3HHGA

Structure of crga, a lysr-type transcriptional regulator from neisseria meningitidis.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
293
structure length
293
Chain Sequence
KTNSEELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTEEGAQYFRRAQRILQEMAAAETEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of CrgA from Neisseria meningitidis reveals a new octameric assembly state for LysR transcriptional regulators
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LysR family
total genus 69
structure length 293
sequence length 293
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hhgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhgA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhgA02
3MW0A 4NB5A 2ACJA 3GUDA 3LA2A 3VDFA 2PI0A 3ECRA 5E20A 3PUXE 3L7WA 2DE2A 2DVCA 2DE4A 1IAWA 5ILSA 1J2XA 1U8RA 2PLYA 3TZAA 4Q47A 3PPQA 4EF1A 3TO9A 4NTLA 5K5OA 4PFWA 3PPPA 4OYVA 4FEDA 1TLHB 3R6SA 1TFAA 2PBWA 3KZGA 4KCCA 5J1DA 2ZFWA 3HSRA 4NQWA 3CLOA 3Q9VA 2A3SA 4A2UA 4GOTA 4GFRA 3C31A 2L4MA 1MGTA 2VD3A 3V8KA 3KP6A 4L5IA 1SYIA 2V79A 1ZH5A 4QF9A 4UVAA 2XAFA 1XOCA 4UA8A 1QVSA 5AA4B 1NNTA 4DNCA 2XXQA 3OSRA 3QOPA 1B9MA 3VFZA 2KIUA 3GVAA 1FSHA 1FQAA 1YLFA 3R26A 1K79A 2ESNA 2HZKA 4RK2A 5D5WB 4EQQA 2ETHA 3K9TA 3KP3A 2X4HA 2PEXA 1A7LA 3THIA 1YS6A 2VT2A 3WODF 5ED4A 1TFDA 4FJPA 2HR3A 2HWVA 5AIPA 4MH5A 4PGHA 3UORA 1SI1A 2XAQA 4DQ2A 2O69A 1OKRA 1IUDA 5E1WA 3TCFA 4S04A 1QPMA 3KG2A 3H3UA 2DQRA 5L9SA 4ZYDA 2IRFG 3C36A 4M9SA 5KDTB 5JEIA 4CGZA 5M2VA 4HAMA 2Q9TA 1L3LA 2EFPA 3K69A 4GXOA 3RLFE 4DLDA 2HFHA 5DVJA 4KDPA 2O68A 2QQ9A 3HHGA 3SZPA 1HSLA 1LDKB 2EA4A 1B7ZA 4WXHA 1H9GA 1B32A 4AIKA 4DZ1A 2QWWA 4PE5B 1SI0A 1W7PB 1N0TA 1PB9A 2NS0A 1MY2A 3OXNA 5CI5A 3GF2A 3MP8A 2STWA 1R5HA 3IO4A 1DPEA 1N7XA 3FMRA 5DCMB 3ZMSA 1RZ4A 5HDGA 1B46A 4H1XA 4M6XA 3ZPLA 3RKWA 1ZJLA 3G3FA 4YB6A 3TTLA 4MEXF 4YFXF 5BUUA 1EZPA 3O28A 1MQGA 2A68F 3BP8A 5BMZA 1GGGA 3TTNA 3VVEA 2XXWA 5H8QB 2QBYB 4IO3A 2F5CA 3GWZA 4IPAA 2VGQA 2VN2A 5JK4A 1HSJA 3LC8A 4MTEA 2PT1A 5HLGA 2ISZA 2Z8DA 2RVCA 1Y9UA 1AWCA 4NF5B 4ASNA 3S9EA 5FD5A 4ZS9A 2JT1A 3DF8A 5BQTA 4ELOA 1KQ9A 2PYYA 3JTHA 3U9GA 3G73A 2ZKZA 2KLFA 5E1ZB 4ZEIA 2HZTA 4IRGA 3IHUA 3K1PA 3UK4A 3RYPA 2XIGA 4XLNF 1P92A 3H6TA 3B6TA 1LBCA 3SEXA 1H9TA 2C6YA 1FYKA 1QO0D 1VTNC 4XXUA 5H8HA 4EV0A 2EFWA 4JBZA 4ELPA 2UYEA 3LR1A 5KVRA 2BJJX 1Z91A 1N3XA 3GFMA 3KEIA 3TTMA 3ABUA 1I6AA 1EH8A 4KN7X 2I4CA 5F7VA 4F1VA 2HEUA 1XS5A 3Q28A 4AWXB 1D9VA 3IR1A 2DT5A 3EQLF 1B1XA 4IO6A 5L9OA 1YW9A 3EDPA 2CG4A 3DXJF 1OQHA 2MD5A 4U4XA 1POY1 3IO6A 3LWFA 3I6VA 4XKPA 3C18A 1MPDA 4EGYA 2RC8A 1HW5A 4RAZA 1SW2A 2QQAA 2MA3A 5CVRA 3JYRA 3DPLC 1MY4A 4ENMA 3VLVA 1FX7A 3ECOA 3Q27A 1FCKA 2LF8A 2VBZA 4ESBA 5HBCA 4MGRA 4AVPA 4D0PA 2HCAA 5KK1A 4HTGA 4BNCA 1PUEE 1T38A 4F2QA 2YPNA 1B1BA 2XXTA 3SESA 4H0EA 5D6FA 2I3VA 3H3GA 1IXRC 4HCWA 4KICA 5LEJA 1KQ8A 4Q30B 4O5VA 4KFCA 2Y7IA 3FMQA 4YZZA 5JTYA 4G94A 4HX7A 1WODA 1XGNA 3K6WA 1YTVA 1U2WA 5HLIA 2Z9OA 2EFQA 1T0FA 2FE3A 3WTZA 5D4RA 3H92A 4GVOA 4ZEKA 2W7YA 2FSWA 3F6VA 2BYVE 4CZZA 3G3ZA 4R6YA 4GWOA 3R7XA 1RNLA 1TQMA 2VBWA 3Q5FA 4KR5A 3QP6A 4OU0A 4BDOA 3MPKA 4LJZF 3IWFA 3GEZA 5KCJB 1U3EM 4U7BA 4U22A 4OOIA 4CHUA 3TKDA 1XSVA 5H20A 3B02A 1BC8C 1RUOA 4OERA 3RNNA 4FATA 2O03A 4G8HA 4RPOA 4YMBA 3L9FA 5K1YA 4NF6A 3V8XB 5I59B 3ZMUA 4L9JA 2H99A 3E4RA 3RGYA 4G6QA 2Y75A 3GBAA 1F1ZA 3PUVE 4N9IA 2DWIA 2Z8EA 4YFNF 2P5VA 2M8CA 4P11A 1ATGA 2OQRA 1B3GA 2OJTA 2ONSA 1OYIA 1ZGAA 2YX7A 3MZBA 1A8FA 1XGMA 1D8KA 3M3LA 4Q5SF 2P6TA 2DSFA 4EGZA 1FYLA 5H6RA 2PFBA 3QU6A 3QRFF 5DCFA 1O3QA 2KIFA 5F1QA 5H6QA 3O6HA 3T9VA 2EFNA 3MC2A 1SW1A 2VC1A 5CVVA 3CDHA 1IRFA 4HBLA 2DU9A 5ILUA 3IOTA 5F6FA 1SDXA 5FTHA 3M3FA 4LB6B 4ZZAA 2GWRA 3OO7A 4I8CA 2GFEA 1LAFE 1LFGA 1HKSA 2FBIA 1Z9CA 4QLCU 1K7AA 3J7AO 2NVUB 2FBHA 4LQ2A 1CB6A 4KQPA 2PBIA 2F5XA 2D21A 3U94A 5CLSA 4U0WA 3TO7A 4Q4ZF 5AA3A 3CG1A 4FX0A 4AQ4A 1NKXA 4HLYA 4Z0IA 4M71A 3G3IA 1IN6A 5JTYB 3O3KA 4G77A 4I9DA 3RY3A 2PVUA 3HRMA 4OZ9A 2QM3A 3F23A 3ONMA 1ZU0A 5L3GA 1UTHA 2K27A 5CM6A 5ITPA 3O6GA 3H6VA 3RTRA 3BBRA 5I57B 4R2BA 1FY7A 2IT0A 3FD3A 1R00A 4DCXA 1S3JA 1P1QA 4ND9A 5AE4A 3KFWX 2J5OA 3BJ6A 2ZMEA 1FNNA 2G9WA 3KE2A 4G2ZA 2W84A 1OLCA 2GXGA 4AD9A 3TFLA 1Z1DA 4MBPA 2NYXA 4LD5A 4F39A 2AL5A 1YW8A 3I54A 2Q0OA 1QKBA 3B73A 3HN0A 4O6JA 3ILUB 4IB2A 4JSDA 3KZYA 2QRYA 2UVIA 2KIMA 1Z7ME 1QNTA 2RGVA 2Q2AA 4CDGA 1MJAA 2M5WA 1LCFA 3WAFA 2X0LA 4YU0A 5I58A 2FRHA 4ZH4F 4XSZF 3SEVA 2I49A 1MQJA 1W5TA 4KI0E 4OEVA 3M7GA 3CO6C 2XVCA 1LGBC 3HSFA 3GFIA 1MS7A 4KD5A 1AL3A 5DDGA 2MC3A 2EV0A 1AH5A 4UVCA 4BDLA 3Q29A 1USYE 4CYDA 1Z05A 3PFIA 1G4DA 2CW0F 4OENA 1EH3A 3IJXB 1OIBA 4L17A 3NQOA 2OD5A 3MJNA 2ZYKA 4EM0B 1A54A 1MG1A 1B52A 4MNUA 2ZXTA 3O2PE 1XN7A 1MQDA 1AMFA 3KP5A 3MZ1A 3B6QA 2FMYA 2R71A 3RPQA 1LVAA 2O3FA 1R1NA 1TBXA 4U1OA 5EEHA 5FO5A 3RDIA 3ML6A 2H27A 2YJPA 3CFXA 4C1TA 5I56A 1BC7C 3M3KA 1NH7A 1LB2A 3Q25A 2B65A 4HW8A 3O97A 1D8JA 1SMTA 1OVBA 1AIVA 4BHPA 4K2EA 4OIPF 3FJGA 5DUIA 3GXAA 3MVWA 1D9YA 4N9HA 2YU3A 1B4AA 1SFXA 1URGA 3ISPA 4OIOF 2NNNA 3T1BA 4UNOA 2W25A 3KEOA 4A6EA 