3HHNB

Crystal structure of class i ligase ribozyme self-ligation product, in complex with u1a rbd
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the catalytic core of an RNA-polymerase ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
molecule keywords U1 small nuclear ribonucleoprotein A
total genus 22
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hhnB00
4W90B 2OSQA 2RU3A 3CCSS 2CQ4A 4WFAQ 3THTA 1VC0A 2KFYA 1OPIA 1SJQA 2JVOA 3VAHA 1RK8A 1VQ4S 1URNA 3MUMP 1SJRA 2OIHA 1U1NA 3ULHA 3I56S 3VAJA 4TLQA 2MZSA 4F25A 1JJHA 1WEZA 5D77A 1CVJA 2MKKA 2JWNA 4W92B 1WHXA 2X1BA 2MPUA 3R27A 2CQ1A 2MGZA 5GAEU 4IUFA 1X5OA 1N52B 2X1AA 1VQ5S 2KXNB 3P6YC 3TO8A 2J0SD 3K0JA 2DHSA 1U1QA 2DGUA 1VBZA 2MZ1A 2CQ2A 1U1RA 3Q2SC 3JB9k 1FNXH 3S8SA 1S79A 1H2TZ 2CPEA 2EVZA 3I55S 1N54B 1X0FA 2MSSA 1FJ7A 2I2YA 3G9CA 1VBXA 5GAGU 2YH1A 3VAMA 5FJ4A 2MMYA 1X4DA 4F26A 2DGQA 4IO9Q 2F9JA 2HVZA 3SDEB 1D9AA 5LSLA 1M90T 2L9WA 5BJRA 1DHMA 2DNRA 5LSOA 5GADU 3LPYA 5GAHU 1H2VZ 2XNRA 2DISA 2CPFA 1U1PA 3BS9A 4LJMA 3BO3A 3MI7X 2QFJA 2AYGA 2CQIA 1IQTA 2WBRA 1JMTA 1O0PA 2MYFA 2MQNA 2F3JA 2E44A 4QU7A 4PRFA 2E5HA 2HYIB 2GO9A 5MLCV 4ERDA 5IQQA 1X5PA 4V19X 2MY7A 3U1LA 5HL7Q 1VQ6S 1QM9A 2N7CA 3CCUS 2M8HA 1N8RT 1WF1A 2MHNA 3SDEA 4TU8A 1YJWS 1X4BA 1WELA 2M4MA 1UW4A 2VOOA 2CQ3A 1OWXA 4CH0S 1WEYA 2DH9A 3N9UC 1K73T 1WG1A 1WTBA 2AYMA 5H1SV 1X5SA 1HL6A 1YJ9S 2N3OA 1KOOA 2OJ3A 2CQ0A 2KM8B 2ZJQQ 1KOHA 4Y0FA 3ZZYA 2D3OR 1YJNS 2M70A 2RRAA 4U67Q 3BO4A 2DNOA 2CPHA 2XS7A 2CQBA 3NS6A 3VALA 1B7FA 2KG0A 2OTJS 1JJ2R 2DNNA 1UFWA 2DNLA 2FPHX 2KN4A 3TYTA 3CUNA 3B4DA 3G6ES 2LECA 1VC6A 2DIUA 2RS8A 3HI9A 4OZ0A 1M5VC 3CC4S 2M0GB 5DETA 4UY8T 3P49B 2YTCA 1Q81T 2RNEA 3TP2A 3ZZZA 2MQOA 5LJ3Y 4WFNQ 1SJFA 3G8TA 3BO2A 2LCWA 2K8GA 2KVIA 1QVFR 4BS2A 2BZ2A 1DZ5A 1FXLA 2DNKA 1M5PC 2J8AA 2MQLA 5DDQC 1H2UX 3CCVS 1Q7YT 2NZ4A 3NMRA 3CTRA 2M8DB 1R8HA 2MKHA 3D2WA 2RUGA 1N88A 2LQ5A 1YTYA 1WI6A 1VQ8S 4UQTA 1F9FA 1WHYA 2MQPA 1X4EA 4M5DB 2A3JA 3CF5Q 1WHWA 2X1FA 2YWKA 1WEXA 2M9KA 1YI2S 3U1MA 2DH7A 1FJEB 1WWHA 3CMAS 2KT5A 1M5OC 4WFBQ 1VBYA 2M7SA 3MD3A 2B0GA 5LXRA 1VC5A 3V4MA 2AD9A 1WG5A 3R1LA 2G4BA 3MXHP 3UWTA 2DGSA 1X4CA 3L3CA 4YUDA 2DGTA 1NO8A 1UP1A 3UD3P 1WG4A 2J76E 5JVHQ 5IM0B 3P5TL 2LXIA 3UE2A 2CQHA 3CCMS 2G1DA 3CC2S 2EK1A 2MKIA 3IWNC 1OIAA 1M5KC 2HGMA 4IOAQ 2ZJPQ 2FY1A 5CXTA 2MQMA 1KQSR 2HZCA 2D9PA 1UAWA 2I38A 3CXCR 4CQ1A 2FC8A 3CCLS 2L41A 2CPYA 3G8SA 2KRBA 2UP1A 3FEXB 2M52A 2HGLA 4ZKAA 3VAIA 2DB1A 1VQPS 1ZH5A 2LKZA 3EGZA 1PGZA 1QVGR 2L08A 1KC8T 2LA6A 2PE8A 1YITS 2O3DA 1DBDA 2EK6A 3NNHA 2LEAA 1U2FA 3DXBA 2DNYA 4F02A 1X4GA 1X4AA 4QPTA 2CPDA 1ZZNA 2CPXA 2LEBA 2DHAA 1FT8A 3CCQS 2NLWA 1AUDA 4A8XA 2MJNA 3CMES 4P6QA 1NJIT 2KYXA 2JVRA 2MZQA 1OO0B 2FHOB 1D8ZA 3US5A 2DK2A 2FC9A 1VQOS 2ADBA 1Q82T 2MY8A 3UCGA 2MKSA 1XN9A 1U6FA 3VAGA 2XS2A 2J0QD 1U1MA 1U6BA 3VAKA 1PO6A 4CIOA 3G4SS 1G2EA 3J7YU 5DM7Q 1U1KA 1VQMS 4FXVA 5HO4A 5DDRC 1YIJS 3MDFA 2U2FA 2LMIA 5D78A 1W2BR 2MKJA 3VF0B 2JX2A 3CC7S 3HHNB 1NU4A 3H2UB 4Y00A 2ZJRQ 1WF0A 1FO1A 2CPZA 1Q86T 2XS5A 2XB2D 4FXWA 4J5OA 4RU2A 2KXHA 3R1HA 1FJCA 4QU6A 1X4FA 3MUVP 2DNGA 1K8AT 3EX7B 2CJKA 3CCRS 3Q2TC 1VQKS 2CPJA 1VQ7S 4OZ1A 1A9NB 1VQLS 2M88A 2E5IA 2MB0B 3NNAA 1SJ3P 2XSFA 2G0CA 3UD4P 2V94A 4EGLA 1SXLA 4C0OC 3OW2R 1SJ4P 2VONA 1S72S 3G96A 2LYVA 2MZTA 2DHXA 1HD0A 2E5JA 2DNPA 4C4WA 3J7ZT 5IM0A 2OTLS 2KXFA 2RS2A 2DGWA 1M1KT 2XNQA 3DLLQ 2RRBA 1H6KX 2KH9A 1WI8A 5GVQA 5IFMA 2MZRA 2E5GA 3MUTP 2DNMA 3BEGB 3RW6A 2DH8A 5ITHA 4C7QA 1RKJA 2QA4S 1U1LA 4CH1A 3CULA 2RT3A 3SXLA 3LQVA 2DIVA 3CCJS 5LJ5Y 5LXYA 2RVJA 4TU7A 3IRWP 2LA4A 2DHGA 1X5TA 2KU7A 2SXLA 5CA5A 1VQNS 2X1GA 1HD1A 1FHTA 1ZZFA 4WF9Q 3NS5A 3S01A 2DO4A 4YB1P 2AYEA 1X4HA 2D9OA 1DRZA 1VQ9S 2BOPA 1YHQS 3S7RA 4Z2XA 2Q79A 1HA1A 2MXYA 2VODA 3S6EA 2CQGA 3B4MA 4WKRA 2DITA 1P27B 5CYJA 3THPA 3UCZP 1BY9A 1K9MT 4WCEQ 5JVGQ 1P1TA 1YWXA 2DNZA 2DNQA 2MKCA 2CQDA 2ADCA 2CQPA 2GHPA 1JJ4A 3G71S 3CPWR 1U1OA 2KI2A 3PIPQ 3CD6S 2RQCA 1WHVA 2MZJA 2MQQA 3P3DA 2KG1A 4LIRA 2PEHA 4TU9A 4PR6A 4QQBA 2ERRA 2N3LA 2JRSA 3VAFA 3SMZA 2LXUA 3NNCA 2RQ4A 2YKAA 2KRRA 2MSTA 2M2BA 1L3KA 2DNHA 2DGXA 3H2VE 3CCES 1WF2A 3MOJB 2VOPA 5EN1A 2N82B 4PKDB 1A7GE 3MURP 2F9DA 2KHCA 3EGNA 3MD1A 2DO0A 3RW7A 2DGOA 2DGVA 2HGNA 2CPIA 3FEYB 2MJUA 1R8PA 5DDOC 2AYBA 3PIOQ 2QEXS 4LMZA 2MGZB 5DDPC 4WIIA 2K3KA 3UCUP 4ED5A 2YH0A 5DM6Q 1KD1T 5GMKa 2U1AA 4YOEA 2OSRA 2KM8C 4IOCQ 2CQCA
chains in the Genus database with same CATH superfamily
