3HHRB

Human growth hormone and extracellular domain of its receptor: crystal structure of the complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
203
structure length
195
Chain Sequence
EPKFTKCRSPERETFSCHWTDEVHGPIQLFYTRRNEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human growth hormone and extracellular domain of its receptor: crystal structure of the complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Hormone/receptor
molecule keywords HUMAN GROWTH HORMONE
total genus 33
structure length 195
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hhrB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hhrB01
3D3VB 2IH1A 4XB7A 5F7YC 4NT6B 4LCWD 3KJ4C 3DX7A 2PNDA 1OM3L 4QCIA 5J57B 1KB9K 3QQ9C 4X6DA 1KJ2H 1WFTA 1VGKA 4K7PY 4DTGH 3X3GL 1T4KB 8FABA 4OZIA 5MERA 1W0VB 1SEBA 3VDBA 5GRVK 3FO2B 4AENB 3O4LA 4KDTA 4QTIL 4GH7B 5IMKB 2Y25A 1CFTA 4ZNEA 5E9DD 2FGWH 3GI8L 4XI5D 3S6CA 2CUIA 5DMIL 1V7MH 4ODHH 1DUZB 2E6QA 4XX1G 2EDNA 4NN6C 1RMFH 4X6CB 3L3OA 3H3BC 4Z7QF 1CLOL 4R7DB 4CJ0A 3VXSE 4LCCC 4APQD 5B39G 5D7JA 3WCYA 2UZYB 1ZT4B 4P59H 4GG6B 3VXQB 5MENE 1J8KA 3GRWL 4JPWL 1F58L 4WEMB 3I2CL 1D5IL 4YHIB 1IM3B 4XI5C 1HNFA 3SDCA 3OTTA 3U46A 3TPUB 1UM4H 3MOAH 2DJSA 3FQNB 3PDGA 2VE6B 2ICWI 4ALAL 3MRRA 4TUOB 5IUSA 5GGUA 5HYJE 4UT6L 3U79A 3DRTB 3MXWH 4WVRA 1EFQA 1XGUA 5C6TH 2PYEA 2VDMH 3GSVA 5CMAB 4FZEH 5F7DB 4WUUD 3EHBC 2W65B 2BNUA 4JRXA 4YLQT 4JO4L 5CUSH 1RUMH 3ME0A 4S1RH 4HWZA 5D1ZC 3PWNB 3VXRB 3TJHD 4N8VB 1PX4A 3WIHL 2FSEA 1T03L 4OLYH 5C9KA 4GXVL 3OKDB 4RAUB 4YUEL 4KKLC 2B4CC 5JQHC 1URLA 4Q6IC 1QLEL 3AXLB 2W07A 2UVFA 4N5ED 5GHWL 3FOMB 3REVB 5JXAL 4RBPH 4UIKL 5HGHA 2DLFH 4FTVE 4MNQA 3CXDL 1WC7B 4UBDD 3QNXB 3LOWA 1A64A 5IQ7L 3X3FH 5AZEH 1RPQA 3D85B 4HIJB 4EZMA 4UU9A 4WHDA 2KBGA 5I1DB 4DKFH 2IC2A 1SJEA 5DD0L 4WW2A 1BF2A 2VDLH 4MD5B 4CDGC 4LLDB 5IW3A 1F97A 5DJ0B 5IG7B 3QNZB 2F5BL 4MAYD 4HJJL 1AC0A 4PRPA 3RTQD 1MOEA 2V5TA 3BPNB 3HI1A 4WHYH 3H9YA 5EIIB 3CSGA 4Y0GA 1GCFA 2VQ1B 3N06B 5CIPB 3DX8A 5JHLH 1I3RA 3RVTD 5MI0C 3IU4L 3SO5A 1RJLB 4MNGB 5EO9A 2I60L 1BEYH 5CZVH 3PHSA 5I17B 2DAVA 2Y36H 2ZPKH 4RWYL 4M3KB 5ANMA 2BNQB 4HF5L 4R8WL 4XNQB 5EO0A 1VACA 3B9KA 4XCFL 4LBEA 1LEIB 3O8XA 3RFZC 3GSNA 1ZTXH 2UWEF 4YBLB 1RJLA 3UAJD 4HPYH 4GG6F 4BUGA 5DF0A 3SE9L 3D3VA 6FABH 4TOYL 4E5XA 4YJZL 2FZ3B 4Z7WE 1I1AD 3SKJH 4N9GB 3KR3L 3O3EA 4MB4A 3LPWA 3RJQB 5KSVB 1D7FA 1JWMB 4LNRA 1GSMA 3S3PA 4N8VG 2OQJB 3TBSB 2PCPB 1NL0H 1LDSA 4NUJA 3NOIA 4OD2A 3G6DH 5CEZH 2BSRA 4M6MH 3TN0C 5JW4M 4LHQB 1UJ3C 2VIRB 3SDAC 3V8CA 3ARGC 2EYSA 1PAMA 1TVHB 1Y18B 5HVFB 3EJYC 2YSSB 1VFUA 4I48B 4OGZA 3GMQB 5CJOL 4LEOB 4M8VA 5EU3B 2FHFA 1KG0A 4XPBL 3G6DL 5CEZL 3G04A 3K4AA 1CN4A 3VFOA 4DUXA 1BFVL 4R4BB 3M17B 5BQ7A 5DS8B 4M6AA 1TPXB 1TNMA 1HQRB 3NPSB 3RU8H 1FAKT 5GS0C 2BDNH 1KNOB 2AQ2A 1X5IA 1XF2B 2FATH 3G5XB 3HAEA 5KN5B 5E4IA 5I8EB 2V2XB 1GGCH 3GSVB 4UQ2A 3U83A 1DUYB 1IGML 4M6NH 5CGMA 2BK8A 4FFWC 4Z7VA 3D3VE 1YY8A 5I1LA 3DRTA 3ILPA 3NCCB 4ZG1A 4L29B 3G08A 4U3CA 3NIGF 3QDGE 5DRXA 3BHBB 1PKQE 3NCFB 5GRJL 5DT1H 4CUCA 3LEYH 1FYTE 2V7HB 1U91A 2E8YA 3OAUH 3ETBF 4JY5L 3ULSB 2KQNA 3SGJC 5J06A 4V1DE 1S7WB 2XZZA 5A43C 4PV8B 3MBXL 2CMRL 1A9BB 5F7KC 2Q86A 2X40A 4HV8B 3RTQB 2QHLA 1MVUA 5C09B 4EDWL 1BAFL 2IMNA 1LEKA 1N0LA 5DT1L 1IZKA 2IH3B 3LMJH 5J6HA 3MRGA 1WZLA 3B9KD 4N8CH 2Q3ZA 4GSDL 1DLFL 4X98A 1HSAB 1YQVL 4EEEA 4JRYE 5F71A 3BP7B 2VKWA 1CGTA 1IEAA 2Q7YA 3U7WH 2XG5A 5I9QC 2DKUA 3ESVF 1AR2A 1AH1A 4PJFF 4NHUB 2JJUA 4OSUH 2O5XL 4GSDH 5IWLA 3MUGA 3MRBA 5IESH 1Q0YL 2FO1A 4LQFH 1C7SA 5E8NA 2WSKA 4NRZB 2WUCL 5BVJB 1AKJD 1J0YA 1OD9A 3BW9A 4Z76B 4J3VA 4CADA 5I71C 1P9MC 2RFXB 3QXWA 1BM3H 5BVJA 4FQHA 1RHFA 4L9LA 1U8OA 1KC5H 2PYEE 2K7PA 2EKSA 1FL6B 4N0YL 4NRXB 3SPVA 1W8NA 2JB5H 1HQ4B 3PWVB 3QXAB 4RGNC 3P11L 4PY7B 4XZUB 2DKSA 5CP3A 4AL8L 1IGCH 4JAMA 1HSAA 2I9TA 5CEYB 3RIAF 2XKUA 5FYJD 5SWSE 3SGKC 4KUCD 2H41A 1LP9E 3C8DA 1RV6X 2BMKB 4LFHD 1Z3GH 3N9GL 4WEUD 4QRPA 3RPIA 3AS2A 3U1SL 2NPLX 1G7LA 2WNGA 4ENEC 1S7WA 3EGSB 4JGMA 1A9EA 5CEXB 2XKNB 4OLEA 3U9PH 3EYQC 2GUOB 2JJSA 3C5JB 5DQDL 5AAMA 3RWCA 5AYUH 2DMCA 3MV9A 1S78C 2ADFH 4YQXH 5INDB 4X5WB 2AJZB 3CZFA 1A6VH 3O6FA 4Z6AT 2NY6C 2HLFD 3EKCA 4U7KA 1DQDL 5I1JL 3TVMA 3FQXB 4KDTC 3LDBB 3VFGH 1N8ZA 4IRSC 4WFED 4OIIH 4YK4B 5T1KB 4X5WA 3WIHA 4XMKH 4CDHA 3QCTL 3BZDA 5DMIH 5CINL 3O11A 4QO1A 3P0VL 4JO3H 2FGWL 1CI5A 1X4ZA 4L3AA 4FFZL 1QRNE 4HK3J 1F6LL 4RGMC 1S78D 4NQXB 5FO7A 2IBZY 3M17A 2KZWA 4DW2L 2E6PA 4P2OD 3VMPA 3O2VH 2CRMA 4KZEH 1FGNH 3WXWL 4DKEH 3E6HB 2GHWB 4FQLH 1FFRA 3TYFA 3IDNB 1KULA 4NN5B 4JFPA 4JAMB 3D18A 4H5SB 3JV6A 3P3YA 1ZLSL 4RZCA 3T0EB 5IMOA 1DTUA 2R4SH 1C12A 4PB9L 1I85A 1U58A 4R4FL 3CDGB 5FHAL 5D5MB 4QWWC 5AWNH 2R0ZL 3KXFB 2JJSC 1HHJA 1UXWA 4NRXA 2VISB 5C71A 8CGTA 2ZCKL 2GW5A 4K3DH 1W0WB 4OCMC 4CNIA 3DUUB 3UJJL 2R8SL 4DOHE 5E08L 2VXSH 1ZLUH 4G6FB 3DVGB 5F7MC 5JUEL 3SY0B 5AWNL 5I1EH 1QFWL 1T22B 4RWHA 4XPAH 3TJHC 3ZE1F 5I8OL 1TQBB 4XWGL 1UM6H 3GK8H 1BOGB 5JO5B 2FIKB 5EBWB 1FZJB 2OTWA 2KUTA 3LEXB 1PSKH 4WY7L 4G8EA 2HN7A 4CGTA 3FQRB 1G7HA 1BJ8A 3QP3A 5D5MA 3RPKA 