3HHNB

Crystal structure of class i ligase ribozyme self-ligation product, in complex with u1a rbd
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
b'RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Crystal structure of the catalytic core of an RNA-polymerase ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
total genus 22
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hhnB00
1WF2A 3G8SA 4PKDB 5IM0A 4W92B 2CQCA 2M9KA 4Y0FA 2CQBA 1U1KA 2ZJQQ 3HHNB 2MZSA 1H2UX 3THTA 1FJ7A 3VAKA 1WG5A 2CJKA 5IQQA 2KXHA 2XB2D 1UW4A 3EX7B 2DNLA 3RW6A 2FY1A 2QFJA 1HA1A 3EGZA 1WEXA 3VF0B 1FT8A 1DBDA 2CQGA 2KU7A 1M90T 2MKCA 1WF1A 4WFAQ 2AYBA 1RK8A 3LQVA 3ZZZA 1SJ4P 1F9FA 2N82B 3MI7X 2FHOB 3S8SA 3R1HA 1X4BA 2MHNA 4F25A 2DHGA 3MOJB 2CQHA 4PRFA 1W2BR 3MDFA 1X5PA 2DNYA 2CPHA 2KYXA 2YWKA 1G2EA 2OSQA 2AYMA 3RW7A 3UE2A 1N54B 2U2FA 5GADU 5LSOA 2RU3A 4V19X 4PR6A 2F9DA 4Y00A 2N3OA 2RUGA 4ZKAA 2JVOA 2L08A 3NS5A 2HYIB 2J0SD 2XSFA 3CMES 3H2UB 1UAWA 1WG4A 2YTCA 2VOPA 4TLQA 1YJWS 2MGZB 1U1PA 1P27B 2DH8A 2B0GA 1FNXH 2DHXA 1YIJS 1A7GE 1VC5A 5LSLA 3S7RA 2X1GA 1WF0A 2CPIA 4J5OA 2LYVA 3TO8A 3TP2A 3CCJS 2EVZA 2UP1A 2KHCA 4ERDA 1A9NB 2RNEA 2LECA 1DRZA 1R8HA 2JX2A 2K3KA 1VQ8S 2MPUA 3D2WA 1K8AT 5H1SV 2CPYA 3SMZA 5DDPC 2VODA 3L3CA 2HGLA 2CPJA 1SJQA 1JMTA 5IFMA 1SJ3P 2CPZA 2CQ1A 1U1LA 3G96A 2YKAA 1Q86T 3UD3P 4TU8A 2M0GB 3MUMP 3CCVS 5CYJA 3MXHP 1Q82T 2M7SA 5CA5A 4BS2A 1R8PA 1JJHA 1P1TA 3BEGB 2E5GA 1ZZFA 3J7YU 1YITS 3UCZP 2DNPA 4EGLA 2MKJA 1KOOA 1VQLS 2CPFA 3CCRS 3MURP 2DGQA 5DETA 2DNQA 2M52A 2DHAA 1X0FA 1D8ZA 2DNKA 1VQMS 2MQMA 3OW2R 3K0JA 4TU9A 3CULA 2DGTA 3PIPQ 4LJMA 1RKJA 3NNCA 3CCLS 1FJEB 1KQSR 2DH9A 1WWHA 2DGSA 2CQ3A 2MKSA 1VC6A 3DLLQ 2KRRA 2M4MA 2MKKA 1WELA 2E5IA 5GVQA 1U1RA 1U1NA 3SDEB 2J0QD 5HL7Q 1NU4A 2L41A 2DNGA 3U1MA 5FJ4A 5LXRA 2MGZA 2MZRA 3VAIA 2DGOA 1VQ7S 1M5PC 3G6ES 1SJFA 1H2TZ 3CPWR 2ZJPQ 2XS7A 3BO4A 1WHWA 2Q79A 3MUVP 1PO6A 2OIHA 1HL6A 2MZQA 2DIVA 2DNMA 3VAMA 2RQCA 2DK2A 1D9AA 1WHVA 3IWNC 1KD1T 2AYGA 2LXIA 5GAGU 2MXYA 1U1OA 1WEYA 2HGNA 1X4EA 3CTRA 2YH1A 4IOAQ 1FO1A 2CPEA 3N9UC 2FC9A 1M1KT 2JWNA 4FXVA 1Q7YT 1N52B 2NZ4A 2J76E 1BY9A 2X1FA 3CCQS 1AUDA 1B7FA 2XNQA 2DH7A 1OPIA 5DDQC 2M2BA 2RT3A 4RU2A 2PE8A 2ERRA 1O0PA 3HI9A 1U6FA 5DM6Q 2N3LA 2M70A 1YI2S 3G9CA 1FJCA 2CPXA 3P49B 2XS5A 1FXLA 4CQ1A 2QA4S 5JVGQ 1VQ6S 2DB1A 5D78A 2M88A 4Z2XA 2KVIA 2CQPA 2D3OR 2DGXA 2MYFA 5GAHU 2KM8C 2D9OA 2V94A 1M5KC 4F26A 1X5SA 5LXYA 1WI8A 2LA6A 3VALA 2HVZA 4ED5A 2DNZA 2OTLS 2GHPA 2SXLA 2KG0A 2MZTA 2G4BA 5D77A 3CCSS 2LKZA 3CD6S 1UP1A 3SDEA 3J7ZT 2BOPA 3UWTA 5CXTA 2KRBA 1X5TA 5DM7Q 2M8DB 3S6EA 2DGVA 3NS6A 3B4DA 2MZJA 4QQBA 3I55S 4YOEA 2MJUA 5GMKa 2I2YA 2LMIA 2LEBA 2CPDA 2J8AA 3Q2SC 1VC0A 2DNOA 3U1LA 2MB0B 3EGNA 3ULHA 1YJNS 2DGWA 4IUFA 1QVFR 4IOCQ 1M5VC 1VBYA 5EN1A 2N7CA 2KT5A 1WG1A 2MSTA 2OSRA 2LEAA 5ITHA 2U1AA 2EK1A 2OJ3A 1CVJA 4U67Q 4OZ1A 2MZ1A 4YUDA 1H2VZ 1H6KX 2MMYA 2CQ0A 1JJ2R 2RVJA 1K9MT 1U6BA 4CH1A 3CF5Q 2BZ2A 2KFYA 2KG1A 1HD1A 2HGMA 2MJNA 3CCMS 4LIRA 1HD0A 4OZ0A 4YB1P 1VQ9S 4WF9Q 1KOHA 1X4FA 4FXWA 1X4DA 2WBRA 3CC4S 3LPYA 1OIAA 2ZJRQ 1QM9A 3BO2A 3MUTP 3VAGA 2M8HA 1NJIT 3NNHA 1NO8A 5DDRC 1S79A 2LCWA 3G71S 1M5OC 2E44A 3UCUP 2RRAA 5DDOC 2KXNB 1VQ4S 2XS2A 2VONA 1VQPS 4F02A 3CC7S 1YHQS 3VAHA 1QVGR 3VAJA 4M5DB 4CIOA 2D9PA 2E5JA 4WFNQ 4WCEQ 1SXLA 1U2FA 3FEYB 3CC2S 1VQKS 2LA4A 2MKHA 2MKIA 4LMZA 2RRBA 3G8TA 3G4SS 2MY8A 2DGUA 2JVRA 3JB9k 2DISA 2O3DA 2AYEA 4CH0S 3BO3A 1N8RT 3TYTA 4QPTA 3NNAA 2E5HA 3NMRA 1UFWA 2CQ4A 5IM0B 2CQIA 2L9WA 3UD4P 2MQPA 1X4HA 2YH0A 5MLCV 2EK6A 2XNRA 3H2VE 1KC8T 2LQ5A 2MQLA 2FPHX 1K73T 2X1BA 1VBXA 3CUNA 1N88A 2NLWA 1IQTA 3I56S 2DHSA 1WHYA 2X1AA 1ZZNA 1U1MA 2DNNA 2F9JA 2ADBA 1YWXA 2CQ2A 1XN9A 4C7QA 2DITA 1SJRA 5LJ3Y 1X4CA 2DO0A 3US5A 1Q81T 2KM8B 4UQTA 5GAEU 5JVHQ 3DXBA 4W90B 2PEHA 4TU7A 4C4WA 3P5TL 2MQOA 2QEXS 2I38A 2G1DA 3V4MA 2OTJS 3THPA 2DO4A 3S01A 1URNA 2MQQA 2DNHA 3P3DA 1OO0B 3VAFA 3FEXB 3Q2TC 4P6QA 1VQOS 3B4MA 1L3KA 2HZCA 2DIUA 2KI2A 2RQ4A 5HO4A 2GO9A 4A8XA 4QU6A 2G0CA 4C0OC 2MSSA 3CXCR 2AD9A 4WFBQ 5LJ5Y 3IRWP 2LXUA 2FC8A 4WKRA 4IO9Q 2RS8A 2CQDA 3MD1A 3CCES 3SXLA 3CCUS 1FHTA 1X5OA 2F3JA 1S72S 2MQNA 1PGZA 1DHMA 2DNRA 2A3JA 4WIIA 1WHXA 2KH9A 5BJRA 1JJ4A 1DZ5A 4UY8T 3R27A 2KN4A 1WEZA 4QU7A 1VBZA 2KXFA 1X4GA 2ADCA 3CMAS 1WTBA 3UCGA 3MD3A 2MY7A 1YJ9S 1YTYA 2RS2A 3P6YC 1VQ5S 3PIOQ 1VQNS 1ZH5A 2VOOA 1U1QA 2K8GA 1WI6A 1OWXA 1X4AA 3R1LA 3BS9A 3ZZYA 2JRSA
chains in the Genus database with same CATH superfamily