4ZEFA 1B5IA 1QUKA 1J0RA 4WK8F 1SD6A 1HXDA 3DP6A 4IRHA 2IPQX 1NL5A 1WKMA 3D4GA 4I0BA 3MZYA 4XBFA 5HVQC 4BHBA 1LSTA 4F3GA 4KA4A 4G8NA 4DCYA 2L54A 3OO9A 1KWHA 4LMYA 4RB1A 4IJAA 2XXIA 3PV0E 4KYEA 3I59B 5DEQA 3OV8A 4LZ5A 1TT1A 5DUKA 4M9XA 2O84X 5D8LB 2O51A 4P55A 3T8RA 3ILTB 2DE3A 5FGMA 3MZHA 4RS8A 4LA9A 5AA2D 2HQRA 1IW7F 2E0SA 5ICTA 1MDP1 3S9LC 2THIA 3V4GA 2UWMA 3TO6A 4G6DA 3T0YA 5D8KB 3GFJA 4HZFA 4YIFA 4NF4A 2DQVA 4DXUA 3BJOA 3GW2A 3TEPA 5LHGA 3IOVA 4IHTA 5E1XA 1FTLA 1WVJA 3KOTA 3CIJA 2NUVA 1KU7A 1R1TA 2UVJA 1GHCA 2CZLA 1OYYA 4O3AA 3F21A 1FW0A 2CWEA 1O57A 3TTRA 1FTJA 4P0GA 3ZKLA 1W7PD 2D1HA 2IA4A 3PGFA 1POTA 4H67A 2QVOA 3TYHA 3WE3A 2V3UA 4U0YA 1MY0A 3IKVA 4Q0CA 4YG2F 4R6KA 1N7WA 1P4AA 3WGHA 4M6YA 2QL3A 4FE8A 3MBPA 1O64A 4ELQA 4WCGA 1B05A 4RGRA 2HQNA 3UP9A 1R6ZA 4QFLA 1OMIA 1S7AA 1V4RA 5CBSA 1MKMA 3HRUA 4RB3C 5ICCA 1XD7A 1WI9A 5H8NA 4R75A 4P9UA 3QK6A 5K5RA 3FXRA 2R6GE 3U1DA 4N0BA 1M5EA 1MXZA 1TQIA 3O29A 1RYOA 3QUJA 5TPAB 4TLMB 3CO7C 1P1WA 2OCUA 4ESFA 5I2NB 2QBYA 3TODA 2GRVA 4G7OF 4M9ZA 4Z2YA 4ZYEA 3PPNA 3K6XA 3SETA 3O2AA 3NEUA 1PB8A 3RN8A 2FF4A 2I58A 4ZYHA 3MPLA 4JK1X 5H8NB 1IXCA 4ESJA 4BDQA 5JFRA 3FXQA 2WV0A 1I27A 4EDPA 2ZMBA 2PMSA 4PETA 3OD7A 3CRBA 1MY3A 1OPCA 3K00A 3FIRA 1BI2A 1TNSA 1F9BA 5HS8A 1RIOH 4FT8A 1MRPA 2OZZA 5D5UB 4G68B 1JHHA 3BWGA 2D5WA 3L6GA 4HF2A 4X48A 4RK9A 3L09A 2DW4A 2TDXA 1LEAA 2V3TA 2ONKE 2Y84A 1ZIUA 1G3TA 3FV2A 1CGPA 3N6TA 3PMWA 1MQIA 3W6JB 3LSFB 3E5QA 1DPUA 4L9VA 3FVKA 5DTBA 2M1BA 4H5GA 5TP9A 2XGXA 5ELVA 4GGGA 3GZGA 3T93B 1IF1A 2RDPA 2ZNUA 3LQQA 1Y3NA 1R23A 2XXXA 3ROUA 1BI3A 2BBYA 3J81Z 1XCVA 3WE2A 4CO8A 1BKAA 3MQ9A 1ULYA 3TGNA 3CFZA 1P1UA 2XXPA 4JSOA 1LAHE 4GCVA 3QPHA 4EJVA 4JDFA 5TRDA 5I57A 4RGSA 3KSXA 3IKTA 2REJA 4LZ8A 2P6SA 2ZBKA 1ZAOA 4IO4A 3E5XA 4E0XA 3EUHA 5E8GA 2F6PA 5DD4A 2F36A 2JPCA 2GAUA 3T8TA 5CYVA 5LLQA 1QUJA 4JBAA 4LLGF 3WGIA 1F4KA 3CFLA 4JWXA 3VXCA 4OETA 3LFKA 1D4NA 1IXIA 5H8FB 2M87A 3COAC 4YIIA 3VVFA 1ODDA 4B09A 2K02A 4QFKA 4JWYA 1Q35A 4MQ9F 5FHMA 3E6MA 1NNKA 2Q8JA 1MDMB 2P1SA 2XKOA 3ZMZA 3FUZA 3KP2A 2DBBA 4OMBA 4ZZEA 3H4ZA 3H3ZA 4I01A 5ICFA 5ITOA 2F7AA 4U4SA 2DFIA 4R9GA 3D5LA 1GV8A 1H45A 3OOAA 3QP5A 4LZ7A 1UHMA 1YCJA 3WTYC 2W85A 4PQJA 1S7YA 4XLPF 5L3DA 5L9MA 2V93A 1Y1MA 2V25A 3TMGA 4G68A 3RPUA 3BFTA 2FXAA 1BIBA 1UTBA 2ZJ2A 1O7TA 4GF8A 3IK6B 4G9YA 1SQYA 5H8QA 2P7VB 1I1GA 3JV9A 4PFYA 3IAZA 2HS5A 4ZEBA 1RUNA 1B40A 2GQQA 3GLXA 2VD2A 1UCRA 3F8NA 1SFEA 3T9UA 1EV7A 3FMSA 5A5XB 3C3WA 1UB9A 3ECHA 4POWA 3G7WA 4KCDA 4YKKA 4EJOA 1SMYF 4F1YA 1MD0A 3KFMA 5CRYA 1J7KA 3KN3A 4M73A 2DQLA 3FJ7A 2FU4A 4XSXF 1UTBB 5DV5A 1IN4A 4B8XA 3TCGA 2DOJA 1G3YA 4GO1A 4ZE8A 5CVUA 3MFKA 2V9VA 2I48A 2QJEA 5J8CA 3ZS6A 1P4XA 1CF7B 4U7DA 2A61A 2A07F 4KYDA 4KMFA 3H7MA 1O3RA 3RKYA 4I62A 2YLNA 4HA8A 4RJZA 2E7WA 5JI6A 1S9TA 4OFOA 2EA2A 1E2XA 2QS4A 1XB4A 3WGGA 5EYFA 3MQ0A 1FTOA 1W7PA 2F2EA 3RPWA 5CMMA 1KU3A 4H0WA 4RA1A 1MDQA 4YKIA 1Y0UA 4ISUA 3FM3A 3U2RA 1T39A 4OXVA 3IWZA 2R7DA 3LBSA 3W6KB 2Z23A 5K2XA 1B0HA 4IHSA 3OO8A 2F5EA 1SFUA 3LQRA 4GXAA 4NF6B 4Q8RA 2IA2A 1OVTA 2EWNA 4O3BA 2XX7A 4MFIA 1PC3A 4BDNA 3EN3A 3ZQ7A 1SAXA 4IXAA 1DDNA 4ENKA 2RINA 3R60A 3V7RA 2QLZA 2PQ8A 3C32A 1TW3A 4MEYF 3OEKA 3KEQA 2P0SA 3FXUA 3WU0A 3SHFA 1JEUA 2ZYOA 2HQ0A 2UXAA 1QULA 3BFUA 2W57A 5LOMA 2X26A 5CBRA 4QFPA 2E1NA 5TPAA 3BKIB 3KN7A 5K2YA 4U21A 3KJ7A 5E17F 1AOVA 5CC2A 1Q1HA 4OMYA 2XXRA 3E5UA 2NWJA 3S2WA 3HOTA 3UGWA 2AXLA 3VB2A 1E17A 5H8FA 2Q8KA 2FNAA 3TPAA 2GZWA 3F72A 4MLVA 3HHHA 2P4WA 4ESWA 2OWTA 5FTIA 1EH7A 1MPBA 4HYEA 3B7DA 1K78A 4RB0A 4K3FA 1LJ9A 1IRGA 2WTEA 1GXPA 4JXIA 2IJLA 3GFLA 3HPIA 4HW0A 2QS1A 1P99A 1U6GA 1TW2A 4YMAA 3R0AA 5BPIA 4PDKA 3GBBA 1ZLKA 1UIUA 2VONA 3REOA 3IORA 1B1HA 3RI4A 3JAMK 3PUZE 5DEXA 2GA2A 1LLSA 4KNYA 1R5GA 3RTWB 3M1EA 1QZYA 4LB5A 1R22A 2O7IA 4O3MA 5I2NA 5ILVA 2UXNA 1N84A 4GQOA 1MPCA 3CUOA 1BN5A 2JZYA 3KP4A 2A6HF 1IN7A 4E70A 2VE8A 3DEUA 4CXFA 3KCCA 3HOSA 1LB9A 4XRFA 1URDA 4NF4B 2GHBA 2XAGA 1SYHA 3D4CA 1UIVA 2I6EA 4RNSA 2PJPA 2LNBA 2DXYA 2RKMA 1U5TC 1Z6TA 1HBXG 2IP2A 4IF4A 2LF7A 2XAJA 4PZJA 1M5CA 2X7PA 3S9MC 2OZ6A 2FMLA 2BE5F 5FHNA 4WX9A 2H9BA 4WEPA 4ETSA 1P2FA 3K2ZA 3VV5A 3QAHA 1DUXC 1B59A 1LEBA 1MZBA 3PMVA 2ZCWA 1WWXA 2KRFA 1IN8A 2V1XA 4C1UA 2BEOA 2E1CA 1GVJA 4OESA 2ALUA 2P5KA 3M8FA 3JTGA 4RY1A 5LRSA 3WG9A 5ICEA 2AYSA 3CUQA 4X9TA 4NF5A 4O3CA 1DTZA 2ZXJA 3T9HB 2OBPA 1SW4A 3AAFA 4X1DA 2ADUA 1PP8F 4NF8B 3RUMA 1ZRFA 4EJWA 1H43A 2RCBA 4N13A 4H6DA 1DTGA 3SXYA 3TQNA 1N3WA 2XX9A 4M1VA 2DPDA 4Q48A 3N6UA 4WEDA 5J8FA 2M30A 1JXSA 4NEDA 4QSDA 4KIFA 3HSTA 3OEMA 3TUSA 1GVCA 1OMPA 4PFUA 2IA0A 2NRAC 3N94A 5H8HB 1PDNC 2V1DA 4POXA 3FASA 4WXJA 2R9JA 1B3FA 1R7JA 3BPXA 4HLXA 2A5TA 3HTSB 1LFIA 2QUFA 1UFMA 1PP7U 3C35A 2A5SA 3KBRA 2OWSA 5CJ9A 3DPTA 4PFTA 5ICQA 3KLOA 4N6PA 2FNCA 1YAEA 1LAXA 2ZYNA 3QIMA 1M5BA 1O3SA 5DVIA 3ZP5A 4LONB 2QPQA 2VHAA 1XCBA 3J80Z 1S8NA 2Z5UA 3QUFA 3P9CA 1TTYA 3RJPA 1ZRCA 4U0VA 3EHSA 4Y13A 2QS2A 2OU2A 3FM5A 5KZTA 4UV9A 3DELB 4THIA 1IZ1A 1R1UA 3JSPA 3SEUA 3MVYA 2DI3A 4F1UA 3WTWC 1GXQA 4F29A 2F97A 3UA8A 2HZLA 4MF3A 3LUYA 5I2KB 3U8QA 5HM4B 4GYGA 5KDTA 2ZMEB 