2Y6SD 1Q0XH 3FT3A 5CD3A 4HGMA 3ARYA 1IEAB 2H9GB 1CDHA 1NAKH 4V2BA 3QZWG 4M7KH 4CKVX 3HG1B 1WIUA 5SWZA 1TZIB 3D39A 4NCC1 1DBBL 1BECA 5DA4A 4U6XA 4KZDL 5TPWL 2ZG1A 3V4PH 1NCUA 3WNLA 2EDOA 4QRPE 2XPGA 4ZD3L 1X3DA 5I9QB 2YPKB 3P73A 3L5IA 4MJ4A 3RTQC 1EO7A 5JOFA 3L9RB 3MJ9A 4I5BA 2R1YA 1LK2A 4XC1L 4U2YA 4DOHB 2R1XA 4DVBA 2VDNH 1U91B 4GKOA 4OZFG 5ACLA 1C5DA 5IKCA 3T77A 5DVLA 4L9DA 1F3JA 1W72H 2HFFB 5EG6C 2YUWA 5FECB 4R97C 2NY7H 1LO0L 5CHNA 3AC0A 1AGEB 2GIYA 3DVFA 3MLUL 2A77H 4P4RB 3C5ZA 5D1QC 1EAJA 3DUSA 5CGYD 3F7VA 1I8IA 4J3TA 2XICA 4WO4D 2VQUA 3SHSA 4DN4L 1DUYA 4DGVH 4HZAA 4AM0B 5JOEA 4NZJA 1F58H 1R6VA 1I1AA 3VXPA 4TQEL 1RULL 1ROWA 1U2HA 5JR1L 3HC3H 3WXVH 2D03H 1K9TA 1C5CH 5FYKU 2FATL 5IHZA 1A2YA 1G9MC 3IVKB 1HWHB 3ZDZE 3IGAA 5F6HJ 2HTKD 1EVTC 3UZQA 5T1DH 1I8KA 1FNGA 5DMGD 3OKEB 5T3ZD 1QLRA 3QWRD 4JREC 3TNNB 5T3XD 3C5SA 3K2UH 4PRBB 4UNVA 3D0LA 1BFVH 1P5UA 1CICD 5FF6A 1MUJB 3DXAE 2VXQH 2I9TB 1H3XA 5J1SC 2WBJC 4FOMA 2X4OA 2B2XL 4RISL 2BJMH 4KWUA 3HE6D 3W5NA 3I3DA 1BZ7A 1CDYA 4LCUB 3MO1B 3GI9H 5K9QG 3WNPA 4HHAA 3T77B 5E2TH 2QJDA 3R0MA 1S7TA 4B41A 5HHPA 5IP4A 5IB2A 1KIPB 2AEQL 1NBYA 4YHIA 1U8OB 1GHFH 2F19L 1TENA 3MPCA 4ODUB 2R1YB 4XP1H 3BGFB 1ZT4A 4CU7A 5KW9L 1K3ZA 3QDHA 4RFOL 1FVDA 1QBML 1NUDA 5L8LB 4UDTA 1ADQA 1JRHH 4I9WD 4PTUA 4GBXC 1AGFB 4LARH 4QRQA 3U7WL 2DQJH 5IOPA 3TLRA 3D39B 1Y0LA 3BXNA 3OKKB 1FH5L 1R0AL 1U92B 3WHXA 2G75A 1BJ1J 2CUHA 5A16B 2HTLD 1N59A 1BVLA 1QFWM 2PYFA 2A6JB 3MRMB 5EBMB 1EEQA 2Z31B 5FGCB 5CJQL 1CYGA 5GISL 1P53A 2XWTB 2PO6C 3G6JB 1UCBH 4KKCD 5IK3B 2R2EA 4K7PX 3BZ4A 3OAUL 2DQEH 2K3TA 3Q5OA 2YA2A 1IC4L 1SJXA 1LO2H 1SYSA 1T2JA 2MOVA 4GXUM 1JF1A 4TULH 3BJ91 4RIRA 1GAFH 1X7QB 5CAYB 5AYUL 4LASH 1F3DH 3X14A 5JW4N 5SWSB 2NY6D 4L8BA 3KPQA 4PJFE 5MI0B 1OAZL 4HHAB 1UH3A 5HI4C 4MAYC 3U82B 2GY5A 5IG7A 3DLQR 4NO2B 5DQ9A 3KXFA 4DQOH 1LDPL 2LQRA 5DJYB 2MKLC 3QQ4B 1B2WH 1HZHH 2ITCB 1HOCB 2JK5A 3GSRA 3D18B 12E8H 3C6LC 4NNYA 3ARFB 3SO3B 2YMXL 4NNPH 1NCDH 3HAEB 5KN5A 1JGLH 3H7BB 4A6YB 4H0IA 4AEIL 1RIVL 4APQA 3S37H 3V5KA 5AAWA 2HMID 3RGVD 3T65A 2AK4A 3SDXF 4U1MA 2MHAA 5E00A 5E00B 3B2UC 4OUOA 2BY2A 3JTTA 3Q3GA 3V7MA 2MPAL 2E7HA 3V5KB 5FOBA 2A9NL 3UX9B 3MMEB 3V4VL 3QUXD 4WWKC 3C9NA 2CR6A 3FFCE 1B3JA 3EO1B 5IGXL 1KPUB 4X7SH 3B9AA 3MRIB 3S37L 2HT3C 4DCQB 1IC7L 5IB1A 1WT5A 3FQXA 2ITCA 1H3GA 2FX8H 3VFRA 2QKIB 4IMLB 1T6WA 5F3BB 4UAOB 4H1LB 1JNLH 3HB3D 4HJ0C 4F7EA 3N1FC 1L9MA 1KLGB 3PDOA 2NLJA 5CEXA 4GKNA 1JZ3A 1JZ7A 4WV1B 2XNAA 3NN8B 3B8YA 3BESR 5GGRA 4ETYA 2ZG2A 1TQBC 3PE9A 1P4LB 3DBXA 5GXBB 2F58L 1G1CA 1AP2A 3ALPA 4K8RH 3QUXB 2JCCE 2R69H 5DJCA 1TJIL 4IBLT 3ALWA 2EECA 1RZJC 1JV5A 3O8XB 5CEYA 2XWTA 2BHUA 1KPVB 4B50A 2MWCA 4PY7A 2H9GA 4JO1H 1N2RA 1LK3H 5I1IH 1BQHB 4MAYA 4F7PA 4F7PB 4MD0B 4NKMA 4MCZB 4UT9L 3TZVC 3UPRB 4LKXB 1IKFH 2HN7B 3P0GB 5F9AC 4J3UA 1PLGL 4F3FB 4GRLD 4M1DH 1JN6A 3SDAA 1F4HA 5HHOD 4GG8A 4NN5C 4DGIL 5JMRA 5FFLA 5DJCB 1DLHA 4JN1H 3FO9A 1QD0A 5TGBA 1DN0B 1C5BH 3FOLB 5MP6L 1KSRA 4ZFZB 4WNQB 2VABB 3QQ9D 1A3RL 4QOKD 4OQTH 2RR3A 4NCDA 2Q8AH 3UYOD 3C08L 1RZKC 5C0GB 3QFJE 3PL6D 3BP5B 1RK0B 4U33A 4IRJA 3TBVB 1LD9B 4I18C 3GMOA 3GNMH 1X5KA 3MNVA 5MEQB 3VFSB 3PJSA 4AH2B 1IQWH 4HUUB 3ZYJA 2YD8A 2X1QA 3TH2T 4IEFB 1FNEA 3MBED 4UDUB 1KPUA 3QIWC 3L5XH 5IJVB 1A6ZB 2RAMA 2DQTL 1OARL 2J1KA 3OJDA 3D0LB 4UB0H 3TYFB 4PRBA 4QRTA 2HG5A 4FXLA 3B4NA 4LSTL 1YNLL 3TZVA 4EN3D 4MS8C 2D7TH 1PW3A 3NABH 2DQGL 3KPLA 1XF3B 5ACMA 4YDJA 3VA6A 4KRMB 4EI5A 4HS6B 4DK6A 4XWOC 4M8QB 1VPOL 2X4RB 5ALCH 2ZUXA 3AS1A 1WTGT 3T0AA 4WI3A 3L3IA 2BY3A 1QSFD 1I1AB 4OGYH 5K9KA 1MRFH 5A2JH 5CJBA 5E6IA 1JNHA 5CMAA 4NNYB 4JRXE 1JCKA 4G3YH 4NOBA 1U95A 4N5UA 2AKRB 2AKRA 1N5AB 1S7RB 5H37H 5C0RH 4Y4HD 4AIXA 3RI5K 2OL3L 4NO2A 3MJ7B 1EXUB 1GZPA 3NTCH 5KSAD 3QXTA 3QNYA 3F65A 3D39E 1MRFL 5EBGA 4K9EH 4FABH 1T83C 3U7YL 1AO7E 1MH5A 3FN0L 4HC1L 3WBDA 3HNVL 5HI5C 1NCBL 2NY3D 4PRNB 5CBAA 1EK3A 4RFNB 1ZAGA 2J4WH 3KPOA 1A6AB 4DEPC 3CFCL 1GOFA 2CLZB 2BMKA 3CVIL 3TNMA 1NGWB 4I0PD 1ZT7B 3DXAA 3PDDA 4Q2ZA 1BX2A 5D2LE 2FEEL 3VI3E 3MX0A 1A6ZA 2IAMD 5JHDE 2YZ8A 5ALBL 2KZ1B 2VIRA 3QA3A 3MRDA 4E41B 1MJUL 4Y2DC 4F2MB 2F53E 2FH8A 2P5EE 3NA9L 3RAJL 4NUJB 4QKXB 3DMMA 4ZMAT 1RIHL 4PGBA 3TBWA 4G8EB 2VDRH 3VJ6A 4NGHL 1I8MB 2GSGB 2XTJD 3BDYH 5DK2A 3OPZL 3KYMB 4D9QD 3RNQB 5HPMA 2FBOJ 4OQTL 4N5EC 3VXMA 3C60A 1BZ9A 4WNQA 1IGJB 3S34H 1DQQA 4NGHH 3WO4C 2DQDL 1EHNA 1FH5H 3TO4D 1I1YB 3CH1B 5ICYA 2OSLA 5C2BH 1W2KT 3QIUC 5FHBL 3QCUH 1GC1L 1BD2A 4LCUA 2BCKA 3VD9A 1DLFH 1ACYL 1Q1JH 2UYLB 3AFLA 3UTZA 4X9BA 3KNBB 3QUYA 5DO2D 1CXLA 4OZGA 4CU6A 5I8KH 1F90L 1HHGB 4BQ6A 5L6YL 3IDNA 5B22A 1LO5B 3B2UD 3OHXA 4Z7UB 3SDDB 3G6JF 1PQZB 1S7UB 1VFOA 2NY6B 1GC1H 1FC2D 4YHKL 4OGAD 1IQDB 5C0CA 1FORH 3BZEA 4NJ9L 3DO7B 1BQSA 1EMTL 1QBLH 3MTRA 2AV7A 1U8JA 5I15L 4R26H 2HYMA 4NSKA 4HMCA 2XWJA 4M1GH 1G1YA 1IAKA 1YECH 1OF2B 1IEBB 3F58H 3KDMB 4LLDA 2RHEA 2HFGH 3G08B 4OGYL 3UJIH 4R3SA 1FIEA 1NEZG 5BZDA 3P9MB 1AGEA 1JPGA 2A0LC 5GS3A 5KOVC 1NJ9B 1L7IL 2V2XA 2B0SL 3RWCB 1A7OH 5FUOL 1ZANL 3DHMA 1DQDH 5IFHL 4JFHE 4P2RD 4QT5B 3O6LL 1MCWM 2MPAH 4H20L 4DKAA 4ELME 