2XHCA 2OSQA 3EZ5A 4NASA 4DCJB 3CCSS 3AD7C 2AGOA 2M3DA 4RW8B 5D15A 4Q7AA 1LK7A 1NAQA 1SJQA 2VZ9A 1G6BA 4I7FB 4B3RJ 1RK8A 3RYLA 3W62A 5T41A 1QAYA 1VQ4S 4MK7A 2OKQA 1EETB 2V68A 1URNA 2D7SA 3KJQB 1SJRA 2WVEA 3BH7B 3LO3A 2OIHA 1IJFB 1B0VA 3NGSA 1U1NA 1TV6B 3ULHA 2RE1A 1ZM3A 4J9PA 4DPOA 1RTHB 2NXUA 4L3NA 3VAJA 4F4WA 2ZNZA 1REGX 1XWLA 3OLAA 4MAKA 4ZLLA 2MZSA 4U6PA 4X64F 3I9ZA 4H4MB 5LMNJ 5C7PA 2Y1LB 4IO1A 2E1RA 4M5IA 1VIXA 1CJKB 2GJ2A 2C3UA 1HNWJ 2VPYB 3KLHA 3R27A 5KFCA 3M9OB 1R8CA 1BHNA 1X5OA 1C0UA 1X0PA 4TY8A 5IC6B 3W9HA 1ICEB 1UZHA 4QW8A 1OSCA 1PBUA 1EQMA 5E33A 1VYAA 2CQ2A 4ZPBA 1U1RA 1YRXA 3Q2SC 5A2QY 4F4AA 4JV5J 4KGVB 4IG0B 1X7VA 1K0VA 1U2CA 4DR1F 2ZE2A 5GAHI 4O3NA 2CPEA 4RW7A 3JSBA 4YR0A 4QYZJ 4NLYA 5K8NA 3PACA 3O44A 1S1XB 2MSSA 1X0FA 4RJVA 1WACA 1ZM2A 5EX3A 1C0TA 3LALA 3G9CA 1QY7A 2O66A 1FA0A 2V4JB 1WORA 1VK8A 1ZBTA 3PY8A 2HS3A 5FJ4A 3I0SA 1JLGB 2E1PA 4IYQA 4JOUA 3OTOJ 1X4DA 4F26A 4J9OA 4DR5F 2F9JA 1B7YB 4AL5A 3SDEB 1U26A 4ZVGA 3GJSB 1C1BA 5LSLA 2L9WA 2YPZA 1L3TA 2OPPA 2CZ9A 5B09A 5GADU 5GAHU 3G82A 2EBGA 1S10A 4GO7X 3SCIE 1YBTA 1SVDA 2XNRA 4K0KJ 4DV2F 2R42A 2D69A 4ZVSB 1FFWB 2R8HA 2UUBF 2BQUA 2CPFA 3A3PB 5HAOA 1U1PA 2ZH3A 3FSYA 2HFOA 3D6HB 2POKA 3I0RB 3MM7A 4KRWA 3TQ1A 2AYGA 1JLAA 4LF8J 1LW0A 5MAOA 1UVLA 3NNHA 4FF2A 4UT4A 4ECYA 3EXYA 4LRBA 3Q8VA 1JMTA 4BLGA 2EW9A 5KFPA 5C24A 2M5YA 2F3JA 5L38A 4WK1A 4QU7A 3M8WA 3MAAA 3A8IA 1FRKA 3AQOA 2A6OA 4ALZA 2NREA 4PRFA 4MKVA 5KG5A 4KHMA 3ZZ0A 3Q8YA 3LP0A 1PJ6A 2A1BA 1JXEA 4GVBB 3OSNA 5IQQA 1F5BA 1HWUA 5DO2A 1TELA 4DZDA 1X5PA 3KTQA 4C8LA 5HL7Q 1NZAA 5THWA 4Z7CA 3DRSA 5G0RB 3B82A 3CCUS 2UUAF 3F73A 1BD6A 1VJWA 4LR7A 1P6TA 4YB5A 1YJWS 1LWCA 1HMVB 3D54A 4KR0B 4OLPA 1BQMB 2LEPA 3PXGa 5AE3A 3MCSA 4F3MA 5A2QU 1D8YA 2M4MA 2R8KA 2A2CA 2E7WA 2V4JA 3AJ2A 2VOOA 3QFHA 4K4UA 2CQ3A 4UUWA 1UJ4A 4C3KA 4CH0S 2WSFC 4YY3F 2YNFA 3PJXA 1SPBP 3NOGA 1WG1A 2AEMA 1KHVA 3OTDA 4B08A 3AD9C 2AYMA 3DOLA 4RKUC 2XCAA 4N8NA 4IQXA 3POTA 4WYLA 2N3OA 3LP1A 4LBHA 3W5YA 1XBWA 1LW2B 3NCPA 2C3OA 2MDAA 3VZHA 2RAQA 1IXKA 4NE9C 3KG1A 4USTA 2MLXA 2GQ2A 1H7WA 2AJ2A 2HNDA 3F56A 1TP7A 3G87A 3R5CA 1NK7A 3M8ZA 2GJFA 5HMYA 3T41A 1P8GA 1S48A 4JI3F 3HVWA 2YWGA 3C6TA 4U67Q 2DY9A 2P5VA 2R8GA 2DNOA 3AA9A 1HBNA 4OHZA 4B3TF 2CQBA 2B4VA 3JTPA 1RTIB 2XS7A 4DF8A 4A8MP 2IMOA 2W7PA 4Q43A 2PMHA 1VLYA 2DNNA 2BR0A 2BRLA 1UFWA 3QGPA 2KN4A 4C2MA 3KJVB 3TYTA 2FJWA 3IR7B 2BM0A 3HJFA 2LDIA 4KGXB 1KONA 1VC6A 3AXMA 1Q7LB 2DIUA 4OZ0A 3HI9A 3CC4S 3P49B 2M0GB 5E7OB 1Q81T 2MQOA 3OLBA 3LTOA 2C22A 2DJWA 4QIVA 2GGPA 1SJFA 2A2DA 3KXDA 4FYXB 2MTLA 2O67A 4C11B 5I4MA 3HLUA 2W9AA 1T03A 3K5LA 2LCWA 1HBUA 2ZDPA 4OHXA 1VR6A 2IJFA 3KK2B 3EPGA 2NCKL 3KUHA 2DNKA 1FXLA 3CNQP 5A8RB 2P9EA 1N0VC 2D3O1 2C3MA 3UVJB 1BUXA 1KS2A 4O23A 2V5HG 1IM4A 1B99A 2OLWA 1GNKA 2NZ4A 1RSCA 5DGBA 1NSKL 3SV4A 1EHWA 1AB8A 2GMLA 1V3RA 4NLQA 4YR3A 3D1OA 1R8HA 2BW7A 2ZBRA 3D2WA 4ZITA 1F9HA 4FNIA 2LQ5A 4CLPA 2OI2A 1YTYA 3R7SB 4DV4J 2EFOA 3M8PA 4HVZA 2ZC3A 1SV5A 3H98A 3CULA 3V6HA 3L7PA 3DCAA 4GMKA 2KTQA 1MU2A 4RNFA 5HQMA 3DGVA 2H5JB 4L6V3 4CLZA 1T9WA 3KUEA 1WEXA 2LQ9A 3IRXA 4XPCA 4S0MA 4K4WA 1CG2A 1Q1KA 1H0HB 3MEGA 3LANA 1RT2B 2OPRA 3CMAS 2H4WB 1Q8KA 4DWIA 4WFBQ 3SYZA 4DSKA 1RT1A 4DPXA 1G7CB 2V50A 1VBYA 1FWKA 1APSA 4HYKA 5GADI 3MXHP 3V4MA 2AD9A 1WG5A 1QUPA 3CMQA 2K1RB 3E01A 4P72A 3R1LA 4Q5VA 4Y2CA 4A8OA 1YGYA 3DRXA 4JBCA 1NO8A 5J1EB 3UD3P 2FHJA 2C3PA 3DNCA 3HSDA 4R8UB 1UA0A 2B4OA 5ETOA 2ZD1A 2JJ4D 2KKHA 2WW8A 3UE2A 1JLFB 5AJ3J 4LFCJ 1P9QC 3MPDA 1MNEA 1RZMA 3CC2S 1V5IB 5EDWA 2ASJA 1FD8A 1KLNA 1WKKA 3BGRA 3RAMA 4U9RA 3LWMA 4WZQA 1OIAA 1TZ0A 4A8WA 2Q66A 5KT2A 3QLHB 4L76A 2HGMA 5HJXA 1FDBA 4CLYA 2CG4A 1ZTTA 5CYQA 1NNDA 1IWAA 1QUVA 3QT6A 3SIPB 3LGHA 2E9RX 3H20A 3QNWB 5CXTA 3BGFA 3HM9A 1V6HA 1X9SA 4JI1F 3KDNA 3U1NA 1IQZA 1REVB 4CLSA 3JS9A 1Q8LA 1TKTA 1UAWA 2I38A 5D6GA 4ICLA 2H4YB 3I87A 3MPWA 4Q44A 4TVAB 3PEJA 2FC8A 2O1PA 2AJQA 2ACYA 3D4JA 3KHHA 3CCLS 2XULA 3KUGA 4DR2J 2BE2A 3OL6A 2KRBA 5C2GA 3EGZA 1LK5A 2VPWB 3MPYA 2PT0A 3QJJA 2I0XA 1JLCB 3TAMB 1RQ0A 2FGCA 1QVGR 1FWPA 3MM5B 1WOOA 3OL8A 1PILA 2O3DA 3CJQA 3HSZA 3PRVA 1DBDA 1DY3A 5HVFA 3UNGC 1FKPB 1E6VB 5ETLA 5I42A 2QYGA 5F8GA 1UKUA 4B3SJ 3T5LA 1I6JA 3A1YG 5E3RA 2G0IA 1CJVA 1XNRJ 4OV6A 2OD6A 4IDKB 4QPTA 4NPOA 3NGKA 3MAQA 5T7LA 1TL1A 3TX0A 4IDKA 4CO5A 1FT8A 1HW8A 1SC1B 2H3EB 5AXMA 1QD1A 4WK3A 3CMES 1T9TA 3OVSA 2UV8A 1IM6A 3M05A 1HI8A 2IM1A 3JQMA 2W2PP 3LA0A 4USIA 4CZCA 2JVRA 1Q4RA 4ZHRA 4PEOA 3ZNUA 4FF1A 1GX6A 3BBFA 1LNQA 1WJ9A 5E3AA 5KFUA 3QZ8A 2XZDB 2BKNA 2BJ1A 4HI2A 1RAJA 1S1VB 4H54A 1D8ZA 3US5A 2FC9A 1NDPA 4DLGA 5CYQB 1UFLA 5KFMA 1XNQJ 3EVMA 5D4PA 4DX8H 1B3TA 3T1HJ 1U6FA 3VAGA 3M9NB 4DL5A 3ETOA 5ETMA 5L1LA 3GZ7A 1NDCA 1HI1A 4CIOA 3J7YU 5DM7Q 3L7UA 1YSJA 1TL5A 1U1KA 4F2SA 4F0KA 2FGOA 3GFXA 3Q86A 2A0FB 4FXVA 1R8BA 2VG7B 2NYHA 2JFDA 4IFVB 5E3PA 5KT4A 5DDRC 2DTJA 1R89A 1EAYC 2HK3A 1GEHA 3MDFA 3W66A 2CDRB 3CDAA 2JX2A 4JV0A 1LWFA 1NU4A 4J9KA 4GRSA 3OD2A 4URQU 2CPZA 1K47A 4OYPA 2QL7B 3N0VA 1RT3B 3ENQA 4FXWA 3FGVA 4J5OA 4QYZK 2IRYA 1FJCA 2FHMA 2PMWA 5ETKA 4QU6A 2HIQA 3QWUA 4LF2A 3RJMB 3HK2A 3ZTSA 1S0NA 3QGGA 1MMDA 2E66A 3G8QA 5KG3A 3TEGA 3H25A 3E2EA 4YN3B 2CJKA 2V69A 4R8UA 4YY3J 3MCNA 2RJZA 3DU5A 4DSJA 3CJRA 1PC4A 4J9RA 5F3TA 1L3SA 1VQLS 2E5IA 4NLRA 4DCPB 2XMTA 1IKYB 4KPCA 2JEJA 4J91A 4ZLJA 4DV3J 1KTQA 4TYBA 3R5BA 3DLKA 3UD4P 2HHHF 2FZCB 3HSGA 3QIPA 4ZLPA 3FBBA 1KDNA 1RA6A 1S6QA 1EJ7L 1SXLA 2HFVA 3M8PB 4C0OC 3OW2R 3M30B 1HR0J 3V6DB 3LUYA 1MG7A 4M63A 5KT7A 1S72S 4OYOA 4NLGA 4UTGA 1N33J 3DDKA 2IMWP 2HLUA 1Y5NB 1VMBA 2FUG9 4L75A 4ENOA 1NBEB 1HD0A 2B4PA 4A4JA 4DR3F 2ZH7A 2NR0A 3N4WA 4F4KA 2B7CB 4MIAA 3V81A 1CJUA 3ZZOA 