3HHGA

Structure of crga, a lysr-type transcriptional regulator from neisseria meningitidis.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
293
structure length
293
Chain Sequence
KTNSEELTVFVQVVESGSFSRAAEQLAMANSAVSRIVKRLEEKLGVNLLNRTTRQLSLTEEGAQYFRRAQRILQEMAAAETEMLAVHEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSLVSSEGYINLIERKVDIALRAGELDDSGLRARHLFDSRFRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGKLIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of CrgA from Neisseria meningitidis reveals a new octameric assembly state for LysR transcriptional regulators
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, LysR family
total genus 69
structure length 293
sequence length 293
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hhgA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhgA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3hhgA02
4A0XA 2UVIA 3HO7A 2CMOA 4PGHA 4NF4B 3I6VA 1OYYA 3M1EA 2VT2A 4G8HA 4X9TA 3WAEA 3RT6B 4C0RA 3KSJA 4LK1F 3FX3A 3LAPA 1LNWA 1H45A 3VLVA 1EZPA 5LHGA 4ELOA 3TQLA 3KP3A 3BOQA 1B4AA 3JYRA 3MAMA 1QUKA 3EQLF 3MUQA 3WTYC 5DUIA 5B70A 3DV8A 1IW7F 4HA8A 1FBUA 3OEKA 2YSRA 1U3EM 3S9MC 3JZJA 4ENMA 3RJPA 4HV6A 2F6PA 1AOYA 1U2WA 5ITOA 3O6BB 2OBPA 4QFOA 4Q4ZF 1A54A 1OMPA 2O6AA 4LD5A 2Z8DA 4PDKA 3GBAA 2F34A 4OQOA 3IJXB 5H8NA 2A5TB 3K01A 1HSLA 5KZTA 3V7SA 2EB7A 2DW4A 2KJCA 4I62A 4U1OA 4R79A 2DFIA 3ZN0A 2GWRA 1IZ1A 2MC3A 3M9AA 1XSXA 3VOEA 1FSHA 3BFUA 1ZJLA 3ONMA 2K02A 2YX4A 2VHAA 1IN5A 2PBWA 4R9GA 5FLXK 2DSFA 3N6TA 3L00A 1SDXA 1KQ8A 4IJAA 2A61A 2Y7WA 5A5XA 4NF8A 4A12A 5L9OA 1UTHB 2P4WA 4L17A 2LSOA 2O1MA 1Y1ZA 3UIFA 3G7WA 2F5CA 1HW2A 2G7UA 3A3CA 1CGPA 4NB5A 3RDIA 1P2FA 3KN7A 4KDPA 2DTRA 1TBXA 1NKXA 2HYGD 4R6HA 5H8HB 3FJ7A 2L02A 1DP7P 4GIZA 4ELQA 5CJ9A 5BPIA 3CG3A 2A07F 1ZTYA 4AD9A 1ZRCA 1UCRA 1H43A 1SD3A 3CO7C 1VR5A 1JW5A 4MGRA 4H8IA 4MLVA 3WU1B 1SQYA 4BDOA 4CICA 1KYZA 3LSXA 4L9TA 5ICCA 4EDPA 1B9MA 1Q1KA 3CTAA 2R7FA 2XXRA 1WSUA 3CRBA 5ICFA 4NF5A 4OEUA 1NNFA 2QENA 3MAJA 4I8CA 5I2KB 1YTYA 3GUDA 1ZAOA 1WWXA 3ZMDA 3ABTA 2Z3YA 2OWSA 1IIWA 4OETA 2RVCA 2KKOA 3TMGA 2VD2A 1FTMA 2ZMBA 3F8MA 4PZJA 1Y3PA 3JTGA 5CMBA 1QQIA 4G7OF 2ZKZA 4XIGQ 4HYEA 3CFLA 1Z7UA 2V6CA 4CO8A 1B5HA 4GXSB 2Y84A 3PPPA 4OMZA 5BMZA 3FM3A 4KMFA 4H5GA 3F11A 4XRFA 4NF6A 1B4ZA 1RKMA 1MPBA 3OELA 5LRSA 3RGYA 1QVSA 4RYAA 1N84A 1YW9A 4EQQA 4YICA 3PD9A 4ZECA 1MDMA 4NF5B 4RGUA 1U6GA 3LSTA 3H4ZA 2EV6A 3I53A 4LZ5A 1U78A 3D5LA 5LGNA 4U0VA 4MFIA 4G6DA 5AA1A 1T98A 1D3KA 4LG0B 3EUHA 2M8CA 2KIMA 4CHUA 3C36A 1FTKA 4NQWA 5EEGA 2V1UA 4O6JA 1IUDA 3TODA 1EZOA 2I3VA 1BI1A 4I9DA 1U5TC 1SFUA 1XS5A 3MZYA 5E17F 3V8JA 4U21A 4H0EA 2HGCA 3MCZA 2P1SA 3JSPA 2XX8A 2QWWA 4YAHX 1JHFA 1D8KA 4XTCQ 5D5XB 5A5XB 1R1UA 1MDP1 3NQOA 3BP8A 1I1GA 4DIGA 2X7PA 3W9VA 2HZTA 5I84A 3WTZA 2HTSA 3W6JB 3ZP5A 2UVHA 2Y7KA 4X1DA 3QAHA 4U1ZA 1RNLA 3TCGA 1IRGA 1MXUA 1OYIA 1LDKB 3N26A 4N9HA 4U22A 1EH3A 3N5LA 4IHTA 2ZO4A 3L7WA 3FJMA 2GQQA 2LNBA 1MJ9A 5TRDA 3DP8A 4EJUA 1ZH5A 4RAZA 2JRTA 3TKDA 1LCTA 1SW4A 1K78A 1PB8A 1B3EA 1D3YA 2I4CA 3ZPLA 1MJBA 3DXJF 3TTKA 3MPLA 3KJ7A 3PD8A 4ASNA 1ZU0A 4KYWA 1ULYA 3H3GA 4C1TA 2WWYA 4NWCA 3H3ZA 3T0YA 3TFLA 1MGTA 3HYIA 3GBBA 3SEYA 1IXSB 4HOBA 1O7TA 5ICTA 3RKYA 5ERIA 4HF1A 1F4KA 4UVAA 1QULA 4G7ZF 1HSJA 3U2RA 4FX4A 1SI1A 2UZKA 4WXHA 1MY2A 4MEXF 3J81Z 4KNYA 4HLYA 3GYHX 5AE4A 4G68B 2ZYNA 1U5TA 3JW4A 1R1TA 2IJLA 2Z23A 4M6XA 3ELKA 1QPMA 4WK8F 1B6HA 3RYRA 1N0TA 5FTHA 2KRFA 1R58A 2ACJA 1NNTA 2E1CA 3PGFA 4MHGA 2VC1A 4GL0A 1LFGA 3T93B 4ZYDA 1CF7B 1NMUA 4Q48A 3WTVC 1BLFA 5AIQA 3IAZA 4YB5A 4CZZA 1FOKA 2D5WA 3H6TA 1LSTA 3MVXA 5AA3A 5LOMA 1ZMGA 4POXA 4TLLB 5BPDA 1ON1A 4LUBA 1HSTA 3BKIB 4IO7A 4HX7A 1H44A 4DXBA 3J80Z 3QOPA 3MZ9A 1URSA 3WTSC 2FMLA 1RUNA 4M4GA 2OJTA 5AONA 3KJTA 2YPNA 2OQRA 3K6UA 4IGTA 4GWOA 1O3SA 3BJ6A 2B3FA 2QPQA 2QQBA 2I49A 2VP1A 5D5VB 1T0FA 3G3HA 4FATA 3O28A 3EYIA 1P1QA 4RK9A 4F2QA 2Z33A 1Y1MA 1T39A 3SEWA 1WDNA 1BN5A 3GXAA 2HOEA 4U23A 3P9CA 3GWZA 2ZXJA 4EXKA 4AIKA 1A99A 2FBKA 3QK6A 4I7HA 3TQNA 4FJPA 1OPCA 2ISZA 4IHSA 3LWFA 1B51A 2PVUA 5J8CA 2DT5A 3RTFB 2X26A 3AXFA 2RDPA 5D8LB 1LFIA 3I59A 3O66A 3PUYE 3CUQC 1FC3A 5HBCA 4RPOA 3U93A 5E1ZB 4KN4X 4P9FA 1K78B 3FZVA 3QP6A 1SI0A 2XXYA 3SERA 2HYFA 2Q2CA 3HN0A 4EM0B 1B1HA 4BHCA 1V4RA 4KUMA 1K79A 3U72A 1ZBMA 1J59A 4R73A 3IRRA 3AAFA 2RKMA 1FTOA 5E1WA 4OMYA 1JEUA 5H8SA 3F23A 4HAMA 4FEDA 4FE8A 1MXZA 4EGZA 1TW3A 1DPEA 1LAXA 4KIFA 1ZGJA 4WKMA 5H8QA 3J80K 2LF8A 3K0VA 4R6KA 4XLNF 1O3TA 2LF7A 1FP1D 1USSA 2I6EA 3L6GA 1DTGA 1QW0A 3CI8A 1B7UA 2O69A 3ZKKA 1O7LA 1EU8A 3FV1A 5CI5A 5DVJA 3GZ5A 2PI0A 2CGPA 5JFRA 4EJTA 2XROA 2QS4A 3C3WA 3RIRA 5J6XA 1K6OA 1Q1HA 2XV4S 1W7PB 2W57A 1ZRFA 1B1BA 2VT3A 2IA4A 1LB8A 3BJAA 3K69A 1R9LA 1UTHA 4O3MA 3GZGA 4CYDA 2IVMA 3ISPA 2ZYKA 3OD7A 4LONB 3RYPA 5FO5A 4DCYA 2HKXA 1ZHFA 3GO5A 1JW1A 1FQDA 2XAHA 4BLAA 2GIVA 1XVXA 1XVYA 4KIBA 5EYFA 4IO4A 1EH6A 2IA1A 1XCVA 2V3QA 3TDJA 3F6OA 3PQKA 3DEUA 3T9XB 3TAJA 4HCYA 4F22A 5K2YA 2A69F 3HSEA 1RIOH 2GZWA 3P7IA 5L9MA 4RB2C 3LC8A 3RI4A 2KLFA 4F31B 4HV5A 5D5UB 3E5QA 2KIFA 5H8NB 3L9FA 4MLQA 2EWNA 