3A3CA 3A09A 3MAMA 2MH2A 3LSLA 2PT2A 4PCQA 5L3CA 2P5LC 4U88A 1YIOA 4BHCA 4L0YB 1USYH 1Q1KA 4A0YA 5HDKA 2Y7PA 1IXHA 1D3KA 1OR7A 3BOQA 4MLQA 4H65A 1JNFA 5AONA 3P9IA 1TXFA 1JVXA 3VFJA 2H94A 4AB6A 4HX8A 4Y15A 2RF1A 6PAXA 4A5NA 2RC9A 1GR2A 2PMUA 3I0TA 3FJMA 4DDDA 2AS5F 3TDJA 1XC1A 3CR9A 1T6SA 2FNPA 2YPRA 3K6UA 3T96B 4FX4A 3QPTA 1YO5C 4F3SA 2UYFA 2ABHA 2DPUA 3HYIA 2VOOA 3HTUA 3DQVC 3C4MA 1R9QA 2XV4S 1MJ9A 2KKOA 3KP7A 3UIFA 1QKAA 1B3LA 2H25A 3EHTA 2NOOA 5TP9B 1ZKBA 3IX1A 5H8SA 1MDMA 5CMCA 2R3SA 1FZPB 1PDAA 5LGTA 2O1MA 3PUYE 4WKMA 4HCYA 4G7HF 4F7ZA 3IB2A 3P9KA 1OQGA 3W9WA 3MZ9A 4LATA 1USSA 4AIHA 4HQEA 2RQPA 1H76A 3K4UA 4H8IA 1MXVA 3V8JA 5BS6A 1SD5A 2VXZA 3VODA 3TDUC 1BM9A 3RT8A 3S2VA 4Y17A 3R61A 1IXGA 3ULQB 4LGWA 1I69A 3ZSFA 3J80K 3FATA 4LG0B 4XKRA 4BYYA 5DVFA 1PEBA 3R0JA 5D4SA 1PBPA 1ELJA 3IC7A 1J9IA 2UVGA 1IUYA 2RN7A 4L9TA 1G6NA 2HYGD 3BROA 3CUQC 4QHQA 3RIRA 4GRKA 1UQWA 3HRSA 5KCJA 4EXLA 5AA4A 4R73A 3F8CA 2OK2A 2Y0MA 3DKWA 5FD6A 4R9FA 2O7UA 4IO2A 2O1LA 1XGOA 4GL0A 3S4UA 1B5JA 1MH3A 3PPRA 3N5LA 4GLIA 2Q2CA 4OINF 1D3YA 1RI7A 1MY1A 4IGTA 4KYWA 4ELRA 3OMBA 2M8EA 4RB2C 1R58A 3IL2A 4R6HA 4EQ9A 2QMWA 5BWJA 1BP5A 3CG3A 1DP7P 1D5VA 5CMBA 5FB2A 3SDFA 3O6BB 2FA5A 4R74A 4R1HA 4FECA 3VVDA 5AA2A 2D1VA 1I5ZA 3MAJA 3WTXC 2G7HA 2O61A 3OOPA 5ICGA 2NXOA 1BJAA 1PB7A 4KT5C 1U78A 4IRIA 2ONRA 1BIAA 1RKMA 3N26A 3H6UA 3N4MA 4KYSA 1I6BA 4IY5A 3EYYA 1K6OA 4YB5A 2K4BA 5LEKA 1VFDA 3K01A 3IOUA 1JW5A 4XKQA 1G3WA 3F6OA 3QSLA 4OMZA 2EV5A 1VE4A 3QXMA 5DD8A 3KGCA 4IO5A 4HV5A 3BDDA 5FLXK 3IOWA 1B51A 2LKPA 3ZMVA 3IRQA 3TCHA 1KA8A 1MXYA 3P7IA 1SD7A 4KIBA 1LFHA 4EM1A 2KJBA 2F7BA 1FP2A 2FEZA 2F35A 3CUQB 1VFEA 4ON0A 4QWQA 4ZDMA 2HAUA 2CFXA 4WXCA 1LAGE 2DVZA 2G29A 3PU5A 2GIVA 1ZG1A 2I0CA 2RKHA 4FORA 3IB0A 3QYTA 2DK8A 4L5JA 2G7UA 3EYIA 2B3BA 5DYMA 2VOPA 5L3BA 3L2CA 2HTJA 3OENA 3B6WA 3CI8A 4BH9A 4IO7A 1CF7A 1VSOA 4IGRA 1Y3QA 3BY6A 1HQCA 2V6CA 3C34A 2MBFA 3G3GA 1REPC 3TTKA 1HSEA 4EJTA 2H6CA 1BLFA 1R36A 4I2OA 4OIQF 1XSDA 4I98B 4R8HA 1SD3A 3F22A 1Y1ZA 1XDSA 3O66A 3QAXA 2RV8A 1S6LA 2A5TB 5F64A 4BDRA 2XUBA 4BAYA 3CSGA 2BV6A 1B7HA 1EZ9A 4BQAA 1HW2A 2DYXA 2P7CB 2FOKA 1TQPA 1J75A 1JETA 4GXSB 3E97A 3SEWA 4ZZLA 1ZYRF 1EU8A 4JWOA 4OHNA 2VP1A 4M72A 1G3SA 3VEPA 2H5YA 1S29A 1XMAA 2HAVA 2J5PA 4I09A 3G3JA 2DLLA 2AL4A 3G3KA 1ZGJA 1P6RA 2JTVA 1QW0A 3R4KA 1WRJA 2DXRA 2H98A 1IITA 4LLNA 3S9NC 2K7LA 3O6IA 4U2RA 1Y4TA 5A2QZ 1V3FA 2ANJA 1JW4A 5A5XA 4NE4A 5HS9A 4RGXA 5DEXB 3SEYA 1TWYA 1ZG3A 4L0ZB 2ZNTA 4F2OA 3VLWA 1DOTA 3OO6A 2KJCA 1ONVA 5TJJA 3EETA 4DE8A 4NHJA 2DWJA 2D2WA 1O3TA 1ZHFA 2F8DA 3HSEA 3HUGA 5LBQA 4ECFA 5HLHA 1JE8A 5JR3A 5CMKA 1NH8A 4UV8A 1ZARA 2QENA 1RYXA 2IEEA 2DAOA 1XMKA 4U23A 2O0YA 2ZYMA 3PPOA 2DO7A 1ZN2A 2CGPA 4G68C 2I0BA 3ZN1A 1DPRA 1IIWA 5EHMA 1DSNA 1N04A 2QQBA 2UXXA 3F8FA 1B9JA 3DM0A 1M5DA 1MH4A 4YICA 4ZEDA 1FQDA 2FYIA 1KYZA 3M9AA 2Y7KA 3RTFB 2Y48A 2ZNZA 4R2FA 5IT3A 3V7SA 2EJRA 1YTYA 1QGPA 4KFQA 4E0WA 4TV7A 4UVBA 4M74A 3I53A 5K5QA 2NNYA 4OFLA 3T5XA 3MWBA 1LQ1A 1C0WA 4GIZA 2JSCA 4M4GA 4OWDA 3OSQA 3E3KA 4EJUA 1Z7UA 4ENNA 3HV1A 3I5OA 3SQNA 4G7ZF 3GZ6A 1UHWA 2OZUA 3K6VA 4LK1F 5F1RA 5AIQA 1GTKA 1P4WA 4P9FA 3USDA 3ODBA 2LAOA 4LLLA 3WU1B 2Z3YA 3RKXA 3CJNA 3TQLA 1MQHA 4F19A 1FBQA 1LCTA 5L3FA 1FTKA 1NNPA 3MCZA 1XSXA 3I59A 2CQKA 3DV8A 1FWZA 2HTSA 3TOBA 3U93A 3EPEA 2VT3A 4XKNA 3VOEA 4HF1A 3LSWA 2R7FA 4HDUA 3EF7A 4A6DA 1S7OA 3V7CA 1KGSA 2YX4A 4OEUA 2WKYA 2OAZA 2QS3A 1Z6RA 4HV6A 3WTUC 1YS7A 4YAHX 3JAMZ 4F3PA 2VC0A 4L18B 1QJMA 4P96A 5LGUA 3KJTA 4YB7A 5I56B 5FLXZ 1HKTA 3ERED 1H44A 3JW4A 4QFNA 3L00A 3GZ5A 5FFZA 3ZMTA 2Y7RA 1PBQA 1W5SA 4HX4A 3LA7A 2DWHA 3L6HA 1B3HA 2DTRA 4I0AA 1A40A 4EUOA 1QQIA 1I6QA 2M45A 4ZE9A 2E7XA 2ELHA 1U5TB 1LDDA 1A04A 1BTJA 3T22A 1B58A 3T9XB 3KSJA 5D6EA 3DP8A 4WF2A 5D5XB 3FF5A 2V3QA 1FBSA 1STZA 5DYHA 2MLKA 5E8IA 3TQWA 1OLAA 5BPDA 1MXWA 1JEVA 2YSRA 3K02A 3LAJA 1QBJA 4NWDA 1YG2A 1FSEA 5LGNA 4EVIA 5EEGA 2I4BA 3WAEA 4KPTA 1U5TA 1CE2A 2CMOA 3DFGA 2V84A 1QUIA 1US5A 3I4PA 2QSXA 1O7LA 3HO7A 2MLGA 1K78B 4IY6A 1FLIA 1X3UA 4GL8A 2P8TA 4A5MA 2HEOA 1NHAA 4I02A 4H5FA 1IQ7A 3RT6B 1A99A 5BOXA 3W9VA 5LRRA 3TELA 1KU9A 2XASA 4PP0A 2DK5A 2ZNYA 2XXYA 4QSCA 4OTEA 2XXHA 2L4AA 4KN4X 3HIFA 2H6BA 2DWAA 4LVQA 3KOSA 3A3UA 5A2QK 1MXXA 3D0SA 1B4HA 5I58B 4OFJA 3U92A 2Y7WA 1HW1A 3FX3A 1I6XA 5HDNA 3V83A 1KYWA 3U1OA 4Z7EA 4MHGA 3WTTC 1JVYA 3FGSA 3F3XA 4LFUA 5IT9K 2OBGA 3DP7A 4EF2A 3MP6A 5IAIA 4NF8A 5I2KA 4GYIA 2F7CA 3U72A 5FHOA 5DCMA 3K1NA 3E3VA 4HOBA 2STTA 3KZZA 2L02A 2CYYA 4HS7A 1ON1A 3MEXA 2LDUA 2XROA 1URSA 1J5YA 1B7UA 1LNWA 1ZLQA 4ENJA 5IT9Z 3BJAA 2Q2EA 3GO5A 2O6GE 1DMBA 1II5A 2OA4A 4RAYA 5HS7A 1IXSB 1MJBA 1IEJA 1YPNA 2L01A 3TAJA 2REGA 3V5AA 2EB7A 1IN5A 1BIYA 2Z22A 4HF0A 4RPNA 3IRRA 2Z8FA 3JSOA 1A8EA 1EZOA 4L9NA 1Y3PA 1H0MA 3ELKA 3I71A 4MTDA 4EQBA 2H09A 4RXLA 1JHFA 4AIJA 4ESXA 2XRNA 5CVIA 4OIRF 1MM7A 2HXWA 3K0LA 1FYMA 1N76A 1F9NA 4ZYGA 2XAHA 1NFTA 1BI1A 2GA1A 3FWEA 2HGCA 2VODA 4S05A 3HRTA 5AA2B 3P7NA 4ONYA 2PG4A 3K2DA 5LHIA 4GD5A 1ZRDA 3F8MA 2LSOA 1FTMA 4DXBA 1HKQA 1USTA 2HOEA 3PQKA 2JRTA 1US4A 2XX8A 4I1DA 3GX4X 1YFHA 