3HHRB

Human growth hormone and extracellular domain of its receptor: crystal structure of the complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
203
structure length
195
Chain Sequence
b'EPKFTKCRSPERETFSCHWTDEVHGPIQLFYTRRNEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN GROWTH HORMONE
publication title Human growth hormone and extracellular domain of its receptor: crystal structure of the complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Hormone/receptor
total genus 33
structure length 195
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hhrB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hhrB01
1T1YB 3QPXH 3VA2C 3E6HB 4ELMF 3RBGA 3HG1A 4U1MB 3GSXB 4IM8A 4UV7L 2BVYA 4ZQKB 3ILPA 2GY5A 4LDLB 1UG9A 3KPMB 3PV7A 4JREB 2AJVL 2PW2B 1I9RL 3AMLA 1YPZA 4DVRH 4S1SL 4LIQH 4RGOH 3BHBA 4X7TA 1CQYA 4I3RH 3V5HA 3TBVB 1HYSC 1ZVYA 4Q9QL 5GRWA 2Y6SC 4MNGB 4O2EB 1WAAA 3MRIB 2CDGB 5ICZB 3EOTH 5K33A 5T3ZE 2PTTB 4Q9CA 3TCLA 4XP6H 5GS2H 3FN3A 1U8MA 2ADIB 2J88L 4JANA 1B0RA 3MX0A 4DAGL 1FNEA 3B8YA 4G7VH 1A6ZA 3WO3B 3PWVB 1NLBH 1IKNA 3V4PH 2XWJB 5GZND 4NQEB 5IESH 4DQOL 5I1AB 4GRWE 4PRID 5BZDB 4PJ7F 5CKAA 1H5BA 4L5FH 2R8SL 3PDDA 5DJZA 4K55A 4Z7QF 2X70A 5EU3B 5FA3B 1PZ5B 4UDTB 2VLRA 1MUJB 1NCCH 4JFFB 3B5HA 3T1FB 4GQ9H 3VXUD 4XBPA 2NY7H 3QQ4B 5FYJE 2YC1A 3D18B 4DZBA 4GG8A 2H3NA 4XPGL 1TZGH 4HS6B 2V5RA 4Z7NE 3E2HB 2OK0L 4WV1B 1J5OL 1AR1D 1CE6A 5FHBL 3LPFA 4KJYA 2NTSP 2Y7QA 4XVTH 3G5VB 4Q9BA 1JV5A 1BIIA 4UIKH 1JPGB 1NCWH 2H26B 1U8LB 3HB3D 4PJBE 3D1MC 4WWKD 2APTA 1OW0A 5CILH 4F7TA 4JDZB 3R4DA 1Q9OB 2WUBH 3QXWA 2A73A 1JVKA 2YZ1A 2B7DT 5CEXA 5B22A 2VN7A 3L3KB 1K3ZA 4KK5C 5BMFL 1Z9OA 43C9A 4LDOB 4MJ5A 1ZWIA 4PJAE 2M8XA 4WU5B 4XWOC 4X98A 4A6YB 1QNZH 1NCUA 5M7QA 1QSED 3NIDE 1JMZA 1HHIB 1B4JL 1MIEL 5KSAB 2DI7A 1IFHH 1HSBA 4MNHA 1U93B 2CSPA 1OTUD 3G6JE 4JPVL 2EDBA 2WP3T 1WTLA 1EJOL 1MWAH 2FYYA 1TQCB 2QSTA 3IU3B 2VDQH 2EE2A 5DVKA 4DN3L 6CGTA 2DQHH 1IM9A 1MLCA 1QSEE 2XTJD 4ODSL 5GGSY 4X80L 4YXLH 1WSST 5DMKA 5GGSA 1JYNA 1AGCA 3N1MC 2ESVE 2R4RL 2C3WA 3HE6D 4G43A 5KVDH 3KS0H 1DL7H 4HXBL 3H7LA 3MV9A 3ARGA 2C1PA 3QG6B 5FK9A 1G7JB 3V6OE 1Z0MA 2IFFL 3HUJA 2MTPA 3QIWC 4TVPL 4NQTA 4XI5D 4ZUSB 3S35X 4QRPD 4RQQA 1B6DA 4YC2B 2IQ9L 4ZUUA 3O6LH 2HT2C 2KQNA 3HE7B 4LQFL 2AXFA 5D5MF 5EN2B 1GZQA 1FAIL 4FG6C 3SBWC 3CDGA 4RA3A 3O4LA 1CXIA 1ERNA 1HN1A 3L5HA 3UTSE 3HG1B 4XPAH 1IVLA 5HYEA 4MVBC 3DMMD 25C8H 3ILPB 1MJ8H 1MH5B 4P3DA 1MJ7L 4QRPE 3TYFA 3TZVC 4Y4HC 1EEQA 1UH3A 1JYWA 4PRBA 3E3QE 3T2NL 1EGJL 3QYCA 4P2QD 3BHBB 4X7TB 2UVFA 1MELA 1XGRA 4EVNA 1S7SA 2IGFL 3V5HB 3GI8H 2EEDA 4P2YA 1CGSL 4ODHL 5CD5D 3SHSA 3W82A 2EDNA 1IAIH 2CRYA 4L3EA 5KOMC 1NUFA 4KKAD 3TCLB 4D9LL 2IBZX 3EYSL 4C56D 4XGZA 1U8MB 5F7HA 4JANB 1B0RB 4OGXL 1UM6L 5BV7B 1FNEB 1YC7A 3CX2A 2X4NA 4P2QE 4Y1AA 1A6ZB 1J1XH 3CDFA 3T2PA 5HHOA 5EZIL 2JJVA 1AFVH 5D2NE 4B53A 1CFNB 5J11B 2QR0A 1H5BB 3BDYL 5EO0A 3L6FA 1FAKT 1INEH 2XN9E 2YK1L 5DJZB 1WZLA 2X70B 2DAVA 4PJ9A 4LCCC 4XC3H 5JA8B 4GW5A 4EKXA 4NZUH 1IMHC 1BBDL 1C5CH 2HRPH 4WNQA 