2PLYA 1N7WA 1UFMA 3MEXA 1I69A 4F1YA 2XAJA 5AA2A 4DE8A 4F18A 2O51A 5LEKA 1S3JA 3DKWA 3J81K 3USDA 1OR7A 4G68A 5L3DA 1LB2A 2K4BA 3ZMTA 3OOAA 3BDDA 3DP7A 3U9GA 4Y17A 3MPKA 2HEUA 3G73A 1B32A 3ROUA 4O3BA 4OMBA 3SZPA 3T1BA 2DBBA 4OYVA 3J7AO 1R1VA 1M5EA 2M87A 4YKKA 5JTYA 1PC3A 2Y0MA 1SD6A 3OO9A 3IB2A 2UVGA 3QSLA 4OHNA 1G3YA 2DOJA 2Q2AA 1MM7A 3SZTA 1QUJA 2QRYA 4HF0A 1TNSA 3OO7A 3TPAA 2QSXA 4I0AA 1IUYA 2XD3A 4G77A 1FYLA 1GR2A 1TTYA 3KEQA 2NVUB 1TNTA 1M5FA 4P96A 4LLNA 1FQCA 4EJOA 1A8EA 1B6AA 2ELHA 4ZYHA 3IR1A 3QYTA 4PFWA 2GH9A 1B46A 3QRFF 2D45A 5HDGA 5FFXA 4D0PA 4P9UA 2P8TA 1XMKA 2PBIA 1KGSA 1WQ2A 5FD5A 1JVXA 1ZLJA 4YZZA 4DDDA 2EFPA 2W84A 2VONA 3K0LA 5I58B 5CBSA 3R61A 1XHYA 1DTZA 5CYVA 5I59A 2DWAA 4F3GA 5HM4B 2DVZA 3WTWC 2GFEA 4YMBA 1A04A 3VFJA 2XGXA 4DQ2A 3E13X 3HOTA 4MTDA 4KICA 2CSOA 2O03A 1XT8A 4WXDA 4RB3C 4JWYA 4GVOA 5DD4A 1E2XA 1OVBA 4ZS9A 1KU3A 2RNJA 5HDNA 1SFEA 4A6EA 5HLHA 3REOA 4ZEKA 2C6YA 3G3IA 5TJJA 1Y9UA 4WXCA 3PPRA 2OA4A 5ICGA 3M3LA 1F5TA 1UHWA 3MJNA 1QBJA 4PP0A 4F7ZA 2VGQA 5F6FA 4OIPF 4QHQA 2HKOA 3H92A 1Z7NE 1FQBA 4PFYA 4OTEA 4DNCA 1KU7A 1YG2A 3TO7A 5FB2A 1IEJA 5E20A 2VD3A 3BJOA 3C18A 4F29A 3GX4X 5L3BA 3M8EA 1I6QA 4QLCU 3VB2A 1UB9A 3U92A 1MXVA 1S9TA 4RAYA 2R71A 3FASA 2O1LA 4G7HF 3QUFA 2L4AA 1O7FA 2EK5A 3IRQA 3U1OA 5BWJA 3PFIA 4ESXA 4HDVA 4LQ5A 4UUVA 2O3FA 2REGA 2L54A 3DFGA 3GFIA 3JSOA 2XHKA 3DP6A 1HKSA 3I4PA 2MH2A 3EETA 4EF1A 1LAFE 4PFUA 2H98A 4PE5B 3F8NA 4R8HA 1AH5A 4LZ8A 2ZCWA 1URDA 2XAGA 3EDPA 3JAMZ 1R5HA 2EFQA 3F8FA 3EN3A 3O29A 2FBIA 1I1SA 2H99A 4HDUA 5IAIA 2Y7IA 1SMYF 2DE3A 4NF6B 3BPXA 3VDFA 1POY1 1QZYA 2FRHA 2HXWA 3HTSB 5H6RA 3UORA 2XX9A 1T38A 3K6WA 2Q8KA 1N7XA 3QPTA 3IHUA 5D8KB 1SD5A 4RJZA 3R0JA 3A3UA 5DT6A 3Q27A 4KN7X 2P2AA 2Y48A 2DXRA 4AB5A 2OWTA 5I2NA 4JB7A 3R0AA 4IY5A 5CC2A 4KI0E 4IO5A 2QMXA 3LA2A 2I0BA 3PV0E 5ILVA 1A55A 3RUMA 5JK4A 1FNNA 3HSRA 5HVQC 4IRIA 1R36A 1TFAA 3L2CA 2AYSA 4UNOA 3I5OA 5FLXZ 2ETHA 3ODBA 1IRFA 3RKWA 4RXLA 2ZNZA 2A5YB 1RYXA 2V93A 3G3ZA 2STTA 1I5ZA 2ZJ2A 4A6DA 1H3DA 4GLIA 1UHMA 4KIGA 2RQPA 1MPCA 3FVGA 1ANFA 3PUZE 3MZBA 3IB1A 5J1DA 4UHTA 2XXTA 1XSDA 1ONVA 2CFXA 3UK4A 4NWDA 4FHTA 4L5IA 2IEEA 3FJGA 2JZYA 2FNCA 3TQWA 2EFOA 1Q35A 4R9FA 3G3KA 5ELVA 1O57A 1IXRC 4G2ZA 3GLBA 4HX4A 3NRVA 1FQEA 3U94A 4OIRF 1IXHA 3KE2A 5D6EA 4ON0A 1N3WA 4YKPA 2W25A 1EZ9A 3G3FA 2R7DA 4MTEA 2QS3A 4NF8B 4BDLA 1BI0A 1J2XA 3VXBA 2H9BA 4AVPA 2RF1A 3KLNA 3KP4A 5H8FA 4OFOA 3SDFA 3FMQA 1U8RA 2VBYA 5J8FA 4H8JA 4FEBA 1V3FA 3B6QA 3EQ1A 2CZLA 1GXPA 3E3VA 2PYYA 2Z9OA 3BBRA 4E70A 5ILUA 4HS7A 1CF7A 3IOUA 2H4IA 3SKPA 1M5CA 1ON2A 1G4DA 1Z91A 4OESA 1XGMA 3ZSFA 1B5IA 3LBSA 4H67A 3N6UA 5A2QK 1MQIA 2HQ0A 2IT0A 2EFWA 1AMFA 5HS9A 2I4BA 4HX8A 2J5PA 2ZFWA 1NH7A 2XAQA 2P0SA 2A6EF 2PQ8A 5H20A 1YLFA 2G93A 4GO1A 3RPUA 4U88A 1OQHA 4GQOA 1MDMB 3S2WA 2VOOA 2XHDA 1FZPB 3TKYA 1FYKA 3GFJA 3F8BA 2M5WA 2QQ9A 3HSFA 2GXGA 4N0BA 3D4CA 3FV2A 2WTEA 1JW4A 3ZKLA 3KCCA 1IN4A 2XXHA 2BGCA 3N94A 4XKQA 2DP8A 2THIA 1TT1A 4LP2B 2HR3A 4L18B 1KU9A 3TOAA 3KZZA 4LLLA 4QRZA 5ITPA 2BV6A 1UIVA 2NS0A 5HPQA 2Y75A 3LAJA 4E0XA 1P6RA 2NAZA 2GRVA 2P6TA 3V8XB 4QSCA 3H6WA 2M45A 4MEYF 2BEOA 2IPQX 2DAOA 1SW1A 4LGWA 1SD4A 3ERED 2PG4A 5KK1A 1D9VA 4IVNA 1SFXA 1HW1A 1LGBC 3FVKA 1B3FA 3O6HA 3HRUA 2ANJA 4B8XA 4UXNA 4M1VA 2Z5UA 2E7XA 3KN3A 3I5UA 2IRFG 3IK6B 4RK2A 4DCXA 1TQPA 3KEOA 3SEUA 2I58A 3DF8A 4ELPA 3F6VA 2OZ6A 1D4NA 2H25A 1T6SA 2O7IA 1Z6RA 5L3FA 1XGNA 1FX7A 2DI3A 3CR9A 4HW0A 4EF2A 2VODA 2PT2A 5K5QA 4G8MA 3COAC 4QFNA 3CSGA 2MA3A 1OYWA 1JHHA 2F5DA 4QSDA 3MQ0A 3VFZA 1MH3A 5LRRA 1LBBA 3KG2A 5EHSA 3K00A 1Y20A 2I0CA 3F72A 1VTNC 4WEDA 1H9TA 3IO4A 3WE2A 5ICEA 4LZ7A 5EHMA 3KGCA 2HCAA 4EXLA 3V8KA 4L0YB 4WWCA 4OINF 3SFZA 1Y0UA 5FTIA 2DLLA 3GXOA 1FLIA 2MLGA 4CXFA 3CJNA 4NHJA 3TTLA 1PP7U 1WODA 5CMKA 3B6TA 3S9EA 2HFBA 1TLHB 4PCQA 1NNPA 3E5XA 5FGMA 4OXVA 4QFKA 1DOTA 2A5SA 5L3GA 3O6GA 2LAOA 2OBGA 2STWA 1H0MA 1B0HA 4BQAA 1XC1A 3RY3A 4BHPA 3R4KA 3H6UA 4H6DA 2ZYMA 2Q88A 1N04A 3E3KA 3HHHA 5LHHA 1K7AA 2E0SA 2ZMEB 3A09A 2XD2A 3IORA 4HZFA 1G3SA 2VN2A 1FTLA 1US4A 3SESA 3FATA 1YCJA 1RUOA 1G3WA 3KOTA 4KT5C 1ZREA 1UTBB 4ONYA 2RN7A 1WRJA 1ZG3A 3H03A 3FVNA 3G3GA 2EA2A 2F5XA 1URGA 3K4UA 4WX9A 4G94A 4BH9A 5DD8A 2AS5F 2FEZA 3OMBA 1OVTA 2R9JA 5I57A 1STZA 2ZNSA 1GVCA 4GGGA 4OOIA 1PP8F 1SW2A 3VVFA 1J0RA 3BFTA 3NEUA 3S9NC 4G4PA 4I09A 1MY3A 4RY1A 4YFNF 1BJAA 1H76A 4P55A 4RPNA 4TLMB 2Y7PA 3T8RA 4TOZA 3CSBA 2PEXA 4THIA 3M8UA 4HCWA 3FIRA 3L6HA 3FMSA 1FBSA 4H65A 4MF3A 5BS6A 2A3SA 5B7DA 4EJVA 2FOKA 2ZYOA 2D1VA 4MBPA 5HLGA 3MWMA 3JV9A 2V1DA 2AL4A 1TXFA 2HDCA 1JNFA 5E8IA 1YPNA 3TGNA 4PFTA 4HBLA 3V4GA 4GF8A 5LLQA 4ENJA 2K86A 2MBFA 4PGGA 4H1XA 3K2ZA 3K2DA 4GOTA 3O3KA 4M6YA 4KYEA 2RV8A 3O6IA 2DWHA 5ILSA 1FP2A 1F9NA 4AIHA 1L5TA 1J7KA 1S7AA 4M9XA 4ETSA 4DLDA 4M9ZA 5KDTB 5K5OA 5TP9A 1B05A 1XGSA 1NNKA 3SEVA 1R9QA 1GXQA 1B4HA 2L4MA 2H09A 2DPDA 1MKMA 3TO9A 2O0YA 4YFXF 5KVRA 4IO2A 2BJJX 4L9VA 1QGPA 4L0ZB 2YR2A 5F7VA 1DSNA 1LLSA 4BNCA 3TZAA 3KFMA 2V3TA 2A68F 4JQFA 3G3JA 4MQ9F 2CW0F 4OFLA 5LHIA 4ZEDA 1VE4A 2E7WA 2NOOA 1ZG5A 3R6SA 3BWGA 4HQEA 3SHFA 4AQ4A 2O6GE 3V83A 4I98B 4KQPA 4KHZE 