1F11B 3L9RA 1JRHI 4HZLB 4HUKB 1JTTA 1TETH 1F5WA 3TF7C 4P3CH 2PO6D 5E8DH 1JPTL 5D6DA 3BO8B 4PJAA 3TIEB 4G80A 3PWNA 4C56D 1Y18A 4PJ5D 3TPKA 1MJ8L 3O0RL 1FFOA 4K7FB 1A3LL 4HUUA 3BPCA 1G9NC 5D5MF 5ACZA 5T1DL 1N26A 5KAQG 1BFTA 1MCSA 4O2CA 3HRZA 3IT8D 1VKXB 4ZUWB 1LD9A 3NTCL 3N1MC 1XGQB 1D5MB 3UZEA 1IC1A 4LRIC 3BIAX 2WMPA 1IM3A 1D6EA 3QRGL 5ICYB 1OTUD 5ITBH 3TWCL 4JN1L 4PJDA 3VH8A 2IFFH 2PYED 4KY1L 4E5XB 5BMFH 1OW0C 5T3XE 2W92A 3L3OB 1DLHB 3I02B 1I3GH 4E9LA 3WJLC 1XR8A 1UC6A 2NY5H 4HLJA 5E8NB 1F8TH 3FB8B 1Q72H 4BJLA 2CDFA 5D7LD 3B9KB 3VJ6B 1NMCC 3QUZC 5GSRB 4ONGH 1NC4B 4P23B 4JY6B 1CFVL 1OT2A 3C5ZC 3UP1A 3TBYA 3WHXB 3MRDB 2ICWA 3UTSB 2D7QA 3ZTNH 3U7AA 1H8NA 1S7SA 3WIFA 1U8LA 2YRPA 2EDTA 4XVJH 4CJ1A 4KJPD 5D5ME 1E28B 3O81A 3ZZ1A 1OAQL 2FNBA 3GBLA 5E56A 3QUXA 3D25A 2ITDA 2XOTA 5L88L 4PFEA 2OJZL 2JCCA 4ONFH 5E8PA 4PJBE 4HEME 5DK0B 3V4UH 1F2XK 4KMLB 3ARBC 4TSCH 5D7LE 4Z7OE 4H0HB 4JFFA 1WCBB 4JFFD 4EDWH 4YXKL 2DQHL 1TPXC 3LKQA 1R3IL 5IB2B 3QT2A 3PDOB 4DKFL 4KHTH 3GK8L 4JM2A 2AXFA 3MJ9L 5F1NB 3VW3L 2P4AB 2IEPA 3UTQA 5JORA 4XWGH 4Q97A 2F15A 4L8SB 5INCA 5ESQA 5L0QB 5EDXA 3TVMB 4L29A 4RBPK 3B9EA 4NM8L 4YXHH 2LVCA 2VXUH 4UU9B 5TQ0L 1FO0L 1X5HA 3EFDH 1E4XH 4LRIA 3NACL 3C9NB 1ZA6A 1ZK9A 3OV6A 5F88A 4Z7VF 1A9EB 3ARBA 1JGDB 4OGAC 1T0NA 1I7TB 1OP3H 3KPSE 2ZOLA 2YD9A 1H9VA 5DGRA 4F33B 4D0BA 2E9WA 3B2VL 4YEFA 4LLUB 2GTZA 4CRPA 4S1SH 3HC3L 3WXVL 4BSJA 2VDPL 1T0NB 4JFQB 5HGDB 5IFJA 1EEUA 4N0CC 3RY5A 5AD0B 3LKSB 3UTTE 2NTFA 1KIQB 4G5ZL 4TN9A 4OF7A 1QYGH 4YDVA 2G5RA 4X5XA 5IBTH 5E2UL 1UM4L 4OZHF 1OGTB 1MLBB 5L9DH 3X12A 5IM7B 1RI8A 3OKNB 2UZIH 2CLRA 1WUNT 4IIQA 4LHUA 3CAFA 4JR9L 1F13A 3INUL 2J8HA 3VWJD 3M1BA 1VB9A 1VA9A 5GGTA 5C8JA 2EO1A 3P73B 3VH8G 2J8UF 4KRNA 2EH8L 4U49A 3EOAA 1E28A 3JZ7A 1A14L 4PRPE 4LVEA 5IJKC 3RVTC 2QL1A 2UZIL 3FB6A 1QR1A 2VLRD 5DJ8B 5DQDH 1QRNB 5I30L 1EO8L 2A0LD 4G8IB 2IJ0C 2UWEA 5C0FA 1Q0XL 4KK5D 5GGVL 3RZCA 1N6QH 1MRCH 1QSEA 1IGFL 1ZXQA 2DYPA 2VH5H 3ARGA 2M26A 3D1MC 1J5OH 4G8IA 4P9HH 3QHTC 4MA8H 5HD8D 3FFDB 2FX7L 4X4ZA 3F8UB 4ODTL 1CDUA 1LO3L 2G60H 5EO9B 3ARWA 4BKLA 4X6EA 5I1AB 5TF1L 2N7AA 2NY2B 3BP6A 5HYSB 3OKNA 4O02L 4OCWL 1KJ2B 3ALXA 2PXYB 3ULUH 1O7SA 4PLJC 1W0WA 5E7FA 3BP4B 3E6FA 2ICES 1BIIB 4Y16B 3OKOB 1WZKA 5CD5C 1A7QL 1YEHH 1MCCA 4G7YL 4H1LA 3VXMD 5F3BA 4K2UL 4ISVA 2AXHA 2SEBB 2L0DA 2LVEA 5AD0A 5JDJA 1YN7A 3ZT5A 2H26A 2ZNXA 1ZLSH 3AY4A 3VW3H 3BOVA 3MBEB 4YHLL 3JV6B 1EHLH 4C56E 1YEEH 3ARFD 5EC1B 2WUCH 1MHCA 4RFEB 5EOTB 3O9WA 2FX9H 3OKEA 2IG2H 4XCCL 3QSKB 2JKXA 4LPXA 3BRDA 4P5MB 2AJVL 2B4CH 4GMSH 4U0RB 3RL1B 4D0BB 3V5HA 1WBYB 1BD2D 4K8RL 4PGJA 3KPPA 3C60C 1S5IL 3IFPB 3LHPL 3NZHL 1WWCA 1NEUA 4TPRH 5DHVH 3MLTB 5LWYL 1IKNA 1QFOA 1YMMA 5E8EA 2VWEC 4O9HL 5EN2A 2GJJA 1IGIH 1KACB 3WHE0 3KWWA 1YY9D 1IT9H 4P9ML 2HFTA 2EXWD 1IBGH 4NC2B 1X5GA 3MRRB 3C5ZB 4UNTA 1NMBH 1YNTA 5E1HB 3KLAB 1CFBA 3B5HA 1HKLH 4TNVF 5FECA 4M62L 1F3JB 2CMRH 2HFFA 4ZTPH 4M5ZH 1KCVH 4TVSa 1IAII 5FA3A 2HJFA 3IF1A 3D0VB 3QFDA 4Z7VE 4HD9A 5E8PB 1FC1A 5TPWH 3TYGH 3NFPB 2NR6C 4JFOA 3HI5L 4PJEB 4FP8H 3L3KB 3GFUA 1S9VB 1KCRH 4IM8A 5IROA 5ETUB 3SGJA 2IALB 3G6AA 5J11B 1RD6A 4QXTA 1IGCL 4HWNA 2UY6A 3QUMB 4DAGH 3ARSA 3ARTA 2YEZB 4Y5YB 5DJ2A 1MCBA 3SKNB 3S88L 1DBKH 2PKDA 4ODVL 3VI4F 2UY7A 5LBSH 1VFAB 5DJ6A 5EU5B 1UENA 5I19L 4AENA 1CTNA 4P2CG 3IDIB 2ARJQ 4OM1H 4LSUL 4YHPA 5D6CA 4MQSB 4ODWB 1RVFH 4Y4HA 4F37K 1PZ5A 5DURD 4BA8A 4P5KA 1ZE3C 2J8UA 3GEWB 3LQAC 4N0CD 3WFDL 2ZUWA 4M5YL 4LLYB 2VZVA 4IRZH 3C6SA 4OLZH 4TULL 1FZKA 1AR1C 4RAHA 5ISZE 2VXVL 1MHPH 2ZCHH 1FVEA 4PJFB 1DQJA 4HIXL 5D1QA 2FYYA 1A1NB 1D5ZA 3OB8A 3T3MF 3CFJA 3J7HA 3V6FA 3KPSD 2C3VB 4HG4K 3L3GA 3JV4A 2I25N 2DQIL 3LH2H 3KS0J 3MV01 4X6BB 4Y5XA 4NHUA 4PGBB 1YEKL 5C0BB 2MCPH 4U1GB 5JPMA 4NQSA 4XVJL 5C7XH 2ED8A 1MRCL 5KANG 3ZKND 3U0TA 1DDHB 4O51B 3F7QA 4G8GA 4QY8A 2JE8A 1NAMA 4P5TC 4ZUSA 5DUML 4BZYA 2CLVA 1QLRB 3K3QA 2GEEA 3PHOB 4JFYA 2AEIT 2ZUQC 3SCMB 1A2YB 1ZEAH 3VFMA 4PV8A 3QR2A 3EJYD 3QJFA 3A0OA 4Y2DD 2XIDA 4LEXH 3MLVL 5EORH 3JTSB 1IC5L 3AM8A 1FIGH 3I50L 1A7PH 4NP4H 4LSVL 4IJ3C 4WU5A 4YAQB 5D2NC 2J7LA 3FHQA 1TZHB 5DRXB 2PUQT 3F7VB 1UZ8A 3EYVA 3KLHD 1YPZB 3VXME 5L9DL 2BSSB 3LCYA 4P2RB 4YFLF 1IAKB 1ZVHA 2BOBA 2BVPB 2OI9C 4HDIB 1K5NB 1ONQB 3MCKB 1YEGH 1U36A 3SDCB 4ACPA 4L8CB 2A9ML 15C8H 4Z78A 3VXQA 4GKZB 1KOAA 4Z7UA 3SDDA 1G7LB 2NY3B 5DS8A 1EGJL 5MEOB 1JGEA 4UIMB 3M07A 2VZSA 1X5YA 2FEEI 2O26U 3MRJB 4PGCA 3K81A 1P7KB 2Z4QA 3L7EB 4P46C 4NWUH 5FUZL 5E1AA 3T3PF 3WL9B 5E5RB 2J5LB 4PGDB 3UTSE 1ZOXA 2EXYD 1DDHA 4F9PA 3C8KA 5GS2H 1OW0A 3VXOA 4WRLA 4QXGL 1L0QA 5ESAA 3HLAB 1R3HA 4QEGA 3RWGA 1QFUL 4LPYA 4I3SH 5DFVD 3IXTA 3HS0A 1A1NA 2UYLA 3PL6C 4PTTB 2IPTL 3F62A 2R0WH 1OSZB 3GSWA 1KLUA 3GMMA 3IDYB 5MERB 4ZTPL 3NFSL 4QOKE 2H32B 1P4IH 2BVQA 3GSOB 3JWDC 4R2GD 1RUML 1L7TH 1AE6L 3CVHL 1I1YA 4M7LL 3HUJB 1MCQA 1PYWA 4PJCE 1AI1H 4I0PB 3WLBA 1UWXH 1KGCD 3MRNA 1H5BC 5DHYB 3DHJA 4JRYD 1QG3A 1T2QL 3HS0B 2BRRH 2E9IA 3HC4H 4XCFH 1G6RB 1QYGL 3IDIA 3C6LA 5T1MA 1ITCA 3SGEI 3KS0H 1QPPA 5F7LB 3L3DB 4KHXL 2BSTA 4ZS6D 3HNSL 4HT1H 3HMXA 1CDJA 4IOFD 2CJUH 1RFDL 