1YRUA 3NP5A 2P6SA 4LFAJ 5KFXA 3VHQA 3UNGC 3EPIA 1NK4A 3AA9A 3GWCA 3EX7B 5B0FA 1CS4A 3LOUA 2OI2A 2P9EA 2YNFB 1IBMJ 3K89A 3M7VA 1RTDA 1F9FA 4O3PA 1OJ4A 3MHYA 4CNZA 3M32A 4YMEA 2GGPA 2V8PA 1N56A 5JMNA 3TUJC 3GE9A 3KMSA 2UUTA 1TK8A 1RT7B 4NLDA 3HULA 3OUYA 3R9LA 5FLXU 2H51B 1SPBP 1U24A 4C11A 4ZKAA 3ETMA 4ICLA 4Y28C 3G6XA 2DH8A 5HVGA 3LAKA 4ZMMA 3TX8A 4EYHB 4NXMJ 1RE1B 1KQKA 4ZPDA 3BBCA 5LOQA 3TAPA 2ZD1B 1WTFA 4FYDA 2LXFA 4D3GA 5F8IA 3N01A 2CPJA 2E7WA 6FD1A 4N5SA 1VISA 2BKNA 1SJ3P 1RBLA 5KFBA 1EB0A 1UJ6A 2CJQA 1GX5A 4P10A 4AD6A 4P52A 3BYPA 1IWGA 4DV5F 2CJ9A 4OV1A 5DZ7A 3KOAA 2WB4A 3TZXA 2J9DA 2WBMA 5KTQA 3KJVA 3K5MA 1NHUA 2F8MA 1VR6A 1EARA 3CJ8A 4KV8B 4LJMA 4ZPTR 2DGSA 2CQ3A 2HBRB 2KRRA 4OI1A 1LWFA 1WJ9A 3HFVA 3R5CA 4H4KA 3CJ3A 1X31C 1RACB 2FJVA 5SUHA 2ACYA 2V68A 2QC3A 4DL3A 1DFDA 1RT4A 3KG1A 3X3UA 3JYTA 4CM2A 1LWXA 2XS7A 5M2PA 4BLGA 3MMCA 1GXTA 1YK9A 1HL6A 4IR1A 3VAMA 2AYGA 4WPAA 2QV6A 4CWBA 3CTRA 5KT7A 2ZOMA 2ZH5A 4X4NA 2DR5A 3DOMA 5A8RA 1DAXA 2AJ2A 3TA1A 2VPXB 5T7LB 3CCTA 3KLFA 2ROGA 1FVSA 2CQPA 2OPSB 4H4OA 3HX9A 1GFWB 1NZ8A 2DCUB 5HROA 5I3UA 3C16A 5L1LA 3DKDA 2XG8A 5KFFA 3CCSS 1S10A 2BOPA 4MK7A 3CD7A 3HD2A 3SCIE 2J7UA 2B43A 2AF6A 3N4WA 3MR2A 3KK1B 2DVIA 2HIYA 2MJUA 1KVKA 3I0RA 3H90A 2FVCA 2MB0B 2W4CA 1T0TV 5HLFB 3TANA 3H5SA 5LSRA 3NL0A 3D54A 1ZPVA 1UPMB 2VG7A 2KG1A 3SFGA 2YNGA 3W2WA 2IAJB 1AFIA 1RXOB 1IXKA 4AXJA 1S1TB 4WK3A 2DEIA 3KLGB 1RTZA 4NLSA 2YKQA 4DR3J 3ELHA 3MR7A 2FJXA 4P2MA 3DM2A 4ED3A 4YY3F 4DI6A 3W64A 1HNZJ 3DN9A 3ITHB 2XS2A 2GQCA 5GAGI 3KLEA 4B3TJ 2J0WA 3LP2B 1XR5A 4JV1A 1QTMA 4OMFG 3Q8UA 2MKIA 3G82A 4IG0B 1LWEB 3FMBA 4NA3A 1Q1KA 4ID8A 4UOGA 4HHHA 2L9WA 1QAYA 4KSEB 3H2VE 1LOUA 1R8BA 1UFLA 3I56S 7FD1A 1NKEA 4I56A 2JDJA 4LSLB 5J2MB 1JLFB 3TA2A 3US5A 4F50A 4RW8B 2OTJS 3THPA 3FEXB 3FC9A 2R7RA 1KNZA 4O0NA 2PA8D 5KOWA 2MHEA 4NYPA 2HFUA 2CFXA 2GVZB 4WFBQ 1RZMA 4P2XA 3T41A 5HBMA 4QWAA 3A3PB 3V6JA 5BJRA 1FEHA 2A6OA 2GC8A 3IAS9 4USKA 3WIVA 1OWXA 2B9YA 3P4UB 2JRSA 4I7FB 2CQCA 4J9OA 2QN6B 1U1KA 2BANA 3LP1B 1YRTA 2EFNA 5IQQA 2ROEA 2J6UA 2RKIA 4LSNA 1W26A 1UW4A 2DNLA 3V6DB 3PJWA 3RW6A 5IT9Y 2FY1A 4WU2A 1UWAA 3TOQA 3HPOA 3QAUA 2PMZD 5I42B 2KFZA 2V50A 4GKJF 3R1HA 5J2QA 5E2QA 4MK9A 2YWKA 1M1GA 1NCLA 3AOCA 2HS0A 3H25A 1S6QA 5KFPA 2RUGA 1XMOF 1UAWA 4FNIA 4RW4A 1N32F 2OD4A 4LFBF 5HP1A 1X60A 1U1PA 1RHJB 3POTB 1JX4A 4FN5A 4DR4J 3MECB 3PW5A 3MMBA 2LECA 1JLEB 5H1SV 4DV1J 3SMZA 4XTTA 1Q8IA 3GTYX 4R0EA 2JZ5A 3KMQA 3J7AN 2VPWB 1RBOB 1RA7A 3MM7A 4CNYA 2W7AA 3M9NB 1GMWD 4OI0A 3HSJA 4KHRA 2BJ8A 2XMTA 4FYWB 2DR9A 1JLBA 2W25A 2DNKA 4KPYA 5FIIA 5D3GB 3JSBA 4ECYA 2K06A 4Q44A 3LWMA 1JNRB 3DLGA 2J0QD 5A2QU 2OEJA 1F2GA 2DNGA 3C15A 2OPPB 5LXRA 4LT6A 1G3OA 3MEGA 3NGKA 2F4VF 3T6BA 2UVWA 2DGOA 3CPWR 1Q5VA 5EGYA 3CCWA 1T8EA 2QIFA 2RILA 1QUPA 2ZOFA 1IR2A 3IO1A 3W62A 4KFBB 1U1OA 2AZ3A 2YH1A 2WTFA 1S1UB 2GV1A 3L7UA 3PR5B 3KLIA 1SIWB 1NJWA 2VICA 1JWWA 4OHYA 1S48A 1XR6A 5HMZA 1OY9A 1OPIA 2XY7A 1SQFA 4WP8A 4ZJOA 1S1XA 5M2UA 5BYRA 2VDIA 1FXLA 3M9MB 1UTAA 1UJ4A 2M88A 4NLUA 4KAIA 1VDHA 2V94A 3LAMA 1OY6A 4X66F 1FDDA 3MM6A 2DNZA 3QWUA 3A12A 3Q89A 2HZAA 3CD6S 1N33J 2WVFA 1SH3A 5CXTA 1X5TA 3EM1A 3G2XA 2QSWA 8ATCB 2QMWA 3FDSA 1RWNB 1T3OA 4EZ6A 1RTIB 4OZ2A 4DFKA 2FUG9 1VC0A 4LF9F 4DV5J 1FE0A 1GNKA 3GG1A 4TQSA 3UQSA 2F40A 2ZH3A 1WKKA 4DR6F 4UW2A 4GVBA 4Y6IA 4E98A 3CF5Q 5IV3A 3P5BP 3CCMS 2XMUA 2EPIA 3UVJB 4MT1A 1FX2A 3BGFA 5IOLA 3IWXA 2XYHB 5AJ3F 3UCUP 3TAMB 1LNQA 3KG4A 3HVTB 4F02A 3FRYA 1CJKA 2PT0A 4WFNQ 4DR1J 4Q7AA 2JVRA 3JB9k 3PX6A 2DISA 3DI6B 1VFJA 1NHKL 1KFDA 3M6XA 3BQ1A 4H54A 3EUNA 3IC1A 3KDNA 2ASDA 4YHHF 2ZH9A 1GK8A 1U2CA 4TU7A 2DO4A 4J9UE 5FDLA 4O4GB 1ZPWX 1BMQB 2VPYB 3BH7B 4NRTA 2FJAB 3DMJA 4LF6J 2RDJA 1GAOA 1UWBB 1VOMA 5LJ5Y 1RWXB 4WJBA 4WKRA 3CCUS 4KIAA 2DNRA 3UR0A 1WHXA 5A0YA 2IYGA 4QU7A 3KK3B 2M5YA 2KXFA 1RAJA 4L3NA 2ZITA 2D74B 4TNOA 1N4LA 2R7WA 2ZDOA 1RT5B 4I2PA 1ZH5A 1DLOB 5G0RB 2ZZMA 3UR3C 2A2DA 3BF4A 4W92B 4JI2J 2AV5A 2Y1JA 1FKOA 4JI4F 1WG5A 4OHZA 1XNQJ 4LF7J 1ZAWA 2YBVA 4W98A 1S12A 4OHWA 1K1QA 2IMWP 4YY3J 3GFXA 1TUVA 3H59A 3ZZZA 2OPQB 3BV8A 3S8SA 3ENVA 3R6LB 4YQWA 3TRGA 4C9DA 4PPDA 4DCOB 2E9TA 4K59A 2D3UA 4ZP6A 4LF1A 4FBTA 5LMUJ 2F9DA 2C2MB 4ZPCA 1K1SA 1M0SA 2HHHF 1UJ5A 2JVOA 2RF2B 2FVSA 3EE3A 2G9OA 1C0TA 2VOPA 1Y00A 1FK9A 1ZAXA 5HJYA 1Q78A 1CQMA 4IRKA 1AUSL 5CABA 3RRHA 1UVMA 2K3KA 2VJUA 3I82A 2XY5A 2VODA 2HK2A 1T11A 4KR0B 4KGKA 1U1LA 2QFIA 2ZE2B 1OPZA 2DR7A 4DPUA 3O5TB 1JJHA 4AT1B 3J7YU 2FYXA 2XMWA 2WSFC 1IKWA 1Q0NA 4ZCLA 4YP3A 2W24A 4A4JA 2VQEJ 1DJ0A 4CYUA 1YG0A 3OPKA 4HDHA 1BQNA 4B9NA 1QE1B 4DCJB 2MQMA 3OW2R 3CULA 3MM9B 2IVMA 3EMTA 3B82A 4OYZA 4DV7F 1S57A 1REVA 2E5IA 4KH0B 5KOXA 3UPFA 3CO0P 2DYAA 3SV3A 2UVRA 3RAXA 4K0KF 1SBRA 4OJGA 4Z37A 5KT4A 4ANDA 2ZJPQ 4YB5A 2ZBPA 4ITSA 3CWJA 3EVMA 2CZ9A 3HKWA 3TR5A 1KD1T 1U26A 3T3FA 1HPZB 3DLEA 3CD5A 2HGNA 3HKZD 3L09A 3N9UC 3AOBA 2J9DE 2ALZA 2W7PA 3MR5A 1C0UA 2GCFA 1RU2A 4RU2A 1O0PA 1KONA 2WVCA 1NSPA 3PRBA 1RT3B 5L9NA 1XMQJ 1H98A 5DLGA 1M5KC 1K0VA 4YDDB 1OY8A 2QLJB 2B3TB 3ZFVA 3IG1A 2BKOA 4WP9A 2VF3A 2C2OB 2J9EA 1Z2ZA 3IS9A 4PXCA 3R2DJ 4G1QA 1FWPA 3MMJA 4PZVA 3HHDA 1X8DA 4C6AA 1U4BA 2XQCA 2HHWA 2DTJA 5ETSA 5C24B 2QA4G 4WFXA 1JLAB 2AEFA 5LL6d 2VG5A 1VRTB 4IRCA 1Q8LA 1JJCB 3I32A 3LWLA 1VQ4S 1MLAA 1PIEA 2B7BB 1QVGR 4LFCJ 4KGXB 4BDPA 1VQKS 3DLKB 1RAFB 1U6ZA 1LW2B 2HWHA 3DRPB 2ZM6F 2BEFA 3NNAA 3BQ2A 2VG6B 2MQLA 3DM2B 5L39A 1HI1A 1T9VA 1U8WA 2X1AA 3GG0A 2QA1A 1PYOB 1YWXA 4LF2A 1XTZA 4TY8A 3CJTA 1SJRA 4HVZA 1EETB 5KFTA 2GVDB 2Z30B 1X9SA 1FTRA 4Q2MA 3WX8A 1DURA 1AROP 2VFUA 4RBVA 2R7VA 3W3SA 1IKXA 1B64A 4LBPA 4FF4A 3D0IE 4HT5A 5L8RC 2ASJA 4NI2A 4OX9F 