1IN7A 5AA4A 1MH4A 4IF4A 3IO6A 3T22A 1YAEA 3SEXA 4R1HA 2RC7A 4RNSA 5H8QB 1FTJA 1PB7A 3GEZA 5L3CA 4KA4A 3DLNA 2IA2A 4GRKA 4ESWA 3JTHA 2RKHA 4U0YA 1J9IA 3VODA 3PMXA 5F64A 2JT1A 2Q89A 3TTMA 2PMSA 3F22A 1QJMA 3IOVA 2VOPA 2GA1A 2ESNA 3WODF 1JGSA 3CIJA 1M5DA 4PETA 1W7PD 1B59A 1S50A 1XGOA 4AIJA 4HW8A 1FWZA 1HBXG 1B3HA 1C0WA 1B5JA 4F39A 4R2BA 4C1UA 4AB6A 2XRNA 4EV0A 3MVWA 4L9NA 1IAWA 2BE5F 4ZZAA 3E9XA 3B6WA 1B52A 3C34A 4YIFA 1TFDA 1CB6A 2P5VA 4B09A 2F6GA 3W15C 3CVGA 1YS7A 2W7YA 1R23A 2FXAA 5CBRA 2PMHA 5D4RA 3TYHA 4FT8A 5D5WB 2QBYB 4S05A 1FPQA 5FD6A 1QO0D 3EHUA 4ZE8A 3V7CA 5A2QZ 2JPBA 2R6GE 1YW7A 4G9YA 2B65A 5JI6A 3C32A 3HHGA 4GXAA 3WGHA 4I0BA 3R60A 1ATGA 1B7ZA 1GVJA 4NE4A 1B2HA 2D21A 4BDMA 3WTXC 3V8LA 3GFLA 2UXXA 4F1UA 2FYIA 3TO6A 2QYOA 3VV5A 3UN6A 2WC2A 1LAHE 4M9SA 2FA7A 1W5TA 2XIGA 1W7PA 2FMYA 3I58A 3OEMA 3WTTC 5DVFA 2H6BA 3H6VA 3CO6C 1NHAA 1BC7C 3E6BA 3IL2A 4I2OA 2HQRA 4EJWA 3H3UA 2NRAC 3Q29A 2GAUA 1YW8A 5H8FB 1YIOA 4OWDA 1TW2A 1R1NA 4YKJA 2UYFA 1MZBA 1O64A 4KR5A 4H5FA 3T5XA 2B0LA 2P7CB 3F21A 1SD7A 3HRSA 2ADUA 3R7XA 2GHBA 2AXLA 3E97A 1ZIUA 3Q28A 3MZHA 4RS8A 1G6NA 2KJBA 4G68C 3C31A 3FXUA 4DXUA 4Z2YA 4ZYGA 2ISYA 5HS8A 3WGGA 3PPQA 5DDGA 4GFRA 2DS9A 4ND9A 4OIOF 2DWJA 4Q8RA 3E6MA 1IXGA 3PPOA 2HTJA 2E1NA 2ESHA 1Y3QA 4U2RA 2JTVA 4BYYA 2G29A 5E1XA 3MFKA 5L3EA 1D5VA 2QS1A 3MZ1A 2PN6A 3PUXE 3K6XA 1FYMA 1ZLQA 5FHNA 3DELB 3BPVA 1BOAA 2Q0OA 1FQFA 5DYHA 1GTKA 2P5KA 1KWHA 1OIBA 1BIAA 4M71A 5F1QA 4A5NA 2NUVA 4QSEA 2EA4A 4A5MA 1UIUA 2E1SA 4OEVA 1AOVA 5L8DA 1Z7ME 5IT9K 2ONKE 5BOXA 1J1NA 5AIPA 1RZ4A 1TWYA 1MG1A 4GYGA 4R74A 3BROA 5K1YA 3KBRA 4WF2A 2BBYA 2G7HA 4YKIA 1MD0A 1X3UA 2ZXTA 1MY0A 2A5TA 4A0YA 5LBQA 4OERA 5JVTA 5I57B 4QFPA 1XCBA 5DCMB 1GGGA 2CQKA 2FNAA 3IKTA 4ENKA 1BP5A 1Y4CA 3UGWA 1A40A 1Z1DA 2HAVA 1Y4TA 4H0WA 3V89B 2XAFA 2QVOA 2NWJA 1MQHA 1ZRDA 3ZMSA 4R72A 3WG9A 4I01A 1FT9A 1MY1A 1OQGA 1B0LA 3T9HB 2QS2A 1QZZA 4JWOA 5FHOA 3ECRA 4HQMA 2D1HA 3ECOA 1XDUA 3F3XA 4BDQA 4Z7EA 2P6SA 5EEHA 4LA9A 1OKRA 4XLPF 2AL5A 3CFZA 4I02A 3LQQA 2MD5A 2CG4A 2IP2A 3EHTA 3ULQB 3GVAA 2H27A 4F3PA 3HUGA 1S6LA 3HCQA 1D9YA 1XB4A 3BY6A 2FF4A 4L5JA 4IGRA 2UXAA 4KCCA 3CDHA 3VE1B 2XXXA 1R5GA 2F35A 1USTA 1HXDA 4DZ1A 2F5EA 1L3LA 2W24A 4ZZEA 4F3BA 1BI3A 4IPAA 4KD5A 3PPNA 3HOSA 3OOPA 1R7JA 1ELJA 3I0TA 4POWA 4Y15A 4ZEFA 2PFBA 4LK0F 3KEIA 5JEIA 4OENA 4U0WA 1FCKA 3IL1B 1B58A 2MLKA 3C1DA 2ONRA 4EGYA 4UACA 2VBZA 3ML6A 4RGRA 4L9JA 2HWVA 4N13A 1P1OA 1JEVA 4IB2A 1ODDA 1IN8A 3ECHA 3FD3A 4AWXB 4WEPA 2L3DA 1MXWA 2QL3A 3GF2A 2XX7A 5KCJA 3OO8A 3V7RA 4EVIA 2GHAA 1WVJA 1QNTA 3RLFE 1B7HA 1PDAA 2FSWA 2RC8A 2CWEA 5JR3A 1I6AA 2PJPA 4ELRA 4LVQA 2DPUA 2A6HF 3GZ6A 1SBPA 3MVYA 3RNNA 1P4WA 1LCFA 2VE9A 1BM9A 3E6DA 3S2VA 3K02A 1HQCA 1TQIA 5F1RA 3QXMA 1XMAA 2ZBKA 4LLGF 2ZNYA 2H94A 1LEBA 2O7UA 3RTRA 2RCAA 3CFXA 2OQGA 3W9WA 5HLIA 1KQ0A 1OLCA 2XXVA 5DCFA 4DXCA 3IOWA 1ZKBA 2QZ8A 4OZ9A 4ZEIA 3QPHA 4P5OA 3KSXA 2F78A 3LA7A 3RPWA 4EUOA 1IXCA 1DPPA 1NFTA 4FECA 3HTUA 5TP9B 5IT9Z 2W85A 2Z8FA 2YPRA 2X7QA 1LDJA 4Z0IA 1LBCA 4R2FA 3D4GA 2XVCA 2NNYA 3P9KA 4ZZDA 4HF2A 4ENNA 2QBYA 4LB6B 4S04A 3T96B 3TTRA 3RN8A 1ZN2A 2V25A 3TDUC 3R26A 3JAMK 4GL8A 3FWEA 1MY4A 2EV0A 2QUFA 2FE3A 3CG1A 3PUVE 1O63A 4FIMA 4WXJA 1KU2A 2Q9TA 3OO6A 2EV5A 5CVJA 3M8FA 1BIYA 4JBZA 3VLWA 1VFEA 4O3CA 3TOBA 4OVJA 4ZE9A 5FHMA 2VBXA 1PDNC 2GA2A 3VXCA 1W5SA 1IITA 3B7DA 5CVVA 4ISUA 3OENA 4Q47A 1YS6A 4M73A 4JWXA 2OZZA 2YJPA 2AIXA 1KYWA 4ESFA 1QKAA 1P1UA 5FFZA 1XN7A 1ZLKA 3IJOB 5M2VA 4F2OA 2NNNA 3TUSA 1P4AA 5CLSA 2O84X 4IO6A 4N07A 2TDXA 1HW5A 3Q5FA 2FNPA 5H6QA 4G6QA 1B9NA 1XDSA 4JDFA 1SAXA 4KYSA 3I71A 3KP7A 1A7LA 3FF5A 4GCVA 1SVXB 4JSOA 4P0IA 3FMRA 2DXYA 3KP2A 3KLOA 1VFDA 3I3VA 5AA4B 1QUIA 3KN8A 5CVUA 2DO7A 3ZQ7A 2O68A 3O2PE 2EJRA 6PAXA 3LSWA 1P4XA 3C35A 3DPTA 2P5LC 3CUQB 1BKAA 2ZMEA 4F1VA 3IWFA 4RGXA 1IN6A 4Y13A 1T0KA 4Q30B 2ONSA 3TTNA 2FBHA 5ICQA 4LFUA 3WGIA 1MDQA 5CVIA 2O61A 3M7GA 1FSEA 1BI2A 4JBAA 2V79A 4YFKF 1UQWA 3T66A 2XXPA 3H06B 2OAZA 2QMWA 2QM3A 4FX0A 2H6CA 5K5RA 3O2AA 1HSEA 4JXIA 2Q8JA 3ZS6A 3FM5A 4RB1A 2XXQA 3S9LC 2COMA 3HIFA 4Q5TA 3I59B 3Q9SA 4O3AA 1F9BA 2XXIA 3O97A 2Y7RA 2K27A 4R6YA 2XXWA 4U4XA 2DU9A 2WV0A 3WAFA 4LG0A 2UXNA 5JHUA 2CYYA 1E17A 4K3FA 1IXIA 3LSLA 4FORA 3QP5A 2P7VB 1AIVA 4FAJA 3M3FA 2D2WA 2REJA 2ALUA 1MXYA 1JXSA 3LA3A 2V1XA 4MNUA 5D6FA 1R00A 4RA1A 1A8FA 3GFMA 4OIQF 4ESJA 2HS5A 2Q2EA 4GYIA 1JETA 1NL5A 2DE2A 2UVJA 1RYOA 4K2EA 2VXZA 3Q9VA 5DV5A 3WTUC 2BYVE 5I2NB 1N3XA 1S29A 4UA8A 2DWIA 4N9IA 3DM0A 3PQJA 3V5AA 2F2EA 3IB0A 4NF4A 5IT3A 1QKBA 2XKPA 3WE3A 4XSXF 4CDGA 2HFHA 3N97A 4TQUQ 4YG2F 1ZARA 3T8TA 3DP4A 1CE2A 1XSVA 1P1NA 3FUZA 2J5OA 4RB0A 1DMBA 4Q5SF 2R3SA 1REPC 3MC2A 5LEJA 1FY7A 3KZYA 4YIIA 4N6PA 3DPLC 3ABUA 3PUWE 5I2KA 3KOSA 3FVOA 2FQ3A 4LATA 4KFCA 4F3SA 5DCMA 4XKPA 1FW0A 3TCFA 5E8GA 3OSRA 4ESBA 2PMUA 3ZMZA 1LQ1A 2PX1A 2JPCA 4XKNA 3TCHA 1FBQA 3TDZC 1VSOA 1MQDA 1B9JA 3OSQA 5KCJB 1P92A 2B3BA 2F5FA 5CMCA 1Z9CA 1P1WA 2M8EA 1S7OA 4WCGA 1B1XA 3MP8A 1FQAA 1SYHA 3I54A 1ZYRF 5CVRA 3RQTA 4NTLA 1S7YA 1YO5C 1MRPA 1ZG1A 2RC4A 3TEPA 3KFWX 2M30A 2OLBA 4IXAA 4RGSA 3QU3A 3SQNA 4EQBA 5TU0A 3W6KB 