1FBSA 2MW8A 1VQ9I 2RDPA 2MD0A 1ZIUA 4ZC3A 4R8HA 1FPKA 2X6XA 1MQDA 1S50A 3JYRA 2QS1A 2PT1A 2VODA 5F7VA 2H94A 5TPAB 1MBFA 1V5EA 3W6JB 3WHCA 2WV0A 1LBZA 3D4GA 2ID6A 3ABKH 1S7AA 1FPDA 5CQGA 4BL0B 3GTJJ 1WZ2A 3KPHA 1R1UA 4EVIA 1ACIA 6PAXA 3EQ1A 1A36A 1K9YA 3ZS6A 2JUGA 4C9YA 3CI8A 1I5ZA 4S04A 2VIXA 1K6OA 2X9DA 3WTWC 1HF0A 4R73A 3OIPA 2DT5A 1J09A 2X6OA 3JAMK 1JE8A 3LA7A 5FHMA 1SFUA 1II5A 2QEXI 3I53A 3ONMA 5FHNA 1SEUA 3T0YA 4WKMA 2XGCA 3LC8A 4HNUA 1XN7A 4BDNA 2I49A 4BDLA 3T8TA 2OPTA 3IP4B 1VQ4I 1JHFA 2K4BA 4HLYA 1FBCA 3H3ZA 1XGSA 1ODDA 2H1LA 2VQLA 2XAHA 1KZHA 3HOWJ 1XOCA 1FTKA 4BDRA 2RREA 2NXNB 3T0JA 1YOVB 1UG0A 2L0KA 2P1SA 3B6CA 4CCMA 1WH7A 2V3UA 4P0IA 2A61A 4A3KJ 4CYCB 5H8HA 3BJAA 1XCVA 2HKXA 1YTVA 2IXSA 3VPRA 1J75A 1LUJB 1MIJA 4DJAA 3I58A 5FKLA 5IAIA 1V5GA 2E35A 3K2AA 4H5GA 3MAMA 4HPQA 2ZJQF 4J19A 4Q0CA 3C18A 1NH8A 2R5YA 2WBMA 4L5IA 2ZYMA 1FPIA 2JT1A 2CEXA 1NH3A 1JEUA 2Y7KA 4JWXA 2DQVA 5J3LA 2FNCA 4F2QA 5EGOA 1X58A 3F72A 5HLGA 3V8XB 1MS7A 4HF2A 2STTA 2QL3A 4F1VA 2A3SA 1BK4A 3KFMA 3MVXA 3DU6A 3KP3A 2FMLA 5HDGA 3H6VA 1ZMGA 2JUCA 3S9MC 2H8WA 3R4KA 5CVRA 2HVQA 5DEQA 3LMMA 2GXAA 3QP6A 2XWVA 3G3IA 4X1DA 3CC7I 4Y33A 4Q8RA 3KBZA 1A35A 3KCCA 4JOMA 4JX4A 4ENKA 4OANA 4B48A 2DYSH 4OZ9A 3OYKA 3ZPLA 1IDZA 3RPLA 1HSTA 4LK0F 2E0SA 1VQLI 4P1LA 5JVTA 3RKYA 3S15J 3KBRA 3LSFB 1MMNA 1AIVA 3B73A 2Y7WA 1I3QJ 2P5LC 3A1YA 3AG4H 4GFRA 3VYSB 1FBPA 1LBXA 1P1NA 2VXZA 1G4DA 1OPCA 1USSA 4NX1A 4YKPA 3P9IA 1N76A 2AXTC 2K9NA 5J1UA 2A5YB 2QGUA 4ESBA 1STZA 3OYIA 4XKQA 4Z0IA 4A5NA 3TTRA 2IJLA 5D8LB 2ZMEC 4BDMA 1RDXA 3IAS2 4HQEA 1R9TJ 4KPTA 1Y1WJ 1YIOA 3BOQA 2PI0A 1DTGA 4R75A 4LZ7A 1NNPA 4MFIA 3N5LA 4YB5A 1P1WA 4OAZA 3OY9A 3IV5A 3E6DA 3OIQA 3S3OA 3C33A 1HKTA 1RDZA 2PBWA 2UYEA 4QIWN 1YJWI 5F64A 4WEDA 2ELHA 4GX6A 4FEDA 2VE9A 4D7NA 4E7IA 4B1RA 4ENJA 2JWTA 2KFDA 3I3LA 3EHTA 4EQBA 5I56A 1HW5A 1XSDA 5FD5A 3RJPA 3SYTA 4D5CA 3HB9A 3FJGA 5DDGA 4KYSA 1P9QC 3CDHA 3E1SA 3D4CA 3JAMZ 2VD2A 1IRFA 1FW0A 2O7IA 