2FYXA 3T1YJ 4NZ7A 3K5NA 2WTFA 4GVLA 4MYTA 4PZVA 3FSIA 2FJVA 2HAIA 3VCDA 2RRBA 3UN2A 3AOCA 1H6KX 1FJGF 3LAKA 5IFMA 3RB4A 4IFVA 4QYRA 5E0OA 1JNZB 5DZ6A 3U7JA 2QT7A 1SL0A 4CDIA 3DLBA 1XMOF 1AT1B 3QSYB 4HDHA 4HT7A 1QLNA 2LU2A 4J9NA 2XSJB 1U1LA 2DHHA 1O51A 2L3MA 3C16B 3MMAB 4CLTA 4CH1A 1WUUA 4NCGB 3SXLA 5DQHA 2DIVA 1T9VA 2BX6A 4OJGA 4D3HA 1RWPB 2VL1A 5I3QA 5HI7A 3CCJS 1RISA 5LJ5Y 1XMQJ 2KZMA 1T9XA 1R27B 5LXYA 5D0GA 4LF6F 3IRWP 4M5HA 3NMAA 1NCLA 4ZHRB 2ZVIA 3IFEA 1X5TA 2CNLB 5B0EA 1TMMA 1VQNS 2J9EA 2YNGB 3IBFB 2X1GA 4ZVPB 1ZZFA 3O5TB 2HNDB 3KJVA 2PSZA 4FDFA 4OI6A 4TKTA 3TR5A 1BXNA 3IAS9 4MYUA 4YB1P 2DO4A 1ZOTA 3BSOA 3TI0A 1LQ9A 2D9OA 2RB7A 4HTJA 4QR1A 1DRZA 3QRRA 2VQEJ 3V6DA 4LF7F 1HBNB 3CT9A 3TJ8A 4USMA 1HR0F 4IH6A 4ZMMA 3D6MB 4EZ6A 3S6EA 3DLGB 1RKIA 4EBCA 3PRDA 3WZ0A 1IR2A 1RHRB 4XDCA 2OEMA 1XMBA 1JLCA 1LKZA 1ZTWA 3UI3A 1QSYA 4DUYF 4B9LA 1S4FA 3BKTA 3IG1A 1PIEA 3M6UA 3D28A 1QTNB 3THPA 2CJ9A 2HBQB 3POTB 3W7BA 2MHEA 5IQ6A 3KLEB 5B08A 1RWMB 2ILYA 3M1VB 3DGPB 1IBKF 4C0BA 1FF2A 5KOXA 4PQUB 1YWXA 5CH7B 5GAEI 1HNIB 3TX8A 1T7PA 2ADCA 1JJ4A 1N56A 4UW2A 1RCXB 2HFUA 1HQUA 4XO0A 1Q95G 2HNYA 4DR7F 2H54B 2KI2A 3PIPQ 4KHPJ 1RYSA 2V8VA 2A6MA 3TA1A 1UL3A 3O6QA 2I6WA 2HG4A 3DI6B 4USHA 1PBAA 4DUTA 1FRHA 1PAUB 3MECA 4KYZA 5K14B 3IS9B 3ZO7A 1XNRF 1JJCB 4NXMJ 1NB2A 2MZJA 2WVFA 1Q5VA 1U0HB 2FY8A 3L95X 2RSQA 3NBPA 2W2QP 3P3DA 4H4KA 4LIRA 4USKA 4C8MA 4AE5A 4FKXA 2CNOB 2NPFA 2RD5C 1EZZB 1JLQA 2YKQA 4OI3A 5JMNA 4WZMA 3OR2A 1FRIA 2GVZA 2FIUA 3ZNJ1 2NXEA 4B9NA 4BDPA 1HARA 4KE5A 4DL3A 1HPZB 1HIYA 2YKAA 4MJKA 4IRKA 1NEEA 5B0BA 2MSTA 1O8BA 1L3KA 3W2WB 3PX6A 3K58A 5L8RC 1ELOA 2Q43A 1NKCA 1RBAA 1MN9A 1S5ZA 2XMUA 3G82B 4I2PB 3T9NA 5C24B 2IC3B 1E6YA 2PEBA 3MHYA 5K8MA 3CCTA 1LW0B 4R5PA 3V6JA 2VOPA 1BWVA 2HHVA 4NLDA 1TUWA 3ISZA 1TMJA 1ZPWX 3UD5A 4EZ9A 2YKPA 2HVHA 1Z4UA 5HP1A 4CLWA 1FEEA 2XWXA 4BWMA 2BQRA 4DV1F 3TAQA 4DXLA 3ISNC 4RUCA 1KN6A 5E41A 3ZTQA 3CSKA 4HDGA 2XTJP 4LRCA 1RU2A 3K5OA 2YKMA 2UXBF 3EJMA 1J5EF 2DO0A 2Z0GA 4G1PA 1FKPA 2DGVA 3W61A 3I32A 1FD2A 2CZ4A 1YRTA 2HZAA 3FEYB 2F40A 1PC5A 5DDOC 2AYBA 3RGIA 2LQJA 3MAHA 5BYRA 4LMZA 2XY7A 3P6YC 4CO2A 1WC3A 1CS4A 5CZXA 2RF2A 3FQKA 5DDPC 1BWEA 4DQPA 3GSIA 3EYZA 1F9EB 2BE2B 2IA0A 3GR0A 1RT4A 2AU0A 4GKKJ 2ZC4A 9ATCB 5A8RA 1BLUA 4M8LA 4U95A 2Y8WA 4NYOA 4P2XA 4HI1A 4JI6F 1ZA1B 1OQ3A 3GJQB 4K5SA 2L9DA 4TY8B 1FJEB 1FVSA 4Y2MA 3GTYX 5KFYA 2CQCA 1T03B 1FNMA 1NUEA 1OPZA 4RW9A 2KFYA 1OY9A 1OPIA 3VWSA 4DU8A 2JVOA 1EETA 1S76D 3PX4A 2JEGA 1I1GA 1XJWB 2ILZA 4WYWA 5F8LA 3JQJA 1SH2A 2WSCC 3EDRB 2NSBA 1S4EA 3AB2B 2ZNYA 7FD1A 2GS8A 5F8MA 1A0OB 5AJ3F 4UOFA 2XGPA 3BQ1A 4OI4A 3M8YA 3ZFVA 2V9WA 2UXDF 1JJHA 5ETVA 1CVJA 3D68A 3BREA 2MKKA 3W8GA 1WHXA 5B7WA 5H9EK 3RB0A 3LP2B 3WQPA 3KLVA 2VQEF 4U7UK 3R2CJ 1S1WA 4MFBB 2E7VA 3HHLB 3TO8A 4UOGA 2KXNB 1VQ5S 5A0YB 2K2PA 3IBCB 1RT1B 3LP2A 3K57A 2DGUA 2XMWA 2UXCJ 3MM6B 3LP1B 1KQKA 4IRCA 3EVWA 1RT2A 4P75A 4DBQA 2V4QA 2ZM6F 1FNXH 4JI0J 3HO1A 1RHKB 1RAOA 3OV7A 4I56A 1SH0A 2J6TA 3PFEA 2EVZA 4KQZA 1N54B 2AT1B 2RF2B 3EGWB 4K7QA 1CBKA 3A12A 3EUNA 4PYDA 5F9NA 1RYRA 5IXUA 1FJ7A 2RHQB 1RAEB 2HKEA 2WVCA 3G6XA 1LV5A 3TWZA 1BQMA 2OO4A 1QAIA 2ZZMA 2G2ZA 4LBIA 2DGQA 4QJVA 5KFOA 4IO9Q 1HHQA 2HVZA 4NXMF 4B9SA 1T05A 3GYXB 1G4CA 4OYBA 5F8IA 2OPSB 4X66F 1DHMA 3QO9B 1H2VZ 3MM9A 2JL9A 4CP5A 2J9DA 2AV5A 2LLZA 5IT4A 1B70B 2DISA 2FVCA 3MFHA 3P5BP 4HHUA 3LP0B 4PPDA 2PFDA 2PN6A 3Q8SB 1IKWA 4DN0A 4P7TA 2CQIA 3CO9A 2QLJB 2PO4A 2WBRA 5HANA 4RU9A 2AGQA 1S9FA 4I2PA 2AP6A 1ZM4A 4NI2A 2MQNA 3DDNA 3W65A 1OMSA 2R7OA 2HHQA 2FJBB 1JLAB 2E5HA 1RTJA 1ZAWA 1S7HA 2Q3PA 2CJQA 5AXKA 2CJBA 2K06A 4NLXA 4ZOSA 5KFXA 2AZ1A 5M2RA 5MLCV 1LFPA 4J9UE 4ZCIA 8AT1B 3Q0AA 3IGNA 3NG8A 4G65A 3D3BJ 4I6AA 4OHYA 4LF7J 1RLDA 4N5SA 3U1LA 4CLFA 3OFGA 1O6XA 4QWDA 2NXJA 2N7CA 5DG9A 1HLWA 2Z2MA 2Y1IA 3P45B 2M8HA 4X2BA 3NL0A 4ED0A 3PW7A 3SDEA 3HDSA 4ANCA 1X4BA 4HHJA 3DRRA 2ZHOA 3NAHA 1JLGA 3PKMA 3QJPA 2XC9A 2KJWA 3LW5C 2G0JA 2EFNA 3CJ5A 4NOHA 3M8RA 3OXGA 5AXNA 4O4RA 1OWXA 3CC7S 4KPYA 2GMHA 1B0TA 4DPWA 4PXCA 4PQUA 2W4CA 1Q16B 4PUOA 2JDJA 2VJUA 4EBEA 2XI2A 3HFZB 3KNGA 3GMGA 1X5SA 2P6SA 3NCQA 5IWAF 4YR2A 1SBRA 4ECVA 4FVMA 2UVUA 4B3SF 4CT9A 2V8DA 3KK3B 1IKXA 3FBFA 1X8DA 2ZJQQ 1KOHA 4X84A 2FHJD 4CWBA 2VA3A 1IBKJ 2Z2LA 3MGJA 1HMVA 5D4LA 2BDPA 5D0RA 1FXRA 2VHGA 3FFIB 3E8OA 3DI6A 4WFXA 3KG4A 2CPHA 3HVAA 1FK9A 1B7FA 4CO3A 3OT9A 3HHLC 1JJ2R 2ZH6A 1TV6A 3OQ2A 3EPIA 2FPHX 2CJAA 3M2VA 2EEYA 4LSNB 3GE9A 4J7CA 2IM2A 2LECA 3NCRA 5C42B 3JTNA 5DETA 4L74A 3L4BC 3ZZZA 3MAAB 4OYXA 1MMNA 4UQGA 2MLYA 4KFBB 2W9BA 4PWDA 1FFGB 2AJFE 2V8PA 3M8QB 5HMZA 3TAPA 4TXSA 3BO2A 2B6AA 1F0XA 2FJEB 3HMJG 5K5MA 5HVGA 3G6VA 2B7BB 1NM2A 2KVIA 1JX4A 1C4CA 2MLZA 2J7KA 3HSJA 4IQMA 4MIWA 1DZ5A 3O2IA 3BM7A 3N5BA 4F4YA 4ID8A 1VOMA 2UU9J 4J9QA 2G13A 4DV2J 4ZPTR 1H2UX 4CLKA 1TKXB 4ZJLA 1KR4A 2IIHA 2IFXA 2VBYA 3QGIA 1T11A 3NMRA 1T02A 2OPPB 3ETMA 4NEYA 2MKHA 2GC8A 4KY3A 1NKEA 2BKPA 3WX8A 1WI6A 2OGUA 1OYDA 3MEKA 4JB8B 2R4FA 5BR8F 1D9DA 4UY85 2VFTA 1O5JA 3TZYA 4LREA 4FBTA 1YZ7A 2MQPA 3HCXA 3CDWA 1CJUB 1X4EA 2W2MP 