3P9IA 4UV8A 3HSTA 5I56A 3P7NA 1N76A 4UVCA 3FXQA 4QFLA 1EH7A 2K4JA 4EM1A 3PMWA 4X48A 1II5A 5DEXB 4X1BA 3UA8A 2DQVA 2OU2A 3E6CC 3L09A 3F8CA 4PQJA 1WI9A 1R22A 1WKMA 4ZDMA 4LB5A 3MP6A 2F97A 4XSZF 1S8NA 5TPAA 1LDDA 3Q25A 4MQVA 4LMYA 5AA2D 1LVAA 1Y3NA 3U8QA 2F36A 2LKPA 1I27A 1PBQA 3KZGA 3HRMA 4BHBA 4KPTA 3PU5A 4GXOA 4QWQA 1IF1A 2X4HA 4EMSA 1PUEE 3O9PA 1Z05A 1J5YA 2OZUA 1AWCA 4BDNA 1ZGAA 3CLOA 4YB7A 2LDUA 3HV1A 5LGTA 2RGVA 3LSFB 4KMUX 4HLXA 5I59B 4M72A 1M5BA 2YLNA 1B3GA 5JTYB 1D8JA 1PB9A 3C33A 3EHSA 1PEBA 2DQLA 5KDTA 4U4SA 1T2KA 1IQ7A 1XD7A 4CGZA 3FGSA 4U7BA 2DYXA 1LFHA 1OMIA 2V9VA 2ZNUA 4NEDA 4G8NA 3KP6A 5ISUA 4BDRA 3SXYA 4EQ7A 3MQ9A 1BIBA 3LR1A 2HZKA 3K1NA 5CMMA 1KQ9A 2F7AA 3RTWB 3RPQA 3RT8A 3K6VA 3CUOA 2I3WA 5AA2B 1H9GA 3VVDA 4YMAA 3E4RA 4ZH4F 3IOTA 5CM6A 3GW2A 1U5TB 1I6XA 3QU6A 4MH5A 4XKRA 2K7LA 3TELA 1HKQA 3THIA 2G9WA 3C7JA 3MBPA 5I56B 5CRYA 2RCBA 4OU0A 3ZN1A 3Q26A 2XASA 3E5UA 1NH8A 1UTBA 4LQ2A 1SMTA 3T9VA 1BTJA 3EPEA 3C9HA 2HEOA 5HOOA 3K1PA 2ZNTA 5DVIA 4E0WA 3MVZA 2JSCA 4G8XA 2VOZA 4JSDA 3UP9A 1EH8A 4UVBA 2OCUA 2QQAA 3C4MA 5BUUA 3M3KA 1B40A 3S4UA 1USYH 1MQGA 3VEPA 1O3QA 5K2XA 1JQFA 1J75A 3BZ6A 3WU0A 1DUXC 2VE8A 1GHCA 2F7BA 5DTBA 1JVYA 1MS7A 3PMVA 2MH9A 2UYEA 1MJAA 1P99A 4ZEBA 4ZYEA 1O3RA 4YB6A 5L9SA 2ABHA 3LQRA 5HS7A 1YYVA 1TQMA 3ILUB 3KP5A 4EM2A 2XKOA 1R6ZA 4BXUA 2XXUA 3RKXA 1SYIA 4ECFA 2PT1A 3FHZA 1LJ9A 4XXUA 2IA0A 4LJZF 3HRTA 2IW5A 3HPIA 4QF9A 2CO5A 3B73A 2Z22A 2H5YA 5H8HA 4NMYA 1YQAA 3H7MA 3K1MA 3LFKA 1DPRA 1DDNA 4O5VA 1HKTA 1MQJA 5E18F 1POTA 2HAUA 2VBWA 4JK1X 3ZMUA 3EF7A 1BBYA 3EYYA 1YTVA 4U7DA 2Z99A 3QIMA 2QLZA 3OV8A 3IWZA 3R6UA 2DK5A 3FXRA 1US5A 2NYXA 5IKBA 4EQ9A 4GD5A 1F1ZA 2FU4A 2QJEA 1G3TA 1EV7A 4KCDA 5TPAB 4M74A 4HTGA 5DYMA 2DVCA 3MW0A 4XBFA 1I6BA 2UWMA 1MM6A 1GV8A 1USYE 2DE4A 2RINA 3DQVC 4P11A 2F8DA 3U1DA 2M1BA 4BAYA 1XOCA 2O8XA 1AL3A 5DEXA 2V84A 5DUKA 4Q0CA 1LEAA 3VLUA 3N4MA 1KA8A 1SW5A 2YX7A 2DK8A 2X0LA 3I64A 3IC7A 4A0ZA 3QAXA 5DEQA 3VVEA 4KYDA 1MXXA 3KETA 2NXOA 1JE8A 2OD5A 4F19A 3IKVA 2EFNA 5LGUA 1B3LA 2RC9A 4R75A 4UV9A 2KIUA 3OXNA 1BC8C 2YU3A 2F7CA 2OK2A 2XUBA 1MPDA 4IRGA 1YFHA 5BQTA 4IRHA 1Z6TA 1LAGE 5HDKA 3HHFA 1PBPA 3SETA 5ED4A 2V3UA 3ILTB 4ZZLA 2I48A 4YU0A 3ZMVA 5I58A 1RI7A 3GLXA 3MWBA 3T9UA 2GXBA 3CUQA 1LB9A 2VC0A 1OLAA 2HQNA 2D3IA 2HZLA 2WKYA 2Z8EA 3IX1A 1DPUA 2FA5A 4I1DA 4IY6A 4P0GA 3B02A 4A2UA 3K9TA 1L0OC 5D4SA 2DQRA 3MP1A 3D0SA 4TV7A 4IO3A 4KFQA 2L01A 4OFJA 3LUYA 1W4MA 3QUJA
chains in the Genus database with same CATH superfamily
4A0XA 2UVIA 1T56A 3HO7A 2CMOA 3RYDA 4PGHA 4NF4B 3I6VA 1OYYA 4N6KA 5FKKA 3I55I 4JX4A 3M1EA 2VT2A 4G8HA 4X9TA 4J01A 3RT6B 3WAEA 4C0RA 3KSJA 4LK1F 1JUSA 3FX3A 3LAPA 2PJRA 1LNWA 1H45A 3VLVA 2R7XA 2LLKA 2V1NA 1EZPA 5LHGA 1OISA 2V9PA 4ELOA 5FBPA 3TQLA 3KP3A 3BOQA 1B4AA 3JYRA 3MAMA 1QUKA 4JP0A 3EQLF 5J4VA 1I6HJ 3MUQA 3WTYC 5DUIA 5E79C 4IR8A 5B70A 3DV8A 1IW7F 4HA8A 1FBUA 1VQOI 4RAFA 3OEKA 4CH7A 2XRLA 2YSRA 5ET7A 1U3EM 3HG9A 3JZJA 3S9MC 4ENMA 3AKZA 3RJPA 4HV6A 2F6PA 2R0QC 1AOYA 5KCMA 1U2WA 4NC6A 5ITOA 1X3WB 2K3FA 1GVDA 3O6BB 1Y0NA 2OBPA 5CQEA 4QFOA 2NS7A 4Q4ZF 1A54A 3BCAA 1OMPA 2O6AA 4LD5A 3BIGA 2Z8DA 2LP0A 4PDKA 3OY9A 2F34A 3GBAA 2WAEA 4OQOA 1FPEA 1IMFA 3IJXB 5H8NA 1NV5A 2A5TB 3K01A 1HSLA 5KZTA 3V7SA 2EB7A 2DW4A 1YXIA 2KJCA 4I62A 4U1OA 4R79A 2DFIA 3ZN0A 2GWRA 1NUYA 3LSHA 1IZ1A 2MC3A 2XB0X 3FDYA 3M9AA 2VASA 1XSXA 3ERMA 3VOEA 1FSHA 1FTZA 1FPDA 3BFUA 2O9LA 1ZJLA 3ONMA 4IEJA 2K02A 1T0FC 2YX4A 2VHAA 2GOMA 1IN5A 2EBIA 2PBWA 4R9GA 1XTAA 2DFHA 5FLXK 2DSFA 3N6TA 3L00A 1SDXA 1KQ8A 4IJAA 2A61A 2Y7WA 4N17A 5A5XA 4NF8A 4A12A 1RESA 2HPGA 4IQJA 1UTHB 2Y5KA 4PGPA 2P4WA 4ZTFA 4L17A 2LSOA 2O1MA 1Y1ZA 2JA8J 3E78A 3UIFA 3G7WA 1EYIA 2F5CA 1HW2A 2G7UA 2WBDA 3A01A 3L1PA 1CGPA 3A3CA 4NB5A 3RDIA 1P2FA 3KN7A 4CSWA 4KDPA 2DTRA 4AIDA 4O8MA 1TBXA 4XLCA 1NKXA 2R93J 2HYGD 4I76A 3FK7A 3FJ7A 3HOVJ 4R6HA 2L02A 1DP7P 4GIZA 5H8HB 4ELQA 5CJ9A 1VNDA 2DDAA 2Z16A 2JN6A 5BPIA 3CG3A 2A07F 2HDDA 1ZTYA 4AD9A 1ZRCA 1UCRA 1H43A 1SD3A 3CO7C 1VR5A 1JW5A 4MGRA 4H8IA 3LMMA 4MLVA 3WU1B 2JA7J 1SQYA 4BDOA 4CICA 1MMDA 1KYZA 2Z1DA 5KNLA 1YX5A 4L9TA 4F92B 5ICCA 3LSXA 1X1AA 4EDPA 1R71A 1B9MA 1Q1KA 1P9QC 3CTAA 3M1CA 2R7FA 2XXRA 2JUCA 1WSUA 3CRBA 5ICFA 4NF5A 4OEUA 1NNFA 1LBZA 2QENA 1A35A 5EEAA 1S5LC 3MAJA 4CCOA 2CJJA 4I8CA 5I2KB 1YTYA 3GUDA 2KL4A 1ZAOA 2CQXA 1G59A 1WWXA 1BR4A 3ZMDA 3A03A 2BXYA 2X1CA 3ABTA 2Z3YA 4RLQA 4CYCB 3OYFA 1HCRA 1T33A 2OWSA 1IIWA 4OETA 2QVUA 2RVCA 2KKOA 3K6GA 2VUMJ 3TMGA 1ETVA 2VD2A 1NV0A 4BJTA 1FTMA 2ZMBA 1Y6IA 2ZZWA 3SDGA 3F8MA 4PZJA 1Y3PA 1V54H 3JTGA 4LN5A 5CMBA 4A3EJ 1QQIA 4G7OF 2EH3A 2ZKZA 3P5JA 4XIGQ 4HYEA 4DYQA 5B5EC 3CFLA 2L7FP 1Z7UA 4UUTA 2V6CA 4CO8A 1B5HA 2VT5A 4GXSB 2Y84A 3PPPA 4OMZA 5BMZA 2DMUA 3FM3A 4KMFA 4H5GA 3F11A 2M0CA 4XRFA 2TRTA 4NF6A 4BQNA 3ZQIA 1B4ZA 1RKMA 1MPBA 3TEDA 3OELA 5LRSA 3RGYA 1Q1VA 4CYCA 1IMEA 2ZSIB 1QVSA 4RYAA 3GTLJ 1N84A 1YW9A 4EQQA 3GTMJ 4YICA 3ZGKA 3EUHC 3PD9A 4ZECA 1MDMA 5HLTA 3HJEA 1FOYA 4NF5B 4RGUA 5CC2A 1U6GA 3NARA 4PCDA 3Q0VA 2KZGA 3DBLB 3E7LA 3LSTA 1IJWC 1B8IB 3H4ZA 1WJEA 4XKWA 2EV6A 3I53A 4XOTA 1U78A 4LZ5A 3D5LA 