1MRDH 4XBPB 2YC1B 4DZBB 3ZTJG 1L6XA 4FTVD 4GG8B 2H3NB 1JNNH 4NJ9H 5I19L 3NA9L 2OTPA 1WISA 4JKWA 5K59F 1E0OB 4XP1L 4HK3J 1CE6B 3O45A 4LNRA 4KJYB 3WJLC 2BK8A 5C86A 2O5ZL 5EU6D 2OJEA 2Y7QB 2LFGA 1JTTA 1JV5B 1BIIB 4G7YL 3ZDZF 3GI9H 4NZTL 2OP4L 4H0IA 2GJJA 2BSRA 5TF1H 4F7TB 5HDQL 5HHMD 2A73B 3KR3L 2DIBA 5EU6E 5CEXB 5B4MD 4FOMA 1YYLH 5ITBL 43C9B 2W60A 4X4XA 4MJ5B 4F33A 1ZWIB 3CXDL 4X98B 2YUWA 1OP3K 1WT5C 2F8VA 3V95A 5DEFA 1VCAA 2WAHA 4HJJH 3NZ8A 5L7XH 1HSBB 4DFHA 4MNHB 4N8CL 1B0GA 4N0YH 2MMXA 3P2TA 4AQOA 1KELL 1U9KA 2VOTA 5E7FA 3HI5L 2FYYB 2HN7A 1Q0YH 1YECH 4Q0XL 1CK0L 4PRIA 3B6SA 4I0PC 4P99A 1IM9B 1MLCB 3MLWL 5AG8A 2AV1A 5H37H 5GGSB 1AGCB 2DLFH 4OCWH 1X6NA 4G43B 5JW4R 2D0GA 4F9PA 1EDQA 1FGVL 2PUQT 5DRZA 5EWIH 5I2IA 3VXUA 2A6DA 3ARGB 3MV9B 2C1PB 4PJBA 4QRQA 5FK9B 2GITA 3CSYA 3HUJB 5HHXL 3QQ9D 1FLRL 2P49B 3T3PF 3LS4H 4RQQB 3VWKD 2EKSB 4FMFA 4ZUUB 3MLSH 1GGYA 1PDKA 5HVHC 4ODTL 4DTGL 5ICYA 2AXFB 5D7KE 4JQIH 1GZQB 3CDGB 2D7PA 1HHKA 2H1PL 3O4LB 5SV3A 3VGAC 5DVNA 1WBZA 2NPLX 1SEQL 5JDSA 2VB5A 4WWKA 1P9MC 1DQDL 1FZKA 3GM0A 2APWA 4P3DB 5GS0H 4TNWF 3TYFB 4HSQA 1QFOA 4PRBB 1T03H 1Q0XH 3HAEG 4XPBH 4TNWK 4DCQB 1XGRB 4Y89A 1S7SB 4EVNB 4M6AA 2PCPA 4LGRB 5F7LB 4GG6F 2NZ9D 4L3EB 4KGJA 2CQVA 1ZT1A 1QSEA 4EUPA 2NXZD 5HVFB 4XGZB 3WFDL 3C5ZD 1YQVH 1JUFA 3I84A 4HUUA 4Y1AB 2X4NB 2ADFH 1A7NL 1QFHA 3LHPL 3RA7H 1V05A 2GQHA 3ARQA 2C4XA 2R56H 3V6OA 4DOHB 5HHOB 3VD3A 4XP5L 1CD8A 4NM4H 2DRUA 1A1MA 4HV8A 3SCMA 3HC3L 2DQTL 1CLZH 5GS0C 2QR0B 3HE6A 3N50A 5EO0B 2Z31C 1CD0A 3L6FB 4PJ9B 3AS2A 3AREB 1YJDH 4GW5B 1WEJH 1EBPA 3BQUC 5C0BE 3UC0H 4WNQB 4QRPA 5IGXL 1UENA 2AJXL 1PLGL 5F1NA 4HCRA 1Y18A 1UCTA 1CGTA 3O45B 3RAJH 5J6HA 2G60L 1C5BH 2DQGL 2OJEB 1GPOH 4Y5VC 3TJEL 1LO2L 4LRIC 3DMMA 1FDLL 4OLEA 5KS9E 5GGQL 2I5YH 3TVMD 1F3RB 3IDNA 3WBDA 3RNKA 5IFAH 4TSAH 4POYA 2BSRB 1UH2A 2JLLA 4P2QA 2R4SH 4OCSL 4JZJC 1Q72H 4IEFB 3OG4B 3V7AG 4L4TD 4P3CL 1FJ1A 5CGYD 5KN5A 1YJDC 3OL2A 43CAA 5HDBE 2JB6A 1MCNA 2W60B 4X4XB 4C56A 4GRWB 4F33B 1T1WB 1X5XA 3W5NA 1T7YA 1UM5L 4FZEH 4LVNC 3MACL 5DEFB 4KRPC 1HXMA 3SDYH 4HUWA 3ZKQD 4NHCH 4ALAH 2QBWA 3NZ8B 4YUEL 2A6KA 3MSPA 4HZLA 3LSOA 2HG5A 1B0GB 1WGOA 2DICA 3FRUA 4C83A 2UZYB 4ZNCD 1SVCP 3LKQA 2HN7B 1URLA 5EBMA 1TETL 4HK3N 4PRIB 3GDBA 3B6SB 1RIUH 1R5WA 4JVPA 5KSBA 1D6VL 2AV1B 1CT8B 4YHYC 4R90L 1T7XA 3ARBC 3RGVD 2F74A 4XRCA 3ILQD 4P2CG 2QQNL 5ALCL 1HINL 4JN1L 5DRZB 5B3NA 5I2IB 4X5XA 3VXUB 2A6DB 2ZSVA 2BDNL 1FHGA 4PJBB 1ZVSA 4QRQB 4FTVA 2GITB 4CVXA 3CSYB 1MY7A 1AC0A 1Q9KA 4NO3A 5AWNH 3ZL4H 3ZZ1A 3G5XA 4U4BA 3VGGA 2A1WL 5ICYB 3MRDA 5EU6A 4L4VD 4PJIE 3BO8A 2BHZA 3QHZL 3DX7A 3BP7A 4M8VA 2P24A 5T3XH 4GKOA 5B39G 3H9SE 1HHKB 5HGGS 1WBZB 4NNYA 5JDSB 1MRFL 2AK4D 2M1KA 5LWYH 4A2LA 4WWKB 1FZKB 5EC1A 2F58L 5CS7A 4LSSH 1BFVL 1F2QA 3B2UD 5ERWA 4ZUWA 2GY7B 3I3BA 3LN9A 4AM0A 4C55A 5JDJA 1NJ9A 1CE1H 2QQKL 3VGEA 2PCPB 3INUL 1MCWM 2AI0H 4OZHB 4MA3A 1S9KC 3LD8C 4JQVC 3C6LC 1ZT1B 1QSEB 4EUPB 4L9LA 2G75A 1R5IA 5GS1A 1JUFB 3R8BB 4M8QA 1NCDH 4HUUB 1CXKA 4M7KL 5JW5A 1EHLL 2VN4A 2D9CA 3DO3A 3UTTD 