2JH3A 3N5FA 2F3JA 3PRVA 3K7RA 2ZBRA 4DV0F 1DZ5A 3JTOA 2KN4A 1D9DA 4DX7A 1KHWA 5CH7B 1XWLA 2NXCA 2VB6A 2VBWA 1HBNA 4ILLA 4DFJA 4UUWA 3QGPA 3W61A 4DLGA 1SKWA 2XHCA 4PKDB 4Y0FA 2MZSA 3SBMA 4L72B 4MJKA 2BJ1A 4IH7A 3SQGA 4FPRA 5HBMB 3EGZA 1GTEA 2CQGA 3K5NA 3GJTB 4X4TA 2AYBA 3LQVA 4PG4A 1FRHA 1K47A 3QSIA 3MOJB 1TR0A 2XM3A 3BJYA 4J9NA 3RW7A 4GC7A 1JLQA 1BQXA 4NA1A 1S1VA 5HAOA 1XIQA 5D0HA 3NMAA 3NCQA 3MR3A 2BA9A 5AE1A 4ZHRB 1U0HA 1YIJS 1A7GE 2EVZA 3HFKA 1KWMA 4CTAA 4IQMA 4D3HA 2FVRA 2VL1A 1Q86T 2WZ1A 1LV5A 2HNYB 3EWGA 4DPOA 4BS2A 1FF2A 1WORA 2VIHA 2MKJA 1KOOA 5KFOA 1RGVA 1VK8A 2EFPA 4K4VA 4DPYA 1TK5A 4C0BA 3VTIA 1EZZB 3QIPB 2J0XA 3E01B 4TLRA 3MAQA 1VC6A 2OGUA 1WNEA 3BDEA 2MKKA 1T9XA 2I1RA 4ED0A 1IM4A 1U1NA 5L46A 2L41A 4EFAC 2XO6A 3MM7B 4UZBA 5FJ4A 1PCAA 3DOKB 4JI8F 3VAIA 1PJ5A 4RLEA 1IBCB 1D9AA 3NBPA 3NWRA 2HHSA 1WHVA 4EI2A 5D15A 4IR9A 1IKVB 3CDBA 5GAGU 2MXYA 3MCNA 3SI8A 1QSYA 2FC9A 1T9YA 4ED7A 4KPCA 1LWCB 3KJNB 3MMAB 4CO3A 4DQPA 1FNOA 4HI1A 3TQ1A 3MEGB 4CP5A 4NMXA 2Y0SD 3T9NA 4Z2XA 1R8AA 3IBWA 4MK8A 2UVVA 4ZVHA 5GAHU 4IOBA 2FTRA 3QPIA 1EIYB 5IC4B 2HVZA 2UXBF 1HWUA 4CH7A 3M8ZA 5F8HA 2LKZA 1UP1A 3OR1A 4PQUB 2EBGA 3WDOA 3UO0A 2NXEA 4CM0A 2BKPA 5CCMA 3PYDA 1PJ6A 4DV4J 3PYEA 4YOEA 2FB0A 2VFTA 2CJYB 2J8SA 3ULHA 2OELA 1QVFR 8AT1B 4UOHA 4Q8EA 2LEAA 1HBOA 4FNHA 4ID5B 1JJ2R 2RVJA 4CH1A 5DQIA 5K8PA 2KFYA 3PM9A 2HMIB 1RCXB 3ISZA 2WBRA 2HK3A 4WK1A 1T03B 1G6BA 1HNVA 3T1HJ 2HAFA 2IHR1 3ZZ0A 4QWDA 1HMVA 2FZGB 5AT1B 3DDNA 2VFRA 4K4SA 2UV8A 3NG8A 1S1WA 2NXNA 3MEDB 4I6WA 3W5ZA 3CC7S 4CIOA 1VIOA 4ELTA 2HVDA 3I5AA 3MTJA 3H4DA 2PDAA 2YKOA 4OHVA 3HZGA 3FFIB 3V2UC 4ZLNA 4MIAA 3SSQA 5IM0B 2XTJP 3AFGA 2LDYA 2F9JA 1UZHA 2BVZA 4JI6F 2D3O1 3C14A 3MFIA 2A6MA 2BYCA 1E6VA 2DO0A 2HWIA 1RT1B 1HBUB 5B0BA 3TJ9A 2Y3YA 4MTPA 2VUGA 2CUYA 4PWDA 2PD1A 1BGXT 4L3KA 4QIFA 4WU3A 3GJQB 2I9SA 4OQJA 3BBBA 3GB0A 3CCES 2A1BA 5LM7E 1TKZB 4AQYJ 2AW0A 4RW9A 4MIBA 2XI2A 2HPUA 4ZJLA 5IWAJ 2J9CA 2X3GA 2EFOA 3M4XA 3UCGA 4PPZA 3RGIA 3AH6A 4KRWA 4ZVFA 2JLFA 3WC2A 2VKZG 1HHSA 1LKZA 3T5LA 5KFKA 4HH1A 5C42A 3T5HA 2CQBA 5J2PA 4MKBA 3THTA 3LA0A 1ZA2B 4P71A 1EKRA 3VF0B 3M1VA 2KU7A 4ZDNA 2ALYB 2IJRA 1U02A 1SJ4P 5B0EA 1JLCA 4L73A 1X4BA 4F25A 2K1RA 3QZ7A 2AYMA 4PUOB 1Q53A 2NREA 3EJMA 3BGRB 1KRPA 4ZN3A 3EGWB 4J37A 2ZM6J 3GCWP 1CULA 3M8PB 1YRXA 2XSJA 2YTCA 1N6QA 2AEMA 1N5QA 3N5BA 4ETXA 4NLRA 3TUPA 1CJUA 2ZWOA 4DL6A 4C8MA 2LQ8A 1T9WA 3S7RA 2XZWA 2X1GA 2LP4A 4QIVA 2VDHA 3GFYA 1RHMB 3H5XA 2JJ4D 1S97A 4K5RA 1GX6A 2PMHA 2YKAA 1H3DA 3IM8A 2V2QA 3MXHP 2BACA 4A46A 3H4BA 1OS5A 4C98A 3E3XA 1EP4B 3DGVA 4JI1F 2XGQA 2MLXA 1SH0A 3UFCX 3OXLA 1D8ZA 2BE7D 4HT7A 4X65J 1TL1A 3MEEA 3MM5A 3R5DA 3W5XA 3NNCA 1KQSR 4FF1A 3U02A 4QJVA 3TW0A 5GVQA 1U1RA 3OTCA 3OVSA 1NU4A 1DQ8A 5KFVA 3PY8A 2EFGA 2HNZB 1IBLF 2ZZTA 2HVEA 1VQ7S 4DMZA 2DBBA 3DRXA 1RTJA 1GXLA 1WHWA 4CYUB 4JV5F 3MM8B 2DNMA 4K50A 4H4MB 2WOMA 3PEHA 4ECZA 3N0VA 5IT9U 2XWXA 1S6PA 4A8YA 2UUBF 2GS8A 3CCQS 3H5UA 4IFVA 2DH7A 1C4CA 2RT3A 3HI9A 2IJNA 2H4YB 4BWJA 4V19J 4CQ1A 1OSCA 5DGAA 3BKTA 1XEZA 2OFGX 2BABA 2WRMA 3DXSX 2HRTA 3Q24A 3R5GA 3DRSA 1NK6A 5HN0A 4QYZJ 3DLEB 4DSJA 4OYXA 2ZZNA 1KS2A 2HNDA 1UFKA 4IKAA 1A6LA 4EUVA 3M2RB 2M8DB 2B5JA 5AXKA 4RW7A 2DPIA 3EDQB 4Z7YA 5A8KA 4LRDA 3MPDA 4EYIB 2H5JB 5CD4H 1FCAA 3Q2SC 1MMDA 3EGNA 3PX4A 4WTOB 5EN1A 4IYQA 4O3QA 1ZS6A 5A8WA 4YUDA 3V5RA 4IH5A 3BSAA 3BR9A 1KOHA 1D09B 3GIMA 2JFDA 4Y2MA 1X4DA 3HCXA 3LPYA 2YX1A 3M8QA 3MUTP 3LP0A 3OHBA 3NNHA 1O6XA 4LRFA 2H54B 1X9MA 3W2VA 3QGHA 2PMWA 2VONA 1FA0A 2WW4A 2WVDA 5KFGA 2Y0BB 2D9PA 1Z1ZA 1RUSA 2KTQA 4AE5A 1DTQA 5CYQB 3CJKB 1YJRA 3D7SB 4CLTA 1N8RT 3UI3A 5HATA 2CVIA 2CZVC 1S0OA 4QYRA 1C2PA 4MFBB 1NKBA 4WYLA 3GR0A 2X1BA 2C1EB 3M8RA 3M9OB 4C97A 4OYOA 4PXEA 3PG9A 1TL4A 2DXFA 3N6NA 3R5BA 1HI0P 3P5TL 2I38A 1FE4A 3OL7A 2DRDA 1TVRB 3QRRA 5IT0A 3IBFB 4CT9A 2PEBA 5JJBA 1VYAA 2DIUA 4ED8A 1UW9A 4A8XA 3SSRA 3MTKA 1HKAA 1HR0F 3GYXB 5KFNA 3M2VB 5AXMA 2E1PA 4DSFA 2LEPA 1XNRJ 2XZDB 2ATCB 2QL7B 5IS2A 2WONB 4I0WA 1WTBA 1FDBA 2BJ9A 2RQKA 4P75A 1MW7A 4HLBA 4EBEA 5E3AA 1F60B 3T1AA 2BOAA 2VU5A 1TFYA 5C25B 2EEYA 2A2CA 1HBMA 5ETTA 4NZ6A 3SZ2A 2ZFHA 3IRXA 2E1AA 1RT6A 3OL8A 2EWHA 5CYMB 2R9LA 3HHLC 2FHKA 4FPIA 4PWUA 3D5MA 5HI7A 4J90A 4P2FA 3MI7X 2GQ2A 2DHGA 3H2LA 3ILLA 2FGCA 2H5EA 3L4BC 1Y3JA 2OSQA 3AQOA 3U27A 3HT3A 5HJXA 3SFUA 2V5HG 4KO0A 1UA0A 2Y8YA 4Y00A 4EO6A 2XSFA 3MCSA 4QIEA 1QDUB 4CCHA 1YX2A 1YVFA 3HHLD 1Z4UA 1T3NA 3BGUA 4I2QB 2IYIA 5A76A 4ERDA 1A9NB 4IO1A 3OXGA 2MPUA 3D2WA 4CO5A 2V34A 1HWKA 2QT7A 3E2EA 3UNYA 5CYJA 2GHVC 2RAQA 2OUGA 1Q82T 5L1KA 3G87A 2E5GA 2UUAJ 4OYBA 3IP0A 1FJGJ 2DHAA 5KFAA 1X0FA 1IVZA 5K14A 3AB2B 5IV4A 4X4UA 4DUZJ 3LPEA 1PSDA 1Q8KA 2JEJA 4USIA 1KKHA 4DUTA 2DH9A 1QJHA 4CO1A 1TELA 5H9FK 4K4TA 3EICA 2O01C 1WC0A 1MN9A 3OTBA 3FZ2A 3NCRA 4K2XA 4LFAF 1TL3A 1Y4ZB 1OMSA 2ZUGA 4RNFA 3IR6B 4OI6A 1CEZA 3MUVP 1IBMF 1YZ7A 1VI7A 4LBHA 4NLQA 4DG1A 4LREA 2ZHAA 4PABA 2RQMA 1WSRA 2JEIA 2M2BA 5DM6Q 4YS2A 2CPXA 3P49B 4NX9A 4JI7J 3VR1A 3ONQA 2WVBA 1KR4A 1S9EA 1VRQC 1FKPB 5A6WA 1CJVB 1Q79A 3QRPA 4B3SF 1FRLA 4F26A 