1NNFA 3PQJA 5HPQA 3IL1B 3LAPA 4AB5A 1QZZA 3K1MA 4I7HA 4IVNA 3MP1A 4MQVA 3FVGA 3M8UA 3BZ6A 3J81K 4UUVA 1S50A 1B9NA 1UTHB 2QMXA 3SZTA 1TNTA 2Z33A 2QZ8A 4QRZA 4WXDA 3O9PA 2HDCA 3E6BA 3AXFA 3BPVA 1AOYA 1B5HA 5L8DA 2OLBA 2B0LA 1B6AA 4F3BA 4UXNA 3K0VA 4PGGA 2RCAA 2ISYA 2IW5A 3KETA 3SFZA 3IJOB 3G3HA 1B2HA 5DT6A 1ZG5A 1SW5A 3E6CC 4TOZA 3C7JA 3T66A 3HCQA 2GHAA 1FT9A 5I84A 3M8EA 3VE1B 5JHUA 2PX1A 3NRVA 1HSTA 4QSEA 2GH9A 1MXUA 4R79A 3VLUA 1XHYA 4NMYA 4H8JA 1ZMGA 3W15C 4G8XA 4A0XA 2UZKA 2NAZA 3E6DA 1FQFA 3FHZA 2H4IA 4RYAA 3H03A 2ZNSA 2XD3A 3PMXA 2HKXA 3MVXA 3ZKKA 4EQ7A 5ERIA 1FP1D 4ZZDA 3CSBA 1SVXB 3E13X 4BLAA 1SBPA 4KMUX 2CO5A 1ANFA 4LG0A 2PMHA 3MUQA 4U1ZA 2V1UA 4EXKA 4DIGA 1FPQA 1R1VA 3I58A 3JZJA 5I59A 2HKOA 2Z99A 5TU0A 1YW7A 1M5FA 2OQGA 2I3WA 1XT8A 2XHKA 4BDMA 1I1SA 3MVZA 3CTAA 4P0IA 4F31B 5B70A 3PUWE 1VR5A 3C9HA 4HDVA 2K86A 1JGSA 2B3FA 4Q5TA 3Q26A 1DPPA 2VBXA 1W4MA 4FIMA 4KIGA 1XGSA 3CVGA 3SKPA 1KQ0A 1NMUA 2O8XA 5E18F 3TDZC 2EK5A 3UN6A 2RC4A 2FA7A 2WC2A 2F78A 1Y4CA 5CVJA 4LQ5A 3I64A 5D5VB 3DP4A 4QFOA 3ABTA 2DP8A 3TKYA 1T0KA 2E1SA 4RGUA 4F18A 1FQCA 2HYFA 2UVHA 2YR2A 3EQ1A 2A6EF 1J1NA 1L5TA 1EH6A 2A69F 4A0ZA 1XVXA 5AA1A 2XD2A 2HFBA 2F5FA 2VE9A 3TOAA 4FHTA 4ZECA 4C0RA 1KU2A 2XXVA 1FQBA 1ZTYA 2P2AA 5IKBA 1R9LA 4BXUA 3VXBA 3GXOA 1FOKA 1F5TA 5JVTA 2G93A 3WTSC 2BGCA 2RNJA 2JPBA 1XVYA 1P1OA 3H06B 1A55A 3H6WA 1B6HA 4WWCA 1BBYA 1JW1A 4UACA 3V8LA 2IVMA 1ZREA 1BI0A 1WSUA 4P5OA 2VBYA 4KUMA 2A5YB 3PD8A 4UHTA 2WWYA 1FQEA 3LA3A 4JB7A 3WTVC 4XTCQ 3RQTA 5HOOA 5J6XA 1LDJA 1MM6A 3SERA 4FAJA 3LSTA 4N07A 1L0OC 2XKPA 2D3IA 3C33A 1Y20A 5ISUA 3Q9SA 2VOZA 1B3EA 2ZO4A 4TLLB 4F22A 1WDNA 2FQ3A 2F5DA 4LK0F 3PD9A 4TQUQ 2CSOA 2W24A 3F11A 4LUBA 1T2KA 5LHHA 2PN6A 2D45A 3N97A 1B0LA 2Q89A 1OYWA 3R6UA 3I5UA 4NWCA 4JQFA 1ZLJA 2QYOA 3LSXA 4A12A 4R72A 4X1BA 5EHSA 1SD4A 3F8BA 1FC3A 3OELA 3EHUA 2EFOA 1LB8A 4YKPA 1LBBA 3E9XA 1XDUA 3V89B 1O63A 4LP2B 3KN8A 3MWMA 4OVJA 3QU3A 2MH9A 1J59A 1ZBMA 3HHFA 3ZMDA 2O6AA 3GLBA 4XIGQ 3DLNA 4EMSA 2K4JA 2XHDA 3IB1A 4OQOA 2F6GA 4YKJA 4FEBA 1FBUA 2F34A 2XXUA 3KLNA 3FV1A 1ON2A 3FZVA 1T98A 2COMA 1B4ZA 2AIXA 1H3DA 2Q88A 3RYRA 1JQFA 2FBKA 2DS9A 1O7FA 3FVNA 4G4PA 4HQMA 3C1DA 1Z7NE 2RC7A 2X7QA 3FVOA 2ESHA 2IA1A 4G8MA 2L3DA 3GYHX 1YYVA 1P1NA 5FFXA 2GXBA 1BOAA 2EV6A 4YFKF 5B7DA 3ZN0A 3I3VA 4CICA 4DXCA 4EM2A 1YQAA 5L3EA 1WQ2A 4KHZE
chains in the Genus database with same CATH superfamily
3MW0A 4Y7NJ 4NB5A 2M0MA 1MIJA 2MD0A 2ACJA 3GUDA 2CZKA 4X8RA 3LA2A 5IGAA 1X19A 3VDFA 2PI0A 2F48A 3ECRA 1OCZH 1TT5B 5E20A 1K9YA 2VLAA 1PUFA 2R7TA 3PUXE 3L7WA 1VQPI 2DE2A 1MMDA 2DVCA 2DE4A 1IAWA 2DJNA 3BR1A 2KMUA 1LEVA 1R4NB 5ILSA 1J2XA 1U8RA 2PLYA 3TZAA 4Q47A 1OFCX 1N25A 3PPQA 3ZQFA 4EF1A 2KRHA 3TO9A 4NTLA 5K5OA 4PFWA 1F43A 3PPPA 1SVLA 3KIOA 3I3LA 4FEDA 1TLHB 3R6SA 3W2AA 1TFAA 4OYVA 2PBWA 3KZGA 4KCCA 2KRCA 2ZFWA 3HSRA 4NQWA 3CLOA 5J1DA 3Q9VA 2A3SA 4A2UA 4GOTA 4GFRA 3C31A 4PAFA 2L4MA 3OYIA 1MGTA 2VD3A 2V4JC 4BEHA 2EZIA 3V8KA 3BG3A 4FE7A 3KP6A 4L5IA 4PFOA 3HFUA 1SYIA 4XLFA 2GBYA 2V79A 1ZH5A 4QF9A 4UVAA 2XAFA 1XOCA 4UA8A 1QVSA 5AA4B 5DTDA 4PJMA 1NNTA 4DNCA 2XXQA 4PJLA 3OSRA 3KBZA 1ETQA 4JVCA 3OYNA 3QOPA 2ZZVA 1B9MA 1ORKA 3VFZA 2KIUA 3GVAA 2DA7A 1JI8A 2LY1A 1FSHA 1FQAA 2E60A 1D1BA 3H5AA 3KYCB 1YLFA 1GUUA 3R26A 1K79A 2ESNA 4DYQA 2VI6A 2HZKA 5D5WB 4RK2A 1AWBA 4EQQA 2ETHA 3K9TA 2OV7A 3KP3A 3RZDJ 2LVSA 3H0DA 2X4HA 2PEXA 1A7LA 3THIA 1YS6A 1V5GA 2E36A 2VT2A 4X1EA 3WODF 5ED4A 1TFDA 4FJPA 2HR3A 2HWVA 2P81A 5AIPA 4MH5A 5KAFC 1QZEA 4DXBA 4PGHA 3UORA 1SI1A 2XAQA 4F91B 4DQ2A 2O69A 1OKRA 2KQRA 1IUDA 3WHBA 2DMNA 5E1WA 3TCFA 2KR0A 1YE9A 4XKBA 1QPMA 4S04A 1D1AA 3CD6I 2LKXA 3KG2A 1RR7A 3H3UA 2DQRA 5L9SA 4ZYDA 5F0HA 5C44J 2IRFG 3C36A 4A3LJ 4M9SA 1UG2A 5KDTB 5M3MJ 5JEIA 4CGZA 5M2VA 4HAMA 4GWYA 4J01A 2Q9TA 4I3EA 3Q0WA 1L3LA 1P7IA 2EFPA 3K69A 4GXOA 5EYGA 3RLFE 2HFHA 4A3KJ 4OVPA 1G59A 5DVJA 4DLDA 4KDPA 2O68A 4FCYA 1NV0A 2QQ9A 3HHGA 3CCEI 1QGXA 2NXNB 3IH2A 3SZPA 2CEXA 1OJLA 1MMNA 1HSLA 1LDKB 4MCOA 1FIAA 1TZLA 2EA4A 1B7ZA 1MSFC 2O5RA 3DKYA 4WXHA 4C3JJ 1H9GA 1RDYA 2JVHA 3CF5F 3OIOA 1B32A 3C2HA 4AIKA 4DZ1A 2QWWA 4PE5B 2EZHA 1W7PB 1O4XA 1SI0A 1N0TA 1PB9A 2NS0A 1MY2A 3OXNA 5CI5A 3GF2A 3MP8A 2STWA 1R5HA 2JMWA 3IO4A 1DPEA 1N7XA 3FMRA 5DCMB 1SVMA 3ZMSA 1RZ4A 1JKOC 5HDGA 1B46A 4O8MA 3BCBA 4M6XA 4H1XA 3ZPLA 3RKWA 1ZJLA 2LP0A 3G3FA 4YB6A 3TTLA 4MEXF 1R5ID 4YFXF 5GAEJ 1EYJA 5BUUA 1EZPA 3H3VK 1VQNI 3O28A 1FSAA 1MQGA 2A68F 2DMQA 3BP8A 5BMZA 1GGGA 2ECCA 3TTNA 3VVEA 1VQ8I 1T56A 2XXWA 4JVIA 5H8QB 2QBYB 4IO3A 3DBRB 4XKCA 2F5CA 3GWZA 4IPAA 3EUAA 3L2UA 2VN2A 4AM3A 1HSJA 2VGQA 9ANTA 2XWOA 3LC8A 4MTEA 5JK4A 2PT1A 5HLGA 2JRMA 2ISZA 2Z8DA 3OS1A 2RVCA 4BXFA 1AWCA 1Y9UA 4NF5B 4ASNA 3S9EA 3CCQI 1FBHA 5F0FA 1G0HA 2O7OA 5FD5A 2AO9A 2JT1A 4ZS9A 3IUOA 3DF8A 2V4CA 1HDDC 5BQTA 3A29A 2CW7A 1KQ9A 3L2QA 2L7KA 3EKIA 4ELOA 2PYYA 1IJWC 3JTHA 3U9GA 1GLNA 2ZKZA 3G73A 2LH9A 2KLFA 2BW3B 5E1ZB 3RCOA 2HZTA 4ZEIA 1R49A 4IRGA 3NWSA 3IHUA 3K1PA 3UK4A 3RYPA 1X3ZB 2VKEA 2XIGA 1WJDA 4UB6C 4XLNF 1P92A 1VQ7I 3H6TA 3DWLE 3B6TA 3CLQA 3HOVJ 1LBCA 3SEXA 5KNLA 1H9TA 2C6YA 