5LGNA 2AQEA 2LOOA 1BR1A 4U0VA 4MFIA 5J1UA 4G6DA 4NDLA 5AA1A 1T98A 1D3KA 3EUHA 4LG0B 2M8CA 3HEFA 1DP3A 2KIMA 2RREA 4CHUA 3C36A 1TP4A 2F4OB 1FTKA 4NQWA 3S2HJ 5EEGA 2DFEA 3WHCA 2V1UA 2ID3A 4O6JA 2X6WA 1IUDA 3LSIA 3RQ4A 3TODA 3HZJA 1RKWA 5JHFA 1EZOA 4BQQA 1BI1A 2I3VA 1JKPC 5F27A 2QFLA 4I9DA 1U5TC 1SFUA 1XS5A 3MZYA 5E17F 3V8JA 4MNCA 1GLNA 4U21A 2BXZA 2WY8Q 4H0EA 1VQ5I 2HGCA 3MCZA 2R5YB 3JSPA 2P1SA 2XX8A 2QWWA 4YAHX 5ET5A 1D0ZA 1JHFA 1D8KA 3K4CA 2XGDA 4XTCQ 5D5XB 5A5XB 1R1UA 1MDP1 2EZLA 2W1OA 3W6VA 3NQOA 3BP8A 1I1GA 4DIGA 2X7PA 3IFCA 3W9VA 2LREA 3OYBA 1QA6A 1JUPA 2HZTA 5I84A 3WTZA 2HTSA 3W6JB 1WPKA 5FRNA 3ZP5A 2UVHA 2Y7KA 4X1DA 2OTLI 3QAHA 3VSKA 2W82A 4U1ZA 1RNLA 3IH4A 3TCGA 1IRGA 1MXUA 1OYIA 1LDKB 3IFAA 4N9HA 3N26A 1EH3A 4U22A 3N5LA 4BBRJ 4IHTA 5F24A 5FKLA 4XRSG 2ZO4A 3L7WA 3FJMA 2GQQA 2LNBA 1MJ9A 5TRDA 3DP8A 4EJUA 1ZH5A 1Z3XA 3J7ZI 4PAFA 4RAZA 1IMAA 3JRHA 2JRTA 3TKDA 1LCTA 1TWGJ 1PJRA 1SW4A 4M3DA 2KT0A 1K78A 4FASD 1PB8A 2LH9A 1FOXA 1B3EA 3FKJA 4IHWA 1IG7A 2A05A 1D3YA 2I4CA 3CDLA 4YEJA 3ZPLA 1MJBA 3DXJF 4M3EA 2H1KA 3TTKA 1VQ7I 3MPLA 3A2KA 3KJ7A 3PD8A 3K4NA 4ASNA 1ZU0A 4KYWA 4N4NB 1ULYA 3H3GA 4C1TA 2WWYA 1R5ID 4NWCA 3H3ZA 3T0YA 3TFLA 1MGTA 1IMDA 3HYIA 1ZGWA 1G0IA 3GBBA 1U8BA 1F36A 3SEYA 1IXSB 2P0WA 3BQYA 1IUFA 4HOBA 3U1KA 1O7TA 5F04A 3RKYA 5ICTA 5ERIA 4HF1A 1F4KA 4UVAA 1QULA 5LD2C 4G7ZF 2XPUA 1HSJA 3U2RA 3SEQA 4A3IJ 4FX4A 1SI1A 4HNTA 2UZKA 2QKMB 2CEYA 4WXHA 2Y9ZA 4KJZA 4MEXF 3J81Z 4BEHB 4HLYA 3LSMA 3OOUA 3GYHX 4KNYA 2ZXWH 2ZYNA 4G68B 5AE4A 1U5TA 2CFOA 3QYEA 3JW4A 1R1TA 2IJLA 3S1QJ 2Z23A 1UHSA 4M6XA 3ELKA 1NUXA 3H9GA 1QPMA 2MGQA 1X1BA 2G0EA 2O7OA 4WK8F 2HXRA 1B6HA 3RYRA 4B3AA 3LV0A 1N0TA 5FTHA 2KRFA 1R58A 2ACJA 1ZKGA 1NNTA 2E1CA 4PFOA 3PGFA 3B50A 4MHGA 4UY8I 4PBHA 2AQFA 2VC1A 4GL0A 2ZJPF 1LFGA 3T93B 3WHBA 2X1EA 4ZYDA 1CF7B 1NMUA 4Q48A 4AYBN 3WTVC 1BLFA 2DN0A 5AIQA 3IAZA 4YB5A 4CZZA 4IOAF 1FOKA 2GIZA 2ZXHA 2D5WA 3H6TA 1ITYA 1XC5A 4UB8C 1LSTA 2ZC2A 4DBQA 3MVXA 5AA3A 2LVSA 1ZMGA 1J09A 5LOMA 4POXA 4XFEA 4TLLB 5BPDA 1ON1A 4LUBA 1HSTA 3BKIB 3GMEA 3PSFA 4IO7A 4G61A 4MIMA 4HX7A 3SDBA 1H44A 4DXBA 3J80Z 2HOAA 1K4SA 1G0HA 3QOPA 1D1CA 1NV6A 4N81A 3MZ9A 1URSA 1HOMA 2DDBA 5IYCJ 3WTSC 2FMLA 1RUNA 4M4GA 1IV6A 2OJTA 5AONA 3KJTA 1FEXA 2YPNA 2ECBA 2OQRA 3K6UA 4IGTA 4GWOA 1NI9A 4IZZA 1B8IA 1GV2A 4M3BA 1O3SA 2M0MA 3BJ6A 3HKZN 2B3FA 5C4XJ 4ZDLA 2ELJA 2MABA 2QPQA 4QTRA 3S3OA 2QQBA 2I49A 2VP1A 3C2BA 5D5VB 2JUGA 4CCKA 1T0FA 3G3HA 4FATA 3O28A 3EYIA 1P1QA 4MNIA 1FJ6A 2LY9A 1YX3A 4RK9A 4F2QA 2Z33A 2Y9YA 1BA5A 1FBGA 1T39A 1Y1MA 3SEWA 1WDNA 1BN5A 3DTIA 3GXAA 2HOEA 5IGAA 3VYRB 3NWSA 4DYRA 1VQ9I 5GADJ 3P9CA 3GWZA 1Y8QB 2ELKA 2ZXJA 4U23A 4EXKA 2FBPA 4AIKA 4V2GA 1A99A 4OVTA 2FBKA 3QK6A 4I7HA 1WJBA 3TQNA 4FJPA 5ET8A 1OPCA 3GTJJ 2ISZA 4IHSA 3LWFA 1B51A 3FBPA 2QEXI 2PVUA 5J8CA 2DT5A 3RTFB 2X26A 3AXFA 2RDPA 5D8LB 3A0BC 3I59A 5GAHJ 1LFIA 3O66A 5J47A 1ETWA 3PUYE 3CUQC 3VYUB 1FC3A 3CCRI 5HBCA 2CUZA 4PK4A 4RPOA 1W36D 2QSFX 5E1ZB 3U93A 1PYVA 4KN4X 4P9FA 1K78B 3FZVA 3QP6A 1R4MB 1SI0A 2XXYA 3BTLA 4IO9F 3SERA 2HYFA 2Q2CA 2CUJA 2NVQJ 3HN0A 1OCZH 4EM0B 1B1HA 4BHCA 1V4RA 4KUMA 4A93J 2Q1ZB 1K79A 4FBPA 3U72A 1ZBMA 1J59A 4R73A 3IRRA 4HEA2 3CJQB 5E3NA 3AAFA 2RKMA 1FTOA 5E1WA 5HNFA 4OMYA 3H0DA 1JEUA 5H8SA 5FKMA 3F23A 4HAMA 4FEDA 4BY1J 4DI4B 3I56I 4FE8A 1MXZA 4Y52J 4EGZA 1TW3A 1DGRM 2E2HJ 1DPEA 4JX5A 3WU2C 1TC3C 2E34A 1LAXA 4KIFA 1ZGJA 4BUPA 1YHQI 4WKMA 5H8QA 3J80K 1JI8A 2LF8A 3K0VA 2M9HA 3PL8A 2IGKA 3MKYB 4R6KA 2I10A 2E2JJ 4XLNF 1O3TA 2LF7A 4CCNA 3FXJA 3VPRA 1FP1D 1USSA 3ZRGA 4GX6A 2I6EA 3L6GA 4AYBA 1VQNI 1DTGA 1QW0A 4FETA 3S8PA 3AL0C 1B7UA 2CUFA 2O69A 3CI8A 4MIJA 1RDZA 3ZKKA 1O7LA 1EU8A 3FV1A 1VQ8I 4KXPA 1YYZA 1RR8C 4PC9A 2R7WA 3GZ5A 5CI5A 1NG7A 1SVLA 5DVJA 2PI0A 1TZLA 2CGPA 5JFRA 4EJTA 2XROA 2BW3B 3K2AA 2QS4A 5EYRA 5EJCA 2DMTA 2FOWA 3C3WA 3RIRA 3OS1A 3KYDB 3VSLA 5J6XA 1K6OA 1Q1HA 2XV4S 4ANJA 1W7PB 3VYSB 2PFYA 2W57A 1ZRFA 1B1BA 2VT3A 3PO2J 1LB8A 3BJAA 3K69A 3ZQLA 2IA4A 1R9LA 3SJMA 4W97A 1UTHA 2VKHA 4O3MA 1OCCH 1FTTA 3GZGA 4CYDA 2IVMA 3ISPA 4XF5A 2ZYKA 2LC2A 1MMAA 1FMVA 4FISA 3OD7A 2DYSH 1LVKA 3RYPA 5FO5A 4LONB 4DCYA 2HKXA 1ZHFA 3GO5A 3ZXSA 3CCEI 1FQDA 1JW1A 2XAHA 2BVMA 3MVPA 4BLAA 2GIVA 1XVXA 1UJ8A 3HM5A 1XVYA 3PNYA 4KIBA 1HLVA 4IO4A 5EYFA 1EH6A 2IA1A 1XCVA 4CUGA 2V3QA 3TDJA 3F6OA 3PQKA 3DEUA 5GPCA 3OYCA 4UABA 3T9XB 1NV1A 3TAJA 4HCYA 4F22A 2K9QA 2A6TA 2A69F 3HSEA 1RIOH 2QSGX 2GZWA 5K2YA 3P7IA 3OYNA 5L9MA 4RB2C 3LC8A 3RI4A 4RAGA 2KLFA 4HV5A 4F31B 5D5UB 3E5QA 2KIFA 5H8NB 3L9FA 4MLQA 2EWNA 2CV2A 2PLYA 1N7WA 1UFMA 4HNUA 2HHMA 5EG0B 3MEXA 1I69A 4F1YA 2XAJA 5AA2A 3PM1A 2QA4I 4DE8A 4F18A 2O51A 5LEKA 1S3JA 3DKWA 4PTKA 3J81K 3USDA 5KHDA 1OR7A 4G68A 5L3DA 1Y1WJ 1LB2A 4BEHA 1ZR4A 4C3IJ 2K4BA 3ZMTA 3OOAA 3BDDA 4HE2A 3DTEA 2M3AA 3DP7A 2XF5A 3U9GA 1MMGA 4Y17A 3MPKA 2HEUA 2X48A 3MN2A 3G73A 3IUOA 1B32A 3ROUA 4O3BA 4OMBA 3SZPA 3T1BA 2DBBA 3MSTA 4OYVA 3J7AO 1R1VA 1M5EA 2M87A 4YKKA 5JTYA 1PC3A 1M1EB 4J00A 3GCMA 2Y0MA 1SD6A 3OO9A 2DA5A 3B6AA 3IB2A 2UVGA 3QSLA 1G2HA 1G3YA 2DOJA 4OHNA 2Q2AA 1MM7A 3IAS2 3SZTA 1QUJA 2QRYA 4HF0A 1TNSA 3OO7A 3RCOA 