1I3AA 4KMUX 4H6DA 3W15C 1D8JA 3B50A 1R6ZA 2ZFUA 5KAIC 3KOSA 4IO4A 4IQJA 4E7ZA 2FVZA 4RK9A 5AONA 3D1RA 1R4MB 2OD5A 3MWMA 1LAFE 2F4IA 4AS4A 2DODA 4KT6A 2OWZA 3A29A 2REJA 4F29A 2P8TA 5E17F 3CD6I 2BXZA 1MY4A 1MD0A 2F8DA 3TDZC 4XIDA 2OWSA 3H3GA 3S1MJ 4XR6A 2ECCA 4RA1A 3DELB 4UVAA 5EHMA 4CXFA 4RDUA 3EETA 4F7ZA 3FHZA 2KPMA 2V3TA 3KEIA 3U1OA 2KQRA 3HFUA 1MXXA 4G68C 2ELKA 5M5WJ 2IEEA 4KICA 4BACA 1MMGA 2PFYA 1JTXA 3N94A 5HLHA 1CE2A 1P1QA 4H67A 3HSTA 4NF4B 2VN2A 4GRIA 1XGMA 2NNYA 2L54A 3GFJA 4Y13A 1L3LA 5EF6A 4B3XA 1ETVA 4NGUA 3LL7A 2KRFA 4N13A 1R5HA 5H8HB 1RYXA 2FA5A 4A0ZA 1E3HA 1EA3A 1UG2A 3Q0WA 2DE2A 2QS2A 2XA5A 4NQ8A 3V83A 3DEUA 3OSGA 5IZ1A 2GWRA 4FCYA 2E36A 2EZKA 2QMWA 1SAUA 4AIKA 1JGGA 1IDYA 4GX4A 2GIVA 1R1VA 4DI3D 4IO5A 2UVGA 5IZZA 2DWJA 4IGTA 1HSJA 5EQ7A 4GWXA 3LSWA 1ZJLA 1UHMA 4IRIA 1LJ9A 2O84X 3WAFA 1FOXA 2DWAA 3CMAI 2HS5A 3TODA 1RETA 4YIFA 1B5JA 3ZMUA 1MDQA 1I1GA 1P7IA 1MJ9A 1WPKA 1K61A 4EV0A 2R7TA 3I59A 1SYIA 2RC7A 3DM0A 5ICFA 4FEBA 3L6HA 3BC8A 2G7UA 2ACJA 2HQ0A 1OFCX 4IHWA 4M4GA 4HSTA 3K9TA 3N05A 1TFDA 3U8QA 4WCGA 3L1PA 1US4A 2O5RA 3OOPA 4XKCA 2ZJRF 4ZDLA 4KDPA 1NTCA 2V7FA 4KT5C 2L9NA 2I6EA 2R8TA 1A04A 2A5WA 1QJMA 4YG2F 3U2RA 2BJIA 4U2RA 1X3UA 2OZ6A 3A4CA 2P2AA 3BKIB 5I2KB 3QPTA 2NVYJ 1RKWA 2OBPA 4NG7A 3ZRGA 2BBYA 1JKPC 2RC4A 3S1NJ 1FJ9A 1F9BA 1DCUA 1P92A 5KDTB 3H35A 3JV9A 4A12A 2XXQA 5F24A 2Q2AA 2XRNA 4X04A 1V55H 5M2VA 4XK4A 2FEZA 3SZTA 1FC3A 4A3CJ 3IFCA 2PG4A 2KZGA 2W85A 1OCZH 1KU3A 1LFGA 4IB2A 4MF3A 3ERED 5F0HA 3F8MA 2XC7A 2XX9A 1I1SA 1AHDP 4Q4ZF 1MXVA 3ESWB 5K7ZA 1S6LA 3KZZA 4N4NB 1W7PA 4BQOA 3E3VA 1FPFA 4X8RA 3H0DA 2PQ8A 3CCMI 4JSDA 4F31B 1B4HA 2XXXA 1XPXA 1SC7A 4A5MA 1PDNC 3H5RA 3SQNA 1IMEA 4PFBA 2A6TA 1T56A 2Q8KA 2PJRB 2RN7A 2XXIA 2REGA 2ZZWA 1QVSA 2K86A 2G9WA 5GAGJ 1J0RA 5JK4A 1FX7A 3MP8A 3E6CC 3PNVA 1LCFA 1XVYA 3CSBA 3C2GA 1M5FA 1GTKA 3IH3A 1MDMB 2EINH 1L5TA 5I56B 2NOOA 1FP1D 3WU0A 1H45A 1OMPA 2O0YA 2W84A 1A6IA 4IO7A 4ZEIA 3CUOA 1SMTA 5L9OA 3G1OA 