4NXMF 2EC0A 1N36J 1RLCL 4N7TA 1R0AB 2B9XA 2GHPA 3S1TA 1MROA 1LW0B 2G4BA 2JNJA 3PTWA 2DXDA 2KRBA 4QIGA 2AJ1A 1HNIA 4UF4A 4U96A 3OL6A 2AEJA 3TUZC 2DNOA 3U1LA 4C48A 2FGOA 3KUEA 4N41A 3QGGA 1VBYA 2OSRA 1TV6A 4U67Q 4OZ1A 2MZ1A 2Q1LA 2F63A 2APOA 5HMYA 2HGMA 2HBQB 3FKBA 4O0IA 1VHFA 4ALZA 4OZLA 2ZKUA 1IKYA 4DF8A 1ACMB 4WE1A 3G71S 3CW2C 1IBLJ 3R3TA 2VQFJ 3CD0A 1HBOB 5C7PA 4ZVUB 2K3IA 2HVIA 2C2NA 2EXUA 1D3WA 4M63A 1SXLA 3GIRA 4RUBA 4UOCA 8RUCA 2MKHA 2AGQA 2FJDB 4KBIA 4EK2A 2C3YA 2MY8A 2YVSA 2O3DA 1NDLA 3CIZA 4QPTA 1L3VA 4DZ6A 4IFYB 3SEOA 1K73T 4YB7A 4BC7A 4XPEA 3R7SB 3K2YA 1XN9A 3ET6A 3KHHA 2W2PP 3WZ0A 2EFQA 5KFQA 2K7KA 4R25A 4F4YA 2W9BB 4RWXA 4ZVTB 2MQQA 3EPGA 3P3DA 3VAFA 1S5ZA 2G2OA 1YDLA 2R8IA 3IAM9 3B4MA 1Y0HA 3BREA 2IC3A 1PBAA 3G6VA 1J5EF 3SQOP 2YQ0A 2HBZB 3TVZA 2E5LJ 3O8WA 3HFZB 5E33A 2AD9A 2IM2A 5K8NA 3IRWP 2BM0A 3FVYA 2BDPA 2HEKA 5KFCA 2A3JA 1RDRA 4CLKA 4EWTA 2B4PA 2B6AB 4X4VA 3H0PA 1S7IA 1RJJA 2HFOA 4JOUA 4RL1A 3P6YC 4USHA 4B9UA 2GA7A 5AXLA 3QLHA 4GO5X 2K8GA 4KY3A 3CCJS 4ZVQB 5CQGA 3OR2B 2M9KA 1T9TA 3T5JA 1CQNA 4DR3F 1FXDA 3QQCD 3R7NB 4EZ9A 4PG5A 3LALA 3JSMA 2V0NA 1HNZF 1VQSA 1RHKB 1VRUA 4HR2A 4B3TF 3OSPA 1RSCA 2YX7A 3JXOA 2C2RA 3M05A 3AD8C 1PJ7A 2PFFB 5IT4A 1FKAF 4OHXA 2U2FA 3NXZA 4UOFA 5C42B 3BR8A 4PR6A 4LF4J 1JK9B 2W9CB 1RT2B 1B3TA 3F0NA 2YQ1A 5KG5A 3MAAA 3NGRA 4IG3B 4TLQA 4I6AA 5GAEI 4A8WA 5E3CA 5HQ8A 3L7PA 2G0IA 4N76A 2EBEA 2I5JA 5KG1A 1HFEL 4HACB 5B0DA 4ZP7A 3D28A 3A13A 5K5MA 3CCVS 2MLYA 4ZVSB 1FRKA 3HK2A 1XR7A 4ECQA 1P1TA 2XSJB 1H72C 1R0BG 1FRJA 1JLGB 2DGQA 3A8EA 2N4CA 4P9SA 4X4SA 2KJVA 1WWHA 1ZM3A 3KDOA 3CDWA 3R7BB 2V6AA 4U6PA 1N5YB 2RSQA 2ZC3A 1LFPA 2Z2ZA 2HHPA 4A47A 4ZP8A 3OHAA 2GMLA 3T5KA 2MZRA 3G6ES 2HQCA 1JNZB 4ZVEA 2HVHA 2YKMB 3DOLA 3HF5A 2LXIA 3MM5B 2DY9A 3BZQA 6AT1B 5DG8A 3RBEA 2WSEC 3D6FB 3KUHA 1S0MA 2VZ9A 2NCKL 1FESA 3I31A 5E41A 2XS5A 4XAKA 3T9ZA 2XEXA 3KTQA 3QJPA 3EVOA 4F4XA 4NLTA 1NSQA 2XLJA 1NDCA 3RBDA 1SCJB 2W2QP 3MPUB 4DV1F 3HVWA 1PC5A 1M1HA 3NCPA 1K44A 5M2RA 2YPYA 1WDTA 4QQBA 2HHXA 3UD5A 3DYAB 4I4BA 2I2YA 3W9IA 3KK2B 5KFHA 3C66A 1BUXA 1PAUB 4ECVA 1WKLA 2VPZB 1KLMB 2LFVA 3C6TA 1H6KX 1U25A 3AXMA 2HHUA 3E51A 3OT9A 4RWWA 2MJNA 1VQ9S 4EBCA 2V8GA 3OVBA 3OFEA 1JXEA 4O44A 3EZOA 5A8KB 1EJ7L 1U7LA 2CKWA 1NO8A 5K8OA 1MU2B 3PRDA 2F1FA 2OKQA 4M8LA 5F3TA 2XMAA 4HTJA 3VAHA 2Q66A 3J81j 2ZNYA 1HI8A 4NCGA 3N6MA 3RR7A 4DS4A 2LA4A 3G4SS 4F0KA 3QRQA 4O3SA 1AZSA 1UFWA 2QLXA 3UD4P 3NEKA 4F2RA 1N48A 3PKMA 4OI3A 2GIRA 2CQ2A 2GIFA 1I5OB 2HQGA 4PWWA 1HQUA 4F36A 2KM8B 1GXUA 1T05A 1V3ZA 4QWCA 2QEXS 2BX6A 4B3SJ 3S01A 3LW5C 1LFWA 1OSDA 2BW7A 4QW8A 1N33F 3GYNA 1NRKA 3I4PA 2P9GA 3V81B 4PYAA 1BQMB 3MD1A 4L74A 3SXLA 4N8NA 1DHMA 2PIIA 2NPIA 3NY0A 3R5JB 4ZPWR 3UDVA 1JJ4A 3PHEA 2ZOGA 2YNHB 2V8HA 1TL7B 2XBPA 4FYXB 2ADCA 4HYKA 3QO9A 2F8HA 3FUYA 5RUBA 2O1PA 3KLVA 3IWLA 3BGLA 5IXUA 3AD7C 3E8OA 3SYZA 1WF2A 2IA0A 3I9V9 1F5CA 1G1XA 4Q0BB 1LXJA 2CJKA 3GV8B 4DU8A 5GMEA 1SV5A 1RWKB 2VHGA 1RWPB 1OYEA 3O2IA 4ECSA 3RB0A 3PXGa 4E0DA 3CDEA 2R8HA 5L1JA 2V9WA 1I51B 1QY7A 3QT5A 1J27A 1SJ1A 5U47A 1HLWA 4HHUA 3UE2A 4USJC 4DR1F 1TTHB 2XYPB 4RUHA 5F9NA 3RRGA 5L9XA 3EGVA 1OYDA 3ZTSA 4WZMA 2YXLA 4LSZB 3IRXB 2CXEA 1WG4A 2C28A 1L5UA 1HYSA 2FVPA 4F4ZA 4FS1A 1AW0A 4QR0A 2LYVA 3CJQA 1WC4A 5K8MA 4W4MA 2FZCB 4DL0C 2Z0GA 2XMKA 3L3CA 4F3QA 4YR2A 1PC4A 2V4JB 2CQ1A 1BD6A 4ECXA 4LF6F 4KO0B 3VQSA 1J5EJ 1C1BB 1RA6A 1VMBA 4R5PA 1ZBTA 2HFSA 4ETZA 1NH8A 3FBEA 2Z4PA 1YITS 1P9QC 2HLUA 2QYCA 2YNFA 4WBFA 5F8MA 2W7OA 4NEYA 1CC8A 3NWGA 1ZAVA 2DNQA 1P8GA 1VQMS 4OZNA 2LVWA 1RKJA 1RWWB 1IQZA 2Y9HA 3C6UB 1RT7A 2HIQA 5D4OA 4M5LA 3SDEB 5DLFA 4JI2F 4DBQA 2P5VA 1B0PA 3NLCA 2HZVA 1XNQF 4L6V3 4LF7F 2JEGA 1QAJA 1SJFA 5HVHA 1WOSA 2VASA 3DGPB 2DR6A 4FP9A 4QBUA 2RHSB 1KVJA 3ZTQA 2ZD1A 1WC1A 4JP8A 4OX7A 4UTGA 2ZDPA 1JKHB 2J76E 3QJLA 5HQLA 5LMUF 5KG0A 2YWGA 3I0SB 2DPJA 1B7YB 2QA4S 4DV3J 3IFEA 1PKUA 4LRCA 1JXVA 4USTA 1AB8A 1DTTB 1RHUB 4KV8A 1RWOB 4ELVA 3CJ2A 4ZVPB 5GMDA 3MR6A 2QLWA 2F8EX 1YKWA 3J81Y 3CE8A 2UUCJ 2GFFA 3UWTA 4X64J 3LO3A 1FRMA 2MZJA 1F6TA 4Y34A 5EX0A 4DOZA 5GMKa 2CA9A 3PYFA 1S9EB 4O3NA 2VQEF 2XYGB 5D0RA 2W4PA 4OI4A 2JFKA 4ZVRB 2EK1A 2R2SA 1HQ2A 3GMGA 4YFUA 3W63A 2ZUAA 4NL5A 5HSPA 5ETMA 4DX8H 4DU7A 4F3MA 4WF9Q 1X4FA 3HSGA 2H3EB 1HNIB 3F56A 5T7LA 4U9RA 2WVEA 2OPSA 4OZJA 4R8UB 2MTLA 1RLDA 2CYYA 4IRDA 2ZHBA 5DDOC 2KXNB 4X4PA 2FLLA 1QSSA 2ILZA 3WIUA 3Q83A 3PVXA 1S9GB 1LEOA 4EO8A 5E3RA 3CC2S 2V2ZA 2MKYA 3KJQB 2ZH6A 4LMZA 3VZIA 5ADZA 2H4WB 3KK1A 3PFEA 2VA2A 2NPFA 4USWA 3DC2A 3CSKA 1X4HA 3O44A 2PA3A 2EK6A 4WFZA 1VBXA 3OSNA 1TKTB 2L9DA 1WHYA 1RBAA 3BPSP 2ADBA 4B3OB 1XMQF 5HLFA 1S77D 2BW2A 1KHVA 1SVDA 3OJSA 4UQTA 2BE2A 3SCLE 6FDRA 3H5YA 2LDIA 3DHWC 2IBOA 1RISA 3ZO7A 1RHQB 2IAJA 1RAHB 2J6TA 1F2HA 5D4LA 1S1TA 3BN4A 1L3KA 3KLGA 4RNNA 1VQYA 4AXIA 3NOGA 2MSSA 2YNIA 5KFZA 1F1BB 3GZ7A 2AJFE 2RS8A 4N47A 1FHTA 1KN6A 5LT5A 4WIIA 2OD6A 1KTQA 1UMJA 2FLOA 2BJDA 1UVKA 4NXNJ 4IG0A 1LWEA 3Q23A 3Q8VA 1H74A 2IC3B 1SUQB 1FWLA 2BQRA 2GHWA 3BS9A 4ED1A 2ZJQQ 2IM0A 3KLHB 4KTQA 4CDIA 3N28A 1C1CB 3RUBL 4M5HA 3VQTA 