3TPAA 4BS9A 2QSXA 3CHGA 3JR9A 4I0AA 1IUYA 2XD3A 4G77A 1FYLA 1QGXA 1GR2A 3OR2C 1TTYA 3PNTA 3KEQA 2NVUB 1TNTA 1M5FA 4P96A 4LLNA 1FQCA 4NQ8A 4EJOA 1A8EA 1B6AA 3B6CA 2B63J 2ELHA 1ETXA 3BG5A 4M6VA 4ZYHA 3IR1A 3QYTA 2JA2A 5E3OA 5IP6A 4PFWA 3JRDA 1WJFA 2GH9A 4V2FA 1B46A 3GBGA 3QRFF 2D45A 3S15J 5J3LA 5HDGA 5FFXA 4D0PA 3RPLA 4P9UA 3AG2H 2P8TA 4QXDA 2CV1A 1XMKA 2K40A 1KGSA 1WQ2A 2PBIA 5FD5A 3LFUA 1YJNI 1JVXA 2ZMEC 1ZLJA 4YZZA 4DDDA 2EFPA 2W84A 2VONA 3K0LA 1FPIA 1KZ8A 3I4NJ 5I58B 5CBSA 1Z0XA 4NF0A 3R61A 1XHYA 1DTZA 4NAPA 5CYVA 3DTKA 3OIPA 4NBQA 4XONA 5I59A 2DWAA 4F3GA 2Q74A 3BR6A 5HM4B 4A3FJ 1WH5A 5C4JJ 2DVZA 3WTWC 2GFEA 3H36A 5M5WJ 4GWUA 2ZJQF 4LA9A 4YMBA 3H3VK 4XLEA 1A04A 3VFJA 2XGXA 5B1BH 4DQ2A 3E13X 2Y69H 2V6EA 5B3SH 3HOTA 4KICA 4MTDA 2CSOA 2O03A 1XT8A 4WXDA 4RB3C 4JWYA 3J7AY 4GVOA 3CD6I 3S17J 3FISA 1E2XA 5DD4A 1OVBA 4OVSA 4ZS9A 1KU3A 3SEZA 2RNJA 5HDNA 1SFEA 3CCJI 4D7MA 4A6EA 1VQKI 2VPRA 5HLHA 3REOA 4ZEKA 3EKIA 5EQAA 2C6YA 1U9OA 4CZCA 5L9OA 3M3YJ 3G3IA 2OCCH 5TJJA 1Y9UA 2ZXIA 1R6RA 4WXCA 2OA4A 5ICGA 2HQAA 3M3LA 1F5TA 1UHWA 3MJNA 1QBJA 4PP0A 3ONQA 5EQ8A 4F7ZA 4A3BJ 4FCYA 2DFFA 2VGQA 5F6FA 2WAQA 4OIPF 2LTPA 2HKOA 3H92A 4PAIA 4QHQA 1VFCA 1Z7NE 1FQBA 4PFYA 3MKLA 3DWLE 1MNEA 4OTEA 4DNCA 5FLVA 3PSIA 4XKBA 1TWCJ 1YG2A 4PJNA 1KU7A 2DJNA 2QGUA 3TO7A 5FB2A 1GUUA 1IEJA 5E20A 2VD3A 3BJOA 3C18A 3VYTB 3GX4X 3FHNA 2R5YA 4F29A 4CCLA 5L3BA 3M8EA 3WG7H 1I6QA 1P7JA 4QLCU 5EGOA 3VB2A 1UB9A 1IGNA 3U92A 2JRMA 1MXVA 4XICA 1LBVA 1S9TA 4RAYA 2JJKA 2R71A 2O1LA 4G7HF 3FASA 3QUFA 2XSJC 2L4AA 5IOZA 1NUZA 1O7FA 2EK5A 3IRQA 3U1OA 5BWJA 4PJLA 3PFIA 3G4SI 4ESXA 4HDVA 1FOWA 5FLMJ 1ORKA 1D0YA 4LQ5A 4UUVA 2O3FA 2REGA 2L54A 3KZIC 3LSRA 3DFGA 3GFIA 3JSOA 2XHKA 2KIQA 4PF6A 1Z3YA 3DP6A 1HKSA 5LTCA 3I4PA 2MH2A 3EETA 5DS9A 3G6EI 1LAFE 4PFUA 4EF1A 2LY1A 2K9NA 2H98A 4PE5B 3F8NA 4R8HA 4XMYA 1AH5A 5T3JA 3LSGA 4LZ8A 2ZCWA 1URDA 4BE0A 2XAGA 3EDPA 3JAMZ 3HPHA 3N05A 1R5HA 2EFQA 2WB1A 3F8FA 4G6TB 1A6QA 3EN3A 3O29A 2FBIA 1I1SA 2H99A 4I40A 4HDUA 3HL2A 5IAIA 2H1LA 1U0JA 1D5YA 2Y7IA 4YIRX 1SMYF 2HNHA 2KZVA 2DE3A 2PCRA 3K4BA 3BPXA 2XDVA 4NF6B 3VDFA 1POY1 3ZQQA 4PE3A 1QZYA 2FRHA 4C2MJ 2B9SA 3RQIA 3HTSB 3CCUI 5H6RA 2HXWA 2XX9A 3UORA 1BW6A 1T38A 3K6WA 2Q8KA 1N7XA 3QPTA 2E1OA 3IHUA 3FXMA 1SD5A 5D8KB 3R0JA 3OYDA 1RDXA 2WYPA 2WBBA 3A3UA 2E36A 3Q27A 4RJZA 4UUSB 5DT6A 4KN7X 2P2AA 2Y48A 2XWOA 4IOCF 4U87A 2DXRA 4AB5A 2OWTA 3KYLA 5I2NA 4JB7A 4V19K 1A6IA 3R0AA 1S7EA 5M3MJ 4IY5A 2HVQA 4KI0E 3HOWJ 4PBQA 3OYHA 1QPIA 4IO5A 2QMXA 3LA2A 2I0BA 3F9KA 3PV0E 1T8IA 5ILVA 1A55A 3RUMA 1GV5A 5JK4A 1FNNA 3HSRA 5HVQC 4GWSA 4IRIA 1R36A 1TFAA 3L2CA 2AYSA 4UNOA 1QVUA 2JA6J 3I5OA 4BDZA 4Z6YA 1I39A 5FLXZ 4UB6C 4B1RA 2ETHA 4LOCA 3ODBA 1IRFA 3RKWA 4RXLA 2ZNZA 3QOEA 2XXKA 2A5YB 1RYXA 2V93A 3G3ZA 2STTA 1I5ZA 3Q3SA 2VJJA 4IHVA 2IGMA 2ZJ2A 4A6DA 1H3DA 1H88C 1UHMA 4GLIA 2X1DA 4KIGA 2RQPA 1PUFA 1MPCA 3FVGA 1ANFA 3PUZE 2L5QA 3K70C 3MZBA 3IB1A 5J1DA 1YOVB 2I8DA 4UHTA 1KONA 4A69C 2QF7A 4XLFA 1XSDA 2VXDA 2XXTA 1ONVA 2CFXA 3CMAI 4CA0A 3UK4A 1JKOC 4NWDA 4FHTA 4L5IA 2IEEA 3FJGA 2JZYA 2FNCA 3TQWA 2EFOA 4B48A 1DMBA 1Q35A 4R9FA 3G3KA 5ELVA 1O57A 2CQNA 1IXRC 5EDNA 4HSTA 1FBEA 1JTYA 4BJ5C 1UAAA 4G2ZA 3GLBA 2R5ZA 3QMFA 4HX4A 3NRVA 1XS9A 1FQEA 2MKZA 4MHFA 3U94A 4OIRF 3E79A 5B1AH 4N4UA 1IXHA 1E3OC 3KE2A 3FXOA 5D6EA 4ON0A 4PFRA 1N3WA 1ZTRA 4YKPA 2W25A 1EZ9A 3G3FA 2MFZA 2R7DA 4MTEA 2QS3A 4AVZA 4NF8B 2H8WA 2PX9A 3H35A 4IL6C 1BI0A 1J2XA 2E2IJ 4BDLA 5K7HA 3VXBA 2VLAA 2H9BA 4AVPA 2RF1A 3KLNA 3KP4A 4BXXJ 5H8FA 4OFOA 3SDFA 3FMQA 5CPRB 2VBYA 5J8FA 1U8RA 4H8JA 4FEBA 1V3FA 1W0TA 3B6QA 3EQ1A 2CZLA 1GXPA 4XEQA 3E3VA 1Y8RB 1LUJB 2Z9OA 2PYYA 3BBRA 4E70A 4OA4A 4F91B 5ILUA 4HS7A 1CF7A 3IOUA 2H4IA 1SC7A 1ZELA 1M5CA 3SKPA 1ON2A 2DA7A 1G4DA 1JT6A 1Z91A 1NV2A 4OESA 1XGMA 3ZSFA 2XPWA 3K4MA 3ROJA 1UZCA 2KDZA 1B5IA 3BQZA 1FBCA 3LBSA 5GAEJ 5JLWA 3N6UA 5A2QK 1MQIA 2HQ0A 4H67A 1TT5B 2IT0A 2EFWA 1HC8A 1VF9A 1AMFA 4PAKA 1P7IA 5HS9A 4HX8A 2I4BA 2J5PA 1FJLA 2ZFWA 4C30A 2XAQA 1NH7A 5FJ8J 1JKRC 2P0SA 2A6EF 2PQ8A 5H20A 1YLFA 2G93A 4GO1A 5IM2A 3UR3C 3RPUA 4U88A 3KX2A 1OQHA 4GQOA 1MDMB 3S2WA 2VOOA 2XHDA 3SYTA 1JKQC 3HOYJ 2CRGA 1FZPB 3TKYA 4E7SA 1FYKA 2R7SA 3DLAA 3GFJA 4B44A 3F8BA 1B72A 2M5WA 2QQ9A 4MFEA 4PFPA 1K83J 2GXGA 2MC4A 3HSFA 4N0BA 3D4CA 3FV2A 2WTEA 2N8GA 4XQFA 1ZQ3P 1JW4A 3ZKLA 3KCCA 1IN4A 2KDOA 3H0GJ 2XXHA 2BGCA 3N94A 5I5PA 4XKQA 2DP8A 3BG9A 2GQ1A 3DEEA 2THIA 2PMZA 1TT1A 4LP2B 2HR3A 4L18B 2LYCA 1KU9A 4N91A 3TOAA 3KZZA 4LLLA 4QRZA 4ZTJA 5ITPA 2BV6A 1UIVA 2NS0A 5HPQA 2BY1A 2Y75A 1WJDA 3LAJA 2KLOA 2B4LA 4E0XA 1P6RA 2NAZA 2GRVA 2DTZA 2P6TA 3CLQA 2GOXB 4QSCA 3V8XB 5CQGA 1WJAA 4NGUA 3H6WA 1QHGA 2M45A 2R7QA 4MEYF 2AO9A 4P1LA 2BEOA 2IPQX 4XR6A 3S3MA 2DAOA 1SW1A 2JJ7A 4LGWA 1SD4A 3ERED 2PG4A 5KK1A 1D9VA 2DDKA 4MAGA 4M3FA 3PNVA 5M5YJ 4IVNA 1SFXA 1HW1A 4GFBA 1LGBC 4BDYA 3KC1A 3K7AJ 4XK4A 3FVKA 1BOBA 3HPGA 2CUEA 1FBPA 3U65A 3RZDJ 1B3FA 3O6HA 3HRUA 2ANJA 1KZHA 4B8XA 4OVQA 1ETKA 4UXNA 4M1VA 2Z5UA 2E7XA 3KN3A 3I5UA 2IRFG 3ZCOA 1QVTA 3IK6B 4RK2A 2JQ7A 3A0HC 3TW7A 3TP3A 2R7RA 2XA5A 5IP9J 4DCXA 1TQPA 3KEOA 2CH0A 2QVVA 