3QWPA 3R6GB 4M5DB 2A3JA 1HQUB 1Y0HA 5EWEA 1RHJB 2H9ZA 3PO5A 1KVJA 3PYEA 5LL6d 2M9KA 1IBLJ 1KVIA 1WC0A 2ZE2B 4A48A 2QYCA 3DGPA 3C6UA 1S6UA 3HXMA 1RAFB 5C5JA 4OFZA 1HWLA 4M5JA 3QAUA 4RUBA 3KLEA 1M5OC 3Q83A 3TVKA 1RWVB 1YJ7A 1B0PA 2OPQA 5JXSA 1JQGA 3M2UB 4K4YA 5LXRA 1PYTA 2B0GA 4JYAJ 1YKWA 2K7KA 3UWTA 2C2KB 2W1BA 2ZOMA 1NPRA 4YUDA 2G4BA 1UP1A 2HMIA 5JVHQ 4X62J 4DR6J 3JXOA 3NS7B 4CT8A 5H9FK 1TL7B 3GYGA 1SUQA 4ZCLA 4Y6IA 3KG0A 3P5TL 3V4IB 2EG1A 2CQHA 3AT1B 2Z4PA 2X51A 3EMTA 2YKNB 3W9IA 3CCMS 4I2QA 3TW0A 3NGUA 4WP8A 3IWNC 1TVRB 1R3NA 3PFOA 5B0AA 4U8YA 2OHDA 2RILA 4GO5X 4PWWA 3BZQA 4IOAQ 4N7TA 3HZEA 4AXIA 2ZJPQ 1FKAF 4JV1A 2WB1D 2DPIA 2YKOA 4ANEA 4ZPAA 1YRUA 4A8FA 1LWXA 4ED7A 2HZCA 1NJZA 4NA2A 2HVDA 4ANDA 2UZAA 3CJ0A 5LT5A 3J81j 1HNXJ 1EKRA 1NZ8A 4HH1A 2ATCB 2QG9B 2P9GA 2CPYA 2LFVA 1WC6A 2XSJA 3TVYA 2V34A 2M52A 2HGLA 4GC6A 2VBWA 2DB1A 4B3RF 2OP5A 3DKDA 2D3ZA 2ZWPA 1F5AA 4J9MA 2L08A 2HFNA 4NZ6A 4CTAB 3PZPA 4Z37A 1FKOA 4O0IA 1T94A 2ZBCA 3VQSA 2DRDA 2LEAA 1GQEA 2YKMB 4O44A 4UUXA 3DXBA 4DS5A 2UXCF 4IR9A 2DXFA 1S9EA 4YS2A 4F02A 5L1IA 2XY5A 1X4AA 1NB7A 3MEEB 2CWKA 2F8EX 2IHR1 4WJBA 2CPXA 1MROB 3PNIA 4X4TA 1MSWD 3MEDB 2B4UA 4WP3A 2NLWA 1AUDA 5CHCB 3DOKA 1CJVB 2B9XA 4QWBA 4LFCF 1OJ4A 1S6QB 2AWZA 4P6QA 1NJIT 2XLKA 2W7OA 4C9DA 4O0NA 1E6YB 4CLLA 1DTQB 4R5PB 3ENVA 3TUIC 4LSLA 4RW6A 1N5TA 2XGQA 3FZBA 4KO0A 1CPZA 3SQOP 2RDDA 1OO0B 2HS4A 4LFBF 2FVQA 1Q82T 1Y4ZB 2DK2A 5DS7A 1VQOS 2MY8A 2NXCA 2Z2ZA 3UCGA 1HPZA 2RMLA 3KDOA 3QIDA 3Q24A 4ECQA 3MPUB 5DZ7A 5J1PA 2VH7A 1U1MA 2XS2A 4DEZA 1RUSA 2HRYA 3OR2B 4WXWA 1WKJA 3OR1B 2VG5A 2QIFA 1G2EA 2F4FA 4RO0A 4DG1A 1HYSA 1VQMS 5HO4A 3ZZRA 3W5XA 3KK1A 1XK8A 4OHVA 1TAUA 2LDYA 5DQGA 2PFFB 2U2FA 4O44B 5D78A 3RTVA 1YBAA 2MKJA 1YBUA 3NGTA 3PHEA 1YVFA 4OZJA 3VF0B 3GSDA 4XK8C 4Y00A 1NKBA 2J6SA 2GVDA 1WF0A 1FO1A 2VG7A 5A6WA 2EXUA 4DPTA 1Q86T 3OL9A 3ZXWA 1FVQA 4OJ3A 3CIMA 2EFGA 3R1HA 1SIWB 4F0HA 5LMUJ 3MUVP 3GR1A 1JLFA 1YDLA 4DI6A 1KEKA 5KAKA 3OTBA 3CJKB 4MKBA 3I4HX 5EWGA 1XMQF 2XYGB 4TN2A 2JNJA 4I69A 4PXEA 2JSXA 4OYZA 4EO6A 3AA8A 3R5DA 1VQ7S 2NXNA 4OZ1A 4WTOB 2M88A 2W8LA 2AQ4A 4H4KC 4W98A 1U47A 2YPYA 4NYZA 1SJ3P 2DR5A 3QT7A 2V63A 3UO0A 5A6PA 2FB0A 2CA9A 2XSFA 3PW4A 2JEFA 2QMWA 3H5XA 3ILOA 1EARA 1SKWA 3T9ZA 1WC5A 2JLEA 4LBPA 2GIRA 1IVZA 2P6TA 1SJ4P 1MWYA 2EKNA 1MROA 3EVOA 1RWUA 4BWJA 5SUHA 2MEWA 1BGXT 2E5JA 2DNPA 2VG5B 4CNZA 3VR1A 4LFBJ 4O4GA 4PXBA 1RP5A 2HQCA 3GPAA 2ZBQA 3MCOA 2YNGA 4CRJA 1R0AA 1N33F 1NSPA 1F2GA 2KXFA 2JFKA 3FKBA 4J37A 3VGVA 4ZIVA 1AYEA 1RTZA 3NGRA 3TZXA 1DAXA 1XR7A 3MMBA 1N6QA 3ELHA 2PGCA 3NRBA 1R8AA 2R7WA 2IA6A 4DR4J 2DNMA 3BEGB 3Q8PB 4NLWA 4C7QA 3F41A 2E5LF 4ZPCA 1UW9A 4L3KA 3M8SA 2UUTA 2WAQD 1IKWB 1ULRA 3B78A 3KJFB 4KT0C 3DXSX 3LQVA 3TA2A 3C16A 3C6UB 3MMAA 4RLEA 5IWAJ 3WIVA 4JI5F 4ZS6A 2Y9HA 1Z1ZA 1REVA 3DC2A 3IRXB 5IT0A 5KT5A 4J9SA 1N34F 3CCZA 3FSXA 5LOQA 2RVJA 3PW0A 4UZCA 2YX4A 1WDDA 2B5JA 3I31A 5B0FA 3RB3A 1YJTA 4IR1A 1N32F 3AB4B 2ZOGA 2OFGX 2KU7A 2SXLA 2ZDOA 2BE9B 3QLHA 3UN3A 2P9CA 3Q22A 3ZTRA 1TUVA 2G2OA 3QYYA 4G1QB 2ZFHA 2HRTA 5AE1A 2QE5A 2XCPA 3V81B 1FERA 1IR0A 4DR4F 3GFYA 4WF9Q 1CC7A 1RBLA 3CW2C 3M32A 3NS5A 4KAIA 3S01A 1VFJA 3TQEA 4F0MA 1X4HA 2YWHA 1VQ9S 1T8EA 1VISA 1SUQB 3PKYA 1DQ9A 1GH8A 4RR5A 1KQGB 3SSSA 3BSCA 4N77A 3KLFA 1OS5A 4BC9A 3Q8UA 3KK2A 4N76A 2Q79A 4H4OA 2MQ8A 2ROPA 4DV0F 2K1RA 2CQGA 4YDDB 3BR9A 3SCLE 2CNKB 4K4TA 4A8YA 1T9YA 3GIIA 1S1WB 4MFBA 4ZP9A 3N28A 2GGPB 1RXOB 4KIAA 5HMWA 2APOA 4B17A 4YEAA 1U8SA 1SC6A 1YLXA 2ZVSA 1BY9A 4IOBA 3GIMA 3UCZP 3DU6A 3U27A 4CLUA 1K9MT 5JVGQ 2CVIA 4FF4A 2AZ3A 2WVDA 1UETA 5IOLA 3J7Z5 2PI5A 1S9GA 2VC0A 4LIWA 3UN5A 2OAUA 3FCHA 4X62F 4HH0A 3PTWA 2GAGC 2MKCA 1UWAA 2CQDA 2WONA 1RT5B 2CQPA 3QQCD 3D1QA 4NRTA 4Y2IA 4O3QA 2R2SA 3G71S 3CPWR 3T6BA 3OXFA 5KFVA 4NLSA 3EM1A 2IJRA 1ZYQA 2IBOA 5FLXY 2VPZB 3CD6S 3NLCA 3SI8A 4KGZB 1ZAVA 4ZJOA 3TA0A 2ZH9A 1WHVA 3A3NB 4DR2F 1TUGB 4DR5J 1CQNA 2I8EA 4HACA 3W5ZA 4M5LA 3R6LB 3QRQA 2KG1A 1FRXA 2PEHA 3DRSB 1R31A 1RHQB 4KV8B 1XR5A 2LU1A 4ZVQB 5K9FA 4C8ZA 2BJ3A 1EKSA 4HTIA 3ILJA 1A6LA 3KMSA 3T1HF 4IFYB 1WTFA 3DHWC 4QZVB 3VAFA 3SMZA 3JSYA 4JI6J 1FX4A 1VLOA 3NNCA 2RQ4A 1NDLA 2R3VA 1TKZA 3L7OA 2F4VF 3D7SB 2KRRA 3K89A 4P52A 4B02A 1RT6B 3T1AA 1CS4B 2C2ZB 2DGXA 2DYAA 4GC7A 2UVWA 3H2VE 1SL1A 3M8QA 2ZH5A 4LFAF 1WF2A 4ECSA 2GNKA 2OFHX 2QL5B 1EP4B 2DBBA 5EN1A 1Z2LA 3H40A 2OMLA 4C8YA 1URRA 5DRKA 4NYPA 2UXBJ 4IRDA 1TL1B 3A8JA 5ETTA 4C8OA 4OMFG 5HN0A 2DVIA 5IZHA 3MPVA 2D1CA 2HQIA 1KBRA 1S59A 4NZ0A 3H8YA 4DR6F 3P8BB 3H4BA 2UUBJ 2KVQE 3BSNA 2MJUA 1FRMA 3PYDA 4KGKA 1XERA 2L48A 2QX0A 4FN5A 5ETRA 3VV2B 4F3QA 5HVHA 2MGZB 1S1UA 2HNZB 1S49A 4DFKA 1U4BA 4ELVA 5EHHA 1QE1B 3Q89A 2J0WA 4JI7J 1MLAA 3MR2A 1FI4A 3OTOF 3FC9A 4NXNF 2KFNA 1U8WA 4Y2AA 4PWUA 3UW1A 3V2UC 4ZN1A 3GYNA 4ZJQA 1KKHA 4FYWB 5GMKa 1KD1T 2U1AA 2E9ZA 4YOEA 2GFFA 2HPUA 1RACB 2OSRA 3SQGA 4ES1A 4X4PA 1K1SA 2RU3A 4AL7A 1FFSB 2BACA 3THTA 1U0HA 1Q5YA 3HHKA 4DX7A 3THVA 1VC0A 1C1BB 3VAHA 4X4OA 1D1UA 4JV5F 2R7UA 1LXNA 4P2FA 5E3CA 3G6YA 5F8JA 3EGVA 1LFWA 1WSVA 2HLTA 2XI3A 3OTCA 4H4MA 4ES2A 