4PJHE 4AH2A 1JGLH 3WO4B 1A1MB 1V7MH 4TSCL 2AK1H 4HV8B 4UDUA 3DHMA 3SCMB 2VH5L 4W4OC 4Y2DD 5DR5H 3HC4L 3VRLE 3HE6B 5JOPD 3HAEA 5TE6H 4K71B 2DF3A 2OZ4A 1A7PL 5E5RB 4LEOA 4EN3C 1BM3L 1A7OL 1J86A 3G6DH 1SYSA 2G2RA 2RBLA 4QRPB 2YHGA 2C3VA 2WINA 3VWKA 1ZGLA 5E1AA 5ID0A 2J3SA 1E4WH 1IC5H 4XNMA 3LN4A 5TDNA 4LKXA 1Y18B 5DA0B 5J13B 3HR6A 2FJFA 2P5WE 5CFHA 1YEHL 5J6HB 5JOFA 5BW7A 5DGQA 2VR4A 2O5XH 3WNMA 4Z77A 1MCBA 2LVEA 5J4MA 4GAJL 3DMMB 1FO0A 4MYWB 1MFBH 4GW4A 5E8DH 2F15A 4OQTL 2FO1A 3DSFH 3IDNB 3RNKB 3U9PL 4P2QB 2HFFA 5EH1A 2ZPKH 3WIHA 4P5KA 5AZEL 1FJ1B 4HBQA 5KN5B 4FQXC 3U9UA 2D3VA 43CAB 1DBBH 2JB6B 1G1CA 1OPGH 4NRZA 1QR4A 4U0QB 5GS3A 4C56B 5DFTA 4DWHA 3C5ZA 1CLOH 1PX4A 5D93B 1KJ2L 1HXMB 4LARH 4HUWB 4P23C 4HIXH 2GW5A 3DRTA 3TGXA 4ACPA 2A6KB 4HZLB 3LSOB 1KEGH 2HG5B 2IF7A 1M05A 3FRUB 4IOSD 4C83B 2P4AB 3LKQB 4I18A 1YEFL 5EBMB 4P9HL 5INCA 5KSBB 1R5WB 3MZTA 1YN7A 3EJJX 4YHKL 4YHOL 3UJTH 1AHWA 4CDHA 1T1ZA 5DHVA 1OTSC 2F74B 4XRCB 5DHXB 1P4IH 4TSBL 1O0VA 3EOAA 4X5XB 2ZSVB 2BSTA 5TQ0H 1ZVSB 1HYSD 4FTVB 4CVXB 4MLIA 4ODUA 5I1IH 2Y6SD 1Q9KB 2BNQE 5GRJH 2IADA 5I71C 3G5XB 5DDHA 2ZWLT 4PLKC 1JFQL 3AY4C 3MRDB 5EU6B 3BO8B 3MJ8A 3DX7B 4OGYL 1RV6X 1JNLL 2P24B 3QJFA 4W6WB 2ICCA 2AGJL 3VW3H 4NNYB 5DHYA 1JZ2A 4I2XA 3TVMA 2APBA 3QFJD 5B21A 2VDRL 4JO4L 5EC1B 4OZIA 3RUGE 1H3PH 1S7RA 4CRPA 5ERWB 4ZUWB 5HHMB 1NBZA 2DLGA 5DZOA 5E99H 3HI1A 2N56A 4AM0B 3QUXC 2ZCKH 1DVFC 4UBDC 5BZWA 1SVZA 1GCFA 3MNVA 5GXBB 2E9IA 4MA3B 1J88A 5IUSA 1SBSL 3CFKA 4BZ1H 3A6OA 1U36A 3F62A 3MOBH 4L9LB 1NGQH 1R5IB 2G75B 1ZEAL 3IU4L 1LP9E 2O93L 1QACA 1N5YH 5A40E 4PLJC 2YWZA 1T7WA 3MJ9A 5JW5B 2R2CA 2CO6B 4LIQE 4L3AA 3ZTNL 4Z0BL 4WUKL 4AH2B 1AI1L 1MCQA 4UDUB 2CRMA 4WI8A 1DBKH 4DN4H 4I5BA 3LKNA 2F19L 3RGVA 4P46D 2NY0D 2W9DH 5CEZL 4H25A 3HAEB 3WFEL 3CFDA 3STLA 5TFSH 1AIFA 3DARA 2CK0H 4LEOB 1T2JA 3CDCA 1IBGL 5CBAA 1CLCA 3SQOL 4F9LA 1XF1A 5EO1A 3BYTA 3FJTA 2G2RB 2C3VB 2WINB 3I9GL 4LPUA 2D2OA 5E03A 3VWKB 1ZGLB 5E1AB 5T1DH 4XWOD 3U36A 4KAQL 5ID0B 4XNMB 4S2SA 5TDNB 4LKXB 5EUOF 2FJFB 5DGRA 5JOFB 1KB9K 2AK4A 3MGOA 1ZLSH 3HZYA 4KGLA 4Z77B 4H88L 3MCLL 1FO0B 4LU5L 1Q1JH 2Q7NA 4GW4B 4PJXB 4Z7WF 4DGIL 5FM5O 5J3HC 1D5IH 3HZKA 1G6RH 2HFFB 1OARL 5I1EL 1MHPH 4KU1A 5E2VL 4JGMA 1KFAH 4P5KB 4YHLL 4JKPL 2FWOA 2R29L 4PJHA 3VXSD 5I9QB 1JHTA 3U9UB 4QXTA 2NXZB 3MRHA 5GGTH 3SN6N 4NRZB 1P7HL 4K23H 2X44D 2HH0H 3C5ZB 5JOEA 4JFHD 3CUPA 2I60L 5I8KH 1F02I 4NBYB 3F58L 4G6MH 3DRTB 3UTTA 1Z9LA 5DJ2A 1AQKL 4X4ME 3VXSE 4PRPE 1M05B 4HS8H 3K8MA 5IJKA 4HLZH 4I18B 2MQCA 5L2JA 4DGVH 4Y2DA 5INCB 4TVPD 2ZUUA 3UDWA 1YN7B 5GJTL 1CDGA 1AHWB 1T1ZB 3TZVD 4QRUA 4Y4HD 5DHVB 2QQLL 4QXUL 4LP4A 3BJLA 3P0YH 3EOAB 4CJ0A 3CC5A 1WBXA 1PYWA 3NPSC 2BSTB 5HI5C 5DZLA 4X5LA 2AQ1A 1PKOA 1MPAH 2X1XR 4M61A 4LOUC 4ODUB 4MS8D 3D9AH 3PHOA 4HWNA 1P4BL 4XP9H 2IADB 2DMBA 5DDHB 1NCBH 5EOCL 1FLTX 1DLFL 4U1IA 4KRNA 3VXOB 3K80A 3MJ8B 4OCYH 2E6QA 3QJFB 3EYFA 2OMBA 4WTXA 2VSCA 1MOEA 1IC4H 1KV3A 1NANI 2UZXB 5DHYB 4I2XB 3GKWH 3TVMB 5HI4D 5J1TC 4OZIB 3QEUA 2Y06H 1S7RB 3CCHA 3T4AA 1DQLL 1NBZB 5ADPH 