4XNYH 3QIBB 5F96L 1OSPH 1QLFB 1J1OH 3VG0H 1BVZA 2W9DL 3FT2B 5GZOD 2Q87A 5I75C 3MCKA 4CW1A 4ODBD 5C08E 1V05A 5DUMH 4WFHD 1YNTB 4JRXD 2VXQL 4UB0L 1MJJB 1INDH 4UT7H 1AKJB 4EVNB 4YPGA 1Z0MA 2F5BH 5J11C 3RWJB 1GZPB 2HLAB 1MCJA 5FV1L 1SBBA 1TFHA 1K8DB 2QKIA 1QHOA 3EO0A 5EO1A 4QXUH 4YH6A 5GPRA 4TNWK 3LH2L 4ZAKB 5SX5K 2MTPA 5JR1H 4NC1E 4E42A 4DN3L 4RFOH 3EYUH 3QBTB 1LO4H 3C8HA 1D9KA 2X1WL 4EOWH 4KK5C 2FGZA 1E4XI 2Z93B 3P9LB 3S98A 4DFIA 3PHOA 4FG6C 4HBCH 1JWSA 3ILQD 4QRTB 2XN9B 2HAZA 4EJ1C 3QG7L 3MGAA 2P7TA 5IJVA 1S9XA 4D9RD 3VFWB 4OD3L 4XPGL 2H26B 3TZVB 2JJWA 1BD2E 4QHUB 3FO0H 3VFPA 4ONGL 3P9WB 5K93A 4XNMB 1U8KB 3O2DA 5ESVB 3OG4B 4PUBH 3H2WA 3TBVA 5I19H 1WLHA 4GKSB 3P4NB 4U1KB 5LAXA 2AABH 1D5ZB 4QGTA 4X4XB 5FK9B 2ATPA 5GRUL 3H8NA 5EZLA 3V4VH 3VXSB 3RIFK 1FYTA 1EFXB 4KY1H 3U46B 5MEND 1FL6A 4JQVC 1TJIH 5BV7L 4KKAD 1AC6A 3L1OL 4A2MA 4F8QA 1E4KA 1SQ2N 3WJJA 5JNYA 2BDNL 1MIEL 1B0RB 1Z3GL 1G7MA 4LRNH 3I75B 4NKMB 3I6LD 2Y5TB 1VPOH 5F7UA 3DX6B 2XA3A 1N2RB 2A1WL 4OF3A 4QYOA 1GPOH 4QHNA 4ONHA 4QHNB 1LNUA 2JB6B 2C3XA 3MRMA 3UPRA 3IJSA 1U41A 4UI2A 2P5WE 3VRJB 1NFIB 1XR9A 5FB8B 3I84A 4OFPA 5CBEA 2VZ3A 4HJGA 3U4EB 5J1AB 1KPVA 2ARWA 4NZUH 3X3GH 5JXED 5I1HL 4OLWL 5I18L 1SVZA 5BO1H 2AJSH 4WV1A 2NXYC 4LVOB 3SGDH 5IW1B 4LHUB 1MWAL 3MNWB 1JHKL 5FGSA 1WIPA 2OR7A 4HV8A 1ZLWK 3RTQA 2VDOH 3B9KC 3MJ9H 2FX7H 4OZ4B 3W0WA 5J12B 1CLCA 3NN8A 3QXUA 5GS1B 4ZSOE 3MFFA 4C4KO 1KCSH 3PV6B 3M8OL 4FQIH 4MS8D 4IIQB 1AQKH 5DDHB 3MRIA 1C5BL 5FGRA 1RUQL 1AXSA 3X12B 4JCMA 3OAYK 5CJXC 4JDTH 5EC2A 1JYWA 2HVKB 1YY8B 1MCOH 3RHWF 3G5VB 5E6ID 5A2FA 4GOSA 5IIEA 2JIXA 4WW2F 2HH0L 3OG6B 3FQUA 4JFZL 4PJ7F 4YX2H 4Y4FA 5FO9A 3INUH 2VLME 4A6YA 3JTTB 3IGAB 5D1ZD 4KMTL 3T2QA 1WBXB 2BSED 2DICA 3WUZA 4P2QA 3MXVL 3VA2C 3ABZA 1IL1A 4ZNCD 2R1WB 4PRAB 4P48A 5JW3H 1II4E 4HC1H 5DJYA 1XAUA 2E7LC 1MCPL 4P9HL 1NEZB 2VH5L 4IDLA 4GQ9H 3RA7H 4U6VH 3PGDB 5H37G 5IROC 1ZHNB 1ZS8A 1IILE 2YD5A 3ULUD 4EDXA 4P3DA 5F1NA 1A6PA 5D7JD 5TE7H 1UH2A 3FCTA 3LQZB 5J8OA 3RI5F 3CMGA 1V3LA 3BP6B 4LARL 5DQJB 1B9ZA 1T7WA 2UZXB 5DK0A 4ORZC 3G6JA 3X17A 1GJIA 1SYSB 1DFBH 5L2KA 3LS5H 4AG4L 5GS0L 4P5TD 2UUDK 3BZ4B 2IQAA 4XVUC 1GXEA 5C0AB 3RZCB 1NUFA 1INEL 3RKDD 4CVZB 4AEEA 1CFQA 1JPTH 4PS4L 5DK3A 4ONHB 2G5BB 3IXAA 4XBEL 4IRSD 1XGRB 5K9JH 4X99B 3H3KA 4YC2B 4JQXC 2A6JA 2Y7QB 5I6XB 3W0WD 1WWBX 2ZUUA 2CD0A 3BN9D 1G7HB 5LCVH 4C4KT 1MCDA 3BRFA 1SEBB 3VD4A 2FIKA 5DYOB 4JFXA 3SOBL 3KLHC 1YEDA 2AAVA 5KJRL 4EBQL 3BKJL 4OFDA 5IV2A 4IRJC 1OAUL 4HMEA 5IR1B 2KKQA 3GKWH 3SDDC 1SY6A 5DJXA 3VFVA 3S8WA 1XGQA 4Z8FH 4TVPH 5D2NA 4P23C 5T5FL 1K4DB 3FONB 3KPRA 4O2CB 3EYSH 3KYKL 4ZOCA 5FK9A 4PBWD 5GQBA 5ERWB 4KRPB 4LOUC 3RWGB 3MV7A 2C3HA 2YKLH 3V6OE 5EBLB 3N0PB 4YWGH 1Q72L 4QHUA 3VFPB 2R1WA 2PR4L 5ACZB 3O9WC 4MJ5A 5DJAB 2BVTA 1FNGB 2OYPA 1XMWA 5C09E 3R8QA 1HKLL 4U1IA 4PGCB 4P2QB 3UAJC 4YNYA 1MUJA 3DSFL 3FB7B 3S36X 4P57A 1UXSA 3LZFL 1V7NH 4JY4B 2KQMA 4MNQB 1I7TA 4NQDD 3TIEA 4Y4FB 4HS3B 2FECI 5DJZB 2IFFL 1EAPA 2JIXB 2FHCA 2ZUSA 2HT2D 1OP5H 2G2RB 1NCTA 5FO7B 1NGZA 3WV0A 5D7IA 4N8VA 5KAQF 1M6OA 1T2QH 2R0ZH 4I3RH 4P4RA 2Q6WA 2R4SL 4PB9H 4KKLD 1OGAD 4Y1AB 3HA0A 4JM2B 4JPVH 1MAML 5BZDB 2ID5A 1AQKL 2FD6L 5C08A 4JFFB 2N7BA 4AK1A 2GYSA 3FQNA 2GI7A 4X7FC 2XWJB 1UGNA 2QTEA 2P45B 2YN3A 3P0YH 5DD6B 2JTDA 5IGXH 4DVBB 4IHOB 4XPAL 5HYEA 5DJZA 3TN0A 1PQZA 3GHEH 5JUEH 3MLXL 4MJIB 5D7JB 1RU9H 4JKLA 5JIPA 3UTZB 3K1KC 5CIPH 5EOCL 3TV3H 1S5HA 1DBKL 4P23A 2VSDA 5C0BA 4HCRA 3OR6A 1JK8B 3CVIH 3HG1A 5CGYC 5H2BA 3BH8B 1PD6A 1L0XA 4Q9BA 2YD6A 2P8MA 1IVLA 2EE6A 1NCAH 5ISZD 2Y9RT 1IM9B 5E4EC 1KB5B 4J7RA 5SWQA 2Z92B 4WTZA 4EN3C 2MFNA 4IRSA 5DHYA 5CD5D 1B0RA 4XNXH 1R3KA 5EU7C 4ZTOH 1UVQB 2OL3B 4FABL 1G7QA 5JLZB 4Y5VC 3I6KA 4WJ5B 4XPTH 4ZUVA 4YHKH 1CXIA 3JWDH 3GJFB 1E6OH 4ZXBD 4D0CB 4D0CA 4ZXBB 1R5IB 1KJVB 4ELMF 4MXVF 4OT1L 1MNUL 1A7BA 1CICC 3PP4H 3MLVH 3TBWB 2R9HD 1MAKA 1P4IL 1WGOA 3U0WH 5BS0D 4YDLC 4F2MA 4LP5A 2E6JA 3IXAB 4G6JH 3C8KB 1SMOA 1DANT 2HFGL 2I24N 2ESVD 5DZLA 2NW3A 1FFQA 4XTRD 2GTWB 3ARBD 1F4WH 4QTIH 2H6PB 4M6OH 4Y5VB 4FQ1L 1UEMA 4P2YA 2CIKB 2YZ1A 5FM8A 5FGBC 2VR5A 2VRAA 5CBAB 2DMBA 1FFPB 4DGYL 2ENYA 3TIDA 1MH5B 3EFFA 5DMKB 3T0EE 1N6UA 1TVBB 4JHAH 4YHLH 5JW3L 2J88H 2Z8RA 1EXUA 4PRNA 3QI9C 4QHLB 1BFOB 3NCJH 3JSSA 4M93C 4Y7MA 4AY0A 2BVYA 2OK0L 3KJ6L 1WWAX 4OAWA 3P30L 4PJ9D 1OPGH 5D7JC 3D3VD 1HDMB 3RY4A 5KTEH 3BISA 5B39A 2HH0H 2XKNA 2W0LA 3QCUL 1NC2D 5D72L 3IJYA 2X4RA 3FN3A 4CMMB 3KPPB 5SWSD 4GLRH 4IOSD 4YDJB 4EUPB 3QIUB 3SDXA 3TO4B 3WDIA 2I26N 3TIDB 2HG5B 4M00A 3N85H 3FQUB 3BWUC 4EI5B 2DQFB 3AU1B 2NY0C 2NY4C 3A67L 1T1WA 4J3WA 4OI8A 4KQ4L 5D9SB 5JZ7C 4K9EC 4D9LH 3QQNA 1TTUA 1PBYA 3I2CH 2ENSA 4I48A 3MCG1 2DKMA 2FJFA 3VWJC 4P59L 4JFED 1BD2B 1TIUA 3L3GB 2AJXH 2P48B 5KVDL 2NYYD 1Q9LA 1CL7H 2DLFL 1I1CA 4S1QL 4Z7WF 2XRAH 4XVSH 2VITA 5CKAA 2OQJA 1EZVY 5D2NB 2I27N 2NY1B 5FYLD 4HWEL 4B7IA 5BS0E 2X44D 1J10A 2Q20A 3QIUD 4FQQB 5DC9B 3SKOA 3BP5A 3NCYP 1SY6L 3C6SB 3ZKSD 1EEYB 1DBAH 3UDWA 4PUBL 4P5TB 5LGJA 4LIQE 4H1LH 2H32H 4GG8B 3KYMA 2H32A 3QUZA 4MB5A 4J3SA 3NIFE 1EEYA 3NFSH 4H26A 1F8TL 4Q6IA 1ZLVK 