1FYKA 2UVHA 1VF9A 1QO0D 3OYMA 1VTNC 3HM5A 2FBPA 4XXUA 1RC9A 5H8HA 3BG9A 4EV0A 2EFWA 4JBZA 4ELPA 2UYEA 3LR1A 2MABA 4PDHA 5KVRA 2BJJX 2IBDA 1Z91A 4E7HA 1W0UA 1N3XA 3GFMA 2KQZA 3GBGA 3ABUA 3KEIA 3TTMA 1I6AA 1EH8A 5FKOA 4KN7X 2I4CA 5F7VA 1A6QA 4F1VA 2HEUA 1XS5A 2OF7A 3QQAA 2CMPA 4AWXB 1D9VA 3Q28A 3IR1A 2DT5A 3EQLF 1B1XA 1BL0A 1ETVA 4ZDOA 2V6EA 2MG4A 4IO6A 2F3DA 5L9OA 1YW9A 3EDPA 4P3LA 2CUZA 2R4GA 2CG4A 3DXJF 1OQHA 2MD5A 4U4XA 4A3BJ 4PK4A 1POY1 3IO6A 3LWFA 3I6VA 4XKPA 3OYGA 1YJWI 3C18A 2PX9A 4FQGA 2XPUA 1WPKA 4EGYA 1HW5A 1MPDA 2RC8A 4RAZA 1YJ9I 1SW2A 1ERDA 2QQAA 2VASA 2CFOA 4XRSG 2MA3A 5CVRA 3JYRA 1S9HA 3FXJA 3DPLC 4N8YA 1I50J 1MY4A 4ENMA 3VLVA 3ECOA 1FX7A 3Q27A 1FCKA 2LF8A 2VBZA 4ESBA 5EQ9A 1PVEA 4FETA 1X1BA 2KFDA 3HL2A 1GV5A 4AYBA 5HBCA 4MGRA 4AVPA 1V5FA 4D0PA 2HCAA 1NV7A 5KK1A 1D0ZA 4BNCA 1PUEE 4HTGA 1T38A 4F2QA 2YPNA 3OL4A 1B1BA 2XXTA 3SESA 4H0EA 5D6FA 2I3VA 3H3GA 1IXRC 4HCWA 4KICA 5LEJA 1KQ8A 4Q30B 4O5VA 4KFCA 1NG6A 2ME0A 2Y7IA 3FMQA 4NGUA 4YZZA 5JTYA 1AA7A 3HGYA 4G94A 4HX7A 1NV4A 1WODA 1XGNA 3K6WA 1YTVA 2KT0A 5FJ8J 1U2WA 4XLCA 5HLIA 4AYBN 2Z9OA 2WADA 4I1DA 5E3NA 2EFQA 2OWZA 4OVTA 4PFIA 4GWZA 1T0FA 2FE3A 3WTZA 5D4RA 3FKJA 3H92A 2L7MP 3ZQIA 4GVOA 4ZEKA 2W7YA 2FSWA 2WY7Q 3F6VA 2BYVE 4CZZA 4BBRJ 4NAPA 3G3ZA 4R6YA 4GWOA 3R7XA 2Y69H 1RNLA 1TQMA 2VBWA 3Q5FA 4KR5A 3QP6A 2HZDA 4OU0A 3IFCA 1N75A 4BDOA 3MPKA 4LJZF 3IWFA 4GX6A 3GEZA 5KCJB 1U3EM 5E3OA 4U7BA 5GTHC 3BZKA 4OOIA 4U22A 5EYRA 3L2WA 4CHUA 3TKDA 1XSVA 4NC6A 2EIJH 1OCPA 5H20A 3B02A 1BC8C 1RUOA 4QPQA 4OERA 3RNNA 4FATA 1X1DA 2O03A 1KZ8A 4G8HA 4RPOA 4YMBA 3L9FA 3NAUA 5K1YA 2CUFA 4NF6A 3V8XB 2FOWA 5TISC 3PO3J 5I59B 3ZMUA 2QEXI 3BZCA 4L9JA 2H99A 3CC2I 3E4RA 1X58A 3RGYA 2M9HA 4G6QA 2Y75A 3GBAA 1F1ZA 1VI0A 4H46A 3PUVE 4DJAA 1Z67A 4N9IA 2DWIA 4A3GJ 5E3MA 2Z8EA 4YFNF 2P5VA 2M8CA 4P11A 1ATGA 2OQRA 1B3GA 2OJTA 2ONSA 1OYIA 1ZGAA 2YX7A 3MZBA 3HEFA 1JGGA 1A8FA 1XGMA 3JR9A 1D8KA 2DA1A 3GZNB 5IY5H 3HXLA 4Q5SF 2P6TA 2DSFA 4JX5A 4EGZA 3M3LA 5F27A 1H89C 1FYLA 5H6RA 3MYUA 2PFBA 3QU6A 4IX7A 3LUZA 1BJZA 5DCFA 3QRFF 1FPEA 1O3QA 2XX8A 2X1DA 1MBJA 2KIFA 3PNTA 2L9RA 1NUWA 5H6QA 4IQ4A 5F1QA 3DLLF 1JUPA 3TL4X 5I5PA 3O6HA 4D9JA 3TEDA 1ZGWA 3T9VA 2EFNA 2FIEA 3MC2A 4XEQA 1SW1A 2VC1A 5CVVA 3H9QA 2Y0SA 3CDHA 1JKRC 1IRFA 2K9MA 4HBLA 2DU9A 5ILUA 3IOTA 5F6FA 1SDXA 5FTHA 2LR8A 4BE2A 1M1EB 3M3FA 4LB6B 3D5SC 1JKQC 4ZZAA 4O7IA 5E3LA 2GWRA 3OO7A 4I8CA 1FBEA 2GFEA 1LAFE 1LFGA 4DGWB 1FPGA 1HKSA 2FBIA 3IAS2 3FBIB 4DI4B 1Z9CA 1K4SA 4QLCU 1P9QC 1K7AA 3J7AO 4C2TA 1LBWA 2ZB9A 4OVQA 2NVUB 1F36A 2FBHA 2QCOA 1JT6A 2VKVA 4LQ2A 2IEKA 1CB6A 1A5JA 4KQPA 2PBIA 2X6OA 1VQ9I 2D21A 2F5XA 3U94A 2XDVA 3K4LA 3FK7A 4LG3A 5CLSA 4U0WA 3TO7A 4Q4ZF 5AA3A 3CG1A 4FX0A 4AQ4A 2X1CA 3K4JA 1NG7A 4AVZA 1NKXA 4HLYA 4Z0IA 1IO2A 2K85A 4XOPA 3FXMA 4M71A 2NVTJ 1IN6A 3LSHA 4A93J 3G3IA 5JTYB 5JHFA 3O3KA 4G77A 3IH3A 3IP4B 4I9DA 4L5EA 3RY3A 2PVUA 4GWSA 1FIPA 3HRMA 4OZ9A 2QM3A 3F23A 3ONMA 1ZU0A 5L3GA 3L2RA 1K83J 2K27A 1UTHA 1WH7A 3O6GA 5CM6A 2XF7A 3H6VA 5ITPA 2BY0A 3B6AA 3RTRA 4D7MA 3BBRA 5I57B 1LE8B 4E7IA 4HE0A 1FY7A 3SDGA 2IT0A 5FRNA 2LYCA 3FD3A 4PAKA 4R2BA 3CP2A 4B43A 1R00A 4DCXA 1S3JA 1P1QA 4ND9A 5AE4A 3KFWX 2MKZA 4IHVA 3ZR8X 4NG7A 2J5OA 3OSFA 3BJ6A 2ME6A 1LVKA 2ZMEA 1FNNA 3GTLJ 2G9WA 3KE2A 4G2ZA 3ESWB 5IP7J 2W84A 1OLCA 2GXGA 4AD9A 3TFLA 1Z1DA 3SDBA 5LTCA 4MBPA 2NYXA 4LD5A 1CNQA 4F39A 2AL5A 1YW8A 2UUZA 4W97A 3I54A 5B1AH 2Q0OA 1QKBA 3B73A 3OIPA 4JOMA 3HN0A 4O6JA 3ILUB 4IB2A 4JSDA 3KZYA 2QRYA 2UVIA 2KIMA 1Z7ME 3CMAI 1QNTA 2RGVA 2Q2AA 3UNGC 4CDGA 3HC7A 4IL6C 3K4MA 2DOFA 1MJAA 2M5WA 1YRNA 1LCFA 3WAFA 2X0LA 4YU0A 5I58A 2FRHA 2L2OA 4ZH4F 4ZTJA 4XSZF 3SEVA 2I49A 2KHMA 4C3HJ 1W5TA 1MQJA 5ESYA 3ZCOA 4KI0E 2QVVA 4OEVA 1B72A 4PF6A 3M7GA 3CO6C 2XVCA 4E7JA 1LGBC 3HSFA 3GFIA 1MS7A 3K6GA 4KD5A 1AL3A 5I7IA 5DDGA 2MC3A 2EV0A 1OR7C 1AH5A 4UVCA 4BU2A 3MKZA 4BDLA 1H8AC 4G61A 1A35A 3Q29A 2DXIA 1USYE 2DA2A 3P5JA 4UUTA 1OQYA 4CYDA 3ABLH 1WJEA 1XX5A 1Z05A 2W4SA 4HNTA 3PFIA 1G4DA 1BR4A 2CW0F 2VXDA 4PJ0C 1JKPC 1FJLA 1FOYA 3OYKA 4OENA 2DODA 1EH3A 2EILH 4W1UA 3IJXB 4XQFA 5HLTA 1OIBA 4L17A 3NQOA 2OD5A 3PUBA 2JJKA 3MJNA 2ZYKA 4EM0B 1A54A 4GX4A 3M8JA 1MG1A 1B52A 4MNUA 2ZXTA 5M3FJ 2OUMA 1R4MB 3O2PE 4DOZA 1XN7A 1WVRA 1AMFA 3KP5A 1MQDA 3MZ1A 4NC8A 3B6QA 2FMYA 2R71A 3RPQA 1LVAA 2O3FA 1R1NA 1TBXA 2LMDA 5EEHA 4RM3A 4U1OA 5FO5A 3SKPA 3RDIA 3ML6A 4HEA2 1I6HJ 5CQEA 2H27A 4IHYA 2YJPA 3CFXA 2K3PA 4C1TA 3HKZA 5I56A 1BC7C 3M3KA 4MNCA 1NH7A 2WYKA 1LB2A 1NH3A 5J4YA 3Q25A 1NV6A 2B65A 4HW8A 3O97A 2XF6A 3M1CA 1D8JA 2KZGA 1SMTA 3HOYJ 1OVBA 1AIVA 4CH7A 4BHPA 5IM2A 4K2EA 4OIPF 3FJGA 5DUIA 3GXAA 3MVWA 1D9YA 4N9HA 3A4CA 2YU3A 1B4AA 1SFXA 1URGA 2E35A 3GTOJ 3ISPA 4OIOF 2I5UA 2NNNA 4XKWA 4AC0A 3T1BA 3OS0A 4UNOA 2W25A 1DBZA 2GIZA 3KEOA 3MVPA 4A6EA 4ZEFA 2VPRA 2GM4A 1J0RA 2L9VA 4WK8F 1B5IA 1QUKA 1SD6A 3V42A 1HXDA 1IV6A 3DP6A 4IRHA 2IPQX 1NL5A 3WG7H 2WAQN 4HE1A 1WKMA 2BOLA 5EZGA 1GDTA 2QSGX 3D4GA 4I0BA 3MZYA 2A6TA 4XBFA 5HVQC 1J09A 1U9OA 4BHBA 1LSTA 4KA4A 4F3GA 4G8NA 4DCYA 2L54A 3IFAA 1KWHA 3OO9A 4LMYA 4RB1A 4IJAA 2XXIA 3PV0E 4KYEA 3I59B 