4DQRA 3MEKA 1FRIA 2EFVA 5J2MA 1HHQA 1JLFA 1FT8A 1U45A 1NDKA 4RW8A 4QR2A 3HHLB 4ELUA 2ZKTA 4EEYA 1W2BR 3MDFA 1SQEA 1TAQA 4LFCF 2CPHA 3BQ0A 1FRXA 1VS3A 4NLOA 4HI2A 2E1CA 1TAUA 1Y3KA 1BWVA 2GVZA 3ZZOA 4CLFA 4MKAA 4ZLLA 4KKOB 1XC9A 3OFFA 1JXLA 1TZ0A 2L08A 4FDFA 4U8VA 3MPYA 3M2UB 5E3PA 3BBFA 2MGZB 1P27B 4JV0A 4C8LA 3KG0A 5LSLA 1V6HA 1AA1B 1RWMB 1R8HA 2IRXA 4I7FA 3VV2B 1S49A 2R8KA 2O66A 4TQRA 1O51A 3V6DA 5KFYA 1VCTA 3BEGB 1ZZFA 5CZVA 4ZIWA 5J1EB 5I42A 4YB6A 3L9ZA 2B56A 3MOZA 2GNKA 4LR9A 4MAKA 1Q5YA 1PYTA 3F41A 2DRBA 4ZPBA 4ZIVA 4K2JA 1FJEB 2G2YA 5B08A 2MKSA 5EUHA 2XWYA 3HM9A 1ZTTA 4ILRA 5BR8J 5KFWA 2BBEA 2RB7A 3POTA 1PO6A 2E66A 3MECA 2KKHA 1VLYA 1JLEA 3THVA 1TKXB 4X62J 1ZM9A 4A8SA 3CJSA 1SKUB 2FD2A 4QOTA 2IM3A 4E8UA 2R2TA 3HSZA 4RX6A 1V5IB 3Q22A 3FNNA 4Q8FA 1Q7YT 1EKSA 3BB5A 3HVAA 1AUDA 2X1FA 1HWIA 3ZNUA 4DN0A 4C3MA 2AX1A 3ZZRA 5KT6A 3IXQA 1NBEB 2KVIA 1HIYA 2MYFA 3LGMA 3JTNA 1H73A 2H48B 4LR7A 2P2CB 5D3GA 3QYYA 4WWSA 4ZLJA 3K17A 3AOAA 1CJTB 2EG1A 2AJQA 4DQIA 2OH2A 4WTYA 3OFGA 2OPPA 2DGVA 4KGMA 2DRAA 2OPRA 3NS6A 2H1YA 2V8DA 2YKNB 4CLSA 3TVKA 2O67A 3M6VA 2DGWA 7FDRA 1NDPA 2N7CA 4DJBA 4KFBA 1P6TA 2CQ0A 1S1UA 3R2CJ 2UU9J 2I8EA 1FERA 4RW6B 1EAYC 1UVNA 1NB2A 1BXNA 3A8IA 2H5IB 4B3MJ 3ENQA 3QATA 2NUHA 2ZJRQ 3J7A1 1V3RA 1W7WA 2ZBQA 4IDKB 1HNWF 4DSEA 2DKOB 4KGVB 3EDRB 2OEMA 3NRBA 2B51A 1YHQS 4F67A 4J91A 1RCOB 1N0UA 1ITPA 3VGVA 3V4IA 3K58A 4M5MA 1RTIA 1XK8A 4UQGA 1QAXA 4CLLA 1V5VA 1OQ3A 2MQPA 4O3RA 5MLCV 2NUUG 3QFHA 3D3CJ 1ZZNA 1UEUA 1F3VA 1CS4B 1RAIB 2DITA 5GAEU 2AJ0A 4CLWA 3I5CA 4RKUC 1RTDB 2MQOA 2G1DA 3V4MA 3PEJA 3UVJA 3OLAA 3M32B 4JBCA 1VQOS 3J7YI 2GGPB 5D0GA 2NSBA 4QU6A 3AODA 2QX0A 2VKRA 4KB7A 4C8ZA 3OUYB 3DU5A 3CVKA 4DV4F 1DY3A 3TAMA 4P74A 4C11B 3HVTA 2QMXA 5KG3A 4Q43A 4ICLB 5CCLA 2K2PA 5H9EJ 1TP7A 3A3NB 2O5DA 4USMA 1RQ0A 2RS2A 5I3PA 3L95X 4F7VA 4DUYF 1S0NA 3DI6A 1WI6A 1HNXF 2R8GA 4K4ZA 3QT8A 2CNOB 1KQGB 3T1HF 3DLJA 1LK7A 1N5SA 3HXMA 1M5HA 5D0EA 2WAQD 3KJVB 1FFWB 4MYUA 1S6OA 4NLXA 4O4GA 4AL5A 2JC1A 3AT1B 3VWSA 5B7WA 2AIRB 3IGNA 5ETPA 3H40A 4NA2A 4NYZA 2R7SA 2D7SA 1LWFB 4NYOA 2CWXA 5ETNA 1UA1A 1WC3A 3CMES 3H2UB 1NSAA 2IRYA 4LF8J 1RT4B 3KK3A 3JYTB 4YR0A 4NCAA 3CNQP 3MMCB 5DS7A 1RT5A 1Y5LB 4OI2A 4J5OA 2KHCA 1DLOA 5G0RA 2H9ZA 3N79A 3NGDA 4ED4A 1J2VA 2AMCB 4ZP9A 4ECUA 4C0HA 2Y1IA 1U47A 1JMTA 4JYAJ 3G96A 2RD5C 3HHKA 2M0GB 3MUMP 2V8VA 3DOMB 5A8RB 2QO3A 4DR7J 3UN3A 4AQYF 3D6HB 2QYGA 2AX0A 4LRBA 1VQLS 2FHJA 2OPQA 3AQPA 3KLFB 3CCRS 5IWAF 1I3OB 5H9EK 3R5AA 4H4OB 1WD6A 2BXJA 1Y5IB 5HROB 1FI4A 1AYEA 1GT8A 5I3UB 2L3MA 2MEWA 3TX0A 3C16B 4NWBA 1CG2A 3GSDA 1R7IA 3CJ4A 4M5IA 1F0XA 3A8KA 3B6BA 3LH2S 3DHXA 5HL7Q 2RF2A 2K7JA 5KFUA 4R5PB 5KG4A 3MWBA 1UVJA 1N34J 2FIUA 2ZBIA 2FZKB 3B8HA 2UVUA 3AJ1A 3U1NA 3I0RB 4KHPJ 2RQCA 3IWNC 2E1MC 1FVQA 1P9YA 3UDEA 4K4WA 3NAIA 2JWNA 2VG7B 1X9WA 2ZE2A 3P8BB 3RYLA 2YNGB 3W2WB 1GEHA 1IBKJ 2N3LA 2PGCA 4DPXA 2E9RX 1VQ6S 4GKKJ 5D78A 3O3LA 1FWKA 1BC6A 1QE1A 3JAMY 2BJEA 3MM9A 2R3VA 1RU1A 2RDDA 2IDLA 3KLEB 2HHQA 2LLZA 3CJ0A 3I4HX 2ZH1A 5LMNJ 2IDEA 3MAHA 4ECTA 4A8OA 3H98A 1AT1B 2LQJA 2GAHC 4YN3B 1XERA 3G82B 4J9PA 4QCLA 4X4RA 3I55S 4PAAA 5HMXA 5K20B 2ZNZA 1TU0B 4DN9A 2VBXA 1H38A 4IOCQ 3KFWX 3T1YJ 1HPZA 2AQ4A 4PXDA 2NZCA 2C22A 4X65F 1U6BA 2GMHA 3OBIA 4NEZA 1PYSB 3TWZA 1VJQA 4G1PA 4YB1P 3CC4S 1RYRA 4DR5J 5I4MA 4C3LA 2WCXA 5EHHA 2R2RA 4F3OA 2CIMA 2R4FA 1RT3A 3SIPB 5D4PA 2E44A 5ETOA 5KFMA 3AXKA 4AL6A 2RIJA 4UUXA 1T95A 4WCEQ 2Z2MA 3J80Y 1SL0A 2RRBA 3G8TA 4XDDA 4CLPA 2VA3A 3M6UA 3X1LB 2BANB 1IQTA 1N88A 4OX6A 2RKIB 3WQPA 4LSNB 4P2SA 4R0JA 3ADAC 4DF4A 1X7VA 3DDIA 4ZS6A 5LJ3Y 2EKYA 1Q81T 5JXSA 1P1LA 1RAOA 5J2QB 2HFNA 5C24A 4DX6A 1JLAA 4G6VB 4FF2A 5HANA 1KDNA 2KI2A 1UPPA 1WKJA 1VRTA 4DSKA 4YEAA 3K57A 4ILMA 4QIWD 1S6QB 3ZTPA 2JOQA 2LXUA 1X5OA 2HS4A 1C4AA 2YWHA 1KSPA 1UVIA 2X51A 4UY8T 1YJVA 4RW4B 4OLOA 2BQ3A 2DHHA 1SQGA 3R8YA 5HP1B 2BE2B 3CMAS 2VD3A 1RWVB 3DLKA 5E5NA 2WW8A 1MMNA 2QJ3A 1IJEB 1VQ5S 1LW2A 3MMBB 3PIOQ 1VQNS 2VOOA 3DRPA 4USVA 1N5TA 4TY9A 2CNNB 4G65A 4DV6J 3G8SA 2FDNA 2VG6A 2OP5A 2YNIB 4QR1A 1OQ6A 2ILYA 4KHMA 4N77A 1I6JA 4NOHA 4DSLA 4FKXA 4NZ0A 1HNWJ 4G3IA 2F7VA 3G6YA 1CC7A 4LVNP 1EETA 2OAUA 1F9HA 1LK5A 3FCWA 1WF1A 1NPRA 2GVDA 1O8BA 1JLBB 3LUYA 2XLKA 2PSZA 5B0AA 1X5PA 1R3NA 1U8SA 4FZVA 1N54B 2VV5A 2RU3A 3JTPA 5GAHI 3DLGB 2BRLA 3V6HA 3C15B 3FSYA 3K8WA 3QGIA 2GX8A 3F44A 3ETOA 1CLFA 1FNXH 1FD8A 3Q8RB 4OFZA 3TO8A 2UP1A 1DRZA 2AT1B 2AP6A 2VC1A 3ILJA 2CPYA 4AYBD 5L1IA 4Y2AA 3RR8A 3KLIB 3AAWB 4ZA1A 4JI0F 1S1XB 1R8PA 3CDUA 1XNRF 2DNPA 1ZYQA 2C2DA 4AFFA 2NQPA 3FQLA 5DETA 2UXCJ 4AUKA 4DL2A 5F3ZA 1D9FA 3GJSB 4B9TA 4KYZA 4DR2J 3MM6B 1U09A 3DLLQ 3D1OA 2B4OA 4DUYJ 1NJYA 3UDCA 2ZHOA 1HNXJ 4ZHRA 3T19A 4RPFA 4FYYB 5L38A 5KG6A 1KQFB 1FEEA 2W2NP 3I5BA 1H2TZ 2HSEB 1SB6A 4K4YA 2DIVA 2GQQA 2C3PA 2LU2A 4Q5VA 3GJRB 2Q3PA 2H65B 4HH0A 3TJAA 4GVBB 5GADI 4NZ7A 2R7QA 2NZ4A 1BY9A 2R7OA 4OZ3A 2HNYA 3ICLA 2ERRA 5AE3A 1FJCA 2BJ7A 1AFJA 4GMKA 3CT9A 2P8IA 1BLUA 3IA0A 2W01A 2QL9B 1R27B 2KM8C 3QIPA 4BHQA 3E01A 3W66A 4C3KA 3FCVA 1SIZA 2KT2A 1CJKB 2SXLA 2IM1A 1NK9A 