2NVUB 2HOAA 4C2UA 4OYVA 4DCYA 4QSHA 2R7SA 3AAFA 1QRYA 2DWHA 3TO7A 4IZZA 4PBHA 3E78A 1XMXA 4HZFA 1SAXA 2JN6A 2PX1A 4F22A 4JK1X 2UYFA 2DFFA 3A3UA 3OYBA 5H2FC 4KNYA 1OVBA 2Y30A 3OV8A 3K01A 2MABA 1WI3A 1HDDC 1FMVA 2VBWA 2FE3A 4H0WA 4D1QA 3OMYA 1CF7A 4KN7X 3AFHA 3K4MA 4OMZA 1KQ9A 4V2GA 5FB2A 1U3EM 3L00A 3OS0A 4N4UA 1MNDA 4AYBN 4XRMA 2RNJA 2Z9OA 1JVXA 1XC1A 2A5TA 3MUQA 3JSPA 2OZZA 2CUFA 2HPGA 2OX3A 4OIOF 4OFJA 4M3DA 1EU8A 1MNEA 3CCQI 4R6KA 3WU2C 4NHJA 2ZNYA 1URSA 1OLTA 1LKXA 2JPBA 3P9KA 4ISUA 3TTMA 2DCEA 2OCCH 5IY5H 1SFOJ 3HPIA 5FRMA 1JUMA 1QKAA 4M3GA 1SMYF 2XD3A 2JSCA 1O63A 1JW5A 2NOJB 4FE7A 2HQ5A 3ZKLA 2JJ7A 1G3SA 4XOTA 1IZ1A 1W36C 3OL4A 3C1DA 1GHCA 3WHBA 2QSFX 3G3FA 3MSTA 2Q74A 4E7KA 1VFEA 2EFOA 3DCFA 4LK1F 5D4RA 3WU1B 1EJ9A 4H8JA 3GZGA 1HXDA 4LD5A 2ZMEA 3MEXA 2Q8JA 3LWFA 4U22A 3RLFE 2CW7A 3FXBA 4D7MA 3FBNB 2H5YA 4N15A 4QHQA 2JRMA 4PDDA 5BNGA 3IAM2 1VQMI 4IEJA 5H8SA 3O8HA 3H7MA 2HTSA 2PMZN 3HRUA 2FXAA 4NQWB 1LBBA 2KLFA 3C32A 4YB6A 3CQZJ 2D21A 2DO7A 1YFHA 4KR5A 4MNCA 2GOMA 2MBFA 1MW7A 3E79A 5HDKA 4ZTFA 2VPNA 4QSDA 2MKZA 1K9ZA 4FECA 5LGTA 3TBIA 4IR8A 3H0GJ 2F5XA 1TWHJ 4UVBA 4L17A 1YS7A 1SANA 5F6FA 1O64A 3O29A 4RPOA 1BN5A 4I76A 1ZG5A 3A0HC 3L2VA 3MP6A 2WB1A 3M9AA 5BMZA 4IY6A 1UELB 2ONKE 3H03A 2OF7A 1VI0A 1FQFA 3E3KA 2WAFA 3JCUC 5K2YA 2VT2A 3QU3A 4WXHA 3FF5A 4DIQA 3GYHX 4IO9F 2OBGA 4ZS9A 4ELPA 4NNJA 3MW0A 3S2DJ 1FPBA 4LB6B 1KYZA 4KA4A 4PFPA 4IO3A 4OVJA 4ELQA 4OENA 4FQGA 1OKRA 2M0CA 1LEVA 3W2AA 4POXA 2IVMA 2ZCWA 2VC0A 3E97A 3FXLA 3KEQA 4G94A 2QBYA 3IKTA 2DSFA 4ESWA 1LFHA 1ETWA 2GOXB 4L9VA 3Q9SA 1TWFJ 4M6XA 3JW4A 3B6WA 4I01A 2LRDA 4IHVA 4NHBA 2EILH 3BJOA 4LG0A 4BDZA 2CG4A 2IA2A 2O61A 1SD6A 9ANTA 4RB3C 2CJJA 3FK7A 4F52A 3IR1A 4G68A 3GEZA 1D5VA 2RINA 2Y7RA 1Z3YA 3LSXA 4MTDA 1XGOA 3BROA 2XXWA 3FISA 1YX3A 3RYDA 4M3BA 1MM6A 3OO8A 4WWCA 1SBPA 1X4OA 5I3SA 4BXFA 2R0QC 3GLXA 3RDIA 1DGRM 3I55I 1B1HA 1U5TC 1BM9A 3LFKA 1T0KA 4ABZA 3EHSA 2O6GE 4IHXA 3HRTA 3K7AJ 3CC4I 4XLCA