1R7IA 4ES3A 3MUMP 1SL2A 1Y3KA 3PO4A 3ET6A 4FNHA 4IG3A 4DV1J 4FS2A 4EBDA 2FZKB 1RHMB 2QFIA 3KJNB 1BC6A 4ZVOB 3J7A1 3OSPA 4TLQA 3M6XA 1RWXB 5HJYA 2FVSA 4DOZA 5A8WB 1WEZA 2D41A 2VG6A 3M1VA 3SFUA 4PYAA 4YB6A 1M5HA 2R7XA 1VJQA 3CCWA 3DHXA 5CCMA 1OQ6A 2X1BA 2MPUA 4ECRA 5IC4B 5A0YA 3KFWX 2CQ1A 2NYIA 3CO0P 1LEOA 2L9NA 1UPPA 2XBPA 3ENWA 3M6VA 1D09B 2X1AA 3PYFA 1S0MA 4U8VA 2DR7A 2J0SD 4F36A 4P9SA 4KH1B 1VBZA 2EI5A 2R7QA 2OPRB 3AODA 1SI9A 3JB9k 3S8SA 1S79A 3CDEA 3S1TA 3H0PA 2HK2A 2AHOB 3R97A 3PW5A 2NUHA 1C1CA 1UTAA 3PCOB 3KNAA 5JJBA 2AX1A 1AUSL 2AMCB 3CGIA 2CUYA 2H51B 3HX9A 3I55S 1RTHA 5KFZA 1G1XA 1N5YB 2BJDA 3HVTA 2P8IA 2HHPA 3PG9A 4ILLA 3R8YA 3VGTA 2XQCA 4F50A 1S1TB 5L39A 1D9AA 5ADZA 1M90T 4B9MA 1RADB 5BJRA 3BB5A 1YX2A 2DNRA 3D67A 2HIYA 1C0TB 1VHFA 4NI2B 2OEJA 2YQ3A 5GMDA 1KSPA 1YG0A 4JP8A 3TOQA 3LPEA 4AD6A 4ZVHA 1L5UA 4RW7B 2W4DA 4TLRA 4JI4J 3IXQA 3PM9A 4NA3A 1H74A 4LJMA 3ILLA 2FVRA 1VRTB 3MI7X 2VJVA 4LSZB 2VV5A 1IQTA 2BANA 4C3MA 1HBUB 1Y9OA 4PXDA 1M1GA 1O0PA 4QWEA 4OX6A 1S97A 2CXEA 1NK4A 3ITHB 2HWTA 3SCKE 1WSRA 2OUGA 4HACB 3T6JA 2HHWA 3AJ1A 3FCWA 2AIRB 3ILIA 3IMQJ 1GFWB 3LGNA 4TYAA 5KG7A 2HYIB 2GO9A 2ZBIA 3GJRB 5DLFA 5IT9U 2AKWB 4RWWA 4ERDA 3BDEA 1R0AB 1H98A 2ZM6J 1N5QA 2W24A 3B8HA 4HR2A 4YP3A 4L72B 3HVTB 4V19X 4LVOP 3TUJC 2W2OP 2V8HA 2XMVA 4LF5J 2VQFF 3RAQA 1VQ6S 1JXLA 5CQGA 4ECUA 5K20B 1S9GB 5KFSA 1UFKA 1N8RT 1WF1A 3MZIA 1Y3JA 4DS4A 3IR5B 1CSJA 4I7FA 3C6TB 3VTIA 4TU8A 1WELA 4Y34A 4ED1A 2DPJA 4LF4J 5F3ZA 2ZH8A 5A8KA 4OV1A 2BRKA 5KFHA 4RZRA 2Z2YB 3Q8QB 1NJWA 5BYSA 1UW4A 3K17A 3K5PA 3DYAB 1KFDA 3I5BA 2DY1A 1VQSA 3RBDA 1EB0A 4LF6J 2NZCA 2DXEA 2LVWA 1WEYA 2DH9A 4H4OB 4DV3F 1B64A 5D4NA 1S77D 3W60A 2XZTB 1WTBA 1N0UA 1T0TV 2GA7A 2VG6B 1HL6A 3B6BA 1YJ9S 2IVYA 1U09A 2MQQA 3JQKA 1ROFA 4P10A 4ED4A 4M5GA 2CQ0A 4E8UA 5IS2A 2KM8B 5LMUF 4Y0FA 4L73A 4P73A 1S0OA 4G3IA 2D3OR 3EXCX 2UVRA 3FUYA 1YJNS 5KFJA 2M70A 1CJTA 3BO4A 1ZETA 2QRRA 3DRPB 2IY5B 4LF9J 1RHUB 2HNYB 3W8PA 4P74A 1ZS6A 3TRGA 2CRLA 3MCMA 3WIUA 4ZVUB 2XMKA 3ET6B 4IG3B 2R7VA 2BOAA 3GLJA 3B4DA 3G6ES 3DLJA 2RS8A 3OTEA 4UY8T 2BJ7A 1HNWF 2HVIA 2YTCA 4Q8FA 1Q0NA 2K3IA 1XNQF 5LJ3Y 2ZOFA 1HWKA 3G8TA 5KOWA 3GV7B 2IRXA 4P2MA 4FS1A 3SQGB 1JKHB 3BR8A 2K8GA 5L1JA 3K5MA 2WW4A 4AQYF 4BS2A 2R7TA 2BKOA 3MR3A 4OI0A 4ELTA 3D0HE 3RR7A 2UXDJ 2Y3YA 1WNEA 4OZ2A 2J8AA 5HLFB 2NQPA 1NPKA 4DCOB 4DV6F 5DDQC 3H59A 1Q7YT 2QV6A 2GIFA 4OL8A 1H3DA 2HS0A 3CTRA 4RL1A 4M94A 2LP4A 2WOMA 2Z30B 3GV5B 3AHPA 2EG2A 3NOCA 4LR9A 3C8YA 1MWQA 2JLFA 1S9EB 3DLEB 3TANA 2G9OA 1N88A 1D3WA 1SC3B 3NWGA 1NJXA 1VQ8S 3X3UA 3BDPA 4BBYA 4I67A 1F9FA 3E51A 1WC4A 4LT6A 3J7YI 1UWBB 2AX0A 1KVKA 2YWFA 4CTAA 4A8QA 3T5KA 3CF5Q 2HZVA 1WHWA 3FDSA 3W2WA 4AUKA 2E1AA 4V1Ak 2YWKA 3FMBA 2HW3A 1FWLA 3DMJB 5FIIA 1V9OA 3IN5A 1TKZB 3U1MA 2D3UA 1HNXF 4YDXA 2QO3A 1WWHA 3V5RA 4MT1A 1DQAA 2KT5A 4USVA 3AAWB 1EP4A 1P9YA 5U47A 4B9TA 1TTHB 4ILMA 1RBOB 3BQ0A 2C2OB 1W2IA 2E1MC 2M7SA 3FQLA 3MD3A 3UDVA 1NK9A 2FZGB 3NBPB 4ZIWA 3KLHB 3DLGA 1X4CA 4B3MJ 9RUBA 2BUNA 2F7VA 2IPOB 3LOUA 5B0GA 4DN9A 4U7CA 5GAGI 4N8OA 2C28A 3RRGA 5IM0B 1CEZA 5F0WA 2DR9A 1HQ2A 3CVKA 4AFFA 2HBZB 1KRPA 3BGRB 2KJVA 2HQFA 3FRZA 2YNIA 2G1DA 2XMAA 2AJ4A 4G1IA 6AT1B 3KOAA 1XIQA 4WBFA 2YKNA 1I51B 2XG8A 2MKIA 2V0NA 3EDQB 5F8HA 5KFEA 2JH3A 4ZP7A 3ZTPA 3ONQA 4LRFA 4ECXA 1M5KC 2WSEC 4JI5J 3GG1A 3W2VA 4X4NA 2KL8A 3EZOA 4I1TA 2NSCA 5M2PA 1WC1A 2OH2A 2N4DA 3N6NA 4ZPVR 2KO1A 5EWFA 3D1HA 1FE4A 4X66J 4E98A 3PVXA 2IAJA 1FDAA 1RT7A 1J27A 2D9PA 3L9ZA 1DTQA 4DJBA 5KFQA 2EBEA 3CXCR 4USJC 1FCAA 4CQ1A 4RNMA 2VFRA 1HFEL 1Q8IA 4DHVA 4QR0A 1TK8A 2Z57B 3DOKB 1PYSB 3IA0A 3MEGB 2DXDA 2W2NP 4LR8A 2UP1A 4CCHA 3FEXB 4X4UA 1J2VA 4KKOA 3VAIA 1VQPS 1LXJA 2LKZA 5BXIA 2V9KA 1QTMA 5K8PA 3TARA 2C1EB 4RPFA 1UVIA 1MU2B 2PE8A 2CAJA 4DDFA 4KJIA 1F3FA 1LWEB 2EK6A 3BGLA 1JLEB 4Q8EA 2BJ8A 3KLFB 1KLMA 1Q78A 4Y65A 1AXQA 5HK4A 2R9LA 4DFJA 1BQXA 1U2FA 4A46A 2V2ZA 4LRAA 3WC2A 1S12A 2CPDA 5L46A 4JI1J 3P96A 2CJXB 1FTCA 5KG6A 3L09A 4NLUA 3BKFA 2LEBA 4E0DA 4A8XA 4ELUA 4DUZF 2ZBPA 3DN9A 2BVZA 3IWXA 4G1QA 3RB6A 3MM8B 4K4SA 5GMEA 3RR8A 2KYXA 1SB6A 3T1YF 1GTEA 4TQRA 1IN0A 2GX8A 2V2KA 2HQ3A 4QWCA 4HKQA 2ALZA 1SQFA 1DTTB 2BABA 2FHOB 3ZZPA 3DLHA 1Q8BA 5KFFA 1VRUB 3J80U 3MMBB 4I64A 4Y2KA 2UUWA 3HZGA 2ADBA 2ATLA 4B3OB 4WU2A 5HSPA 2MKSA 4PWDB 2DCUB 5C42A 1SQGA 3SZ2A 3BH6B 2J0QD 3VAKA 4I6WA 4LSNA 1PO6A 1R0BG 3VGSA 5L9XA 4FYDA 4ID5B 4KGMA 4ZLNA 3D3CJ 2YXLA 2R8IA 3OHAA 4PG8A 2QN6B 3PDNA 1FK9B 1TAQA 4DV4F 3KLIB 1N6QB 1BQNA 4JI2J 2LMIA 1EIYB 4K4VA 3OFHA 2W9CB 1JLBA 1HHSA 1N5SA 3MTKA 4C8NA 3JAMY 4F67A 4O4GB 2XB2D 1N34J 4Q2MA 2YNIB 1X4FA 3HHDA 2YWWA 3KYLA 2OPQB 4K0KF 5FDLB 1J5OB 4B3OA 3T5HA 5HMXA 2JZ5A 2QLFB 3RUBL 3UNYA 5KG2A 1K8AT 4YMEA 3QMQA 2YWEA 3VZIA 1HBOA 1RA7A 3E3XA 3EE3A 3A8EA 4IH7A 4EYIB 4ICLB 1K73T 4O3SA 1A9NB 3V6KA 3NAIA 1K1QA 2HHTA 2VBXA 2CG8A 2GJIA 1UWBA 3M6WA 3SBMA 3W1YC 3WX4A 3PRBA 1RI7A 4DV7J 2GMJA 4ZVEA 4E2FB 3NKYA 3LH2S 4EO8A 2F1FA 2V4RA 4DV5F 3ISND 2XMJA 2BYCA 4O3OA 3KK1B 3G96A 1NSQA 4FP9A 5CZVA 5G0RA 3HVRA 1HYSB 2QSFA 4LVNP 2DHXA 5KFNA 5IV4A 