4P3LA 2M7AA 2I58A 1N25A 2F48A 3SEUA 1V5FA 3DF8A 3F6VA 5LFAA 4N8GA 5I3SA 2OZ6A 3D1NI 4ELPA 1D4NA 2H25A 4RMNA 1E3PA 2L7KA 1T6SA 2P3NA 2O7IA 3HFUA 2JK3A 3JRFA 1Z6RA 2IGNA 1XGNA 5L3FA 4YRVA 1FX7A 2DI3A 1LBWA 3CR9A 1SFKA 3NOHA 4HW0A 4EF2A 3ASNH 4FE4A 5KAFC 2VODA 5K5QA 2PT2A 4G8MA 3COAC 4QFNA 3CSGA 2MA3A 3HGYA 1OYWA 1JHHA 2F5DA 1ACIA 4B4CA 1RETA 3MQ0A 4QSDA 3VFZA 1MH3A 5LRRA 1LBBA 1AU7A 3KG2A 5EHSA 3K00A 4A3JJ 1Y20A 2I0CA 2DOEA 3F72A 3LL7A 1VTNC 1H9TA 4WEDA 3IO4A 4MMPA 3WE2A 1NV7A 5EQ7A 5ICEA 4LZ7A 5EHMA 3KGCA 3BR2A 1IC8A 2HCAA 4EXLA 3BR3A 4B47A 3PFYA 1BL0A 1A31A 2KR0A 1CQTA 3V8KA 4L0YB 3E1SA 3K4LA 5DM7F 4OINF 3LSKA 3SFZA 4WWCA 1Y0UA 3DBRB 2MYSA 2EIKH 2CZKA 2DLLA 3GXOA 1FLIA 5FTIA 1BJZA 2LKXA 4OVPA 2MLGA 1DBZA 3L2UA 4CXFA 3CJNA 3DCFA 4NHJA 5C3EJ 3TTLA 1GT0C 1PP7U 1WODA 5CMKA 3B6TA 1X3ZB 3KFMA 1YE9A 2HFBA 3S9EA 1TLHB 4PCQA 4D1QA 5GPAA 1LFPA 3E5XA 1NNPA 1FBDA 3EUAA 5FGMA 4OXVA 4QFKA 1DOTA 2A5SA 2XGCA 5L3GA 3O6GA 2LAOA 2OBGA 3BTCA 2L9VA 4QBAA 2B7EA 2DA1A 1X1CA 3OL3A 4QIWN 5IZZA 2STWA 1H0MA 1B0HA 4BQAA 1XC1A 4XN0A 2EPFA 3RY3A 4BHPA 3R4KA 3JRBA 3BIHA 3H6UA 2ZYMA 2Q88A 4N4OB 1N04A 4BXFA 4H6DA 3E3KA 4N8YA 3HHHA 4BU2A 5LHHA 1K7AA 2E0SA 2ZMEB 3OWTA 2XD2A 3A09A 4HZFA 1G3SA 2VN2A 1FTLA 1US4A 3SESA 3FATA 1S72I 1YCJA 1H8AC 1RUOA 1G3WA 3K4JA 3KOTA 3PTYA 1VQMI 2IGOA 1X2NA 4KT5C 1ZREA 1UTBB 4ONYA 2RN7A 1WRJA 1ZG3A 1DGWY 3QPLA 2K9MA 3H03A 3FVNA 3G3GA 2EA2A 2F5XA 1F43A 1URGA 3K4UA 4DGWB 4WX9A 4G94A 4HPQA 2DA6A 4BH9A 5DD8A 2AS5F 4PDHA 1W0UA 2FEZA 3QWLA 3OMBA 1X4OA 1OVTA 2R9JA 5I57A 1STZA 5JLXA 4X0GA 2ZNSA 1UMQA 3CC7I 1K6YA 3V42A 1EKEA 3W2WA 1GVCA 4GGGA 4OOIA 1PP8F 1MMSA 1SW2A 4C3JJ 3VVFA 1J0RA 3BFTA 3NEUA 2HU9A 3S9NC 4G4PA 4I09A 4E7IA 4F52A 1MY3A 4GX4A 4HE1A 1JJ8C 4RY1A 4YFNF 1BJAA 2LK2A 1EYKA 1H76A 4P55A 4GBVA 4RPNA 4TLMB 2Y7PA 3T8RA 2HOSA 1HDDC 2CW7A 2OWZA 4PFIA 5IP7J 4TOZA 3CSBA 2PEXA 4OWRB 4THIA 3M8UA 4HCWA 3O8HA 3FIRA 3L6HA 3FMSA 1FBSA 4H65A 4MF3A 2KPMA 2A3SA 2OCEA 5BS6A 3A01B 1B72B 3S2DJ 4EJVA 2FOKA 2ZYOA 2D1VA 4MBPA 5HLGA 3MWMA 3JV9A 2V1DA 2AL4A 1TXFA 2HDCA 1JNFA 5FKNA 5E8IA 3TGNA 3BG7A 5FRMA 3M4OJ 1YPNA 2QVRA 4XLHA 4BKXA 3FXBA 4HBLA 4PFTA 3V4GA 4O94A 4GF8A 5LLQA 4NUBA 4ENJA 1R9TJ 3CC2I 1VZ0A 1OQYA 3DBHB 5EZHA 5E3MA 2W48A 5IZ3A 2K86A 2X9DA 4II2A 2MBFA 3FXLA 4PGGA 4H1XA 3K2ZA 3K2DA 4GOTA 4NG7A 3O3KA 1VQ4I 4M6YA 4KYEA 2RV8A 3O6IA 3A1YA 2DWHA 1ETOA 2HI3A 5ILSA 2Y0SA 1F9NA 1FP2A 3G1MA 5IYDJ 2DJIA 4AIHA 2L7MP 1NK3P 1L5TA 2DXIA 1J7KA 1S7AA 4M9XA 1X2MA 4ETSA 4DLDA 4M9ZA 5KDTB 5K5OA 5TP9A 1B05A 1XGSA 1NNKA 3OYAA 3SEVA 5F0HA 1R9QA 1GXQA 1B4HA 4A3KJ 1LEVA 2L4MA 2H09A 2DPDA 1MKMA 3TO9A 2O0YA 4YFXF 5KVRA 2VB6A 4IO2A 2BJJX 4HRIA 3TL4X 4XN3A 2TCTA 4L9VA 1QGPA 4L0ZB 2YR2A 2R7VA 1Q9DA 5F7VA 2NVXJ 1DSNA 4MO7A 2UUZA 1LLSA 4BNCA 3TZAA 2BZTA 1Z67A 5KAIC 2A68F 4H4KC 5C44J 4JQFA 3JRGA 2V3TA 3G3JA 3DU6A 4O7IA 4MQ9F 2CW0F 4OFLA 3MMYB 5LHIA 4ZEDA 1VE4A 2E7WA 2WADA 1ZG5A 3R6SA 1V55H 3BWGA 3SHFA 4HQEA 2NOOA 4AQ4A 3H5RA 5J1YA 2O6GE 3V83A 4I98B 4KQPA 4KHZE 1IN7A 3BG3A 2VQLA 1MH4A 4IF4A 4MLOA 5AA4A 2FJ1A 3IO6A 3T22A 1YAEA 3SEXA 4D7NA 4R1HA 2RC7A 4M3GA 2IS4A 2HYJA 4PSXA 4RNSA 2UV1A 5CKTA 2V4CA 2F4IA 1FTJA 1PB7A 5H8QB 3GEZA 5L3CA 4KA4A 2NXNB 1A36A 2IA2A 1WZ2A 1INPA 3DLNA 4GRKA 4I3EA 4HNVA 4ESWA 3JTHA 2RKHA 4U0YA 1J9IA 1QHHD 3VODA 5F64A 3PMXA 2JT1A 2Q89A 4I6ZA 3VWBA 3TTMA 2PMSA 3F22A 1XPXA 2GLOA 1QJMA 2IS6A 3IOVA 2VPOA 2VOPA 2E71A 2GA1A 2ESNA 3WODF 5JVGF 1JGSA 3CIJA 3PIPF 1FJ9A 1M5DA 1W7PD 4PETA 1B59A 3F0CA 1S50A 1XGOA 4AIJA 2CEXA 4HW8A 1OCOH 1LKXA 1FWZA 1Z77A 2DMQA 1HBXG 1B3HA 2QSHX 4XIDA 1C0WA 5A5LA 1B5JA 4F39A 4R2BA 4ZJZA 4C1UA 1IRZA 2OV7A 3SZGA 1EJ9A 4AB6A 2X6OA 2XRNA 3H1CA 4EV0A 3MVWA 4L9NA 1LFUP 1IAWA 4UUSA 2BE5F 2E1MC 4W1UA 3ABKH 4ZZAA 3E9XA 1SPIA 3B6WA 1FPKA 4GRIA 3D5RC 3DKXA 3QQAA 1B52A 3C34A 4YIFA 1TFDA 1CB6A 2P5VA 1FMWA 3CDIA 4B09A 2F6GA 3W15C 4E7KA 4A3MJ 1WVRA 1YRNB 3CVGA 1YS7A 2VIXA 2VJ4A 1R23A 2FXAA 2W7YA 2FQ4A 2PMHA 4C9YA 5D4RA 3TYHA 4FT8A 5CBRA 5D5WB 2QBYB 4S05A 3S1NJ 1FPQA 4MCOA 2KP6A 4DIQA 5FD6A 1QO0D 3CMEI 3EHUA 4ZE8A 3V7CA 5A2QZ 2R92J 2ZSHB 4P9KA 2JPBA 2Z2SB 2R6GE 1YW7A 4KT6A 3FBNB 2DT6A 4JVDA 1WHUA 4G9YA 2EQRA 4RM2A 5JI6A 2B65A 3GTGJ 3C32A 1Y1VJ 3HHGA 3WGHA 4GXAA 4I0BA 3R60A 1ATGA 4BACA 1B7ZA 1GVJA 4NE4A 1B2HA 2D21A 3ZQCA 4BDMA 3WTXC 3V8LA 3GFLA 3OIQA 4DJAA 3OYIA 1MSEC 2Y5LA 2UXXA 2XPVA 3S1MJ 4F1UA 2FYIA 2VI6A 3TO6A 2QYOA 3HGGA 3VV5A 3UN6A 1T08B 2WC2A 5IPAA 2FD5A 2X6XA 5I7IA 1LAHE 1MW7A 4M9SA 2FA7A 1W5TA 4XNFA 2XIGA 1W7PA 2FMYA 3I58A 3QODA 4ZYAA 3OEMA 3L2WA 3WTTC 2QCOA 5DVFA 3TBIA 3M8JA 5EGOB 2H6BA 3H6VA 1UG2A 4NC8A 1NHAA 3CO6C 2W00A 3E6BA 5M3FJ 3IL2A 2HQRA 4EJWA 1BC7C 3H3UA 2NRAC 4I2OA 2GAUA 3Q29A 1YW8A 5H8FB 3KPHA 1YIOA 1SANA 1TW2A 4OWDA 1R1NA 4YKJA 2W7NA 4BE2A 3CCVI 2UYFA 3CMYA 1MZBA 1O64A 4KR5A 4H5FA 2VJ5A 3T5XA 4PSWA 2B0LA 2P7CB 1FBHA 3JREA 3F21A 1SD7A 3HRSA 3I4MJ 3EUKL 2ADUA 3IH2A 3R7XA 2GHBA 1IMCA 2AXLA 3E97A 1ZIUA 2E35A 4YELA 3GTPJ 3Q28A 1AA7A 3CQZJ 4RS8A 3MZHA 1G6NA 1NTCA 5J4YA 2BY3A 2MW8A 2KJBA 1OR7C 4G68C 1KA1A 2CMPA 1MBEA 3C31A 3FXUA 4DXUA 4Z2YA 2KMUA 3ZQGA 1X4PA 2COBA 4ZYGA 2ISYA 