5EWEA 5F8JA 1XQIA 2AGPA 2XCAA 3DOKA 2A10A 3QMQA 2BQUA 5ETLA 1R0CB 2ATLA 3KNGA 2UUAF 3TA0A 3BGOP 4IUFA 1GMUA 1U2RA 1FJGF 2D41A 2MSTA 1IKVA 5CD4A 5ITHA 5HMWA 2U1AA 4M5DA 1H2VZ 2MMYA 4DUZF 4A8QA 3EXYA 4DV2J 3M6WA 4Y2CA 1HD0A 1LWCA 4UT4A 3A1YG 3MMAA 2Z2YB 5FDLB 1B4SA 4FXWA 3DMJB 2QRRA 2OPRB 2DD8S 1SC3B 2AU0A 2YKPA 2QZ8A 5KFIA 2F65A 1GH8A 4TN2A 2J6SA 3G86A 1YGYA 4CZCA 2Q6BA 2G0JA 2AGOA 3VAJA 5A0YB 3DCAA 2VH7A 3LTOA 4OV6A 4PQUA 2IPOB 4I2PB 3Q0AA 3GPAA 1H7XA 2CQ4A 3GSIA 1FFSB 3FGVA 4Q2LA 1SL1A 1FKOB 1KC8T 4JI7F 3AD9C 1RABB 2Z8QA 2ZVIA 1GMVA 2C3UA 4ID5A 2E9ZA 1MMLA 3DXBA 1JIHA 1N36F 2HMIA 4ES2A 2B9WA 4ECRA 2DNHA 2KFNA 3V4IB 3RRKA 4P6QA 1T03A 1NK8A 2RQ4A 5HO4A 1SI9A 1FNMA 2QLBB 1NJXA 2F5GA 1Y9OA 2HWTA 3AY0A 5DG7A 3EYZA 2NR0A 3J81U 1B99A 1D8YA 3MEDA 2QTWA 1C0TB 4DCPB 4RZRA 1FK9B 4OYMA 4DHVA 2AKWB 2NSCA 3VCDA 3L7OA 3FFIA 2KVQE 3JS9A 3M8YA 5D6GA 5F0WA 5IM0A 5FD1A 3QFWA 1H2UX 3VVTA 5B0GA 4XO0A 3SSSA 3HVRA 2C42A 2FVQA 2XHWA 3BN7A 1WEXA 4M1KA 1RT1A 2VQFF 1IKWB 1HBUA 1M90T 4RO0A 4WXWA 3BM7A 1FD2A 5DQGA 1BQNB 1HHTP 3D0HE 2VFVA 4XK8C 2KYXA 1YJUA 3CJ5A 3OVAA 3ZZUA 3W7BA 2J7WA 2JEFA 5F41A 2ZH2A 4JUZA 1RI7A 3M8SA 5I3QA 3EXCX 1REVB 1NNDA 2N3OA 1TKZA 3NS5A 2R2UA 2J0SD 4WFYA 5F9LA 2MQ8A 2VFSA 3UW1A 1S99A 1U49A 3CDAA 2YWFA 4QW9A 5E3QA 5BYQA 1YSJA 3M30A 1RHRB 2RMLA 3FRZA 1VQ8S 3K5OA 5DDPC 4HHJA 1SJQA 4RBTA 2E5LF 1C0UB 2E1RA 2M7SA 5CA5A 1YBTA 5F8LA 2X7IA 2FJEB 2IFXA 2BJ3A 2NYIA 1ICEB 3PW0A 3PX0A 4TYAA 3GFHA 3K0JA 1ZTWA 3KJFB 4PUOA 2DGTA 2Z58B 2XCPA 4ZN1A 3BGRA 4F8RA 4ZCMA 2IA6A 3IBCB 2L48A 3IG1B 1RKIA 1WELA 4UY85 3GP9A 3D1HA 1ELOA 1HW8A 3M8PA 3IS9B 3W8PA 2OEKA 1GMWA 3EZ5A 4G1QB 3RZAA 3HZEA 1WC6A 2CJBA 1NZAA 2Q79A 3D3BJ 2MZQA 1QD1A 3VGTA 3AB4B 1G7CB 2CPEA 1S9FA 5D4NA 1M1KT 4FXVA 1N52B 2V4QA 3PHTA 1AXQA 2QE5A 3TZYA 4LF4F 2CG8A 5EWFA 1YI2S 5JVGQ 2F4FA 2VBYA 4DXLA 3NOCA 2VG5B 1EP4A 2XGPA 1UCNA 2Y8WA 3RTVA 2QGFB 5ETVA 3EZUA 1Y5NB 2LA6A 3VALA 3A3OB 2JSXA 1T02A 2PFDA 3FCHA 2ROPA 1UEKA 2BR0A 1T94A 2HFVA 2HNZA 2FLPA 1VLOA 1S0VA 3W9HA 3G8QA 3MM8A 4JI0J 3U7JA 2J8AA 4H4MA 3IGVA 3NGTA 1ZETA 1WG1A 4CT8A 4TY8B 4F2SA 2V63A 2G2ZA 3JQJA 2BZ2A 4ANCA 5D8HB 1JB0C 5H9FJ 1YBAA 4PEOA 1NK5A 1IKXB 2R7TA 1H7WA 1FX4A 1NJIT 1KBRA 4NI2B 1BWEA 2MLZA 1Q16B 1XBWA 4ZOSA 3KUGA 4N8OA 4GKJJ 2ZH7A 2EW9A 4Y2KA 1HBNB 3M2RA 2C3OA 4Q45A 2CNLB 3D67A 3TYTA 2CG4A 1L3UA 1REGX 3KKFA 3RB3A 3LGHA 1XMOJ 4M5GA 2LQ5A 4MYTA 1I94F 2E7VA 1BE4A 2DHSA 3PW4A 1U1MA 4QZVB 3SQGB 2KB2A 1N32J 4LFBJ 4A8FA 4ZVGA 1X0PA 1KFSA 2IJFA 2N7YA 1X4CA 1F9EB 3ZXWA 2PEHA 4ES1A 3D4JA 4MH8A 4RUCA 4OL8A 3Q2TC 1SC6A 2ABYA 3PFOA 5J1PA 2GO9A 1JLQB 2BM1A 1S1VB 2CQDA 2PI5A 1RP5A 1A0OB 3CMQA 1WOPA 3HHEA 5IZHA 4BCAA 5KFJA 2DT9A 1MN7A 3PJXA 2JLGA 4U95A 1U0HB 1X4GA 4ENOA 5DRKA 4X4OA 5CYQA 4NCBA 3CJKA 2MY7A 3MFHA 4X4QA 3WX4A 3GR1A 1J5OA 3VGSA 2ZBCA 1YJTA 3B78A 4P72A 4CTAB 1NJZA 1X4AA 3R1LA 3FZBA 1S4EA 2V2KA 4MFBA 2XO7A 4PG7A 1XJWB 1TL5A 4I68A 2F4VJ 3TEGA 3ZZTA 4DLEA 3LF0A 3GILA 2GZOA 4WFAQ 1RK8A 4C8YA 1VBKA 2IVYA 1TVRA 4U7UD 4MKVA 3QT6A 1PBUA 2HS3A 3D68A 4TXSA 2YY3A 2GJIA 3M2VA 4ZJQA 4Z7CA 3QAEA 1UEVA 5ETQA 2BRKA 2GJFA 2X3DA 4DS5A 1YJWS 2WONA 4TKTA 3P45B 3OTDA 3LANA 4OLPA 5KAKA 3Q8YA 1MNEA 1NLKL 4X66J 1F3FA 3NBPB 1K8AT 2G1HA 1B70B 5C25A 3DLHA 1R43A 2KL8A 1TKDA 4TU8A 1ZA1B 3QWPA 3RB4A 5CYMA 5A6PA 1NMEB 4YR3A 3UN2A 1Q95G 2HKEA 4LF9J 2V2VA 2CPFA 4K8RA 2KJWA 5BXIA 5F8NA 1CPZA 1PG5B 3FSIA 2Z57B 4DR6J 3OD2A 4IH6A 4GC6A 5KT3A 4FS2A 3DLBA 5K9FA 5C2GA 5EX3A 4JI5F 4NMLA 4ZCKA 2DJWA 3OR1B 3SCJE 2GMJA 2Q6CA 4DWIA 4L75A 2KT3A 5EDWA 1L3TA 3HD1A 5AJ3J 2M3DA 4C8NA 2OIHA 4I2QA 4F4KA 2DK2A 5DGBA 1NK7A 2XLIA 5KG2A 4JI3F 1Y7PA 1RB0A 3D9BA 4IQXA 1B7FA 2XNQA 5KFDA 1HNVB 3FBFA 2D3ZA 2DB1A 4I1TA 2KZZA 3MCMA 3D6TB 2R8JA 2D3OR 1HMVB 2W9AA 4PXBA 2KO1A 2UZAA 4YHHJ 3RBXA 1S1WB 3GQCA 3PO5A 4X84A 2C2EA 1U0SA 3UDLA 5D77A 1DQAA 5DM7Q 3W5YA 3TI0A 4DZDA 3KYLA 3MZIA 2RHQB 3BH6B 3PZPA 2CJXB 2LMIA 1RWUA 2RRNA 2HG4A 2UV8G 2PN6A 4YDXA 2JL9A 1NPKA 3C14B 1E6VB 3GLJA 4DEZA 4M94A 1K9MT 2XMMA 1NAQA 3RAQA 7AT1B 1HD1A 3PJ9A 4KE5A 4PWDB 5JUMA 5KFRA 2UXDF 3D66A 4DDFA 3H42A 2RE1A 4JI4J 2V4RA 3PCOB 3BO2A 3ISNC 3MPWA 5THWA 1FKPA 5KFEA 1CJVA 4FVCA 4ZK7M 4B9VA 4RU9A 3K8VA 3HJFA 4RW9B 1R0AA 1SL2A 4M5DB 2QLFB 4DPWA 3IR5B 1LW0A 3T6JA 5FLXY 2BE9B 4MIWA 1E6YA 2G13A 4DPTA 1NB7A 3Q8SB 3K59A 3RB6A 4H4KC 3CGIA 4FBUA 1DARA 2HHHJ 5HK4A 5J2PB 4DV3F 4BC9A 3ISND 4TYBA 3OTOF 3FQKA 4B3RF 2HQDA 4C7QA 4Y3CA 3ZTOA 1RAEB 3M1VB 1N0VC 3TVYA 5ETKA 1VJWA 2ASYA 4C4WA 2DEJA 1JLCB 2OMLA 2HRYA 1OO0B 5ETRA 3JAMU 2K1RB 3PV8A 2HZCA 2UUCF 3CB4A 4X64F 4I64A 4ED6A 1FTCA 2G0CA 4NPOA 1ZM4A 4A48A 3ZTRA 4ATNA 4IO9Q 3BSCA 1CULB 1IWAA 1PILA 3PW2A 2MQNA 3QBCA 9ATCB 1N6QB 3SV4A 4XDCA 4DX5A 2PC6A 1SKRA 4CRJA 3MD3A 1CJUB 5KT5A 3ILIA 1LXNA 2WK4A 2QA2A 3TQEA 4DV7J 4NLVA 3BPDA 4IFYA 3ZZYA 4LQ9A 4ZPVR 4ER8A 3KWMA 4WP3A 1IM6A 2KXHA 4K0KJ 4U7UK 1R6YA 2B7CB 3AJ2A 4NLYA 1ZOTA 2QFJA 2OMOA 2MKCA 3DDKA 2W9BA 4TVAB 3PYGA 1VHIA 1G4CA 3GIJA 4PRFA 1IR0A 1UL3A 4CO0A 1APSA 9RUBA 2XI3A 1TL1B 3MEEB 4GRSA 2XULA 3OQ2A 4XPCA 5GADU 5LSOA 4V19X 3OXFA 