4RAFA 1EYIA 5DEQA 2DTZA 3OV8A 1WJCA 1NUYA 4LZ5A 1TT1A 5DUKA 4M9XA 1Y8QB 3I4NJ 3FXBA 2O84X 2ZC2A 5D8LB 2O51A 1ETXA 4P55A 3T8RA 3ILTB 2OPTA 2DE3A 5FGMA 5J40A 3PSIA 3SEQA 3K70D 3MZHA 4DYRA 2LTPA 4RS8A 4LA9A 5AA2D 4Y33A 5DS9A 4PTKA 2HQRA 1IW7F 3NARA 2ZXWH 2E0SA 2VQHA 5ICTA 3BC8A 1MDP1 3S9LC 2THIA 3V4GA 4X04A 4NUBA 2UWMA 3MMYB 4G6DA 3T0YA 3TO6A 2L7ZA 5D8KB 3GFJA 4HZFA 4YIFA 4NF4A 2DFEA 4PUSA 2DQVA 3FBNB 5C4XJ 3BJOA 2Y5LA 4DXUA 3GW2A 3TEPA 2AQEA 5LHGA 3IOVA 2H1LA 4IHTA 5E1XA 1FTLA 1WVJA 3KOTA 3CIJA 2NUVA 1KU7A 1NUXA 1R1TA 2UVJA 1GHCA 2NS8A 2CZLA 1UG0A 1OYYA 1X2MA 4DZJA 2CH0A 3PIOF 2OX3A 4O3AA 3F21A 1FW0A 4X6AJ 4M3DA 2CWEA 1O57A 3G1LA 3LSGA 3TTRA 1ZELA 1GVDA 1FTJA 2VKHA 4J19A 4P0GA 1X4OA 2DDKA 1W7PD 3ZKLA 2D1HA 2IA4A 3PGFA 1POTA 2B4LA 1IG7A 4H67A 1P7JA 2QVOA 4P56A 3TYHA 4BQNA 3HPHA 4HSRA 3WE3A 2E2HJ 2RREA 4PFBA 2V3UA 3S1NJ 4U0YA 2HXOA 1MY0A 3IKVA 4Q0CA 4Y52J 4YG2F 4R6KA 1DK4A 1N7WA 1P4AA 3W2WA 1MNDA 3WGHA 4M6YA 2QL3A 4FE8A 4AU7A 4DYCA 5EF6A 1FJ6A 5B1BH 1WGXA 1RR8C 1FJ9A 3BTCA 3MBPA 5J16A 2WB1A 1IMDA 1O64A 5I3SA 2QFLA 4ELQA 4NF0A 2BW3A 4WCGA 1B05A 4RGRA 2HQNA 5IOYA 3OYDA 1R6ZA 3UP9A 2MGQA 2PCRA 4QFLA 1OMIA 1S7AA 1V4RA 5CBSA 1MKMA 3BT9A 3HRUA 4RB3C 3GTQJ 5ICCA 1XD7A 1WI9A 4XRSA 4R75A 3S2HJ 5H8NA 4QPOA 4P9UA 3QK6A 5K5RA 3FXRA 2R6GE 2M3AA 3OYHA 3U1DA 2WBMA 4N0BA 3KC0A 1M5EA 4XKVA 4YRVA 1MXZA 1TQIA 5IZZA 3O29A 1RYOA 3QUJA 2NS7A 2XPWA 2CS3A 4TLMB 3CO7C 5EG0A 1VQLI 1P1WA 4ESFA 2OCUA 5TPAB 5I2NB 2QBYA 1VQ4I 3ZQQA 3TODA 2GRVA 2EZLA 1T08B 3E78A 3KZIC 4G7OF 4M9ZA 2V26A 1ENHA 4Z2YA 4ZYEA 1FTAA 3PPNA 4I99C 3Q3SA 3K6XA 5KAIC 5JLWA 3O2AA 3SETA 1QRYA 3NEUA 5FKLA 1PB8A 3RN8A 2FF4A 1D0XA 4ZYHA 2I58A 3MPLA 1MMGA 4DI3D 2JN6A 4JK1X 1D0YA 5H8NB 2Q8MA 1IXCA 2FJ1A 3GCMA 5IP6A 4ESJA 1HLVA 1JT0A 2QSHX 5JFRA 4MAGA 3FXQA 4BDQA 1PJRA 2WV0A 3PTYA 1I27A 4LIUA 4EDPA 2ZMBA 2PMSA 4PETA 1X1AA 3K4NA 4GBWA 2BY2A 4NN3A 3OD7A 3CC7I 3CRBA 2VQCA 1MY3A 1OPCA 2LRDA 1EYKA 1APLC 3BTIA 4ZJZA 1RKTA 2HVRA 3FIRA 1BI2A 3K00A 1TNSA 1F9BA 5EQ7A 5HS8A 1POGA 1RIOH 3WU2C 4FT8A 1MRPA 2OZZA 5D5UB 4G68B 3CHGA 5J1YA 1JHHA 3BWGA 3QPLA 2D5WA 2DA4A 4UY8I 3L6GA 4HF2A 1E3PA 2ZJPF 5FRMA 4X48A 4RK9A 2OCEA 3BG5A 3L09A 2DW4A 2WAQA 2TDXA 1LEAA 2V3TA 2ONKE 2Y84A 1ZIUA 1G3TA 4MX6A 1SANA 3FV2A 1CGPA 3N6TA 4PBQA 3PMWA 4A3MJ 1MQIA 3W6JB 4E6KG 3LSFB 3GTJJ 2V9KA 2DMTA 3E5QA 5FKKA 4L9VA 1DPUA 3FVKA 2M1BA 5DTBA 3HDDA 4H5GA 5TP9A 2XGXA 5ELVA 1IUFA 3VSLA 4GGGA 3GZGA 3T93B 4PFPA 1IF1A 1YRNB 1DQUA 2R7XA 2RDPA 4FISA 1MSEC 3LQQA 2ZNUA 5FBPA 3CCUI 1Y3NA 1R23A 2XXXA 3ROUA 1BI3A 4AS5A 2BBYA 3J81Z 1XCVA 3WE2A 2O8KA 3OYCA 4CO8A 1BKAA 1ACIA 2X6XA 3MQ9A 2DA6A 4OANA 1ULYA 3TGNA 3GTMJ 3CFZA 1P1UA 2XXPA 4JSOA 1YJNI 5A5LA 1LAHE 4GCVA 3QPHA 4EJVA 4JDFA 4PGPA 2R5ZA 2IS4A 5TRDA 4FBPA 2ICWG 1MNMC 5IZ1A 4N17A 5I57A 4RGSA 3S32A 2HOSA 3KSXA 3FHNA 4CCLA 3IKTA 3L1PA 2REJA 4LZ8A 5TGTA 2P6SA 2ZBKA 3U21A 1ZAOA 3FXKA 4IO4A 3E5XA 3ZXSA 4E0XA 3EUHA 5E8GA 2F6PA 5DD4A 1FPDA 5F08A 2JPCA 2GAUA 3T8TA 3ZQCA 2F36A 5CYVA 5LLQA 1QUJA 4JBAA 4LLGF 3WGIA 1F4KA 1QHGA 3CFLA 4JWXA 3VXCA 4OETA 3KC1A 2H98A 2E5ZA 3LFKA 1IXIA 1D4NA 5H8FB 2M87A 3COAC 4YIIA 3VVFA 1ODDA 3ABKH 4B09A 2K02A 3RPLB 3S17J 4QFKA 4JWYA 1Q35A 1I3AA 4MQ9F 5FHMA 3E6MA 1IRXA 1NNKA 1MDMB 3HBLA 2P1SA 2Q8JA 2XKOA 3ZMZA 3FUZA 3KP2A 4A3FJ 2DBBA 4OMBA 4ZZEA 3JRGA 3H4ZA 3H3ZA 4I01A 5ICFA 5ITOA 2F7AA 2Y0SN 4U4SA 2DFIA 5EYHA 4R9GA 3D5LA 1GV8A 1H45A 3OOAA 3ERMA 1D1CA 1UZCA 5GPAA 3QP5A 4LZ7A 1UHMA 1AKHA 4PAIA 1JTYA 1YCJA 4PDDA 1MBHA 3WTYC 3VWBA 1PYVA 2W85A 3LMMA 1NV3A 4PQJA 1MBEA 4II3A 1S7YA 4XLPF 2GLOA 5L3DA 5L9MA 3ZGKA 4E7LA 2QQ8A 2V93A 1Y1MA 2V25A 3FK6A 4BACA 3AG4H 1T0FC 3TMGA 4G68A 2IAIA 3RPLA 3RPUA 3BFTA 2FXAA 1BIBA 1UTBA 1K6YA 2ZJ2A 1NV1A 1SFKA 1O7TA 4X0GA 4GF8A 4M3GA 3IK6B 4G9YA 2WAEA 1SQYA 5H8QA 3HPGA 1B8IA 3S14J 2P7VB 2JWTA 4NBQA 3JRBA 1I1GA 3CCRI 3MKYB 4IKFA 3JV9A 4KXPA 4PFYA 5J3LA 3IAZA 1X4PA 2HS5A 4ZEBA 1RUNA 1B40A 4V2GA 2HDDA 2GQQA 3GLXA 2KL4A 2VD2A 2FVZA 1EA3A 3F8NA 1UCRA 2KLOA 1SFEA 2VB6A 1EV7A 4XLAA 3FMSA 3T9UA 5A5XB 4F93B 3C3WA 2XGEA 1UB9A 3ECHA 2QGUA 4POWA 2M2EA 3G7WA 3I9V2 4KCDA 5ET6A 4YKKA 4I3YA 2DMUA 4EJOA 1SMYF 1YHQI 3HOUJ 1MD0A 3KFMA 4N91A 5CRYA 4F1YA 1J7KA 2VIXA 3UR3C 3KN3A 3KX2A 2DQLA 4M73A 3I4MJ 3FJ7A 2FU4A 3CC4I 4XSXF 1UTBB 5DV5A 1IN4A 4B8XA 3S16J 2QVRA 2DOJA 1G3YA 4GO1A 3TCGA 4ZE8A 2CU7A 4DBRA 2EPFA 3JRFA 5CVUA 3MFKA 2V9VA 2I48A 2QJEA 4QTRA 5J8CA 5DM6F 4CCNA 3ZS6A 3E0JB 1JUSA 1P4XA 4P1WA 1CF7B 4U7DA 2A61A 2MSYA 2A07F 4KYDA 4KMFA 3H7MA 2X9DA 2Y9ZA 1O3RA 3RKYA 4I62A 2YLNA 2VPLA 4HA8A 4RJZA 2E7WA 5JI6A 1S9TA 2CV0A 2EA2A 4OFOA 2CZIA 1E2XA 3DU5A 4UUSA 2QS4A 1XB4A 3WGGA 2AHQA 2DT6A 5EYFA 3MQ0A 1FTOA 5FROA 1W7PA 2F2EA 3RPWA 2EIMH 2HDWA 3FISA 5CMMA 1KU3A 5CQGA 4H0WA 5K7ZA 1MDQA 5K7FA 4RA1A 4YKIA 4N6DA 1Y0UA 2FX0A 3MKWB 4ISUA 3FM3A 3U2RA 1LBXA 3CJTB 4IO9F 1T39A 1ZTRA 3ASOH 2K5CA 3IWZA 2R7DA 1OISA 3LBSA 4GWWA 4OXVA 3W6KB 2Z23A 2R7SA 2F6CA 4D5FA 5K2XA 2IGOA 4IHSA 1B0HA 3OO8A 2F5EA 1Y1VJ 3LQRA 1SFUA 3A2KA 4GXAA 4NF6B 4Q8RA 2IA2A 1OVTA 2EWNA 4O3BA 2XX7A 4MFIA 1PC3A 4BDNA 4OVSA 5FKMA 3EN3A 1HA8A 3ZQ7A 