4HSRA 3WGGA 5HS8A 2VKDA 3PPQA 5DDGA 4GFRA 2DS9A 4ND9A 4FE7A 4N15A 1QRYA 4OIOF 4L5EA 2DWJA 4Q8RA 3E6MA 1IXGA 3PPOA 4NHBA 2FVZA 2HTJA 2E1NA 2LG4A 2ESHA 5GAGJ 1Y3QA 4U2RA 5F0CA 2JTVA 4BYYA 1POGA 2G29A 2X85A 5E1XA 3MFKA 3IORA 5L3EA 1D5VA 2QS1A 3MZ1A 2PN6A 4DBRA 3PUXE 1MBFA 3K6XA 4XKVA 1FYMA 4F3QA 1ZLQA 5FHNA 3DELB 3BPVA 1BOAA 2M4GA 3IH3A 2Q0OA 1FQFA 5DYHA 2KHMA 1GTKA 2P5KA 2XSDC 1KWHA 1OIBA 2MD0A 1BIAA 4M71A 5F1QA 2P3VA 4A5NA 2NUVA 4QSEA 2EA4A 4A5MA 1IO2A 1UIUA 3RPLB 2E1SA 4OEVA 4P47A 5L8DA 1AOVA 2KFDA 1Z7ME 5IT9K 2ONKE 5BOXA 2E60A 1J1NA 3CP2A 5AIPA 3BT9A 1RZ4A 1TWYA 4D5FA 1MG1A 1K61A 4GYGA 2PFZA 3BROA 2LRDA 5K1YA 4DYCA 3OYJA 4R74A 2MSYA 3KBRA 4WF2A 2BBYA 4XL9A 3FK6A 2G7HA 4YKIA 1MD0A 1X3UA 2ZXTA 1MY0A 2A5TA 4P56A 4A0YA 5LBQA 1YJWI 4OERA 3PJRA 1HDPA 1VQLI 4OANA 3Q0UA 5JVTA 3OR1C 5EYHA 5I57B 4QFPA 1XCBA 2V9KA 3PUFA 2AHQA 5DCMB 2CQKA 1GGGA 1ZK8A 2FNAA 3X2QH 3IKTA 2WB1N 3L2VA 4ENKA 1BP5A 5ET6A 1Y4CA 2O8KA 3UGWA 3Q0WA 1Z1DA 1A40A 2GM4A 1X1PA 1Y4TA 2HAVA 4GX3A 4H0WA 3V89B 2XAFA 2QVOA 2BJIA 2NWJA 4ITVA 5TGTA 1MQHA 1ZRDA 3ZMSA 4R72A 1MBHA 2HDWA 4KISA 1N75A 3WG9A 2JWTA 1FT9A 1JUMA 1IDYA 4I01A 1MY1A 1OQGA 4JVCA 1B0LA 3T9HB 4IHYA 2HPMA 2QS2A 1QZZA 4Y4RA 4JWOA 5FHOA 4QPOA 2CQQA 3ECRA 1XMXA 3EPZA 4HQMA 2D1HA 3ECOA 1XDUA 1QZEA 3F3XA 1SVMA 4BDQA 4IX7A 4Z7EA 2P6SA 5EEHA 3BZCA 1OKRA 4E4HA 1U9NA 4XLPF 2AL5A 3CFZA 4I02A 3LQQA 2MD5A 2YUSA 4NN3A 3CCYA 5F1JA 2CG4A 2RQQA 2IP2A 2ZFUA 2DODA 3EHTA 2AXTC 4OAYA 3ULQB 4HXVA 3L2QA 3GVAA 2H27A 4F3PA 3DEWA 3HUGA 1S6LA 3HCQA 1D9YA 4Y3OA 2WYKA 4CCJA 1XB4A 3BY6A 2FF4A 4DI3D 3CCQI 4L5JA 2ME0A 1OCTC 2EINH 4IGRA 2K5CA 2LR8A 3S3NA 2UXAA 5TISC 2K9LA 3CDHA 4KCCA 3VE1B 2XXXA 1R5GA 3JRAA 2F35A 1USTA 1HXDA 2OTJI 2DYRH 4DZ1A 2F5EA 5EQ9A 1L3LA 3BZKA 2W24A 4ZZEA 3LSPA 4F3BA 1BI3A 4PDDA 4IPAA 5LDZA 4KD5A 3OYMA 1SFOJ 3PPNA 3HOSA 5IZ1A 2LBFA 1KA0A 2XF7A 3BG6A 3OOPA 1R7JA 1NUWA 1ELJA 3I0TA 1LFBA 4POWA 3M07A 4Y15A 4ZEFA 2PFBA 4LK0F 3KEIA 5JEIA 4OENA 4U0WA 1FCKA 3IL1B 1B58A 2MLKA 3C1DA 2ONRA 4ZDPA 2FX0A 2Q8MA 3I3LA 4BQOA 4EGYA 4UACA 1A5JA 1VQPI 2HZDA 2VBZA 3ML6A 4RGRA 4L9JA 4MJOA 2ME6A 2HWVA 4BJ6C 1P1OA 4N13A 1Z21A 1JEVA 2FUG2 4IB2A 1ODDA 1IN8A 3ECHA 3FD3A 4AWXB 3S14J 2F3DA 1FBFA 2L3DA 4WEPA 5B7DA 1MXWA 2QL3A 3GF2A 2XX7A 5KCJA 2DMPA 3OO8A 3V7RA 4EVIA 5BNGA 1RPWA 3JCUC 1MBJA 2IS1A 2GHAA 2NS8A 1WVJA 2CV0A 1QNTA 3DPUA 2LD5A 3RLFE 4AUXA 1B7HA 1PDAA 2FSWA 3AL0B 2RC8A 2CWEA 5JR3A 1I6AA 1LBYA 3OYGA 1IMBA 3B8BA 2BOLA 2PJPA 4ELRA 4LVQA 2DPUA 2A6HF 3GZ6A 1SBPA 3JRIA 3MVYA 4EEFG 5GTHC 3RNNA 1P4WA 5HODA 1LCFA 3H5AA 2VE9A 4A3GJ 1BM9A 3E6DA 3S2VA 3K02A 1HQCA 1TQIA 3W3CA 5F1RA 3LOCA 1K9ZA 1W36C 3QXMA 3DU5A 2OPTA 1XMAA 2IBDA 1MIJA 2Y2ZA 2ZBKA 4LLGF 1FPBA 2MG4A 2ZNYA 2H94A 1LEBA 2O7UA 3RTRA 4FQGA 2RCAA 3O8GA 3CFXA 2BVLA 2OQGA 3OMYA 3A4CA 5HLIA 1WCMJ 3W9WA 1KQ0A 4PFBA 3ZR8X 1OLCA 2XXVA 3LNQA 1VQ6I 5DCFA 4DXCA 1JTXA 3AG3H 4XRSA 1NV4A 1ZKBA 1RR7A 3IOWA 2M2EA 2QZ8A 4OZ9A 4ZEIA 3QPHA 4FTHA 3BTJA 4P5OA 2LBFB 4D5CA 2WX9A 2F78A 3KSXA 2CQ7A 3LA7A 3RPWA 1FPJA 2VPNA 3MKZA 2IS2A 4EUOA 2E5ZA 1IXCA 5K7FA 3ASOH 1DPPA 3CCLI 1NFTA 5EF6A 4FECA 2Q2EB 2VQGA 3H9JA 3HTUA 3IAM2 5TP9B 5IT9Z 3NWTA 4P1EA 2W85A 2Z8FA 2YPRA 2Y30A 2X7QA 1LDJA 4Z0IA 4X1EA 3TP0A 1LBCA 4R2FA 3D4GA 2XVCA 2XAUA 2NNYA 4QSHA 3P9KA 2V7FA 3DLLF 5DTDA 1X19A 3GTOJ 4ZZDA 4HF2A 3IV5A 1R49A 4ENNA 2QBYA 4LB6B 1MSFC 3RSNA 4S04A 1WJCA 3T96B 3TTRA 3RN8A 3CJRB 4JVIA 2NVYJ 3ESWB 2A5WA 1YRNA 1ZN2A 1IDZA 2V25A 3TDUC 3RPUD 3R26A 3W2VA 4Y33A 3KBZA 1AWBA 3JAMK 4GL8A 3FWEA 1MY4A 1PVEA 2EV0A 1MNDA 2QUFA 2FE3A 2KQRA 3CG1A 3PUVE 1O63A 1ETQA 4FIMA 4WXJA 1KU2A 2Q9TA 3OO6A 2EV5A 1Z7LA 5CVJA 3M8FA 1BIYA 2QKLB 4JBZA 3VLWA 3FKIJ 1TWAJ 3C2HA 1SVOA 4D9JA 1VFEA 4B43A 5K7ZA 4O3CA 4X8RA 3TOBA 4OVJA 4ZE9A 2EIJH 4MX6A 2VKVA 5FHMA 2VBXA 3H5NA 4PUSA 1PDNC 3FBIB 2GA2A 3VXCA 1W5SA 2JSPA 9ANTA 1IITA 1EYJA 3B7DA 1NK2P 5CVVA 4ISUA 3OENA 4Q47A 1YS6A 4M73A 4JWXA 2OZZA 2YJPA 3QPSA 2AIXA 1KYWA 4ESFA 1QKAA 1P1UA 5FFZA 1XN7A 1N78A 3S1RJ 2VL8A 1LPQA 2ICWG 1ZLKA 3IJOB 5M2VA 4F2OA 2NNNA 2K9SA 3HBLA 1IRXA 2E19A 3TUSA 1P4AA 4GWZA 5CLSA 2O84X 4IO6A 4N07A 4XLAA 2OF7A 2TDXA 1HW5A 3Q5FA 2R4GA 2EZKA 2FNPA 5H6QA 4G6QA 1B9NA 1XDSA 2WAFA 3W2AA 2EILH 1SAXA 4JDFA 4KYSA 3I71A 1D1AA 3A02A 3KP7A 3FF5A 4GCVA 1A7LA 1SVXB 1WGXA 4JSOA 1W5CC 4P0IA 3FMRA 2D5VA 2DXYA 2R7OA 5F0FA 3KP2A 3S32A 2F5VA 3KLOA 4LIUA 1VFDA 1QUIA 3I3VA 5AA4B 3MZ8A 4I99C 3CCMI 3KN8A 5CVUA 2DO7A 4GWWA 4F93B 3ZQ7A 4BE1A 2RNGA 2O68A 2DCEA 3O2PE 2EJRA 6PAXA 5EZGA 3LSWA 2ID6A 1P4XA 3C35A 3DPTA 1OCPA 5GP9A 1R4NB 3ZQFA 3RKQA 2P5LC 3CUQB 5IYBJ 1JGGA 1BKAA 2ZMEA 5B66C 1PUFB 4F1VA 3J7YJ 3IWFA 5M5XJ 2ECCA 2K85A 4RGXA 1IN6A 2ZB9A 5J1RA 4Y13A 1T0KA 4Q30B 5IY5H 3H9QA 4PJMA 2ONSA 1MY2A 3TTNA 2DMNA 2FBHA 5ICQA 4LFUA 3WGIA 1MDQA 2DA4A 5CVIA 1BK4A 2O61A 3M7GA 1S9HA 1FSEA 1BI2A 4JBAA 2V79A 4YFKF 1UQWA 3T66A 1YZ0A 1MBGA 2VJIA 2XXPA 3H06B 2OAZA 2NOGA 3BR5A 2QM3A 2QMWA 4XM3A 4FX0A 3T0JA 2CW8A 2H6CA 3VDXA 5K5RA 1HSEA 3O2AA 4JXIA 2Q8JA 1T95A 3ZS6A 3FM5A 4JOMA 4RB1A 2XXQA 3S9LC 2XWKA 2GBYA 2COMA 2VQHA 3HIFA 2R5ZB 4Q5TA 3I59B 3Q9SA 4O3AA 4AC0A 1F9BA 2XXIA 2Y7RA