1OSZA 4HJGB 2EH7L 2XA8L 4Y16C 5J1AA 3QEQB 3X13B 5FUCC 1AXTL 4NN7B 4NRZA 5LWYH 3U1SH 2XY1A 1V3MA 4FZ8H 3PG2A 2Z9TA 1NL0L 4RCAA 3F7YA 3P77A 4XAWH 4QXGH 1MCKA 3UJTL 5C07E 5HDOA 4NRYA 5JPNA 1CE1H 1GOHA 1UWEL 1S8DA 1J1PH 1J8HE 1NGWA 3BP7A 1D9KC 2W9LA 3BUTA 1AJ7L 2DQFA 2JJVA 3CPLB 5AUMA 3CXHJ 3DBXB 2EDHA 3W9EB 3B6SB 4PJ9A 3VGDA 3QZWB 3EDDA 4UUJB 2XNAB 3THMH 4OFVA 4O2FB 2F54A 3U0PA 1LEKB 3DX8B 1RUKH 1RZ7H 4LNVA 2PN5A 2CLRB 5DD6A 2DI7A 5F89B 4QF1B 5DO2C 1M1SA 2VC2H 1DVFD 1UKQA 2R4RH 3BGAA 3BHBA 4O58L 2W9DH 3VFRB 1WICA 2CO7B 5D7KD 4YDKL 1DP0A 1KPRA 4I3GA 1A6WL 3L95A 1WAAA 1KNOA 1EBPA 2HWZH 3O41A 5E4EB 4H1LG 3GIZH 4LSQL 5IB1B 3K46A 4EXPX 1M7IB 5KVGH 4QTHB 1JUFA 1T04B 1VEPA 2CRIA 1P7HL 2CH8A 2VLJA 3VRIA 3QNXA 4XHJC 5IVNA 2EDQA 1TITA 2X4QB 1JHTA 4PJHE 1YJDH 1T1ZA 4G7VH 5LG1A 4QRPD 2CRYA 5F9JB 2HVJA 3P4LA 4NQDE 4OD1L 1YA5A 4PGEA 2LU3A 3QH3A 5ENWA 43C9A 3S34L 1NDGA 5E6ZA 3F7RA 1SBSH 3NIGE 5DJAA 5EO1B 3BEVA 2VUOA 4JRXB 1MFEL 3C5ZD 3BDBA 1L7TL 1K3IA 4HCRH 4M03A 1LE5A 5GRXG 4ZSOA 3ZSSA 3MV7B 5KSVA 4JM2F 3DUHA 5CILH 4C54A 1MJJA 2AJUL 1E4KC 1OOAA 4JKWA 4OZ4A 1FV1B 4HQQH 5FDWA 2QEJA 5MENB 3RVVC 3EZ8A 3FO1A 5C0EB 2GKIA 3VWKC 1R5WB 3FQTB 4P5KB 1PZUB 1PZ5B 3C2AL 3HR6A 4O02H 4HW6A 1MREH 2A73A 2FZ3A 5DUPL 4NM4H 1J8HA 7FABL 2P43B 4L1HA 3CPLA 1FLTX 2B20A 3CSBA 4J1UA 5C92A 1NAML 4Z18A 2A6KA 5IW6B 2AQ1A 2PYFB 4HPOH 4Y4FC 1QSEB 3L3DA 1NFIA 5I0DA 4FFYH 4LPVA 4G42B 2YEZA 4Y5YA 4K3GA 2H2PC 5DJ2B 3HRPA 4NO5B 1J5OL 1OTSC 1KN4H 2BNQA 1XFPA 4PP2A 3DX6A 3CH8A 5I2IA 5IOPB 5ETUA 4MA7L 3ARDA 3ECBB 3R1GH 4G6AD 5I17A 1EIBA 4J12A 1MWAH 3FJTA 2BC4B 4KTYA 2G9HB 2YHGA 2ORBL 5H94B 4LF3B 3WS3A 1MJUH 1NDMA 2CDEA 4GMTH 3GHEL 4KTEL 1A7OL 5I74B 3TN0D 4NZUL 1EZVX 4K94C 3S96B 4P9HC 1KIPA 5D71H 4OB5H 5E8OB 4I77L 3GBNL 3GMMB 1B0GA 3QQ3B 4MA7H 5BJTA 4I9WE 2Y07H 5FUZH 4M9OA 4FRWA 1P1ZB 1ZHKB 5FEBA 2VN7A 4EUPG 3WN5A 3DVNA 1IGIL 1I8LA 2AXJA 4LKCA 5ESVA 2HJLB 3D85A 5L88H 3QDJA 1KIQA 3BEVB 4KK9D 3Q6GL 1X5ZA 1YEIL 4YC2C 2ZSWB 3TCLA 4LVNB 4JO2L 4HIJA 3SKUD 1TJGH 4EOWL 4FNLH 4WI7A 2YOCA 1JWSB 1T21A 4HH9A 3VXUB 2QR0B 3S4SG 3L7FB 4KKNA 5B38B 4WUKH 3WKNA 1XGUB 1P4BL 3IJYB 3CLFH 3T08A 1AO7B 5MP6H 2X4NB 2W0PA 2NY5L 4HKBA 1UADC 5IFAL 1CVRA 3KDMA 4ISVB 3I85A 5LKNA 3MGTA 2VC2L 3FAWA 3RX8A 5DDHA 1FVCB 1XF1A 1U42A 4XCYA 1T66D 3OX8A 1XF4A 3ARDC 4H0GA 5CS7A 5GJSH 1ED3A 4MD4A 1R3LB 3WDHA 5CHNB 1KJ2A 4Y89A 4KROD 3E0GA 4AYFA 3MNZA 4TVPL 1IQDA 5AYQA 2V7NB 4CAGA 4OFYD 3MV9E 2PETA 3VRLF 3R06B 2F53B 2IAMA 4I1NB 3L3JA 2NQCA 3RDTC 2BC4A 4L4VE 3DX9B 3UTSA 4I13B 4MA8L 3NVQA 4GAYA 1XR9B 2AJSL 5FYJL 4GG6E 5J9PA 3FQRA 2DB8A 1NC4A 1K8IA 4MNHA 1W0VA 4NQCE 4M48H 5KS9B 1LO0H 5SV3A 3ROOA 4WWKA 5F9DC 4X6DB 3WIIL 3CH1A 4OFIA 1NKOA 3QIBC 3SY0A 1KEGH 2EE2A 3OMZA 5IVXE 3NCEB 5C6TL 1JF6A 5L2KD 1KELL 2CUMA 1L7IH 1CQKA 1AHWC 5EULV 3FN0H 2ZJSL 1NGXA 4MQ7B 3RNQA 5C07B 2VKXA 4WGVB 3FO1B 5C0EA 3MA9H 1OAKL 2EYRA 3I9GL 4YHYC 1N5YL 1FZOA 3O3AA 1VFBB 3GRWA 4ZUWA 3HZKB 5IM7A 2ATPB 2AW2A 3CC5A 2VITB 1OHQA 2YPVL 3DETC 3UO1L 3HI5H 4MQTB 1ZTXL 4XC3L 2DQUL 4Z8FL 1F2QA 5DHVB 3IDUA 3WS6A 4ZFOA 1NEZA 2NY4D 5E2UH 2HKFH 3ZHKA 4GXUN 4Z7NF 1OD7A 4MGXA 4X6FB 3IDJB 3DXAB 5FM5M 3IFLH 3AU1A 5EU7E 5SWZE 1NDGB 4U6YB 5T3ZH 3MCLL 1CR9H 5F8QC 4O5LL 4X7EC 4Q9QH 4WHCA 4MYWB 2C4FU 4YE4H 5F88B 5FA3B 2Q76A 1TETL 1CXHA 1QVOB 3BGMA 1J0KA 4ESKA 1JZ5A 3WS6C 1OPGL 4GMTL 1OAYL 4QOKA 4QTHA 1A7PL 1FE8H 4P2RA 2VXUL 1KN2H 5B4MD 3TA3B 4BFIA 3FB5B 4NC1C 1Q9OB 5K9OA 3OGCB 1KPRB 3LKPA 4DEPB 5T1KA 4GAJL 3NGBB 4NSKB 3T1FA 2IF7A 3ULVF 3C60D 3WE6B 5IHUH 4X80H 3FL7A 4GRLC 2C4XA 3WFBH 1BFOA 5GGTH 3CZFB 3VFMB 4YO0A 2FLRT 4GAGH 4HUVA 1UFUA 2V5YA 3WXWH 4DKEL 1REIA 1UM5L 4QRPB 4GW5A 2GUOA 4Y19E 4POZD 3MLSL 35C8L 4DQOL 2YD4A 3GSUB 1KENH 4U6VL 2R29L 4HUNB 1HH9B 2HMIC 4G8GB 4QY8B 5L2JB 1BPVA 1N6VA 1J05B 3QHZH 1LEGB 3V0VA 1JGUL 5F97E 2BSTB 1S8DB 3QDJE 3OAZH 4YUEH 4M02A 4MXVE 2NMSA 2YD3A 4DUVA 4WUKL 3WNNA 1FCGA 4OLXH 4JFEB 2IGFL 4NKQB 1UYWL 4X8JA 4X6BA 1ZKAA 1IAMA 4KVCH 1BGXL 2Z91A 5EBWA 3GMPA 4L5FH 5FYLL 5D6DC 3DMMC 2WIIB 1FVEB 4XP4L 3QEQA 3QHZL 1IGTB 3X13A 1E6OL 2F58H 1FZMA 4RISH 3CSYA 3VFVB 4KDVA 1MCOL 4X6CE 5HGGS 5IBTL 3O2DL 3CGTA 4LCIL 3HUJA 4RDQF 2OL3H 3RZCC 3FKUS 1NC2A 4XNXL 3LQAH 4OCNC 3I6KB 4ZUVB 2FBJH 2VDKH 1DBJH 1YJDL 3QRGH 2VDPH 1D5MA 1EFXA 1E6JH 2X2YA 5FYKD 3FRPA 1UXWB 2OZ4H 4RGNB 1NMAL 2BFVH 4W81A 1JRHL 1J1PL 1U58B 1EDQA 1QBMH 1QSZA 3VFNA 3CFKB 4KJYB 2Z91B 5AZEL 4R7NB 4NUGH 5D2LB 3MV8A 1CFQB 2FJFB 4KGLA 1CXEA 1E4XL 5J6HB 3BEWA 5LGHL 2XWBA 4QNPF 4WHYG 5D8JH 4M7ZC 1FFNA 3GI9L 1WK0A 5T3XL 4BK4A 1BM3L 4OCYH 4XPFH 1D3CA 3CU7A 3MRCB 1YYLH 3STBA 3MRGB 4XPTL 1IM9D 5KS9E 1N3NA 3RGVC 3OKMA 1CDCA 4MVBD 3ZL4H 3LQZA 1JFQH 3QO1A 1ZHLA 4OLVH 4XVTL 1PG7W 4IMLA 1FPTH 5IMLB 5B39B 1CLYL 5C08B 5E2VL 3SKJL 5ICXB 2GT9B 3VD7A 3LN5B 3GJFH 2D03L 3ZDZF 1RQ5A 3D48R 5T5NG 3UO1H 4DWHA 1FG9C 4YPGB 3P2TA 1NCCL 1Q9OA 1WFUA 4HKBB 1NAKL 2AV7B 3L3IB 5IFJB 1CZ8L 1K4CA 1FNFA 4U05A 1N4XL 4TVPE 5J1TC 3BWAB 4HUMB 5AEAA 1EUUA 1SEQH 2VR9A 2G2RA 2OTUA 1FDLL 3CMOL 3IETB 2AK4B 1T5XA 1RMFL 4P5MA 3SCMA 5DFWH 3C6LD 3MLUH 4X7CC 2VLJE 