3HI1B 1EO8L 5FAAA 4BQ6A 4Y88A 1UWXK 4YK4C 4MQSB 3RVTC 3ZE2F 3LY6A 2VIRA 1X6LA 4BK5A 4LCIH 3MNVB 1NBVH 3EDDA 5EU4A 4LLMA 5L8LB 3NOIA 4HJGA 3CFKB 2V7HA 3FQRA 4NKQB 5FO9A 4KK8C 4R4NC 3PWJA 4OD1H 2NX5D 1H3GA 3QT2A 3QPQD 4PJCE 2QLVB 4XPHL 3D87B 2H45A 2SEBA 4JCLA 1CR9H 1SM3H 4KH2A 3LPWA 1RUMH 3V6ZA 4YDKH 3VJ6A 4YLQT 1VHPA 3D39D 2YA1A 2EE6A 5SX5H 3LIZL 3ZYJA 2PF6A 2ZJSH 4KKLC 4XVJH 1E6JL 4WEBL 3FMGH 3LVEA 4ZMAT 4I5BB 3LKNB 3RGVB 2X4OA 4YNYA 1MVFA 2ZG3A 1FIGH 4H25B 2HKFL 2WNGA 3CFDB 4OT1L 1T83A 4KZEH 3STLB 2MPAL 1AIFB 3IJYA 3OB0K 5DJ0A 1ZHBA 1NMAL 3O6ML 5CBAB 4PJDF 3RUGA 1H8OA 5EO1B 5EIQA 5FGRA 2NY2D 2EDYA 2FECL 5D1XC 4R4FL 5L6YH 3U36B 4S2SB 3LQMA 4EOWL 1WICA 3GO1L 1RUPH 2AK4B 3MGOB 3HZYB 4R8WH 1V7NH 3QFJA 5FYLH 1WCQA 5E9DD 1NGYA 1JGVH 3MXVL 1S5IL 4AEFA 1LP9A 3ARZA 3HZKB 3FHAA 4XVSH 2FX7L 3GSVA 4I0PD 4OD3H 3Q6FA 4X6CA 4MSWA 3TFKC 2RQ8A 3JWDH 1DLHA 1KPRB 2FWOB 4PJHB 1YZZA 5I1KH 1JHTB 1GGCL 4H20H 2DLHA 4QXTB 3MRHB 1ZVHA 1OOAA 1U8KA 3AC0A 1WLHA 1WF5A 2E3VA 4U7MA 1MQKL 3HI6H 3FZUC 2NXYC 3CUPB 2ZKHH 1OAZL 1A9BA 2VQUA 5FKPA 1ZLVH 5D8JH 3SO3C 4D3CL 3KPSD 2P46B 1W2KT 3UTTB 3OXSA 2J5LC 1BEYH 5DJ2B 3LZFL 3H3PH 1MF2H 4XMPL 4PRHD 4Z6AT 1MVUB 4L1DA 1F3DH 4U2YA 2FGWH 4XPTL 5F1IA 3OR7A 5L2JB 4Y2DB 1F90L 2BMKA 1OL0A 4QRSA 4QRUB 5HD8C 3JWDC 3TYGL 1OAYL 3RVWC 3H3BC 4PRHE 3RL1A 2ZCHH 3CC5B 1WBXB 1PYWB 3U4BH 4OIIH 2ADGA 1KCVL 1RJCA 4M61B 3IJHA 4PJGE 4JPKL 1IRAY 2CKNA 3PHOB 2BVEA 1KC5L 1TZIA 2VYRE 1E4JA 3T0BA 4YHZL 1N6QL 2CLRA 2WIIA 4LLYA 4U1IB 5I1JH 5D96C 1BF8A 2E8ZA 4YE4H 3O0RH 1NFKA 4UINL 3EYFB 4PY8I 3BZEA 3CFCH 1KCLA 3KWWA 4J3XA 4K3EL 3QEUB 1P5UA 2YPKA 2YRZA 3CCHB 1MCWW 3T4AB 1G0YR 5D7IA 3WFBL 2D7OA 3QBTB 3WD5H 1CVRA 3VXSA 1T2QH 2AXJA 1YY8A 3G5YA 3B43A 3MUGA 3V52L 2VIRB 5DUMH 4KUCF 2X1PA 3QRGH 4NWUL 4LLMB 3W9EA 5C0GA 4HJGB 1J05A 3FQRB 2V7HB 3AB0B 5FO9B 2EC9T 4KC3B 4TPRL 1A7RH 3PWJB 4R97C 3S35H 5L9DH 5E4IA 3H42L 4R2GC 2HFGL 2XZAH 2SEBB 5ACLA 2R0KH 4N90E 4P57A 3SBWA 3SDCC 5FF6A 2KZ1B 3OAUL 3V6ZB 1VFOA 3VJ6B 4KQ3H 4CDGC 3W39A 1FBIL 1MCJA 5GIRB 4LPCA 4EI5D 2E5EA 3UJJL 2CRZA 2P5EE 3MXWL 2D0HA 1AXSA 3TZVA 5I0ZA 4Y4HA 2BVPA 4KK6C 2X4OB 4I0CC 4O2FA 4YNYB 3D2UD 4O51A 2LE9A 2VISA 3OJVC 3KXFD 4KMTH 3IJYB 4XCFL 3MCKA 1ZHBB 2JCCA 5DJ0B 4XXDA 5HYJE 4WHDA 1BOGA 3IDXH 4IRJD 5CJBA 3RUGB 1U41A 3EZJB 5IVXE 1OLLA 1CFVH 5EBGA 4PUBL 3WFCL 4ETQA 1EGJA 3QUMH 5INDA 5F93C 2HJFB 1U3HD 3A0OA 2VZ1A 4PRNA 3O6FC 4TQEL 4OB5L 3KXFE 3QFJB 4F7MA 1NGYB 5E2UL 3C5JA 3RZCC 4PLNC 3T0XA 1FPTL 1LP9B 4PJCA 3GSVB 4GT7A 4O58L 3Q6FB 4X6CB 3GBNH 5GRXG 4MSWB 3S37H 3DHJA 1DLHB 3ZT6A 1RZFL 4LCCA 4M48H 4YQXH 1FN4A 1IAMA 1H3VA 1HZHH 2X4UA 1YEIL 4JO3H 1U8KB 4KQ4H 1YYMH 2NX5A 4M7LH 2X4PA 4CVUA 2RHEA 1A9BB 5FKPB 1MIMH 3CVHH 3BKML 3OXSB 3WJLA 5DT1L 3D39A 3IFOA 4U1HA 4UILH 2I26N 2VLME 2BRRH 1OCWL 1U6AH 5EIIA 5F1IB 3OR7B 4PBWD 4F58H 3ZE0F 2DQIL 5JA9A 3MTRA 1OD7A 2NY0B 4IRSD 4HS3A 3FB6A 2XA8L 1UEYA 3HFML 3HHRB 4GMTH 4BSVA 2HP4A 2OTWA 4WTWA 4JG1H 2XY2A 3RL1B 3WS6C 4DFIA 1C5DA 4B7IA 5LGJA 1N7MH 5CJQL 1ZHKA 2ADGB 3T0DA 3NCCB 2LABA 4ODBD 