4N41A 2XYHB 2AEFA 2VASA 3I4PA 3OR1A 3MTJA 3PHTA 3H7HB 5F0UA 2GVDB 3A13A 4CM2A 3M2RB 2IRUA 2XO7A 1JLBB 2OTLS 4TY9A 5C2CA 1E6VA 1M1KT 1OY6A 5HROB 2HHHJ 1RTJB 4B3TJ 2IJNA 2RQMA 1BQNB 2W01A 3CJ4A 4OI2A 2EFPA 3DLLQ 1FTRA 4C8KA 2IBKA 1JKHA 4LRDA 5L9NA 5GVQA 2KH9A 2MZRA 2IYIA 3E01B 3KHRA 2EKYA 4DFMA 3RW6A 1N4LA 4LF1A 1RKJA 4K5RA 1H73A 3CDUA 3MM7B 4ZK7M 3PW2A 5DG7A 2RT3A 1TQLA 2E29A 3BF4A 4C48A 1RGVA 1HWJA 2CYYA 2IM0A 3BBBA 2KB2A 3OFFA 1ZA2B 4NRUA 4G6VB 4NLPA 3BV8A 4WPAA 3UDEA 1W26A 2I1RA 3KHLA 1DTTA 5DJBA 3JAMU 4CM0A 4TU7A 2E1CA 4DSLA 3FNNA 5B0DA 3QJLA 2HQGA 1U02A 3QO9A 3GWCA 1FE0A 2DHGA 1HW9A 3MWBA 4LSLB 4RW6B 1QAJA 2BJEA 3H5SA 2ASLA 5CA5A 4USUA 2RU9A 3SV3A 2ZKUA 1YQHA 4UOCA 4EUVA 1FHTA 1HD1A 4PPZA 1G3OA 2A10A 3IP0A 5CAAA 4DV7F 4BC7A 1NJYA 4X4RA 1NMEB 3D6TB 2FHKA 2YBVA 3FVYA 3TAMA 1S57A 2AYEA 3OUYB 1AZSB 3KLGA 1IKXB 3SFGA 4C0HA 1Q53A 2BOPA 2AW0A 1YHQS 4XAKA 3K7RA 1D0EA 3NP5A 1T9UA 3GONA 4IG0A 4R0JA 1RE1B 1KLMB 1VHIA 2AJ1A 2HURA 1GTHA 4Z2XA 5D3GB 2VPXB 2J7WA 3IC1A 2JLGA 3PYGA 2VODA 1R6VA 1FEHA 3C14B 1U2RA 3OVBA 2CIMA 3IBWA 1MN7A 1C0UB 3MMJA 4OJ1A 4CO1A 1GK8A 3ENAA 2DITA 4NCAA 4F8RA 1CJKA 4RW4A 1TK5A 1P1TA 2N4CA 1RU1A 3ZZTA 5J2PB 4F3OA 1NHUA 1F5CA 3PJ9A 5FDLA 4KTQA 4ETZA 4EU0A 7FDRA 3AQPA 2IVMA 4DPUA 1K44A 2DNZA 3B54A 5HQLA 4X64J 3J81U 1VRQC 3IWLA 4DL0C 2Y8YA 4FXDA 1IBMJ 4K4ZA 1HNVB 2ZD1B 4X65F 1TL7A 1IBCB 2RUSA 4F4ZA 4M1KA 1WOPA 5J1EA 1UA1A 3BJYA 3TUZC 4J90A 5J2NB 4RNNA 4NXNJ 3IGVA 4AXJA 1IKVA 1XEZA 2J9CA 3DOMB 4ECTA 4WFZA 4TU9A 2EPIA 2O5DA 2ERRA 4K2XA 2N3LA 2BQ3A 1GMWD 2C2RA 2RDIA 4WFYA 5KT3A 4ZPWR 1UEUA 2CZVC 2LXUA 4J9LA 3CD0A 3D9BA 1F1BB 3RBZA 1UVNA 4V19J 5B0CA 2YNFB 3OVAA 4PG7A 1SIZA 2DNHA 4NMLA 3UQSA 2UUCF 3CD5A 4HL9A 2QC3A 1CULB 3T3FA 3M2UA 4M5DA 4OQJA 2CADA 2BV3A 5CABA 2BANB 4FYVB 4X4SA 2ZH4A 1LWCB 1CLFA 2I5JA 3CJ2A 4MKYA 1S1TA 1VRTA 4WIQA 3GB0A 3TUPA 5KFRA 3W64A 2C2DA 3LF0A 3GJTB 1A7GE 4DUZJ 4RBUA 2PI4A 2R8JA 1NH7A 2PC6A 2VU5A 1UVMA 1AFJA 1RWNB 5KFKA 4JI8J 2Q1LA 4QR2A 2KHCA 4HHHA 5H9FJ 4EWTA 3EGNA 4ZP6A 1DLOA 2VC1A 1RTIA 3M4XA 2R7RA 5HP1B 1C1CB 3PEHA 5HBMA 2UUCJ 3MD1A 1H72C 5CD4H 3FCVA 2FJAB 5FLXU 2NPIA 1NK6A 1LWEA 2HGNA 2HSEB 3AJDA 1AROP 1NHKL 3BBCA 4OYWA 4X4VA 4Q2LA 5J2MA 1RTDA 1V3SA 1R8PA 2FD2A 2QEXS 2B6AB 2Y0SD 3R7NB 4DSFA 1N5YA 1ACMB 4RNHA 2ZWOA 3PR4A 1LW2A 3N79A 4KH0B 1TKXA 2K3KA 3HKZD 2RHSB 4OLOA 2H5EA 2RKIA 2YH0A 2ALYB 2GAHC 4OZ5A 3W63A 4Q0BA 1AFIA 1DFDA 3DOLB 4KSEB 3IAM9 4UZBA 5F41A 2QA4G 2V67A 2VFUA 3JYTB 1JLQB 3QATA 2DRAA 2IM3A 2JC1A 2XZWA 3FBCA 1SJ1A 2EFVA 4DSEA 2FLLA 4W90B 3CB4A 2CQ4A 4WFAQ 1N36F 1EQ0A 1SCJB 4KFBA 5A76A 3A3OB 2R2UA 2ZH2A 2BMBA 2YNHB 1J5EJ 3IS9A 4ED8A 1ITPA 1H7XA 1N5VA 2LQBA 3C19A 4HT5A 5F8NA 1JIHA 4KHPF 5A8WA 3GIKA 4OIXA 1SC4B 3M2VB 4QIEA 4RW9B 2CDQA 4YHHF 2QSWA 1PG5B 3K8WA 2D74B 3RU0A 3I56S 3D6FB 1T95A 1HBMB 1IJEB 2CFXA 5KTQA 3KK3A 5J2QB 4M5KA 5EUHA 4X4QA 3DRPA 4Y3CA 4F25A 3JSMA 2VA2A 2VUGA 3QZ7A 1RLCL 3GCXP 3OPKA 1NH8A 3FFIA 3R5JB 4FKYA 5D77A 1GX5A 2GHWA 5G4DA 3G2XA 3BPDA 2QTWA 1QE1A 4M5NA 2JWNA 4W92B 1NXIA 4C6AA 4NLTA 2MGZA 4BCAA 2HAFA 5GAEU 4QW9A 1N52B 4DUYJ 3HF5A 2FJDB 5E3QA 4IUFA 3K0JA 4QBUA 2YVSA 2DHSA 5EGYA 2GIQA 1U1QA 2MZ1A 2YQ1A 4B9VA 3I0RA 2ABYA 2GO8A 4WWSA 2XLJA 4PUOB 4WIIA 3DMJA 1H2TZ 3BSAA 4NL5A 5IV3A 4MIBA 4WXOA 3BQ2A 4JI3J 1RWKB 1CC8A 2EWHA 3BYPA 3DYAA 4EYHB 1L3VA 2I2YA 2EC0A 4URGA 1VBXA 1TFWA 5GAGU 4GVBA 4ZCMA 3HT3A 2B9EA 2VD3A 2WK4A 4CYUA 3VAMA 2YH1A 2MMYA 2ZEJA 3NWRA 1GXUA 1KQFB 1FDNA 3I0SB 1UJ6A 2W4PA 2YNHA 3QT8A 4Z7YA 1IBLF 4DR7J 5HBMB 1M1HA 1UEVA 2A18A 4JUZA 1HKAA 3LPYA 5LSOA 4X65J 3H42A 2E5LJ 4I6YA 3FBEA 2P2CB 2QLXA 1RT6A 4C97A 4DQSA 3JYTA 2CVEA 1JWWA 2HVEA 3BS9A 3BO3A 1F3VA 1PAEX 2F8MA 2WRMA 4IKAA 4DLEA 2J6UA 4JV2A 4DZ6A 2BEFA 4NCGA 2QFJA 2FLNA 2GVZB 3CJTA 4WE1A 2RKIB 3UR3C 5SZTA 3R2DJ 4WTYA 3T5JA 3HFKA 2MYFA 4RNOA 1NHVA 4NMXA 2XMMA 1U0SA 2E44A 2GHVC 1QAXA 2UU9F 2PD1A 2GV1A 5J2MB 4OJHA 1FJGJ 3Q8RB 1WOSA 4QCLA 3PJWA 3Q23A 4DR1J 4PG5A 2W8KA 4K8RA 4N47A 3TVZA 1PJ5A 4IFYA 5KFDA 3GV8B 3H2LA 2J7UA 1HNZF 1U25A 2MY7A 4KV8A 1QM9A 3TZZA 1RCOB 5J2NA 3ADAC 3O8WA 2QMXA 2MHNA 4I68A 5DGAA 1T05B 2I5JB 4P2SA 4URSA 1X9WA 3MM6A 3LAMA 4RW8A 5KFIA 3I96A 5LM7E 4A8KA 1HNVA 2DCLA 3HHLA 3SEOA 3DLKB 3GP9A 6FDRA 3ZC4A 1SKRA 2WBMA 1IKYA 3TJ9A 2WONB 3I82A 3GU0A 2Z56B 3N9UC 4KHRA 1NPPA 4MTPA 3NGDA 1S0VA 1RAIB 4EK2A 3I6PA 1WDTA 2RIJA 4XTTA 3WC0A 1F2HA 3C15B 1GAOA 4Y28C 1Q79A 5IT9Y 5H1SV 1X31C 2QJ3A 3GIJA 2XHWA 4OZNA 4DL6A 2JC0A 4O3PA 1IBMF 5JUMA 4Q0BB 4DSIA 1KOOA 4BHQA 2OJ3A 2C3YA 2IDLA 2VB6A 2N7YA 5E5NA 2H65B 3WHIA 5F9LA 3ZZYA 1U24A 4F7VA 4OX9J 1RTDB 1TL4A 2GQQA 3HJVA 3R5GA 3OL7A 3HKWA 3I5AA 3LWLA 2RRAA 2EFQA 3A8KA 4YFUA 1WKLA 3CWJA 3NS6A 3VALA 1DLOB 2CNNB 2KG0A 2ACMA 2HWIA 4PQAA 2OTJS 1TL3A 2J8SA 2DNLA 1DJ0A 2X7IA 4PG4A 3EZUA 3RBEA 1VCTA 1VBKA 3F44A 3UDLA 3CUNA 2DD8S 2WB4A 3CJ8A 1TK0A 2IVFB 2W7AA 2VIHA 2Y0BB 5KFBA 3GCWP 1M5VC 2UUAJ 1RT4B 2ZH1A 3CEDA 3UFCX 2RNEA 3TP2A 5D0HA 1Y10A 3MR7A 2ZZTA 1I5OB 1UZDA 2RH3A 1R0CB 3R5AA 2ASYA 5AE2A 1NSAA 4WFNQ 2CWXA 2B5JB 2BW2A 3HD1A 1M0SA 1SQEA 7AT1B 2V2QA 