4PJ5B 1PKOA 2X05A 3QXDB 3ARBB 1J1OL 3VG0L 3F5WA 4HBQA 1NUNB 5H35B 5DC4B 4MB3A 4NHCH 2EDEA 4MXQD 5D4QA 2XI9A 2P5WB 4YIQB 4FXGB 3WJJC 4OZFB 3CMOH 1FDLH 2OS7A 1CFSA 2VZTA 2XTLA 2COQA 3ARZA 5EU3A 3BX7C 2SEBA 1IFHH 3Q1SH 5ITBL 2VLMD 2YK1H 4PP1C 1XH3A 4TUKL 3P30H 4R4ND 3T09A 3KPMB 3CFJB 5ERWA 3MFFB 3F6IA 2GK0B 2NXYB 4LVOC 4J8RB 1QRND 1YQVH 3JWOL 1VFBA 2MNUA 2IWGA 1DQQB 4Q6YA 4XMLH 3EYUL 3Q1SL 1HILB 1UKSA 4U3HA 2JCCF 4JE4B 3OZ9H 4XCCH 1ZGLA 1MJ8H 2Y6SC 3O0RH 3T2NL 1YPZE 1J18A 3VXMB 1NFDF 3T3PE 5C09D 3RVUD 2VDLL 3GSOA 4ODWA 1VADA 4ENED 2B1HL 2GSGA 4DJMA 3G5YB 3P4OA 4PJHB 4U7MA 4O58H 4PR5B 5IB4A 3B5TA 5SWQB 5GRVL 3WSQL 2AV1B 5D1ZA 4RMWA 4UNUA 1GGYA 2FR4A 4FXKB 1XGRA 1MCEA 1U2CA 2WWMD 5EO0B 5EUOA 4R96B 3DGCR 5DD5H 4HIEA 1CS6A 1OTTD 5J13C 5IFAH 2NY2C 3HZYA 3Q6FB 4Q7DA 2ZNWA 1HIMH 2DBLH 5ANMB 2XACC 5C6PB 3EBAA 5HSFA 5C0AA 1IGMH 1DBML 4M6NL 4NQDA 1AGFA 1T89C 1S9VA 1P7KA 2Z4QB 4S1RL 2EKJA 4XXDA 3VMNA 5CIPA 4C83B 4FQ2H 1FVDB 3NFPA 5C8JB 4QRRA 4UIMA 4YK4C 4P0DA 5DRZB 5ECJE 5GGRB 1ZT1A 2VAAA 3DURB 3MREA 4GRLA 1I75A 3U9PL 4ZOEA 6CGTA 4G6MH 4K94H 4FP8L 3K7UA 4L8CA 1GOGA 1IARB 3MLYL 1XIWB 4LSDA 1MHHA 4HDIA 3U9UB 5HHME 1NBZA 3QXVA 5A2IH 4NQCD 5GS2D 1AXTH 1MLBA 1F4AA 2BXYA 5C0RL 3GSQB 2W38A 5JDSB 1XF4B 5FYJU 4XNUH 5I1DA 1TZHA 1QSEE 2J6EL 1ZSDB 3KHOA 5EIVA 4J4PD 4Y1AA 1NMBL 3EO1A 5CZVL 5M94B 1X5AA 3BD4A 3T8XB 5T1LD 1HSBA 3TNNA 4JFQA 5HGDA 3QUXC 2X1PA 3RWIA 3REVA 2E9JA 4NFCA 2HVJB 1KELH 4UOW1 3BPNC 5EIQA 5ANME 1EAPB 2AXGA 1Z2KA 4LLWB 4UQ3A 1YECL 2BP3A 4UQ3B 2XTJB 4S1QH 1SYVB 1KFAL 5TE4H 4B0MM 3SE9H 1OARH 2Y72A 5TE6L 1NLBH 3OKDA 2IG2L 3ES6B 5F72S 2QQKH 4TRPL 4ZAKA 4JLRA 3BIBX 5KSAA 3HN3A 3VFTA 1TCRA 4WY7H 1PY4A 4Q58C 4WI2A 1UZ6E 1BQHG 3UTQB 4L3EB 3V4UL 1ZHBB 1XIWC 4UINH 4WUUE 1RK0A 1QPXA 2ZWLT 5KOMC 1KEML 2W60B 3O3EB 4I2XE 3GIZL 2PXYA 1DQJB 2NXYD 5J12C 4MNGE 1I4FA 1NFDB 5HI4D 1KTRL 5BJTB 1TTFA 3BAEL 5GHWH 4NM4L 3UJJH 5E99L 2AK1H 1G0YR 3E8UL 3T0DA 5BW7A 1KT2B 4PBVC 1DQTA 1CK0H 5IV2B 1JGUH 4UUJA 3S37X 3QDMA 5IK3A 4MXQC 2VYRE 2ADGA 2P5EA 2B1AH 4TVPD 5MEPB 1LO5A 4L8SC 4HQQL 1YEDB 4OCLC 1LEIA 5LXGL 5HHXH 4HJ0D 2RGSA 3AB0B 1NBQA 2ZCLL 1WAAF 4XXCC 2C26A 1Z9LA 3FRPG 1Z6JT 3GMRB 4WI4A 1RZJH 4MAYB 5LBSL 5KSBE 2BCKB 4ELKB 1S3KL 4X99A 4KFZC 3ULVH 4H8WH 1TMCB 5GRJH 1TZGL 4Z7OF 1KUMA 5TFSH 3IDGA 2VERN 1B6UA 2OP4H 1JHKH 3N1GC 1XGYL 3JWOH 1RUPH 3DWTA 4OTXH 4EXKA 4FNLL 4LHJB 3W11D 1T4KA 8FABB 4HIHA 1U3HB 1I7ZA 2BRQA 1PYWB 3HI1B 4CNIB 4PJDB 3VH8B 1FBIL 5FM5O 4P5TA 3HC0A 3N50A 1R5WA 3FQTA 5LGJB 3BUYA 3RWDA 1FPTL 1MVFA 4EIZC 3QO0B 3IYLW 4LLVA 2VMFA 3RWFA 1OLLA 1GHFL 1OGTA 1AE6H 4YBHA 2WBKA 2XYCA 3KPMA 4NPYB 4YHZL 3QA3B 4XPGH 1GIGH 1T20A 4OBRA 2RBLA 3MYZA 5CSZB 2UUDH 5C2UB 1KCKA 5I1GH 1EHXA 3T04D 2XFXA 1KTLB 3KJ4B 3C5SB 4DTGL 3MMEA 3LEYL 5E1AB 3UTPE 3FOMA 4OZFA 4YIQA 2GTZB 3QIWA 2DQUH 4ZAKC 4U1MB 1R5VB 2X89D 4JANA 5C0DB 5HHQA 5BV7H 2LTQB 3BH9A 4N90D 4APQB 1YZZA 5TDNA 5CFHA 1T5XB 2WWKO 3IETA 3GKWL 3ULUC 2MCG1 5EC1A 4AL8H 1JL8A 5KSBA 3BKJH 2PYEB 5C0BE 4LCYB 3CVHB 4GW1A 5EOCH 3KPRE 4OCRH 2VXTL 4U1NB 3RL2A 4X0KA 1CBVL 3KAAA 3LN4B 2ZZUT 4LSPL 5J3HC 1ZLVH 1KEGL 2Q7NA 2APWA 4Y4KC 2B5IC 3MRPA 3JTSA 2NCMA 2GT9A 3BFOA 2A6IB 3LKQB 5HBBA 3AROA 4HF5H 4PJ7A 1LE9B 1WQVT 1YC7A 2A77L 4I5BB 3IB4A 5F1KC 2NY7L 2IPKB 1ZHLB 4KHTL 4HS6A 3TGXA 4F7TB 1JTPA 3TBTA 4OF5A 4EIGB 1DQMH 4OLXL 4HXAH 5J13B 4MA3B 3OHXB 5E6IC 4PIRF 1VFMA 4BYHA 4PJXB 4U1GC 4ODSH 1ADQL 4U3XA 1UA6H 4NC0B 4OLUH 1H15A 4KAQL 1A7RL 5CD3B 1EX0A 4NQSB 5CCKH 1N59B 2EXWC 3QXAA 1HCVA 1BJMA 3ZE0F 5C0FB 1CT8A 5HD8C 2LU7A 3P77B 1F4YH 2OTWB 3LQAL 4G9FB 2WBJD 5JA8B 4QYOB 1G6RA 4Y2DA 1UB6B 2PTVA 4QCIB 3NGBC 1A14H 3RVWC 1FLRH 3SE4A 4KAQH 4UV7L 2BZDA 4OF0A 1J9CT 3MJ8A 3FOLA 2W1NA 3BQUA 1I9JL 3IJHB 4JCLA 5DWUH 5E2WL 5SX4H 1DN2A 2QQQA 1U8QB 2JLLA 4NBZB 3ROLB 4WJ5A 5EUOF 2YKLL 1FE8L 1FGVH 5F6IB 4YHPB 2AEQH 2AJ3B 4Y1AD 4J4PC 2VOTA 3PQYE 1MFCL 5KTEL 3BPOC 2V5MA 4HSQA 3RVXC 4Z7UE 5LAXB 2EDRA 2LV4A 4PYGA 4KKBD 2LTQC 4OJFH 1TNNA 3QUMA 1ORSA 3BSZL 4P46D 2ADIB 1DR9A 4KI5E 3PQYD 1CFNB 1MI5B 3QULA 3LD8C 1Y6MR 4ODXA 4X8JB 4JFEA 3ZKXB 5KANI 4BFEA 1CR9L 4JN2B 12E8L 3NPZB 5CLTA 3TO4C 1CD1A 2Z31D 3WUWB 1MFAH 2NTSP 4PLJD 4G80B 3WL9A 4I2XA 2GITB 2WUBH 3HFML 3DXAD 4JZJA 4KI5C 1T1WB 3V0VB 2C3GA 4LLUA 3T4YA 5KZCD 4BQ9A 4OV5B 2YA1A 4MLSA 4MLIA 5EOQH 4D9RE 2HRPL 4F8TA 4ONOA 4U1SA 2EE3A 4ZAKD 4KJWC 1FGNL 1ZMYA 2VR4A 3DYOA 1AIFA 4GUPA 3O11B 5D7IE 1P9MA 3D9AL 4P4KC 4DGVL 1LO2L 1MPAH 1JPGB 4OUUA 2D31B 4U1JB 2XQBL 4MZ2A 5IFHH 1A02N 5GRUH 1U95B 3R4DA 1IJ9A 5EPMB 3DJ9A 4XAKD 5CJ5A 3O8XD 3FTGB 3C5JA 3G5XA 1U8JB 1R3IH 1AKJA 4EVNA 5ID1B 3WFCL 4DVRL 3HI6L 4WTZG 3ARDD 5E9DE 1T80A 3PUCA 4DZBB 5IBUG 3MV9D 5JOFB 3QUKA 1VGEL 3EFFB 1CGXA 4KRPC 4ZD3H 5D1XD 3BJLA 4Q9CA 4MHHI 2PW2B 2HJKA 1C16A 1S9YB 5SX5H 3VWKB 1FORL 4ZPVB 2BNRD 1OM3H 3LKNA 4UTBH 5ADPH 4Z9KB 3MBEA 2ATKA 2NZ9C 4Y5VA 4PG2C 5T1KD 4Z7WB 1C7TA 3U6RA 3B2VH 1FJ1B 3MLWL 3VXUE 3A67H 1BAFH 1OP5K 3TO2A 4ZFOB 3UZVB 1RHHB 2CDFB 4KJQD 1AR1D 5F6IC 1J0ZA 3PL6A 5FYKE 4XP9L 3KPRB 2QBWA 2B5IB 3T3ME 2EEBA 3JXAA 3LEVH 5BRZB 2XV6B 1U8IB 5TDPA 