2J8UF 3IJHB 4NZJA 1WIOA 5LCVL 1CGUA 1Y6KR 3C6LD 2D03L 1TZIB 2D0FA 5HHQA 5CINL 3PIQA 2CLRB 2WIIB 4LLYB 2AJYH 2DYPD 4HF5H 1IQWL 1CBVH 2BXYA 1JPFA 1QBLH 1KJ3H 4U49A 1LMKA 5E9DA 2CRIA 3BZEB 1KCSL 5T3XD 1RURL 3BSZL 4NQCD 3KWWB 1U3ZA 4MWFA 3I3DA 3MO1A 2WZPD 2R1WA 4I0PA 4URTB 1BJMA 2YPKB 5IB4A 5D7IB 3VXSB 1I7TA 2DI8A 4J4PC 1YY8B 3G5YB 1GYAA 3MUGB 1INQA 4X6DF 4X7EC 1IGTA 2AEPH 3GMPA 5T3XE 4U6YA 2VXVH 3W9EB 5C0GB 1J05B 4Z18A 1QYGL 1ZGLM 1HIMH 1FFNA 1KF9B 15C8L 1F58H 1H3XA 4ERSH 2VC2L 3CMOL 2EE9A 4XCNA 3DVIA 4PRHA 4P57B 3VFGL 3L3JA 3ZKNC 5FYKH 5FF6B 2ADJA 3O2DL 4XTRC 3W39B 5F44A 3NMEA 1P9MA 4HIEA 3WKMH 4GOSA 5I8OH 1OT1A 1XMWA 2QHRH 1AXSB 1KJMA 3TZVB 1AGEA 4Y4HB 1HKLH 2BVPB 1JPSH 2GJ6E 4O2FB 3BUYA 3VXME 2JB5H 1TZHA 3P77A 5FIEA 3ZMRA 3S88H 1XF2B 4JM4L 3V4VL 2DD8L 5CMAA 2X89A 4FFVC 4O51B 4WTZG 2J4WL 2VISB 2DMCA 1KOAA 3DOSA 3MCKB 2JCCB 3OAYH 5KVFH 4N9GA 5F7DB 4XXDB 1BOGB 3MLVL 3KHQA 5E2WH 5I1GH 1RZKL 4ETQB 3GBMH 5INDB 1R24A 5EU5A 5JHDD 1RZ8A 5D9SA 4OCXH 5JW4Q 4HPOL 3SDXB 1WIUA 1WITA 4O00A 2H6PA 2EIEA 3MOAH 1FGNL 5C6WH 3KS0J 1A8JH 4F7MB 1MCLA 5BOZG 4U1SA 4LMQI 1NCAL 5DSCA 3C5JB 5IW6A 4Y0GA 2RCSH 4MQXC 5F21B 4AL8H 1RZKC 4PJCB 1A9EA 5F6IB 1XGTA 4AMKH 4JPWH 5GHWH 3E8UL 3MFFA 4IS6A 3S34H 4C4KO 4MAYD 2J8UE 1IILE 4G8FA 4LCCB 1PZUB 1OTSD 2IEPA 4JHAL 4NSKA 4QHUB 1FN4B 2UZIH 2VLKE 3BQUA 2X4UB 1T89A 3GSWA 4NQXA 2P5EA 4NKIL 1C1EH 1NCTA 2NX5B 4P2RE 1P84J 5EFIA 2WWKO 2X4PB 2R69L 3L3HA 5D72L 4WVRA 4NHUA 3D39B 2ZNXA 3IFOB 4U1HB 4DUXA 3NH7L 4Y5VA 5HYJA 4LRIA 3ZT7A 1PBYA 1BVZA 5EIIB 5IVXA 3QWOA 4EEEA 1XAUA 2W9EH 4HS3B 3D2UA 5LGHL 4UQ2A 3FB6B 4JZJA 3S3JA 3KXFA 4BSVB 2DQUL 2OTWB 4L8DA 3QQ3A 4FNLH 4YWGL 1CF8L 4UBDD 3X3GL 2D7NA 1UA6H 4RGNE 1C5DB 4WI5A 4WI4A 4F8TA 2NY2B 1ZHKB 1RIVL 3BP5A 2PTUA 4G8EA 5D7LD 1HCVA 3MGAA 3QCUH 5HHQB 4XHJD 3PIQB 3ZKXC 4RFNC 1ADQL 4PLJD 1JPFB 2NY3C 4JHBA 4ELMA 2QQQA 4NZRL 4XB8A 5E9DB 1A14H 1INDL 2WK2A 4Z9KB 3ES6A 4MWFB 3MO1B 4Y2OA 4GFTB 2R1WB 4I0PB 2XZQL 1IGFH 1G9MH 3O3UN 3QEGH 4X7FC 1AE6L 5IB4B 3OWEA 4ODXA 4ONFH 5HPMA 3ARBA 3VXQA 4HT1L 1I7TB 2AEIT 2APXA 4UT9L 1TJGH 2WP3O 1INQB 1H3UA 1KPUA 3KYKL 5DJ6A 1IGTB 5C0AD 1LQSR 3GMPB 1BFOA 3T0WA 4U6YB 4JVUA 5JW4N 5TE4L 1NMBL 5GRUL 1JI2A 5SWSD 2P45B 3VD9A 1FFNB 1ODAA 2XYCA 3KPNB 1UB5A 4KDWA 4KJQC 4IHOA 5F9OL 1WFNA 2AAVA 5HVHB 3BMWA 2FECI 4XCNB 3EO1A 4PRHB 3PABA 5IB5A 3L3JB 3UCRA 2FZ3A 2ADJB 5FUOH 4UAOC 3NPZB 4Z76A 1PGRB 4HIEB 3C8KA 4IRSA 2Y25A 3TBTA 1MFDH 1A6VL 1KJMB 2Q76A 4PJ7A 1AGEB 3OZ9H 4UT7L 2K7QA 3AROA 2FBJL 3BUYB 5J3HD 1TZHB 2IFGA 3P77B 4Z7VE 4NBXB 1J11A 5CMAB 4JZOA 1DANT 4MQ7A 4PJFF 2FX9H 1C08A 1U3JA 4N9GB 4M1DH 1TENA 2DTML 4JQVA 3AGVA 3C6LA 4FP8L 2Q8AL 4IIQC 3MV7D 2FNBA 3WL9A 4OKVA 2DYPA 3IFPA 3GSNL 1R24B 2B1AH 4HGWA 4R0LC 5EU5B 1RZ8B 5D9SB 1I8LC 5FECA 1TXKA 2DJUA 2H6PB 4GSDH 3W5MA 3HNVL 4LRNL 3ARDC 3U0WH 4Z7UF 1KLUA 2J1KA 2N1KA 4OKDA 2YR3A 1IJ9A 4U1SB 5DSCB 3ARSA 3MV7E 5IW6B 4FS0A 2EKJA 3F8UB 4HUMB 1A9EB 2EDOA 1XGTB 3MFFB 4JY6A 4IS6B 2CIIA 2X9XA 4MQTB 3V5DA 4G8FB 1PKQA 4WTZA 3TPUA 4EN3A 4NSKB 5EC2A 3VI4E 