3MF5A 2EG2A 3J80U 3KHGA 1K0TA 3C2PA 4ZPAA 1I94J 2R7UA 2YQ3A 2B6AA 4OYAA 1RTJB 2B0GA 3FBBA 2DHXA 1RTHA 1EX8A 4PG6A 3TP2A 4J9SA 2RNEA 4M95A 2JX2A 3OJUA 3K5PA 2WOMB 3C3LA 5IC6B 2VC0A 1S4FA 4B9MA 3DFEA 1FDAA 3OR2A 1S6PB 3VVUA 1GQEA 5HVFA 1S59A 1TMMA 4IFVB 4BWMA 3P96A 2NYHA 4DSIA 2W2OP 4ES3A 4K7QA 3UCZP 4EGLA 4LQ3A 1YZ6A 1W2IA 3HJVA 3CIMA 4BBYA 3M30B 4LF5F 4NXNF 3DRSB 3PIPQ 3TZWA 1NEEA 4OYWA 5KG7A 4J9LA 3OL9A 4NE9C 3QJJA 2W9CA 4ZCIA 2HNDB 3TZZA 1RT2A 1MG7A 3FMWA 2B5JB 2WSCC 4RW7B 2GO8A 1TQLA 3ENAA 4IG3A 2J7KA 2YWWA 3BSNA 2XMJA 4DFMA 2J5AA 2CDRB 4WKYA 1CSJA 3OTEA 3MPVA 2R42A 3NGSA 4CO2A 5A8WB 2I6WA 2IVFB 4HACA 3QZ8A 2JC0A 5J2NA 2HQIA 3RG6A 1MWQA 4CLUA 4K5SA 1NM2A 2V67A 1TUGB 1U6FA 2C2KB 5HQMA 3G9CA 4LR8A 3N6LA 1R89A 2BMBA 1SC4B 3M8QB 3RBZA 3LP0B 1JLGA 2GW8A 5AXNA 3K5LA 4WIQA 4HDGA 3A8JA 3W2VB 3R6GB 3R97A 4I69A 2N4DA 2VBZA 1N5YA 1MWZA 3JQMA 2UUWA 3IM9A 3J7ZT 1DTQB 3IMQJ 1S76D 3B4DA 3CJRA 2NS1B 4OX9J 3ZC4A 2HQ3A 2CADA 4FVMA 2MDAA 4OJ1A 2CPDA 2LU1A 2YKMA 4DV0J 3WBZA 2HHVA 4O23A 2IMOA 2KT5A 2HFZA 3DRYA 3PW7A 3HSDA 5CHCB 5DZ6A 3H8YA 2IY5B 4GVLA 4JI5J 1NH7A 1QM9A 4F0HA 5BR8F 2ACMA 5F8GA 3CCZA 4B02A 2NXJA 2EKNA 2DY1A 1VQPS 4X62F 3C19A 1WACA 5DJBA 4HTIA 5T41A 3HMJG 3SCKE 2B4VA 1V3SA 1KLNA 3QNWB 2CWKA 4JI3J 3FEZA 3BO3A 2E5HA 3DYAA 4URGA 1VK3A 4RR5A 3KK2A 3O1LA 2XNRA 4N56A 1HBMB 3C8YA 1KLMA 2CJAA 2DNNA 2VJVA 1RT6B 3DRRA 4M5NA 4GO7X 2BUNA 4KQZA 2ZEJA 1HQEA 2QL5B 4RNOA 4AL7A 4FYVB 2CDQA 2Y1RI 4J9RA 2COLA 3C46A 5DQHA 4EBDA 4HEA9 1MU2A 4Y65A 1TUWA 1HW9A 2CVEA 1TFWA 1S72S 1PGZA 2RU9A 4CLZA 2KH9A 3H7HB 1URRA 1JQGA 3I6PA 2L9NA 2EI5A 5A2QY 1YJ9S 1YTYA 3A4TA 2UU9F 3BDPA 2ZH4A 2XZTB 3F73A 4B3MF 3PKYA 2UXDJ 4RUAA 3O6QA 3VAKA 2R7XA 2XB2D 1B0TA 4JI8J 4F0MA 1HA1A 2B9EA 2DXEA 3PDNA 2N82B 2C2ZB 2W8KA 2FHOB 4KGZB 2MHNA 1LQ9A 2CQHA 1J5OB 2B4UA 2DNYA 5K14B 3GIKA 2Y1LB 1T7PA 3Q86A 2W4DA 3V81A 1BQMA 4FKYA 3TARA 2FLNA 3FBCA 1TL3B 2YWEA 5CZXA 2YNHA 4PG8A 1TL7A 3NAHA 3TEHB 4QYZK 2HQFA 3TJ8A 3OTOJ 4B3RJ 2JLEA 1VC5A 4NLGA 4JV2A 5IQ6A 1WF0A 2CPIA 2UXBJ 2W8LA 4P7VA 3W8GA 1Z2LA 3H20A 3EVWA 4DG1B 4Q0BA 1YJ7A 3UD3P 1QSLA 1TMJA 4FF3A 1Q7LB 4CLYA 2HHTA 3MURP 3OLBA 4TU9A 4PQAA 2DCLA 1QTNB 2HURA 3FSXA 1MROB 1EQMA 2M4MA 1Q4RA 3I96A 5T14A 4S0MA 4X2BA 4URSA 4OYPA 1S7HA 4C2MA 1HARA 1M5PC 3ZNJ1 3D0GE 3QIDA 5BYSA 1RAAB 2FQQB 4J9KA 4OIXA 3Q8PB 1RADB 3Q8QB 1WEYA 2ZC4A 1TV6B 1X4EA 5MAOA 4CO4A 1FO1A 2V4JA 2NXUA 4ECWA 2ASLA 1SKSA 4U8YA 4UZCA 3FJ2A 2Q43A 3MCOA 1C1BA 2RH3A 1NK0A 3CEDA 4J7CA 2P9CA 2M70A 4OYIA 4B08A 4M5JA 4LF8F 1IKYB 4WE1B 4MKYA 2DGXA 4JI6J 3W1YC 5B09A 1ULRA 2HAIA 5LXYA 2B8QA 5F0UA 2OTLS 3C6UA 2HLTA 2CAJA 4NRUA 5KFLA 1ROFA 3SDEA 2DR8A 2D1CA 4JYAF 2AHOB 4DQSA 1WDDA 4P7TA 2QG9B 2KDOA 3LGNA 3DGPA 2LEBA 4DR7F 1EQ0A 3W9JA 4CI0B 3ITHA 1V9OA 3BKUA 3ET6B 4EMDA 3LP2A 3UN5A 1JKHA 3PO4A 1O5JA 4LF5J 4L76A 4LIRA 4OJHA 1GTHA 4RNMA 4DQQA 2PI4A 4O4RA 4ZITA 3I0SA 3AHPA 3OV7A 4G1IA 3VAGA 5SZTA 1H0HB 2M8HA 3HP6A 5DDRC 1DTTA 1N34F 3HT0A 2ZH8A 4HL9A 4KHPF 4DL7A 2I0XA 4LSLA 4Y2IA 4MMOA 3QT7A 4F4WA 4NLPA 5E7OB 1U2FA 3M8WA 4ZLPA 2RJZA 2DGUA 2B8PA 1QLNA 2AYEA 1HWLA 3QLHB 1IBKF 4F4AA 2QSFA 2FHMA 2CQIA 1NHVA 4C8KA 4RBUA 3DNCA 2NLWA 4GKKF 2RUSA 4A8MP 4ED2A 3JSMB 1IN0A 3TUIC 5JVHQ 3TAQA 1EHWA 1VRUB 1Q8BA 4C8OA 4XIUA 1NUEA 2LQ9A 3MGJA 5LMNF 3KNAA 1BHNA 4DL5A 1E6YB 1R6VA 1WC5A 3CO9A 4B9SA 4LBIA 2AWZA 3LP1A 3CXCR 4DFPA 2A0FB 4R8UA 3HDSA 2W1BA 2FC8A 2HRUA 3ENWA 3JSRA 3J7Z5 4JI1J 1R8CA 3MAAB 1WEZA 3T1YF 1WSVA 1S9GA 3D6MB 1VBZA 1U48A 1NSKL 4OZ5A 3TNVA 2I5JB 2GAGC 4K4UA 3WC0A 3ILOA 1NXIA 1T9UA 4DR5F 3FK4A 5C2CA 4KT0C 3HHNB 1FJ7A 4P73A 3I87A 1TKTA 2FJBB 4F04B 4B17A 4LVOP 4B3OA 2XC9A 3KHRA 1DBDA 4JV5J 4NASA 4A8KA 1ZM2A 1KTVA 4ZVOB 3W65A 4J9VA 1G2EA 1S6UA 2QMUB 4URQU 2YPZA 2UUBJ 2ZVSA 2OO4A 4JB8B 4KJIA 1D1UA 5J1NA 1IUJA 2HYIB 2WB1D 4WZQA 1WOOA 1R31A 3GV5B 2CNKB 3GCXP 2V69A 3NS7B 2FHJD 4EU0A 1Y10A 4J9MA 2CZ4A 1CBKA 2PO4A 4USUA 1PAEX 3DOLB 5C5JA 4DL4A 1SUQA 1NKCA 2IBKA 2HGLA 3VGUA 4KC5A 3KLHA 5IFMA 2HBYB 1IR1A 2CPZA 3HLUA 1C1CA 1VGYA 5DO2A 4PCQA 3GV7B 1XMBA 1UVLA 3NGUA 3HHLA 1FFGB 2KHDA 2M52A 3RAMA 4OJ3A 1RTHB 3RJMB 4WXOA 2XY6A 4I6YA 3CCLS 3AA8A 1YLXA 2OHDA 3AJDA 1F5AA 1RAGB 2FY8A 4KKOA 4DV6F 4QWEA 4ANEA 5G4DA 1KEKA 2CRLA 3B54A 1B0VA 3U1MA 3M2UA 3DU6A 5B0CA 2MGZA 1F5BA 3BO4A 4LIWA 2KYZA 4V1Ak 2EC2A 4KH1B 5AE2A 3C6TB 1UKUA 4IOAQ 2IIHA 3BSOA 1KP6A 5E0OA 4B9LA 5DDQC 2C3MA 2AJ4A 2PE8A 3WHIA 5DG9A 2OLWA 1RYSA 1MSWD 1FDNA 4QPXA 3HO1A 3PR4A 3PNIA 5J1EA 5CAAA 4O44B 2V9KA 1MWYA 2D9OA 1IJFB 5KT2A 3GU0A 3I9ZA 1X5SA 1VIXA 1WI8A 4ED5A 3VZHA 4NCGB 2KG0A 2MZTA 4QWBA 5J2NB 3V6KA 1QUVA 3S6EA 2FJWA 3QSYB 1D0EA 2OFHX 3GIIA 1AZSB 1HR0J 3IR7B 1SC1B 2AZ1A 5EWGA 1YJNS 1TKXA 1M5VC 2KZMA 2POKA 2UXCF 2GJ2A 2OJ3A 4O3OA 1CVJA 1W25A 1FXRA 2ZWPA 1HQUB 5KFSA 4FXDA 1T05B 2P6TA 4DR2F 1WUUA 2LQBA 4OZ0A 1YQHA 4J9QA 1OIAA 2W2MP 2IRUA 3BYRA 1S79A 2LCWA 2Z2LA 1M5OC 2RRAA 1YBUA 2E29A 4LRAA 3GYGA 3GFZA 1CJTA 3IN5A 4LUBA 2E5JA 1QAIA 2E7XA 3FEYB 1Y11A 1KVIA 1N5VA 3QO9B 4NLWA 2WHOA 2A18A 4I67A 3W60A 1SH2A 4CH0S 3RU0A 4HKQA 4E2FB 3NMRA 2YKNA 1L3SA 2Z56B 2GIQA 2YH0A 1UWBA 1TK0A 2FPHX 3GONA 1NPPA 3CUNA 1SV5B 4DR4F 3JQKA 3D1QA 3ZZPA 4WYWA 4RW6A 4U7CA 4W90B 3PACA 2D69A 2BV3A 2XMVA 1UETA 1URNA 2RDIA 2JHEA 3BKFA 4M5KA 4IDKA 2HW3A 4C0OC 2YX4A 3JSYA 4PYDA 3NKYA 4RJVA 1HWJA 3DRRB 3R27A 3OFHA 1I1GA 4OX8A 1HYSB 1HQEB 3KXDA 1M5SA 4K4XA 3KHLA 4DV2F 1U1QA 4RNHA 1UZDA 1DQ9A