4W4OC 2C1OA 2BNQE 5C70A 4NDMA 1KJMA 3WSQH 5C0IA 1CDBA 5D96B 3EOYG 2R2EB 1IKFL 2ZUTA 1D6EB 1YDPA 3MV11 3PGCA 4V1DB 4ZFFA 4PLKD 3LV3B 2YBRB 3M8OH 4FQIL 1KCSL 4Z95L 3ARGB 2VWEE 4P99A 1PVHA 5DJDB 5H8DA 1A7RH 4HUXB 1OTUC 1UH4A 3DMMB 3GNML 3D69B 2O93L 2GFBB 1U92A 4L3CA 3HLAA 1EA9C 3SOBH 5IQ7H 4PJBF 4UV4L 5ESAB 4DKDC 3B43A 1KB5H 3A6BL 4OGXL 4F15B 1T1XB 3FB6B 3G6AB 2EICA 1SHMA 3ARED 4HX1A 1U9KA 5IT2H 2CRZA 3EOAB 5CJXA 2DN7A 2DS4A 2Y06H 2O61B 1AP2B 1QO3B 2WBJB 4G9FD 5K33A 1KCVL 1JVKA 5GGQL 5LGHH 4F7CA 1T3FB 4LDLB 4QT5A 1PLGH 5HYJA 5E9DA 3QDMD 5DI8A 3V6OC 4NHCL 3NIFF 3IFLL 5HJ3A 3MBXH 4P3DB 1S7VB 5KVEH 3O2WH 4L4TA 2VXTH 1BZ7B 4KKBC 1CL7I 1J86A 5DZNA 3TH4T 5FCUL 2OZ4L 4N0RA 5F6HI 1MPAL 2R39A 2H3NA 1T0MA 3TT3H 4YDVB 3MJ6A 1OCWL 1ETZB 4KI5D 1EEZB 1ULVA 3D2UB 3STZB 3L5WA 1M6OB 3FHAA 5F3HB 5GS0D 3L5HA 4OCXL 1I8KB 3TYGL 1QSFE 2BERA 4G6KL 4S1DD 4NJ9H 5B38A 4R4BA 3RBSA 5C0CB 4Y4KD 4OZHE 1XCQA 3MA7B 1OVZA 3HTLX 3RWEA 4BSVB 3EJZC 1EV2E 4YXLH 3RVXD 1XF5A 4HWZB 2MJWA 4W4NA 4OQ1A 1MHCB 4HPOL 5J4MA 3RUGA 5I8OH 5F7DA 1TVHA 2W0FA 1PJ9A 1NAMH 4ZOBA 4M7LH 3KNBA 3QUYB 2D7TL 2I60H 4PJ8D 4K7PL 2W60A 4WCYH 3RZWA 1T7ZA 1CK0L 4Y5XB 4NQED 4NQEA 4NQEB 2NXZB 1UB5B 3PWPA 1C5DB 2H1PL 1BIIA 4Y16A 5BXFA 2ORBH 5TQ0H 1P1ZA 1D5BB 2ZUYA 4L8BB 3TA3D 5EA0L 3CX2A 4WHTA 5JW5B 1K4DA 3FONA 2LU4A 1TQCC 2DJUA 4RIRB 1NANI 1I9RL 4LVHC 4R7DA 1JZ6A 3WEXB 3C60B 2ESVE 3PWLA 2AS5M 3D25B 2AEPL 2CO6B 5I0ZA 4X6CA 1IAIL 4Z95H 1TDQA 3ULVL 5GGVH 4XRCB 3SDAB 4XNQA 4CN4A 1I9RH 1AHWA 2O5XH 5EBMA 1F4YL 1WTLA 1G7IB 5C0NC 4G7VL 2XQYG 5IMKA 4MD0A 1BBJB 4DUWA 4GFTB 2DL2A 1UACL 4HUWA 2ARJA 5F9OL 2P5WD 2PW1B 2ICEA 3AMLA 3PXHA 4BH8B 5IEHA 3VCLA 4M93B 2R56H 1F90H 1L6XA 3I02A 3DETD 4KVCL 3K0WA 5MHSE 2CLZA 2HKHL 4P49A 4L8DA 4B53A 1GPOL 5FHAH 5JIIA 2DQCL 5HDLA 3UTTB 4YGAB 3I3BA 4LFHG 5F7EH 1ZVSA 3K1DA 1UT9A 4NWTH 4NBYB 1HXMA 4S0TD 3I6GA 1HHJB 4OCSH 4K3EH 3SDCD 1A4JA 2BNQD 2DDQH 1ZHNA 1ZS8B 2XT1B 1M7DB 3ILPB 3K2UL 5IMOB 4CMHC 4AQ1B 1H8SA 3THML 4EUPH 2KH2B 2ZSVB 4ZSOB 1ZLWH 5E94B 4DVRH 4XCNB 5DEGB 1BQLL 3QG6A 2DM4A 3D69A 3SQOH 4NKDA 4GBXD 1QSFB 4GJTB 4DZ8A 1N7MH 3ILQC 5GRWA 5HTSA 2V9RA 5GIRA 2IPTH 4F15C 4JHWL 3BKMH 1RIHH 3RL1A 4Y88A 5JMOC 3O8XC 1T7XA 1RU9L 2F19H 3OBAA 1A6VL 4C59B 4OLWH 4YQXL 3H7BA 3MACL 3VXPB 3OJDB 5TDPB 3UTPD 2NY0D 3NMEA 4HKJA 5HDBE 5JZ7D 2QV2A 5A1AA 4XGZA 5JIHA 5FYJH 5B3JE 4QHKJ 3ZE0E 4ZFGH 5DQ9B 5D96C 3V0WH 1JPFA 4LNRB 1W0YT 2YPLE 1DFBL 3GMNA 3PV6A 4OSUL 3BIKB 2X4UA 5IWLC 2H45A 3NIDF 3MC0A 5IW1A 1GGBH 1DL7H 4BFGA 4HPYL 5C9JB 1ITBB 2AVGA 3B6SA 4K3EL 2DM7A 4PJ9B 5I1KL 3MA9L 3CSPA 4Z0XA 1JN6B 2OTUB 3UPCA 3TEUA 4RRPA 1K4CB 1HINL 3L5WB 4N68A 5FB8A 4NKOB 3O3BA 1GYAA 1RJCA 3FTGA 1GIGL 3FMGL 3T0BA 4QRUB 3HE7C 4XC1H 1ES0A 4KUZL 2Y5TA 1QA9A 2CK0H 2CSPA 5DTFB 3T0ED 2F5AH 5KSUB 4G8FB 1FSKB 1I3RB 4Y4KA 2RFXA 3CFEA 1NGYA 2X4PB 3WLBB 1EPFA 3PHQA 4S2SA 3WFHB 2V17L 3V7AE 5FKPA 4ZPTB 1WFOA 2DTMH 1MSPA 4GKNB 4OTXL 2AI0L 1V8HA 3BD3A 3ZTNL 4JGJA 3MRBB 1DVFA 1QTYT 4E0RA 43CAA 4WWKD 2OXGA 3MO1A 4OZGE 3V5DB 1AY1L 3RGVA 2VL5A 3V2AR 2V2TB 3BN9C 3I6LE 3K8MA 1R3HB 1IC7H 4GKSA 4LLMA 5FGBA 3AAZB 4P46B 1D5XB 4Q9RH 2Y5EA 4OCYL 4XPFL 4KK8D 2X9YA 4GBXB 1QFWH 5GGVY 4N0UB 3MRKA 3TZVD 5F93C 3CX5J 4R0LB 2HT4D 3B83A 3AXLA 3B3IA 3D9AH 4N8PA 1LP9B 3OB0H 2MHAB 2EIZA 5L8JB 4K23H 1GGBL 4RAUA 4ORGA 3IRZA 1NC2B 2BVUA 3BQUD 4K3HA 5C0IB 3BQUB 3QIUA 4O2EA 3UJIL 1LQSR 2RQ8A 1K2DA 2FH6A 4Z77A 3RVVD 1R24B 5K59F 3A6CL 3ELAT 4ZXBC 3MJ7A 5E5MB 2PF6A 4R3SB 3S36L 2QADD 5EH1A 4XAWL 1FO0B 5JORB 4Q0XH 3MLZL 1VESA 3ARPA 1LWRA 5IKCB 4YPJA 3VXNA 5K9KB 5CEZD 3U6RB 4MJ6A 1MI5E 5E8DL 1LK2B 5DURB 3LPFA 2QHRH 4JPWH 1H15B 3QJFB 2ATKB 1OP3K 3S36H 1X7QA 3MV8D 4ETQB 2JCCB 3FT4A 2P8LA 4UTAH 5I75B 3LKNB 3OXRB 3I50H 4OQTA 4TYUA 2PO6A 4MX7A 4XMPL 3KPLB 1HH9A 3UXFA 2OR9H 4OF6A 1RZGA 3ZKNC 3RUGE 1KG0B 5ICZA 3V6ZB 4AT6A 3QIBA 1CE6A 5EZJA 4PRHE 3QEGL 4OZGB 1AD0B 4JPIB 2FIRT 4DZBA 2IPKA 4HKXB 2CR3A 4PRIE 3DRQA 3TBYB 4L4JA 4XMPH 2R0LH 4MJ6B 4XAKE 1BVLB 5DMJB 4UTAL 1MCHA 2YC1B 1CDGA 1QUNA 1T89A 2ZKHL 3FO2A 1JPFB 3RRQA 4FTVB 3LEXA 2B4CL 1S7QA 4KGJA 4N0UE 1ODAA 2D9QB 3S5LG 3GGWB 2OSLB 1TZGH 3FB5A 1CF8L 3EZJB 3U2SA 4NWUL 5D1QB 2BVOA 2FL5B 4HFUL 4U1HB 1IAIH 3VD5A 2VTFA 1K2DB 4Z77B 1S3KH 4GUPB 5E70A 3QPXH 5ADOH 3VXRD 4APQC 5D7KE 2A83A 3A6CH 4HXAL 4I3RL 4ODUA 1A6UL 3ULUE 1HXYA 1LP9A 3K8KA 4KMTH 3B3IB 2VLKB 2OL3A 2OBGA 3K2MC 3MUGB 1ORQB 4LIQH 4JZJB 2LABA 3UDWC 1JJUA 5FA4A 5C0JB 3IXTB 3ULUF 2DI9A 5FKAB 3SGKA 4WCYL 4EI5C 4RMTA 1G84A 4E41A 5GZOC 4Q9QL 2F74A 5C86A 1G6VK 3SDDD 4KI1A 3T1WA 1A0QH 3UBXG 1WBZA 2VL5B 1M7DA 2VDML 4LVNC 3SCMD 4RGOL 1MF2L 4KK8C 4F9PC 5DA0B 2IMMA 2I07A 4Q9RL 4OCRL 1CBVH 4JHAL 3RBGA 3LKRA 2CIIB 5I1IL 1LK3L 4RDQG 4ZYKB 2FECL 5IHZB 1T66C 3W0WE 1P4LA 5C07A 4HZLA 1XIWD 4TSCL 2NY3C 1BWMA 4MNQD 4F57H 2A83B 1HI6A 1SBSL 4UAOC 2QQLL 3E1F1 5MHSD 3IF1B 3IJHA 4FS0A 5DVKA 4KJPC 1C08B 3X3FL 3U4AA 1RZKH 2EC8A 1OCWH 4G3YL 4LCWB 4JFHD 2NY1D 1FYHB 4JO2H 5IMMB 2BVOB 2E27H 5IBLC 5GZNC 3DUSB 5ISZB 4TUKH 4WWKB 3KGRA 3T0EC 4OFKA 3EYVB 1U3ZA 3UCRA 1KIRA 4WDIB 4XTRC 2P46B 3FAXA 3BMVA 5EN2B 