3BQUB 3GSWB 4YPJA 4NQXB 2P5EB 5HI5D 3TC9A 4HWBH 3WLWD 2ZSWB 4AEHH 1A6WL 1J0HA 5EFIB 1C7SA 2DM3A 3L3HB 1H3WM 1NSNL 5MERA 1KTRL 2CGRL 4NHUB 2LTQC 4Y5VB 5HYJB 2F53D 4J7RA 3SOBL 5IVXB 5DC9B 3H6JA 4OUUA 2DQDL 3QWOB 1DUZA 5C08D 4EJ1C 3D2UB 4YHMH 2E7LC 4UQ2B 2BNRD 4R7DA 2V9RA 4LSVH 3KXFB 2BJML 4L8DB 4BQCA 1WWAX 3QQ3B 4K2UL 3SPVA 2Z35A 4FQXA 4XWGH 2F53E 4ZO8A 1KB5H 4GMSH 4OQTA 3BP5B 3ZSSA 1PSKL 4G8EB 1WFTA 2OM5A 3LQZA 4XNUH 2IAND 5JHDA 4LVNB 2V5MA 4R4ND 4KTDH 1B0WA 1W0WA 1EHXA 5GISL 4BA8A 4ELMB 2E7MA 1QOKA 3RIAK 1L4IA 2F54E 4B7LA 4CU8A 3ES6B 4P2RA 1QLEH 1IM3A 5FYKU 3QR2A 4NC1C 3TIDA 3QIBC 4MAYA 4YHYB 4ODXB 1I4FA 4K3JH 5HPMB 5C6PB 1DQJB 3ARBB 3ARXA 4BH8A 2BSSA 3EJZD 1A6UH 3BDBA 1FH5L 1KPUB 4K7PX 5DJ6B 1QKZL 1P5VA 1J8HD 1BFOB 1EZVX 3DXAD 4ZUTA 5JORA 4YZFE 3Q2CA 3P0VL 4Q6IC 3U46A 4EQ3A 3KPOA 1M6OA 5CEYA 5I1CL 2EO1A 3MLZH 1UB5B 5F70A 4IHOB 3AY4A 2F5AH 3EO1B 3BN9C 5DQ9A 3MMEA 3PABB 5IB5B 1MCHA 1IL1A 2B2XH 2FZ3B 8FABA 2VDMH 2CDEA 2B5IB 4A6YH 4Z76B 5HYSG 5FFLA 3BVNA 3C8KB 4IRSB 4HKZA 3TBTB 3TLRA 4JY4A 5I66A 1F13A 2GTZA 1CFQA 2Q76B 4PJ7B 3QUXA 3NBNA 3DI3B 1ONQA 1QLFA 4JZOB 3TH3T 4MQ7B 4HUXA 1GAFL 4PB0H 3ARYA 4Y19E 3U83A 1C08B 5D7LA 5JW4M 3THML 3C6LB 2VDKH 5LJYH 5A3IC 2AEWA 3FQNA 3WL9B 1CN4A 4OKVB 2DYPB 4IOFC 3IFPB 3FZUD 3BD4A 4HGWB 4MMZC 4R6UA 3HCVA 3O9WD 2HJKA 4WHYG 5FECB 5IF0A 4MA8L 4NQCB 1NC2D 2DDQH 4XC1H 1KLUB 3C08L 1YEEH 3L5XL 5IKCA 1BVKA 2DBLL 5FO8A 1KIQB 3ULVF 4XHQA 4JY6B 3F7RA 4KVCH 5C0AA 4U1KB 2CIIB 4UNVA 2AJSL 3V5DB 4J12A 1PKQB 5CD3A 2YPLE 5DK0A 2HMIC 3TPUB 5HD8D 4EN3B 5EC2B 5SWSA 4FABL 2EYRA 1KNOA 5HHVH 2HLFC 5I74C 1UM4H 2NW2A 4KY1L 5FYLE 4KTYA 2PYFA 4WY7L 5ICXA 4LLWA 1NGPL 3RDTC 2JJUA 3B83A 2KDGA 2Y07L 5C1MB 5MERB 3IT8D 4KK9C 5IP4A 1WZKA 12E8L 1QFWH 1FRGL 1I8MA 1C8PA 3QCTL 3RVUC 3NFSL 4CW1B 1JWMA 3QXDA 4OGZA 2UUDK 3ORJA 4OUUB 1DUZB 5BV7H 4YXHH 4PGDA 1U8QA 2AJUL 1Q94A 1XCTA 4R7DB 1J8KA 3EHBC 4XPFL 1ZTXH 1HOCA 4NP4L 3SPVB 2IPUK 2VXSL 2Z35B 4FQXB 1QP1A 1OVZA 3MV7A 3O6KL 3JWOL 4Z95H 1EBAA 1TVBA 5JIIA 4LCYA 3LQZB 3B9AA 5JHDB 1UB6A 2XFXA 4MAUL 1P7QD 1W0WB 3T8XA 4ZFGH 3WLBA 2HWZL 3CLFH 4JDTH 4TTDC 4P2RB 1KGCE 3WDHA 1A0QL 1IGYA 2X42A 1IM3B 2ZUTA 5C3LD 3IXAA 4P59H 5DRNA 3TIDB 3CLEH 1Q9WA 4MAYB 1I4FB 4ZD3H 4MJIE 4BH8B 2IPTH 3E0GA 3KDMA 2BSSB 4NWTH 3MA9H 4KI5E 1JHKL 1PW3A 4ZUTB 5JORB 2EICA 5GGTA 1IEAA 1FQ9C 2YD9A 3U46B 3KPOB 1SEBA 1M6OB 4ONHA 2VLJD 5CEYB 1K6QL 4QOKE 1LDSA 5IVNA 5LQBL 4GAGH 3A67L 3T0VA 3B3IA 1VESA 1B3JA 5DQ9B 1RAMA 3MMEB 1J1PH 4JG0H 2F53A 1IL1B 1A3RH 3AS0A 8FABB 1NAKL 5C71A 2CDEB 3EUUA 3BVNB 4QCIA 4HKZB 2VLJE 5EZLA 4JY4B 1EERB 5I66B 2BNRA 2ZCLL 1J0JA 2GTZB 3V6BR 1CFQB 1QSVA 1MFAH 4UNUA 1JGDA 1ONQB 1QLFB 3IAQA 2F54A 4HUXB 3LB6C 2Q6WB 2W0LA 5D7LB 5IVZA 2IANA 5CLWA 3FHQA 1EUUA 3FQNB 1FFPA 2FSEA 1X5ZA 2Y36L 1LHZA 4F80A 3BE1L 1DE4A 2WUCH 4KUZL 5C0ND 1GGIH 3HCVB 2HJKB 3QFDA 4TVSa 5BO1H 5IF0B 4JM2C 2FB4L 5JPMA 3FO0L 1UKQA 5CZVL 2BVOA 4TUKH 4QRRD 3FQWA 2BY2A 3WUWG 2EZ0C 4ZAKD 1M7XA 5CKGA 3QUZD 3X3FL 1A6AA 1LK3H 1ND0A 1YNLH 2Q8BL 5MI0C 5IKCB 5A2LH 1BVKB 2HVJA 