4ECZA 2QGFB 4FZVA 3C46A 4ZVRB 3KMQA 1QVFR 3MMCB 2BZ2A 1BMQB 1F60B 1TKDA 1H38A 3QRPA 2XY6A 1M5PC 2MQLA 1AA1B 4DMZA 3CCVS 2XWYA 3OUYA 3KLGB 4A8SA 4DL2A 1RAGB 2RRNA 3H4DA 2DRBA 3CE8A 2M8DB 4LF8F 1XTZA 2B51A 2GQCA 4XPEA 4AYBD 2QLBB 2RUGA 3OHBA 2XO6A 5RUBA 4UQTA 1Y5LB 1GXLA 4KC5A 1WHYA 1GMVA 3DM2A 5CYMB 2GW8A 3LGMA 5KG1A 3J81Y 5KFGA 1UPMB 2BBEA 4YQWA 1M5SA 8ATCB 4M5MA 3MOZA 2C42A 4DU7A 3QSIA 4ECWA 1P1LA 1KNZA 2X1FA 4M95A 1YI2S 2HHSA 1SKSA 5J2PA 4FPRA 3HP6A 2DH7A 2DT9A 4RW4B 1HQEB 3MF5A 3OBIA 4OI1A 4ZN3A 2J0XA 1FDDA 1TR0A 3O1LA 4EFAC 4JI7F 2IC3A 2R2RA 3RRHA 4FF3A 1RT3A 3WBZA 3OJSA 1VC5A 3C14A 3DDIA 4TQSA 2DGSA 4EEYA 1ZPVA 3L3CA 3U02A 2DGTA 1FXDA 2NUUG 3AD8C 3MECB 4CNYA 4F2RA 1KP6A 1RJJA 1WG4A 2J76E 3UPFA 2H1YA 2B3TB 3HPOA 1HBOB 5HROA 5D3GA 5BYQA 3P4UB 4DL7A 4PG6A 1K0TA 2J9DE 4RUHA 2LXIA 3AFGA 2WZ1A 1HBMA 1S6PA 3RZAA 3KHGA 5J2QA 1GMWA 1ZAXA 2LXFA 1T3OA 3JSRA 3QAEA 3M9MB 4B3MF 2XYPB 1QDUB 2VICA 2EK1A 4QWAA 4JYAF 2F5GA 3OFEA 5ETPA 5K14A 1S7IA 5E2QA 2BJ9A 2HHXA 4DQRA 1JXVA 2J5AA 3IG1B 2E9TA 3W3SA 2FY1A 2MQMA 1S1VA 5EX0A 2JHEA 4N56A 4ED5A 2B8QA 3TEHB 1DURA 1KQSR 4LQ3A 1UJ5A 1U6ZA 4DG1B 1HNIA 2R7SA 5KT6A 2Z58B 4LF9F 2FDNA 4C98A 2W9CA 2VF3A 5I3UB 1UMJA 1VIOA 2L41A 3CJSA 2DEIA 4ZP8A 1OYEA 3G8SA 4FPIA 3TJAA 2KT2A 4ZKAA 1ZH5A 1J5OA 2HNZA 1S1UB 1TU0B 1BE4A 2AEJA 2ZUGA 1OY8A 3ICLA 5T7LB 5D0EA 3K2YA 4OX9F 2C2EA 1PGZA 2VKRA 4QOTA 1KC8T 1NK0A 2LA6A 2UV8G 4MMOA 1YITS 3HD2A 4QIGA 5BR8J 1NDKA 2RQKA 1JNRB 2V6AA 3UDCA 3DM2B 5CYMA 4ATNA 3EWGA 3KWMA 3H90A 3M2RA 3DRYA 2F63A 3RG6A 3ZZUA 3PV8A 2DNYA 1MWZA 1X4GA 4A47A 4DQQA 3MM5A 1XQIA 3MEDA 4WU3A 5ETSA 4AQYJ 4UF4A 2ASDA 4DPYA 2JEIA 1ZZNA 3M32B 1XMOJ 2RDJA 3H5YA 4ID5A 3VGUA 1U48A 4MKAA 2DHAA 3N5FA 3CCQS 4ED3A 2HBYB 2MJNA 5DG8A 1QSLA 2B9WA 4FYYB 2GCFA 4NWBA 3DFEA 2FTRA 1JLEA 4LQ9A 4LFAJ 3SCJE 5AXLA 4K2JA 2XLIA 1DQ8A 2MZQA 2Q6BA 2QA1A 4R0EA 4I0WA 4YHHJ 2ROGA 1RDRA 4ILRA 2G1HA 1PYOB 2ZUAA 4C11A 2VQFJ 3C66A 2R2TA 2H48B 1NRKA 4P7VA 2B8PA 3NEKA 1YJRA 4NLVA 1VK3A 3D0IE 3GG0A 1XN9A 5FD1A 4B9UA 8RUCA 2F4VJ 2HHUA 4RBVA 1TVRA 2EC2A 5ETQA 1N36J 3C3LA 1JB0C 1U6BA 2X3DA 4DQIA 3G4SS 4OYMA 5DQIA 2OD4A 4ZA1A 1IKVB 2B56A 1PSDA 2PIIA 2QZ8A 3DOMA 4RUAA 4DF4A 1YIJS 2MKYA 3M30A 4F4XA 1W2BR 2HMIB 3HHNB 4OZLA 3QIPB 3KLIA 3H2UB 4OYIA 3JSMB 2ZJRQ 3BGOP 1HHTP 2XS5A 3BN4A 1Y00A 2BA9A 2ZKTA 1NLKL 1RT5A 2FQQB 2KXHA 2YY3A 3FZ2A 2VBZA 1YJVA 4I2QB 4RU2A 4JI4F 2DNGA 4KKOB 3V4IA 3NXZA 3FK4A 4U96A 3BN7A 3F0NA 3EX7B 4DV6J 2UVVA 4RBTA 3R3TA 5I3PA 3CCRS 3PR5B 2O01C 4MK8A 2CPJA 3C15A 5I3UA 1VQKS 3JTOA 3Q2TC 2V8GA 1VRUA 4Q45A 3FMWA 4JI8F 3GILA 5ETNA 2PA3A 2MB0B 4EI2A 2IAJB 2FLOA 3G86A 3NNAA 4DV0J 1UEKA 4GKJJ 4PABA 2G0CA 2AGPA 4LF5F 5LSRA 1Y7PA 3O3LA 1FNOA 2V94A 3GQCA 3AOAA 4EGLA 5L1KA 2NS1B 3W2VB 4ED2A 2ZITA 1IWGA 4CI0B 2BE7D 2VONA 1HI0P 3GFZA 1ZM9A 2HEKA 2YX1A 1AZSA 4K59A 2LYVA 3QPIA 4AT1B 1F6TA 2PMZD 2QLWA 1OSDA 2MZTA 2VFVA 3FRYA 2HQDA 1Y5IB 2BXJA 4W4MA 3VQTA 1U45A 4C4WA 3J7ZT 2HRUA 1S6PB 1NK8A 3BPSP 2CKWA 2Z8QA 5IM0A 4WP9A 4ED6A 1VQYA 1LWFB 4ZVTB 1V3ZA 2DGWA 3CDBA 2RS2A 1N32J 3EICA 3J80Y 2XNQA 1VS3A 3MR5A 3HHEA 1IUJA 3D66A 6FD1A 4MK9A 1SH3A 1WI8A 2ROEA 4R25A 5K8OA 5CD4A 2OELA 1KFSA 2E5GA 5DLGA 3MUTP 4KBIA 2QMUB 2DH8A 3AH6A 2IDEA 1KTVA 5ITHA 4ITSA 2W9BB 2QA4S 2V2VA 3I9V9 1W25A 3QBCA 4PAAA 5HLFA 3CJ3A 4ZVFA 1I3OB 3VVTA 3HT0A 4XIUA 3J7AN 5T14A 5KFLA 1RWOB 2HWHA 4PCQA 3RAXA 2DKOB 3QT5A 1DARA 1S6OA 2YX7A 1LOUA 2VDHA 1YZ6A 2OEKA 3QFWA 2VKZG 2LA4A 1R43A 3K59A 2COLA 1N48A 2JOQA 4QPXA 3AOBA 1UVJA 3SSRA 2ZHBA 3H5UA 5I42B 5J1NA 2VDIA 1RAAB 3C2PA 5CCLA 1L3UA 2CJYB 3A4TA 5KG4A 3VHQA 4CYUB 1HWIA 2XM3A 1D9FA 1VI7A 4U7UD 2WOMB 4DFPA 4NLOA 1GXTA 3GFHA 1CQMA 4NEZA 1S1XA 3R9LA 2WCXA 1AW0A 1C4AA 2QL9B 4QIWD 4DV5J 4LF4F 2QA2A 4JI0F 2Y1RI 1TFYA 2FJXA 1FESA 3WDOA 2WHOA 3OXLA 3S7RA 2Y1JA 2WVBA 2HFSA 1KWMA 4OHWA 1B4SA 2LQ8A 1HA1A 3MMCA 3VVUA 2MXYA 2I9SA 1FKOB 4OZ3A 4DR3J 1S99A 3HFVA 4EMDA 3MFIA 4FBUA 4OX8A 1HNZJ 3IR6B 2K7JA 4P71A 3B4MA 3M7VA 3D5MA 2KDOA 4C3LA 4WKRA 1W7WA 4J9VA 1NK5A 3T19A 3NY0A 3AY0A 1P27B 3DRRB 5CYJA 4LUBA 4FVCA 1U7LA 4WCEQ 2PDAA 3ZTOA 3CJKA 4F04B 5M2UA 4YB7A 2ZHAA 2H5IB 1TKTB 1VGYA 2C2NA 1Y11A 2DNQA 3OJUA 5HATA 4I4BA 2GHPA 2XEXA 2HFZA 1U1OA 1XR6A 4ETXA 2ZZNA 4CH7A 2OMOA 1V5VA 4ZPDA 4CO0A 2RQCA 3K8VA 1FRJA 3BYRA 3GIRA 3DLEA 2KHDA 4GKKF 4DX6A 1MW7A 3HULA 2F65A 4PR6A 3BGUA 2B9YA 4QQBA 5HQ8A 5D8HB 3UR0A 1FX2A 2JRSA 1HQEA 1U49A 2YQ0A 1EX8A 4QIFA 3TZWA 3W9JA 2BM1A 2HBRB 1C2PA 1YJUA 2PA8D 4DX5A 3FJ2A 2Q6CA 1WD6A 3AXKA 3TNVA 3PX0A 2B43A 1JK9B 3IO1A 3KKFA 2M2BA 2C2MB 4AL6A 2W25A 3R7BB 4OYAA 4RX6A 5H9EJ 3CCES 2VFSA 4KO0B 3CIZA 1I94J 4ZCKA 1RB0A 2KT3A 1GMUA 2DR8A 2IYGA 1IR1A 3BKUA 3IM8A 5A8KB 4USWA 3MOJB 4ER8A 1MMLA 5LMNF 1T3NA 2N82B 1RABB 3MM8A 5KFAA 1UVKA 1QJHA 1SKUB 2E7XA 2F8HA 4DL4A 1QSSA 3N6LA 4GKJF 4PKDB 3D0GE 1R6YA 3FEZA 4K50A 3MURP 1PKUA 5KFTA 5C25B 4HEA9 4OX7A 1Z2ZA 2DR6A 5KG0A 1TL3B 2F9DA 3MEEA 4MH8A 4WKYA 3I5CA 1KHWA 3MM9B 4D3GA 3SSQA 4UOHA 3IM9A 2G2YA 5C25A 3QGHA 1X9MA 2KZZA 1RWWB 2OPSA 3RW7A 1SV5B 2DGOA 3HHLD 1CJTB 1XC9A 3RRKA 3MR6A 1YK9A 4KB7A 4K4XA 1X60A 2CPIA 4HLBA 3RBXA 4ZDNA 3PIOQ 1FRLA 1CULA 4NA1A 3ITHA 3N6MA 5AT1B 4O3RA 4NCBA 2X3GA 1I94F 2AJ0A 3X1LB 5D4OA 4NX9A 3UCUP 3CD7A 4RWXA 1VDHA 4WE1B 3N01A 2DEJA 2GZOA 4XDDA 4JI2F 3UVJA 5DM6Q 2AF6A 2FVPA 1GT8A 2KYZA 5KFWA 1PCAA 2FLPA 2KFZA 1RAHB 1RT7B 1UCNA 4TNOA 4IH5A 2KM8C 4IOCQ 4CO4A 1PJ7A