1SAXA 4IXAA 4FE4A 1DDNA 4ENKA 2RINA 2R7QA 3R60A 3V7RA 2HPIA 2QLZA 2PQ8A 3C32A 1TW3A 4MEYF 3F0CA 3OEKA 3KEQA 1Z3YA 2P0SA 3FXUA 3WU0A 3SHFA 1JEUA 2ZXHA 1Q1VA 2ZYOA 2HQ0A 1IGNA 2UXAA 1QULA 3BFUA 2AXTC 2W57A 5LOMA 3S3MA 2X26A 5CBRA 4QFPA 2E1NA 5TPAA 3BKIB 4N6KA 3KN7A 2HOTA 1QU3A 5K2YA 1XS9A 4U21A 5EQ8A 1Z77A 5EGOA 1HF0A 4PJNA 1EJ9A 2LOOA 3RQIA 2DOAA 1DGRM 3KJ7A 5E17F 4N81A 1AOVA 4RA2A 4MFDA 4JP0A 5CC2A 3BQYA 1Q1HA 4OMYA 1LBYA 2XXRA 3E5UA 2NWJA 3S2WA 1FPBA 3HOTA 2A05A 4ITVA 3UGWA 2AXLA 3BR6A 3VB2A 1E17A 4HXVA 5H8FA 5EJCA 3OR2C 4A69C 3RQ4A 2Q8KA 5GAHJ 2FNAA 3TPAA 1R9TJ 2GZWA 3F72A 4MLVA 3HHHA 4GWUA 4CCOA 2P4WA 3ZRGA 3H5NA 4B3AA 4CCJA 4ESWA 4BE1A 2OWTA 3X2QH 2F3BA 5FTIA 1VQMI 2OTLI 3VDXA 1EH7A 1MPBA 4ZTFA 4HYEA 4DBQA 1K78A 4RB0A 3B7DA 4K3FA 3OY9A 1LJ9A 3SYTA 5GAGJ 3UKGA 1IRGA 2WTEA 3OMYA 1GXPA 4JXIA 2IJLA 3GFLA 1YXIA 4HW0A 3HPIA 2RQQA 2QS1A 4BUPA 1P99A 1U6GA 1TW2A 3LOCA 3AG3H 3OWTA 4YMAA 3R0AA 5BPIA 4HE2A 4PDKA 3GBBA 1ZLKA 2DT7B 2KDZA 1JJ8C 1LFPA 1UIUA 1S7EA 2VONA 2ZMEC 3REOA 3IORA 3CJQB 1B1HA 3RI4A 3JAMK 3PUZE 5DEXA 5J4VA 2WV1A 2GA2A 4GDFA 1LLSA 4KNYA 1R5GA 3RTWB 2XF5A 3M1EA 2LD5A 2VT5A 1QZYA 2KIQA 4LB5A 1R22A 2O7IA 3A01B 4O3MA 5I2NA 5ILVA 2UXNA 4CA0A 2K9QA 1N84A 3AKZA 3S3OA 3E79A 4GQOA 1MPCA 3FBPA 2R5YB 3CUOA 1BN5A 3FKIJ 1XTAA 2JZYA 4LIVA 3KP4A 2A6HF 4CYCB 4F3QA 1IN7A 2M8GX 2VE8A 3DEUA 4E70A 4CXFA 3KCCA 3HOSA 2R0QC 4LOCA 2AQFA 2ZZWA 4N4OB 4ZDLA 1LB9A 4RBOA 4XRFA 1URDA 4NF4B 2GHBA 2XAGA 1SYHA 1SEUA 3D4CA 3CCJI 1UIVA 4H4KC 2I6EA 4RNSA 2PJPA 4A3EJ 3H0GJ 2LNBA 2DXYA 2RKMA 4IZZA 3HOZJ 1U5TC 1Z6TA 1HBXG 3W2VA 2IP2A 4IF4A 2LF7A 4KISA 4C2UA 2XAJA 2LK2A 4PZJA 4BDYA 2DYRH 3H35A 1M5CA 2X7PA 3S9MC 2XSJC 2OZ6A 3RZOJ 3FIWA 2FMLA 2F4IA 2R7OA 1XMXA 2L0KA 2BE5F 1ETKA 5FHNA 4XL9A 4WX9A 2H9BA 4WEPA 3FXOA 5JLXA 4ETSA 1P2FA 3KYLA 1NUZA 3K2ZA 3EUKL 2MYSA 4B47A 4D5CA 3VV5A 2IGNA 1TWAJ 3QAHA 1DUXC 1B59A 1LEBA 1MZBA 3PMVA 2ZCWA 2WEFA 1QVUA 4OWRB 1WWXA 2KRFA 1IMCA 1IN8A 2V1XA 2E2IJ 4C1UA 3HOXJ 2BEOA 2E1CA 2L5VA 1NV5A 2K40A 1GVJA 4IR8A 4OESA 2ALUA 2P5KA 2CRGA 2QF7A 1GV2A 2KDOA 2EH3A 3M8FA 5LRSA 3JTGA 4HRIA 3WG9A 5ICEA 3AL0B 2OTJI 4I6ZA 1SFOJ 1X2NA 2Y9YA 2AYSA 3CUQA 4X9TA 4NF5A 4O3CA 1DTZA 2ZXJA 3T9HB 2OBPA 1SW4A 5H2FC 5CKTA 3AAFA 4X1DA 4AS4A 2ADUA 1PP8F 4NF8B 3RUMA 1JTXA 2VKDA 1ETYA 4EJWA 1ZRFA 3AL0C 1H43A 2RCBA 1DTGA 4H6DA 4N13A 3SXYA 3TQNA 1N3WA 2LY9A 2XX9A 4M1VA 1TT0A 2DPDA 4Q48A 3N6UA 4WEDA 3JRAA 5J8FA 1SPIA 2E19A 2M30A 1JXSA 1W36D 4I76A 4NEDA 4QSDA 3NWTA 3S1QJ 1MBGA 2XWIA 4KIFA 3QOEA 1Z3XA 3K10A 3HSTA 3OEMA 5IZ3B 1GVCA 3TUSA 1OMPA 4PFUA 2IA0A 4HNVA 2NRAC 3N94A 2DN0A 4IHWA 1FBFA 3G2BA 1PDNC 5H8HB 2V1DA 5FLMJ 4PSXA 4POXA 1R71A 4IQJA 3FASA 3MKLA 2R9JA 4MNPA 1B3FA 4WXJA 1R7JA 3BPXA 1RETA 4HLXA 2A5TA 1KA0A 3AFHA 3HTSB 1LFIA 2JUGA 2QUFA 1UFMA 1PP7U 2VPNA 3C35A 2A5SA 1YOVB 3KBRA 2OWSA 2P3VA 5CJ9A 3DPTA 3IAM2 4PFTA 5ICQA 3KLOA 4N6PA 2R7VA 2FNCA 1YAEA 3CMMA 1BR2A 4BDZA 1LAXA 2ZYNA 2JSPA 3QIMA 3J7AY 1M5BA 4XF5A 1O3SA 2I10A 4PE3A 1T95A 4D1QA 3BG6A 5IPAA 4O94A 5DVIA 3ZP5A 4LONB 1LBVA 1WFXA 2E1MB 2QPQA 2VHAA 1XCBA 3J80Z 1S8NA 1SVOA 1U9NA 3B6CA 4U87A 4LN5A 2Z5UA 3QUFA 3P9CA 1TTYA 2V9PA 3PL8A 3RJPA 1A36A 1ZRCA 3K4BA 2ZXIA 4U0VA 3EHSA 1U8BA 2D5VA 4Y13A 2QS2A 2OU2A 3FM5A 5KZTA 2CV2A 4YIRX 4UV9A 3DELB 2CQXA 4THIA 1IZ1A 1R1UA 2M34A 4FASD 3JSPA 3TW7A 2WX9A 3MVYA 3SEUA 3E1SA 2M7AA 2IS6A 2DI3A 4F1UA 3WTWC 1IMBA 1GXQA 4F29A 4B4CA 2F97A 2WYPA 3UA8A 2FHYA 1NV2A 2HZLA 2XWVA 4MF3A 3IH4A 4MO7A 3LUYA 5I2KB 3U8QA 3U1KA 4GYGA 5HM4B 5KDTA 2ZMEB 3A3CA 3A09A 3HUGB 3MAMA 2MH2A 3LSLA 3OOUA 2PT2A 4PCQA 5L3CA 2P5LC 4JX6A 1YIOA 2CUJA 4U88A 4BHCA 5K7HA 4L0YB 1USYH 1ZR2A 2CEYA 2CJJA 1Q1KA 2L9NA 4A0YA 5HDKA 4XONA 2Y7PA 4DW6A 1IXHA 1D3KA 1XC5A 1OR7A 3BOQA 1TL8A 3MSTA 4H65A 4MLQA 4P1LA 1JNFA 5AONA 4AUXA 3P9IA 1TXFA 5FLVA 1JVXA 2K3FA 2H94A 3H1CA 4HX8A 4Y15A 2RF1A 3VFJA 4AB6A 6PAXA 4A5NA 2RC9A 1GR2A 2PMUA 3I0TA 3FJMA 1FEXA 4DDDA 2AS5F 3TDJA 1XC1A 1UAAA 1FPKA 2CZHA 1T6SA 2FNPA 2YPRA 1Y1WJ 2HPGA 3BIHA 3CR9A 3K6UA 3T96B 5BNGA 3QPTA 4BKXA 4FX4A 1YO5C 1QA6A 2UYFA 4F3SA 1NTCA 2ABHA 2DPUA 2HYJA 3BTLA 3HYIA 4V19K 2VOOA 2JA5J 3HTUA 3DQVC 3C4MA 1R9QA 2ID3A 2XV4S 1MJ9A 2KKOA 3KP7A 3UIFA 1QKAA 1B3LA 2H25A 3EHTA 2NOOA 5TP9B 3HB9A 1ZKBA 2HQ5A 3IX1A 3JRIA 5H8SA 1MDMA 3CESA 5CMCA 2R3SA 1FZPB 1PDAA 5LGTA 3VYRB 3OYAA 3JRHA 2O1MA 3PUYE 3DKXA 5IOZA 2W7NA 3GTPJ 2IS2A 4WKMA 4HCYA 2L9SA 3PJRA 4G7HF 3QYEA 4F7ZA 1ZQ3P 1YYZA 3P9KA 3IB2A 5IZ3A 2X1EA 3S1RJ 1OQGA 2QVUA 2R7ZJ 3MZ9A 4LATA 3W9WA 4LITA 1USSA 4AIHA 2DYSH 2LBFB 4HQEA 2RQPA 4M3EA 1H76A 1INPA 2BVMA 1FTTA 3K4UA 4O7MA 2W82A 4H8IA 1MXVA 4BQOA 3CDLA 2HPMA 3V8JA 2XGCA 1SD5A 2VXZA 3VODA 3H9GA 5BS6A 3PNYA 3TDUC 1BM9A 3RT8A 3S2VA 4Y17A 3R61A 2WB1N 1IXGA 2B4MA 4OA4A 1S72I 3ULQB 1FBGA 4LGWA 1I69A 3ZSFA 3J80K 3BG7A 1EKEA 3FATA 4LG0B 3G6EI 4XKRA 2R5ZB 3O8HA 4BYYA 5DVFA 1Z7LA 4YEJA 1X1PA 1PEBA 3R0JA 5D4SA 2W00A 4ZYAA 2YU9J 1WZ2A 3IC7A 1MBKA 1J9IA 1ELJA 1PBPA 2HXRA 2NVXJ 1IUYA 2UVGA 3ROJA 2RN7A 4L9TA 1G6NA 2HYGD 5HNHA 3BROA 3CUQC 4QHQA 1WI3A 1R6RA 1FPIA 3HKZN 4E4HA 3RIRA 4GRKA 1UQWA 3HRSA 5KCJA 