5FO8B 5CIPA 4FXKA 3CMGA 5C0AB 1KTDA 1UYWH 1J8HA 3DXAA 5CZXC 1PQZA 5SWZE 1AGBA 5DK0B 5CD3B 5EZOH 1KCRL 3SE8L 4RBPH 4G3YL 4MZ3A 5SWSB 2EYRB 1KNOB 4W6XB 2NW2B 3NCJH 1DQML 1QRKA 2DJSA 1FORL 3EFFA 2PYFB 5ICXB 5D1XA 5IFHL 3F6LA 1WZMA 4LLWB 5C07D 5I73C 3RU8L 2HJLA 1TNMA 4CL7A 1Y6MR 1K4CA 1M7DA 1NLDH 4APQC 4ZS6D 4LAQL 1F8TL 2ATPA 3RGHA 1I8MB 5FA4A 2FD6L 1JWMB 3QXDB 3FOLA 3BGAA 1AD9A 4NGHL 1U8QB 4PGDB 4PP1D 5DWUL 3BEWA 1MRCH 1Q94B 3NTCL 1EXUA 3OKOA 3BKJL 4HZAA 1HOCB 3QWQB 1FNGA 3KYOA 5KVGL 4OTXL 3U6RA 2MSPA 2ICWA 3KYNA 3MV7B 4YGVB 4O4YL 1TVBB 4LCYB 4KMQA 3SGDI 5IHZA 2BCKA 1U8OA 3MODH 4UB0H 3K0WA 1UB6B 2P8MA 2XFXB 3O9WA 4WUUE 1RK1A 1KIPA 1NPUA 3QEQD 4OZ4A 4M62H 3DLQR 4MA7L 3V4UH 1NC2A 1G0XA 3T8XB 3G9VA 3WLBB 5DRXA 3ZKND 4E5XA 4JPIA 4XTRD 5KVEL 5IT2H 5A2KH 1IGYB 2EDWA 3IXAB 2DWDA 5DRNB 3KPTA 1Q9WB 3QEQE 5E70A 5LBSH 3KDMB 1CD9B 1H0DA 3CFIC 3NFNA 3NIGE 1DEEA 5E4EC 3NPSB 4FFVD 3RBSA 1ZANH 5DMIL 3ZDYF 1MAJA 4MDIB 1IEAB 4XNYL 4NN5C 2JELH 1SEBB 1WQVT 4ONHB 1D6EA 3QNZA 4LSTH 4DKAA 2XKUA 4XBGB 3B3IB 4KXZH 3AREC 3DUUA 1K2DA 3QP3A 1XF5A 2F53B 4WFGE 3LEVL 2C26A 3V0WH 4QCIB 5C08B 1I3GL 1LVEA 5EZLB 3VRJA 4ODWA 1JL8A 4AEIL 2BNRB 5KTEH 5DD0H 4MQXD 3OB8A 1RULH 3OKNA 4YK4B 4X6FA 4NM8H 4NN6B 1JGDB 3QDJE 3VG0H 2F54B 4OM1H 2KH2B 5FUZH 1KIUA 3N9GL 5FYKE 5IVZB 1BLNA 1ZE3C 2IANB 2I24N 5BS0E 2YA2A 4Q58C 1FFPB 1P7QA 2FSEB 1VFAA 3ESUF 2VWEE 5M95B 1ZGLP 1UZ6E 3STBA 1DE4B 1QFPA 5KJRH 3LS5L 4M7JH 3QFDB 1K8DA 1LO4L 1XGYL 1CDJA 5JPMB 5C0CE 2RIKA 2BVOB 4Q9RL 3FQWB 3LKOA 3I2CH 5E08L 3Q1SH 4H26A 4NQDE 3W0WD 4JEGB 1XF3A 1A6AB 3BRGC 1ND0B 4ZDHA 4JY5H 3GHEL 5CIPB 1U95A 1HWGB 1KTLA 4JO2H 5GZNC 4FXKB 2GI7A 2E6PA 3BZFA 4JR9L 1KTDB 1J8HB 3DXAB 3RY4A 1PQZB 1AGBB 4N5UA 1IC7L 3BW9A 4F2MA 4XBEL 2P8LA 2B0SL 4OLVL 4O9HL 1FZOA 5FB8A 2OCFD 2VLJA 1MCPH 4LCWD 1EHAA 3SEPA 3EFFB 5D1XB 3A6CH 4ZNEE 3DETD 1EX0A 1GGBH 2HJLB 4F9PC 1K4CB 4M6MH 1GC1L 2R0LH 3O6FA 1RU9H 2VDNL 4KHXL 2ATPB 2NY3D 4OJFH 4FRWA 5FA4B 5GGRY 1BX2A 5GGRA 1HNGA 3FOLB 3UMTA 3M17A 2XOTA 1AD9B 5DQDL 3BEWB 4X7SL 3MBXL 5CGMA 2B1HH 3MLUH 1GC1C 3OHXA 4FZ8H 1EXUB 3OKOB 4KDVA 4PJ8C 1AXTL 5EORL 3BI9X 1FNGB 3KYOB 4YHNA 1H8SA 2DQCH 3U6RB 2APFA 2ICWB 2KBGA 4CADB 3KYNB 1FYHB 3ZT5A 5IHZB 1Z9SA 2BCKB 1U8OB 2NXYB 5L2KE 2P8MB 3O9WB 1RK1B 1KIPB 3QUMA 3SO3B 4OZ4B 1ROWA 4F3FA 5J9PA 5I15H 4KJQD 1NC2B 2J5LB 5C2BL 5DRXB 5I30H 1QSFD 4GRLC 4ZAKA 5DXWA 4E5XB 3IDYC 4JPIB 4I3SH 1RUAH 4AIZA 3GJFK 2DWDB 2ICWJ 3EFDH 4WO4C 4RZCA 1F4YH 1HHHA 2OXGA 3ALXA 4YDIH 4ZTOL 3FO1A 3EGSA 1H0DB 4P9ML 3BKYH 3NFNB 3WO4C 4ZXBC 2XTJC 1JNJA 3T3MF 5FDYA 4KRLB 1JF6A 1NKOA 1WZ1L 4NO2B 1D6EB 1VGKA 4WWID 4N8PA 3QNZB 1KEML 3LEYH 4FQ1H 3ULVL 2YMXL 5D96B 1M4KA 1W0VA 4D9QD 3DUUB 1K2DB 3RY5A 3K81A 1XF5B 4XMKH 5C0DA 1FC1A 1R3JA 2WANA 5FM4A 5IHLB 3ZTJH 5J56B 2Q86A 4EXKA 1MCFA 3VRJB 4ODWB 3P9WB 1P6AB 2FIRT 4OZGF 1B2WH 2YSSA 1B4RA 3OKNB 4X6FB 1OAQL 2JTDA 4HH8A 2VZOA 4OFDA 3UYRL 5I0DA 3QG7H 3CSGA 4YXKH 2AJ3A 1BLNB 4U6XA 1KSRA 3O11A 2VMFA 3GMRA 3QEQA 1P7QB 1F3DJ 4R97B 1VFAB 2OJZH 3WYRA 5CUSL 1I3UA 2CKBL 2MQ0A 2ATKA 