chains in the Genus database with same CATH topology
1LKZA 3T5LA 5KFKA 4HH1A 1YRUA 5C42A 3T5HA 2CQBA 2V2KA 4MFBA 5J2PA 4MKBA 2IM0A 2ZJQQ 3NP5A 3KLHB 2P6SA 3THTA 4KTQA 5KFXA 2XO7A 3N28A 1C1CB 4PG7A 3UNGC 3EPIA 1NK4A 3AA9A 3VQTA 1TL5A 3GWCA 4DQRA 3MEKA 3EX7B 1FRIA 4I68A 2EFVA 5B0FA 3ZZTA 5J2MA 4DLEA 3LOUA 3VF0B 1JLFA 2P9EA 1FT8A 3LF0A 3M1VA 2KU7A 3GILA 2YNFB 4ZDNA 1U45A 4RW8A 1RTDA 4WFAQ 1RK8A 4QR2A 1SJ4P 4C8YA 1F9FA 5B0EA 1JLCA 2IVYA 3HHLB 1X4BA 4O3PA 4F25A 1TVRA 4ELUA 2ZKTA 4EEYA 1W2BR 3MDFA 1SQEA 1TAQA 3MHYA 4LFCF 4CNZA 2K1RA 2CPHA 3M32A 4YMEA 2GGPA 3QZ7A 3BQ0A 1FRXA 2AYMA 1VS3A 4NLOA 1N56A 1Q53A 4HI2A 4PUOB 2HS3A 3TUJC 2E1CA 2NREA 3GE9A 1Y3KA 1TAUA 3KMSA 3BGRB 3ZZOA 1KRPA 2UUTA 1TK8A 1RT7B 4MKAA 4TXSA 4KKOB 4NLDA 1XC9A 3EGWB 3OUYA 4J37A 2YY3A 2GJIA 3M2VA 3OFFA 1U24A 3QAEA 1JXLA 4C11A 4ZKAA 1TZ0A 2L08A 3M8PB 3MPYA 1UEVA 1YRXA 2XSJA 2YTCA 1N6QA 2BRKA 1N5QA 4ICLA 3M2UB 4DS5A 5E3PA 4Y28C 3G6XA 1YJWS 2WONA 4TKTA 3N5BA 4ETXA 2MGZB 1P27B 4NLRA 3OTDA 2DH8A 3LANA 4JV0A 4DL6A 4C8LA 4OLPA 3KG0A 4C8MA 5KAKA 5LSLA 3LAKA 1MNEA 4ZMMA 3S7RA 2XZWA 2X1GA 3TX8A 4EYHB 1V6HA 3NBPB 4QIVA 1KQKA 4ZPDA 1R8HA 2IRXA 3GFYA 3TAPA 3H5XA 2ZD1B 1K8AT 1WTFA 4FYDA 2LXFA 4D3GA 5F8IA 3N01A 4I7FA 2JJ4D 2CPJA 1S97A 2E7WA 1S49A 6FD1A 4N5SA 2R8KA 4K5RA 1SJ3P 5C25A 3DLHA 1GX6A 1R43A 2PMHA 5KFBA 1UJ6A 2CJQA 1GX5A 2YKAA 1H3DA 2O66A 1TKDA 4TU8A 4TQRA 3MXHP 1O51A 3V6DA 2BACA 3QWPA 4A46A 3RB4A 5CYMA 5A6PA 5KFYA 3H4BA 4YR3A 3BEGB 2CJ9A 1ZZFA 4OV1A 4DV5F 1OS5A 3KOAA 5CZVA 2WB4A 2J9DA 2WBMA 5KTQA 5A2QY 3KJVA 5J1EB 4C98A 3K5MA 3E3XA 4YB6A 5I42A 1EP4B 2CPFA 2B56A 3MOZA 4JI1F 2GNKA 2KJWA 2XGQA 1NHUA 5F8NA 1CPZA 1SH0A 3FSIA 2F8MA 3UFCX 4MAKA 3OXLA 1D8ZA 4HT7A 3F41A 2DRBA 4KV8B 4ZPBA 4IH6A 4GC6A 1TL1A 3MEEA 3MM5A 3R5DA 5KT3A 4LJMA 3NNCA 4FS2A 1FJEB 3DLBA 4ZPTR 1KQSR 2DGSA 4FF1A 5B08A 3U02A 2CQ3A 2MKSA 5K9FA 5EUHA 5EX3A 4JI5F 4QJVA 4NMLA 2KRRA 4OI1A 3TW0A 4ZCKA 2XWYA 1LWFA 5GVQA 1U1RA 3R5CA 2DJWA 4H4KA 3OR1B 3CJ3A 3SCJE 2GMJA 3OTCA 2Q6CA 3OVSA 3HM9A 1ZTTA 2FJVA 5SUHA 1NU4A 1DQ8A 2ACYA 4ILRA 5KFVA 3PY8A 4DWIA 4DL3A 5KFWA 2KT3A 1DFDA 2EFGA 1RT4A 2HNZB 3KG1A 5EDWA 1IBLF 3X3UA 3JYTA 1VQ7S 4DMZA 2DBBA 1L3TA 2BBEA 2RB7A 2XS7A 3DRXA 5M2PA 3MMCA 1RTJA 1GXLA 1GXTA 1WHWA 2M3DA 3POTA 4C8NA 4JV5F 1PO6A 2OIHA 3MM8B 1HL6A 4IR1A 3VAMA 2E66A 2DNMA 3MECA 2KKHA 4I2QA 4K50A 4F4KA 2DK2A 1VLYA 4H4MB 5DGBA 1JLEA 3THVA 1NK7A 1TKXB 2AYGA 2XLIA 1ZM9A 2QV6A 2WOMA 3N0VA 3PEHA 5KG2A 4ECZA 4A8SA 2FD2A 4QOTA 2XWXA 2IM3A 3CTRA 4E8UA 5KT7A 2R2TA 4RX6A 1S6PA 2ZOMA 4JI3F 3Q22A 4A8YA 1Y7PA 3FNNA 2UUBF 4Q8FA 1Q7YT 4IQXA 3BB5A 3HVAA 2ZH5A 3CCQS 1AUDA 1HWIA 3H5UA 2X1FA 2XNQA 2DH7A 4IFVA 1B7FA 5KFDA 2DR5A 4DN0A 4C3MA 1C4CA 2RT3A 3DOMA 3HI9A 5A8RA 2AX1A 1DAXA 3ZZRA 3TA1A 2IJNA 4BWJA 2VPXB 5KT6A 4V19J 4CQ1A 1HNVB 1OSCA 5T7LB 3CCTA 5DGAA 1XEZA 2OFGX 2BABA 2WRMA 2D3ZA 3DXSX 2DB1A 4I1TA 2KZZA 3IXQA 3KLFA 2ROGA 2KVIA 2R8JA 1FVSA 2CQPA 2D3OR 2OPSB 2MYFA 1HMVB 3LGMA 4H4OA 3HX9A 3Q24A 3JTNA 2W9AA 4PXBA 2KO1A 2UZAA 2DCUB 5HROA 3DRSA 1NK6A 5D3GA 5HN0A 5I3UA 4QYZJ 3DLEB 1S1WB 3QYYA 4DSJA 3GQCA 5L1LA 3PO5A 4X84A 2C2EA 2XG8A 3UDLA 2ZZNA 2EG1A 5D77A 1KS2A 2HNDA 5KFFA 3CCSS 4IKAA 1S10A 2AJQA 1A6LA 2BOPA 4EUVA 4MK7A 4DQIA 3CD7A 3SCIE 1DQAA 2B43A 2J7UA 2OH2A 3M2RB 4WTYA 5DM7Q 2M8DB 2B5JA 2AF6A 3OFGA 2OPPA 2DGVA 5AXKA 3N4WA 4KGMA 4RW7A 3MR2A 2OPRA 3NS6A 3TI0A 2DPIA 2DRAA 3KK1B 3KYLA 3MZIA 2DVIA 2V8DA 5A8KA 3PZPA 2YKNB 2MJUA 4EYIB 2LMIA 3I0RA 3TVKA 2O67A 5CD4H 1RWUA 1FCAA 3Q2SC 2FVCA 2MB0B 1MMDA 3M6VA 3EGNA 2RRNA 2HG4A 2W4CA 2DGWA 2UV8G 7FDRA 3PX4A 5EN1A 2N7CA 2PN6A 4DJBA 4IYQA 4O3QA 4KFBA 4YDXA 2JL9A 5HLFB 5A8WA 3TANA 1P6TA 4YUDA 1E6VB 3V5RA 4DEZA 2CQ0A 3H5SA 5LSRA 1S1UA 4M94A 3NL0A 1K9MT 4IH5A 2I8EA 1FERA 2XMMA 3D54A 1NAQA 1ZPVA 4RW6B 3RAQA 2VG7A 1HD1A 3BSAA 2KG1A 3SFGA 2YNGA 4KE5A 3W2WA 4PWDB 2IAJB 5JUMA 1AFIA 3BR9A 1UVNA 5KFRA 1KOHA 3GIMA 2JFDA 2UXDF 1IXKA 4Y2MA 4AXJA 4DDFA 1X4DA 1S1TB 4WK3A 3KLGB 3ENQA 2NUHA 3LPYA 4NLSA 2RE1A 2ZJRQ 2V4RA 3J7A1 2YKQA 1V3RA 3BO2A 2YX1A 3M8QA 3ISNC 3MUTP 4IDKB 3LP0A 1HNWF 4DSEA 2FJXA 3MPWA 3OHBA 5THWA 1FKPA 5KFEA 3NNHA 4FVCA 3DM2A 4ED3A 4YY3F 4ZK7M 4B9VA 1X9MA 3W2VA 4RU9A 3K8VA 3QGHA 3NRBA 3HJFA 4X4NA 3DN9A 3ITHB 2XS2A 2GQCA 5GAGI 3KLEA 2VONA 1FA0A 4RW9B 2B51A 5KFGA 2J0WA 1YHQS 1R0AA 1SL2A 4F67A 4M5DB 3LP2B 2D9PA 3IR5B 1LW0A 1Z1ZA 3T6JA 1XR5A 4JV1A 1QTMA 1N0UA 4OMFG 5FLXY 2KTQA 4AE5A 1DTQA 5CYQB 3CJKB 4MIWA 2MKIA 1E6YA 2G13A 4IG0B 3V4IA 1NB7A 1YJRA 3Q8SB 1LWEB 3K59A 3FMBA 4NA3A 3K58A 1N8RT 3UI3A 2CVIA 3RB6A 2CZVC 1RTIA 1XK8A 4H4KC 4UQGA 3CGIA 1Q1KA 4FBUA 4ID8A 1QAXA 1DARA 1S0OA 2L9WA 1OQ3A 2MQPA 4O3RA 4QYRA 2NUUG 5J2PB 1C2PA 1QAYA 4MFBB 4KSEB 5MLCV 3H2VE 4DV3F 1NKBA 4WYLA 3GR0A