2R92J 4EXLA 5AA4A 4R73A 3F8CA 1Y56A 2Y0MA 2YUSA 3DKWA 3OYBA 2OK2A 1VNDA 5FD6A 2V7FA 3S8PA 4D7NA 4R9FA 2O7UA 2W48A 4IO2A 2O1LA 1XGOA 4GL0A 3S4UA 1IMAA 1B5JA 1TWHJ 1IRZA 1MH3A 3PPRA 2JA8J 3N5LA 4GLIA 4GWXA 2Q2CA 4OINF 1D3YA 2VJIA 2VPOA 1RI7A 3DPUA 1MY1A 4IGTA 2DFFA 4KYWA 4ELRA 3OMBA 2M8EA 4RB2C 1R58A 3IL2A 4R6HA 4B48A 4EQ9A 1OCCH 2QMWA 5BWJA 1BP5A 4EATA 4DIQA 2BY3A 3CG3A 1DP7P 1D5VA 4GX3A 5FB2A 5CMBA 3SDFA 3O6BB 2FA5A 4R74A 4R1HA 1FBPA 3JCUC 1VQOI 1T8IA 4FECA 2D1VA 3VVDA 2B63J 1I5ZA 3MAJA 5AA2A 3WTXC 2HI3A 2G7HA 2O61A 3OOPA 5ICGA 2NXOA 4M3FA 1BJAA 1PB7A 4KT5C 1U78A 4IRIA 2ONRA 1BIAA 1RKMA 3N26A 3H6UA 4FTHA 3RKQA 3N4MA 4KYSA 3CP8A 1G8XA 1I6BA 5B66C 3EYYA 4IY5A 1K6OA 4YB5A 2K4BA 4B44A 5LEKA 1VFDA 3K01A 3IOUA 3LSKA 4ABZA 2BHYA 4BJTA 2DJIA 1JW5A 2XXKA 4QXDA 4XKQA 1G3WA 3ASNH 3IV5A 1MNEA 3F6OA 3QSLA 1IV8A 4OMZA 4PSWA 3W3CA 3DBLB 3GYYA 3SEZA 3K2AA 2EV5A 2XAUA 1VE4A 3QXMA 5DD8A 3KGCA 4IO5A 4HV5A 3BDDA 1WJ5A 3SZGA 4XLHA 5FLXK 3IOWA 2HVQA 1KONA 5EEAA 2LKPA 1B51A 3ZMVA 3IRQA 3TCHA 1KA8A 1MXYA 3P7IA 4N8GA 1SD7A 4KIBA 1VQ5I 4EM1A 1LFHA 2KJBA 2F7BA 1FP2A 2FEZA 5E79C 2DDAA 2LBFA 2F35A 3CUQB 3KYDB 1V54H 1VFEA 4ON0A 4QWQA 4ZDMA 2HAUA 2CFXA 4WXCA 3CQZJ 1LAGE 2BXZA 4XN3A 2VQLA 2DVZA 2G29A 2RNGA 3PU5A 2GIVA 1ZG1A 2DCEA 2RKHA 2I0CA 3IB0A 1XG1A 3QYTA 2DK8A 4L5JA 3DBHB 2G7UA 2JJ7A 3EYIA 1MW7A 2B3BA 5DYMA 2VOPA 2FUG2 1WJBA 5L3BA 3L2CA 4BS9A 3QMFA 2HTJA 1RDZA 3OENA 1X1CA 3B6WA 3CI8A 4BH9A 4A3CJ 1CF7A 4IO7A 1VSOA 4IGRA 4UUSB 1Y3QA 1LE8A 3BR5A 4QBAA 3BY6A 1HQCA 2V6CA 3C34A 2MBFA 3G3GA 2LREA 1BOBA 1REPC 3TTKA 4NHBA 2WY8Q 2Y31A 4HG2A 1IMEA 2B9SA 1FOWA 2H6CA 4EJTA 4RDUA 1BLFA 1HSEA 1R36A 1XSDA 2X6YA 4I2OA 4OIQF 4I98B 4R8HA 1SD3A 3F22A 1Y1ZA 1XDSA 2G0EA 3K70C 3O66A 2RV8A 1K61A 3QAXA 4YELA 1S6LA 2A5TB 1PUFB 4MFEA 5F64A 2HOAA 4BDRA 2XUBA 4BAYA 2LKSA 3CSGA 2BV6A 2H8RA 1B7HA 1EZ9A 4BQAA 1Y8RB 1HW2A 2DYXA 4QIWN 2P7CB 2FOKA 1TQPA 1J75A 1JETA 4GXSB 1RPWA 3E97A 3ZQGA 4XICA 3SEWA 1ETOA 4ZZLA 1ZYRF 5GTIC 3PO2J 1EU8A 3DTIA 4JWOA 4OHNA 2VP1A 3QPSA 1G3SA 4M72A 3VEPA 1W36C 1S29A 1E0EA 1XMAA 2H5YA 2HAVA 2J5PA 4I09A 3G3JA 2DLLA 2AL4A 3G3KA 4XLEA 1ZGJA 3GTGJ 1P6RA 2JTVA 4PF8A 2IGMA 3DTEA 3KPHA 1QW0A 3R4KA 1WRJA 2HQAA 3K4KA 3Q0UA 4NDLA 5C4JJ 4LLNA 2K7LA 1IITA 3DEWA 3VPRA 2NOJB 3O6IA 4U2RA 3S3NA 3AG2H 5JVGF 5A2QZ 1V3FA 1LFUP 1Y4TA 2ANJA 1JW4A 5A5XA 4NE4A 3CMYA 4PCDA 4PBHA 1SAUA 4E7KA 3PNVA 5HS9A 4RGXA 5DEXB 1OCTC 4BBSJ 3SEYA 5EQAA 1TWYA 1ZG3A 4L0ZB 2ZNTA 4F2OA 3VLWA 1DOTA 4CCKA 2ELJA 3OO6A 2KJCA 3DLAA 2BHZA 1ONVA 2OJED 5EZHA 5TJJA 1VQ6I 3EETA 4DE8A 5HODA 4NHJA 2DWJA 2D2WA 1O3TA 1ZHFA 4Y3OA 3HSEA 3HUGA 5LBQA 2F8DA 5HLHA 4B3XA 1JE8A 4ECFA 5JR3A 5CMKA 1UJ8A 4UV8A 1NH8A 1ZARA 2QENA 1RYXA 2IEEA 2DAOA 1XMKA 2E1OA 4U23A 2O0YA 2ZYMA 3D1NI 3PPOA 2DO7A 4MJOA 1ZN2A 1W0TA 2CGPA 4G68C 2I0BA 2MC4A 1DPRA 2EBIA 3ZN1A 5HNFA 1IIWA 3LV0A 5EHMA 1DSNA 1FPLA 1N04A 2QQBA 2UXXA 3F8FA 1B9JA 3DM0A 1M5DA 1MH4A 4YICA 4ZEDA 1FQDA 3BR0A 1KYZA 2FYIA 3M9AA 2WAFA 2Y7KA 1KA1A 3RTFB 2Z16A 4IOAF 2Y48A 2ZNZA 4R2FA 1Z0XA 3A1YA 5IT3A 2IXSA 4F92B 3CDIA 3OYEA 4DZPA 3LFUA 2E1MC 3V7SA 5T3JA 2EJRA 1YTYA 1QGPA 4KFQA 4E0WA 4TV7A 5IYCJ 3G1OA 4RLFA 4XOTA 3M4OJ 1QHHD 4RLQA 4UVBA 4M74A 5DM7F 1BA5A 3I53A 1IMFA 5K5QA 2NNYA 4OFLA 3T5XA 3MWBA 1LQ1A 4C30A 1C0WA 2JSCA 4IOCF 4GIZA 4M4GA 2Q2EB 4OWDA 4N4NB 2ZFUA 4BQQA 4CCMA 3CCLI 3E3KA 3OSQA 3RSNA 1Z7UA 4EJUA 4ENNA 3S2DJ 3NOHA 4XN0A 3HV1A 5IP9J 1X3WB 3I5OA 3SQNA 4G7ZF 1BK4A 3SJMA 3C2GA 4G12A 3GZ6A 1FPJA 3JREA 1UHWA 2OZUA 3K6VA 4LK1F 2KPMA 5F1RA 5AIQA 4S0HB 4JYKA 4CYCA 1P4WA 4P9FA 1ITYA 1GTKA 3ODBA 2LAOA 2YS9A 4LLLA 3ZQLA 3USDA 3WU1B 4N15A 2Z3YA 4XRMA 4N4UA 3OYLA 3CCSI 3RKXA 3CJNA 3TQLA 1MQHA 1DGWY 4F19A 1FBQA 5F0CA 1LCTA 5L3FA 1FTKA 3FDYA 3MCZA 1NNPA 3LSJA 1XSXA 3I59A 1NK3P 1FBCA 1I3QJ 2CQKA 2F4MB 3DV8A 2DA5A 3OIQA 1FWZA 1Y39A 3CCYA 4UB8C 2QSFX 4KT6A 4F55A 4A3DJ 3WHCA 1DP3A 3BTJA 1G0IA 2HTSA 3TOBA 3U93A 4AIDA 3EPEA 2VT3A 4XKNA 2EIKH 2MW8A 3VOEA 4HF1A 3LSWA 1YI2I 2R7RA 2R7FA 4HDUA 3PSFA 3EF7A 4A6DA 3G71I 1S7OA 3V7CA 3GTKJ 1KGSA 2YX4A 1EF4A 2WKYA 2OAZA 2QS3A 4OEUA 1E3OC 1Z6RA 1LKXA 4GFBA 4HV6A 3H36A 3WTUC 1YS7A 4YAHX 3JAMZ 1RDXA 4BY7J 4F3PA 2VC0A 4XR6A 3OR1C 2OCCH 4L18B 3OS2A 1QJMA 4P96A 2IGKA 3PUFA 1YX3A 2JA2A 3HGGA 5LGUA 3KJTA 4PC9A 4HNUA 4YB7A 5I56B 5FLXZ 1HKTA 4I40A 2EZKA 3ERED 1H44A 3JW4A 4QFNA 3L00A 3GZ5A 5FFZA 3ZMTA 2TRTA 4OAYA 2Y7RA 2P0WA 1PBQA 1W5SA 4HX4A 3LA7A 2DWHA 3L6HA 1B3HA 2DTRA 2PJRB 2PMZA 2R7UA 4I0AA 1A40A 4EUOA 1QQIA 2BY1A 3A03A 3H9JA 2M45A 1I6QA 2M7BA 3B50A 2E7XA 4MNIA 4ZE9A 2ELHA 1U5TB 1LDDA 5F1JA 3GMEA 5KHDA 1A04A 1BTJA 4MEVA 3T22A 1B58A 3T9XB 3OYFA 3KSJA 5D6EA 3DP8A 4WF2A 3W6VA 5D5XB 3FF5A 2V3QA 1FBSA 1STZA 4P9KA 5DYHA 2BJIA 2MLKA 5E8IA 3TQWA 3O8GA 1UHSA 1OLAA 5BPDA 4RM2A 1MXWA 1JEVA 2L7FP 2M4GA 2YSRA 3K02A 2QKLB 3LSIA 5KCMA 5J1UA 2JK3A 2ZSHB 4MMPA 3LAJA 5IYBJ 1QBJA 2R93J 1AKHB 2A5WA 1AU7A 4NWDA 2N8GA 1YG2A 2W1OA 1FSEA 4B1RA 5LGNA 4A3IJ 4EVIA 5EEGA 2I4BA 3WAEA 4KPTA 1U5TA 1CE2A 3KEYA 3J7ZI 2CMOA 4JX4A 3DFGA 1IC8A 3TP0A 2V84A 3C2BA 1QUIA 3I4PA 1US5A 2QSXA 1O7LA 3HO7A 2MLGA 1JUMA 5LD2C