chains in the Genus database with same CATH topology
2OSQA 3EZ5A 3CCSS 2AGOA 2M3DA 4RW8B 4Q7AA 1LK7A 1NAQA 1SJQA 2VZ9A 1G6BA 4I7FB 1RK8A 3RYLA 5T41A 1QAYA 1VQ4S 4MK7A 2OKQA 1EETB 1URNA 2D7SA 1SJRA 3LO3A 2OIHA 1IJFB 1B0VA 1U1NA 1TV6B 3ULHA 2RE1A 1ZM3A 4DPOA 1RTHB 2NXUA 4L3NA 3VAJA 4F4WA 2ZNZA 3OLAA 1XWLA 4MAKA 2MZSA 4U6PA 4X64F 3I9ZA 4H4MB 4IO1A 2E1RA 1VIXA 2GJ2A 2C3UA 2VPYB 3KLHA 3R27A 5KFCA 3M9OB 1R8CA 1X5OA 1C0UA 1X0PA 4TY8A 4QW8A 1OSCA 5E33A 2CQ2A 4ZPBA 1U1RA 1YRXA 3Q2SC 5A2QY 4IG0B 1X7VA 1K0VA 4DR1F 2ZE2A 5GAHI 2CPEA 4RW7A 3JSBA 4YR0A 4QYZJ 4NLYA 5K8NA 3PACA 3O44A 1S1XB 2MSSA 1X0FA 1WACA 1ZM2A 5EX3A 1C0TA 3LALA 3G9CA 1QY7A 2O66A 1FA0A 2V4JB 3PY8A 1VK8A 1ZBTA 2HS3A 5FJ4A 3I0SA 1JLGB 4IYQA 4JOUA 4J9OA 1X4DA 4F26A 4DR5F 2F9JA 4AL5A 3SDEB 1U26A 4ZVGA 1C1BA 5LSLA 2L9WA 1L3TA 2OPPA 5B09A 5GADU 5GAHU 2EBGA 1S10A 4GO7X 3SCIE 2XNRA 4DV2F 2R8HA 2UUBF 2BQUA 2CPFA 1U1PA 2ZH3A 3FSYA 2HFOA 2POKA 3I0RB 3MM7A 4KRWA 3TQ1A 2AYGA 1JLAA 1UVLA 1LW0A 5MAOA 4FF2A 4ECYA 3EXYA 1JMTA 5KFPA 2EW9A 5C24A 2M5YA 2F3JA 5L38A 4WK1A 4QU7A 3AQOA 1FRKA 4PRFA 4ALZA 5KG5A 4KHMA 3ZZ0A 3LP0A 2A1BA 1JXEA 3OSNA 5IQQA 1F5BA 1HWUA 5DO2A 1X5PA 4C8LA 5HL7Q 1NZAA 5THWA 3DRSA 5G0RB 3B82A 3CCUS 2UUAF 3F73A 1BD6A 1VJWA 1P6TA 4YB5A 1YJWS 1LWCA 1HMVB 3D54A 4KR0B 4OLPA 1BQMB 2LEPA 3PXGa 5AE3A 3MCSA 4F3MA 2R8KA 1D8YA 2M4MA 2A2CA 2E7WA 2V4JA 3AJ2A 2VOOA 4K4UA 2CQ3A 4UUWA 1UJ4A 4C3KA 4CH0S 2WSFC 4YY3F 2YNFA 3PJXA 4B08A 1K73T 1WG1A 4DFPA 1KHVA 3OTDA 4IQXA 2AYMA 3DOLA 4RKUC 2XCAA 4N8NA 3POTA 4WYLA 2N3OA 3LP1A 1XBWA 1LW2B 3NCPA 2C3OA 2MDAA 3VZHA 1IXKA 3KG1A 2GQ2A 1H7WA 2HNDA 3F56A 1TP7A 1NK7A 3R5CA 5HMYA 4JI3F 1P8GA 1S48A 3HVWA 2YWGA 3C6TA 4U67Q 2P5VA 2R8GA 2DNOA 3AA9A 1HBNA 4OHZA 4B3TF 2CQBA 2B4VA 3JTPA 1RTIB 2XS7A 4DF8A 4A8MP 2IMOA 2W7PA 4Q43A 2PMHA 1VLYA 2DNNA 2BR0A 2BRLA 1UFWA 3QGPA 2KN4A 4C2MA 3KJVB 3TYTA 2FJWA 3IR7B 2BM0A 3HJFA 2LDIA 1KONA 1VC6A 1Q7LB 2DIUA 4OZ0A 3HI9A 3CC4S 3P49B 2M0GB 5E7OB 1Q81T 2MQOA 3OLBA 2C22A 2DJWA 4QIVA 2GGPA 1SJFA 2A2DA 4C11B 2O67A 5I4MA 3HLUA 2W9AA 1T03A 3K5LA 2LCWA 1HBUA 2ZDPA 4OHXA 2IJFA 3KK2B 3EPGA 1FXLA 2DNKA 5A8RB 2P9EA 1N0VC 2C3MA 1KS2A 4O23A 2V5HG 1IM4A 2OLWA 1GNKA 2NZ4A 5DGBA 3SV4A 4YR3A 2GMLA 1V3RA 4NLQA 3D1OA 1R8HA 3D2WA 4FNIA 2LQ5A 1YTYA 2EFOA 3M8PA 4HVZA 2ZC3A 1SV5A 3H98A 3L7PA 3DCAA 4GMKA 2KTQA 1MU2A 4RNFA 4L6V3 1WEXA 2LQ9A 3IRXA 4XPCA 4K4WA 1CG2A 1Q1KA 1H0HB 3MEGA 3LANA 1RT2B 2OPRA 3CMAS 4DWIA 4WFBQ 3SYZA 4DSKA 1RT1A 1APSA 1G7CB 1VBYA 4HYKA 5GADI 3MXHP 3V4MA 2AD9A 1WG5A 1QUPA 3E01A 2K1RB 3R1LA 2G4BA 4Q5VA 4Y2CA 4A8OA 1YGYA 3DRXA 4JBCA 1NO8A 5J1EB 3UD3P 2FHJA 2C3PA 3DNCA 4R8UB 1UA0A 2B4OA 2ZD1A 2JJ4D 2KKHA 2WW8A 3UE2A 1JLFB 1P9QC 1MNEA 3CC2S 5EDWA 2ASJA 1FD8A 1KLNA 3BGRA 3RAMA 4U9RA 3LWMA 4WZQA 1OIAA 1TZ0A 4A8WA 2Q66A 5KT2A 3QLHB 2HGMA 1FDBA 2CG4A 1ZTTA 5CYQA 1NNDA 2E9RX 1QUVA 3H20A 5CXTA 3BGFA 3HM9A 1V6HA 1X9SA 4JI1F 3U1NA 1IQZA 1REVB 1Q8LA 1TKTA 1UAWA 2I38A 5D6GA 4ICLA 3I87A 3MPWA 4Q44A 3PEJA 2FC8A 2O1PA 2AJQA 2ACYA 3KHHA 3CCLS 2XULA 2BE2A 3OL6A 2KRBA 3EGZA 1LK5A 2VPWB 3MPYA 2PT0A 3QJJA 2I0XA 1JLCB 3TAMB 1RQ0A 2FGCA 1QVGR 3MM5B 3OL8A 1PILA 2O3DA 1DBDA 3UNGC 1FKPB 1E6VB 5I42A 5F8GA 1UKUA 3T5LA 3A1YG 5E3RA 2OD6A 4IDKB 4QPTA 4NPOA 3NGKA 3MAQA 5T7LA 1TL1A 4IDKA 4CO5A 1FT8A 1HW8A 5AXMA 4WK3A 3CMES 3OVSA 2UV8A 3M05A 1HI8A 2IM1A 4CZCA 4USIA 2JVRA 1Q4RA 4ZHRA 4FF1A 1GX6A 5E3AA 5KFUA 4HI2A 1RAJA 1S1VB 4H54A 1D8ZA 3US5A 2FC9A 4DLGA 5CYQB 1UFLA 5KFMA 5D4PA 4DX8H 1U6FA 3VAGA 3M9NB 4DL5A 3ETOA 5L1LA 3GZ7A 1HI1A 4CIOA 3J7YU 5DM7Q 1U1KA 1YSJA 1TL5A 4F2SA 2FGOA 3GFXA 1UA1A 4FXVA 1R8BA 2VG7B 5E3PA 2JFDA 4IFVB 5KT4A 5DDRC 2DTJA 1R89A 3MDFA 3CDAA 2JX2A 4JV0A 1LWFA 1NU4A 4J9KA 4URQU 2CPZA 3N0VA 1RT3B 3ENQA 4FXWA 3FGVA 4J5OA 2IRYA 1FJCA 2FHMA 4QU6A 2HIQA 3QWUA 3HK2A 1S0NA 3QGGA 1MMDA 2E66A 3G8QA 5KG3A 3H25A 3E2EA 2CJKA 4R8UA 2RJZA 3DU5A 4DSJA 1PC4A 4J9RA 5F3TA 1L3SA 1VQLS 2E5IA 4NLRA 2JEJA 2XMTA 1IKYB 1KTQA 4TYBA 3R5BA 3DLKA 3UD4P 2HHHF 3QIPA 4J9LA 4ZLPA 2W9CA 3M8PB 1RA6A 1S6QA 1SXLA 4C0OC 3OW2R 3M30B 3V6DB 3LUYA 5KT7A 4M63A 1S72S 4NLGA 3DDKA 2IMWP 2HLUA 1Y5NB 1VMBA 2FUG9 1HD0A 2B4PA 4A4JA 4DR3F 2ZH7A 2NR0A 3N4WA 4F4KA 2B7CB 4MIAA 3V81A 3ZZOA 4NZ7A 3K5NA 2WTFA 4MYTA 3FSIA 2FJVA 2HAIA 3VCDA 2RRBA 1H6KX 1FJGF 3LAKA 5IFMA 3RB4A 4IFVA 4QYRA 5E0OA 1JNZB 3U7JA 2QT7A 1SL0A 3DLBA 1XMOF 4HDHA 4HT7A 1QLNA 2LU2A 4J9NA 2XSJB 1U1LA 2L3MA 1O51A 3MMAB 4CH1A 4NCGB 3SXLA 5DQHA 2DIVA 4D3HA 4OJGA 5I3QA 2VL1A 2KZMA 5HI7A 3CCJS 1RISA 5LJ5Y 1R27B 5LXYA 4LF6F 3IRWP 3NMAA 4ZHRB 3IFEA 1X5TA 5B0EA 1VQNS 2J9EA 2YNGB 2X1GA 1ZZFA 3O5TB 2HNDB 3KJVA 2PSZA 3TR5A 4OI6A 4TKTA 4MYUA 3IAS9 4YB1P 1ZOTA 2DO4A 3BSOA 3TI0A 1LQ9A 2D9OA 2RB7A 4HTJA 4QR1A 1DRZA 3V6DA 4LF7F 1HBNB </