4WU5B 5KVGL 4G6AC 3BZFB 4BH7B 3WJLA 3CIQA 4C56A 4JVPA 5JOPD 1EERB 3IDMA 4WFFD 2WV3A 4XP1L 1Q9WB 2ZCHL 4M43L 2Z8WC 3NFNA 5FOBB 2QSTA 3BI9X 1Y6KR 2J4WL 5BQ7B 2O5ZL 1D6VL 1CG9A 2J6EH 3V5HB 5EZOH 3QI9A 3L3HB 5E7BA 3L5XL 3L3JB 1XF3A 25C8L 1I3GL 3QDMB 1RZGB 3ZE1E 1XCTB 3WHE1 4UBDC 1H8OA 3CLEH 3ZLQC 3WEXA 3MJGX 4P57B 3SJVD 2C3WA 3NCYS 4S10A 3A6OA 4AG4H 1KB5L 3DV6A 3HPLB 4WFHE 5DSCA 3I9GH 4HULB 3EUUA 5ID0A 3HHRB 4ZUUB 1YJDC 2X41A 2DTSA 4X4ME 3MODL 3MGTB 3V6FB 4YEEA 1GRWA 3KPSA 1WEJH 1RZ8B 1NCNA 3E6FB 4KKAC 5KSAB 4X0KB 1MWAB 3X11B 1I7RB 4NBXB 4WU7A 4PLOB 5KSBB 4HKJB 4JKPH 1ERNA 4HAGA 3EFDL 3DVGA 5DR5L 3WLWC 1QBAA 1BZ9B 1KC5L 2DWDA 3MRQB 1RUAL 5DVOA 1I9IH 3DUUA 4ZO7A 4UILL 1T21B 4Y5YC 3ZHDA 1MCLA 1DUZA 3JVGA 3QUYD 4NZRH 1WSST 3RY6C 5DK2B 3VU2A 4N9OB 2VISA 1VSCA 2Q1EA 2Z31A 2ZSWA 3BAEH 3VWJA 4AIZA 4IMKA 4JFDD 4HS8L 4FQJL 1A6UH 5DJ6B 4G43B 2CXGA 3HMWL 2Y7QA 1NFKA 1MCIA 3QFJB 3CK0L 4WI8A 3BN3B 5I16A 4F58L 2F53D 1GZQB 1N64L 5IQ9A 3CNKA 3ZDYF 4OZIF 5IVXB 4YGVB 1YEIH 4M61A 3QPQD 43CAB 3E6HA 5AZ2L 1HHHB 1AGCA 2X89A 4JFOB 1X4YA 5F1IB 3SE3C 4PJBA 3W2DH 3M1BB 3HC0B 1LMKA 3FFCA 4PBXA 3WFZA 1NDMB 2CDEB 5H94A 3DTXB 1I3UA 1J0HA 1FRGH 1S7TB 5HHPB 5CLWA 3RP1A 1F3DJ 3HUJE 5CGTA 4PJ7E 2OJEB 2NX5B 3MROB 3GHBL 4RRPG 3IDGB 3DROB 1HINH 3S35X 4L4VD 1RFDH 1V5JA 4BSWB 2NYYC 4QLRA 5BS0A 1KJ3L 3CXDH 5JW4R 1HEZB 4A6YH 1ES0B 3O6FB 2IGFH 1MHPL 3W82A 5F1OB 4PJIF 3GMRA 5D1ZB 1YMMB 3LKSA 5E8EB 2J6EA 2XN9E 4XNUL 1NCWH 2XZQL 4GXVH 2F9BT 3R1GL 3PIQA 1ORQA 3NAAL 3HC4L 3IVKA 2J12B 3WFEH 3LSOA 3PGFL 1Z9SA 5EZIL 4UZGA 1RY7B 5KJRH 4M4PA 5LGKA 5BCAA 3H9SE 1ZGLB 2DLGA 4LRNL 3HE7B 3HI6H 4XP5L 4AM0A 3IDYC 3ARFA 1IMHC 1EGJA 1F02I 1MAJA 5DD0H 1GGIH 4N0FA 1A5FH 1HOCA 3KYAA 1FN4A 1YN7B 3PL6B 1I85C 4HFWA 4MVBC 3GIVB 5GGUB 4OD2B 4TUOA 3RIAK 3VFSA 3DGGB 3HPJA 3MRLA 3UTOA 1XH3B 1IAOA 1MFCH 3O4OC 2F54D 4NQVA 3TPUA 4IRJB 4HGWA 2DRUA 3IFNH 4XT1C 3TT3L 5JHDB 3GIVA 3EYOB 5FCUH 3VI3F 2FWOA 4GQPH 3SDYH 1ZV5A 4XGZB 2GCYB 4NO3A 4GG6A 4FQHB 3V8OA 3PP3K 1YUHB 4KRPD 3VE0A 4HGKC 2F8XC 2E7BA 3HE7A 1YN6B 2VABA 4JZNA 5EU4B 4ZFZA 3V6BR 5H35A 3RZCD 1KTDB 5T5NF 4N1HB 4RMVA 1FRGL 5C0CD 3WLWD 4JDZA 1TJHL 3PP4L 3GSNB 1X6LA 2PO6B 3QIWD 4MX7B 4U6TA 1U8HA 4MHHG 1U8LB 1HH6B 5DLMH 2WQ8A 4J23A 4WFFE 3HCVB 4NYLA 2ICWB 3O3UN 3RWIB 1NGQH 3SN6N 5ID1A 5LJYH 1OWWA 3O41B 4MCZA 2R23B 1YEJH 3S4SA 3O2DH 1IQWL 4NKDB 1ETZA 3IJSB 1UCTA 4JG0L 4NQTA 2V17H 2Q7YB 3QUZD 4Y4FD 3AMKA 3S9DB 5A2KH 1RUPL 3FB8A 5JDSA 3MSPA 3WYRA 4HIIA 4BSWA 1IFHL 5ISZA 4DN3H 1P7QB 1CVSC 1JNNH 1JE6A 3TT1L 4LCWA 4LGRB 1W8OA 3KPRD 2CK2A 5EIIA 1C08A 2AJUH 5E2TL 3OKMB 1T3FA 1TTGA 1UM6L 2DBLL 2H2SC 5BZWA 3STLB 4Z0BH 5CJQH 3GMLA 5DD1L 1KLGA 5AUMB 5TDOA 3G5ZB 5AG9A 2R2HA 2EIBA 2O61A 3QNZA 4LSUH 4NQDB 4ZUTB 4HX1B 3WUWA 3MUZ1 1MLCB 4L4TE 4LSPH 3U36B 5I8CA 2EEDA 4PJCB 2APBA 2D9CA 4PPTA 3QULB 2XXMB 4Z7VB 3DMMD 3B9DA 4GAGL 4MJID 2L7UA 1QFWI 5GGTL 1KIUA 4G8GD 5I8EA 5FF6B 1DJSA 3E3QC 4WW1A 1LILA 4TSBH 5TF1H 4NO0D 2AJYL 3MV7E 5KSAC 3V5DA 4W6YB 3HAEH 4KHXH 5FM4A 2VDOL 3VFUB 4ODSL 4OM0H 3W9DB 4LLQB 1VENA 4R4NC 3H9SB 4XBPB 5C0AE 4I0KA 2NR6D 3EO9L 3AREB 3DIFA 3RUGF 3LS4L 1UQSA 3CJJA 2DL9A 4F7MB 4U0QB 4JKKA 4FQCH 1JI2A 2C1OB 2Y4SA 1Z9OA 1H5BA 3H3PL 3T4AB 4N8CL 1F4XH 4K3JH 4K7PH 2P42B 1I8IB 1RK1A 1EHAA 1D5BA 4FFZH 2EE9A 3EO0B 5CUSL 1KYOJ 4FZEL 2HFEA 4L8SA 2AEWA 1CCZA 3TO2B 2A1WH 3MGOB 1ZANH 4NQVB 1S9WA 3VGBA 3MV9B 2FEDD 4MDJA 3QEGH 4IMKC 4F37F 3PWPE 3KPQB 3CLFL 4JY5H 3VGHA 1FHGA 4CVXB 3KPNA 2A6DA 2J8UE 3CCHB 4Z0XB 4PJXF 4M1GL 3SE4C 4MA3A 3EYSL 3KYKH 3B8SA 2NW2A 3RWEB 1K6QL 4U6XB 1P69B 4JG0H 2X4UB 3O4OB 4ETQA 1VACB 4NKIL 2EIDA 4XZUA 1F00I 1CLYH 4ZTOL 1JWUA 2IADB 4R8WH 5F3HA 3NFNB 4MQXD 4GRWH 4PJIA 2JELH 3MR9A 4PRIB 1LHZA 4M62H 4I4WA 4C56B 1J8HD 3K8LA 1S9WB 1NMCB 3LN5A 3C6LB 1DANU 2ESVA 2IBGA 2WP3T 1G9ML 1BOGA 5JO5A 1Y0LB 3BXNB 4LGSB 1OGAE 1U8PA 1L0YA 5BS0B 4MNGA 4G9FE 3UC0H 3SJVB 4QHLA 3P11H 3CVHA 1YMHB 3OB0K 5HGBA 1Q38A 4UDTB 4JFZH 2A74A 4WI5A 1JYNA 2YPLB 2D4DA 2E5EA 3MRHB 4M1CD 3AM8C 3UYPA 1PGRB 4X4MA 4Z76A 4KUCF 1FG2B 1LP9F 1QFUH 2VSCA 3GB7A 2V9QA 1PY9A 4M7KL 4UV4H 2X9WA 5F1IA 2AJVH 2VZUA 4LLQA 1RUQH 3OR7A 3O6FC 4HJJH 5IB3B 3SDAD 1Q9KA 2CPCA 3ULVC 4YHOH 1Z5LB 4MD5A 2D7MA 4OIAA 3L5JA 4QXWA 3SDCC 4CL7A 4ODXB 1UZ6F 2HLFC 4R7NA 1J12A 4KJYA 1MJ7L 2VDQL 1CDIA 1EO8H 4GO6B 3RX7A 5I8CB 3JWOC 4W6XB 1OAQH 4OCSL 5HGHB 2DQJL 3BSZH 1A7QH 3DOSA 5LVEA 1DEEA 4MSWA 3P4MA 1OAYH 3IKCB 3OXSB 1QNZH 5CINH 4UT9H 4KROB 3STLA 4MQ7A 2Y36L 2ZPKL 3OAZK 2GJZA 4JFEE 3VXRA 3PHQB 4S2SB 4PY8J 3ULSA 2CKBB 2WP3O 4A6YL 4HT1L 2Z35B 3CFCH 1E0OB 1V3JA 2BVPA 4U1HA 2ICCA 2W9EL 2ADFL 5I76B 1H0DA 1JYXA 3BGFC 1N5AA 1MQKH 1VDGA 5IB5B 2JELL 3GGWA 3EIFA 4AEHH 2UV3A 3MOQA 4G9FA 4YAQA 4R90H 1OGAB 1CWVA 1HYRC 3U7YH 1NC4D 1NBVH 4EN3B 1SEQL 3MLYH 1KENL 5DMGC 2R23A 2Z8SA 4PJIB 3ZHLA 1M71B 3ZT7A 2X1OA 3Q48A 3LAFA 2GJ6D 2FJHB 5AZ2H 4D0DA 2DD8L 4S1SL 2YPKA 1MHEA 1GGCL 2ADGB 1C16B 1S9YA 4XP6L 4E41E 1UJ3B 4PV9A 1F6FB 4YFLI 1XZ0A 1KT2A 4PG2A 5HPOA 3L3HA 2YS4A 2HP4A 3C09B 2WANA 4QHMB 4TQEH 4GW4B 3VXTA 1E27B 1T2XA 1CU4H 3BQUC 5J6GB 1P84K 1WV7T