5DEZA 5CD5C 2IC2A 3CK0L 3C8DA 5ESQA 4LSUH 5F7YC 2ZUVA 3GNMH 1K8DB 4IJ3B 4KKAC 5ACMA 4Q2ZA 2FBOJ 1FFRA 2VL5A 1RUQL 3J8F7 4Z7WA 4RMRA 4UI2A 3LKOB 4H26B 5HYFA 5I18H 4WCYH 1XF3B 2VUYA 3Q0HA 1UACH 4DGYH 1BZQK 1U95B 2PR4H 1KTLB 1LDPH 5I1HH 2YS4A 1ZLUK 3O2DA 1PY9A 5J12B 1AH1A 1X5JA 3BW9B 4F2MB 2P8LB 3FFCD 1BFSA 4KUCD 1FZOB 5FB8B 4C58B 2VLJB 2DKSA 2MCG1 5HY9B 4YDJA 1Z3GL 4JGJA 6FABH 4CN4A 2VXUH 3OBAA 1U3YA 3LH2H 3QDJA 4OBSA 4JHWH 3IFNL 2G5BA 3EJYD 2CXGA 3CZJA 3OKLA 1IEHA 3O6FB 5MP6L 3WXWH 4U0RC 4RISL 2E27L 2XKNA 2ZUQC 4ZPVA 1VDGA 1BX2B 5GGRB 1RSFA 4KZDH 3CH1A 1NBYA 4HFUH 5GJSH 3M17B 2OI9B 3VI3F 5CLTA 4M43L 4U7SA 1BQLL 4ZO7A 3MLXL 3QIBD 3OHXB 3PWPE 2NCMA 1X5YA 5C0CA 1YN6A 3KPRE 4YHNB 4H0HB 3BP6A 4R4BA 4M5YL 2GJZA 1EEZA 2YN5A 1ACYH 2Z8SA 4NJAL 4NC1E 3KPQA 3HAEH 5CHNA 5JPNA 5B4MC 5E94A 1YMMD 3QUMB 3U2SA 2OZ4H 4F3FB 5J9PB 4OBRA 3N85H 4QRRB 5K9JH 2IAMC 5J1SC 4NQEE 5D7SL 3BN9D 4M6OH 4ZAKB 4JFED 1VGEH 3W0WA 3BYYA 5C0RH 5DD5H 1L7TH 4O02L 4L9LC 4AIZB 4OIAA 3MRPA 3GKZA 3QHFH 4N8VG 4RZCB 2QSCH 1HHHB 3VMOA 3OSKA 5H2BA 5MHSE 4FFZL 5D71L 2EEBA 5EU7C 3FO1B 3GJEA 1LEIB 3ECBA 3EGSB 4M1GL 2Y5TA 1I9JL 1S3KH 4OCMC 4LCWA 5IQ9A 1CLYH 3KJ4B 2BHYA 2EH8H 1OAKH 3NABH 4BKLA 1YPZF 1KN4L 2VZTA 1VGKB 4D8PA 2XZCL 4S1RL 5A3ID 3WIHH 5DQJA 1WAAF 4K3DL 4IOFD 1W0VB 2AABH 4GO6B 3WIIH 3GSOA 5C0DB 3HRPA 1R3JB 1O7VA 4JHZA 3QQ9C 2A38A 2EDHA 2FL5A 1UCBL 3VWKC 2Q86B 4HJ0C 2PO6D 3NAAL 2YSSB 1ADQA 5BW7C 4K94H 3VMPA 1A7BA 3JV6A 1S7WA 2AJ3B 3RX8A 4U6XB 3O11B 1NUGA 2HLFD 3GMRB 2BVQA 3QEQB 3V0VA 4YFDB 4G9FE 5F7EH 4HKJA 4IDLA 5DHVH 4RX4A 3V8CA 5C09D 4LSPL 4DK3A 4P48A 3PV6A 2NZ9C 3R0MA 1QSFA 5ESQB 4MMXC 4Q2ZB 1Q38A 1UJ3A 4KK9D 2VL5B 4HXAL 3C5ZC 4UQ3A 1LEGA 4Z7WB 2B4CL 3M1BA 5ILTH 4DUWA 4KVNH 4FFYH 4G6KH 4UV4L 2KUTA 1C16A 2DM4A 4K94C 1KB9J 1NUDA 5JIPA 3T4YA 5JQ6H 1KN2L 1U91A 3EHBD 5K9KA 4F15B 1F97A 4I18C 2CDFA 4JAMA 4XAKD 5TE7L 4YDJB 4CNIA 1CGYA 4IIQA 5AZ2H 1SYVA 4U1LA 1YEKH 1W72L 2HT3C 3I6LE 4E41E 4DEPB 3MLYH 5FHAH 1IGCH 3IDUA 4R0LA 4ZOAA 1JK8A 3QDJB 2G5BB 1BZ9A 4LSRL 2VJXA 1U8HA 3OKLB 1R3IH 5L0QC 2ZUXA 2H41A 3ARDA 3ZE1F 4LL9A 4ORZC 2V17H 2XKNB 3HG1E 3ZDXE 4ZPVB 1CYGA 3U1SL 4X8XA 3QDAA 4TTDD 5EA0L 1MFEL 3CH1B 1NBYB 3NIFE 2DL2A 4WW1A 3GSNA 2AXHA 3MJ9H 4QNPF 3QRFM 3FQTA 1JGEA 1N4XL 5T5FH 2X4TA 5C6TL 2QTEA 5C0CB 1YN6B 1CXEA 3TVMC 5KW9L 3BP6B 4WFFD 4HKBA 4R4BB 2UY6A 5E2TH 1PJ9A 5ANME 1J87A 1DFBL 4M6NH 1J1OH 5FOBA 2GJZB 1EEZB 5F7NC 3ZHDA 1YQ2A 3KPQB 5CGYC 5CHNB 5JPNB 3DROA 4EBQH 5E94B 3T09A 3U2SB 1BJ8A 3PNWA 4NN7C 4HQQH 4Y8AA 5F9JB 3HUJF 2FATH 3OXRA 1N6UA 4WFFE 1G9NL 3WIFB 1D7FA 3W0WB 1UWEL 1BZ7A 3C09C 1GIGL 1CZ8H 1OAXH 4U2ZA 1F4WH 3MRPB 4LCUA 5C0EA 3OKEA 1A3LH 2E7LA 3ULUL 3S98A 1NFDF 5H2BB 1JHLL 3EO9L 1MCKA 4QF1A 1NH6A 3GJEB 3ECBB 4K8RL 3FFCA 4YFEA 1L7IH 2Y5TB 3U48A 3MFGB 1G9NC 4GKSA 4LCWB 5IQ9B 3Q48A 3GSXA 3WSQH 4CJ1A 4BKLB 2X2YA 1DBAL 3RGVC 4F7PA 2YN3A 3ILQC 3VFSA 3ULUC 2HA1A 1CDIA 4NQVA 4D8PB 3ZKXB 3PWPA 4OLUH 3BUTA 5SX4H 5DQJB 4Z5RA 4K8RC 4M5ZH 4X7CC 1T0MA 1UJTA 3KPRA 3MV11 2NY3B 1KBGL 5ADOL 3GSOB 1EMTH 3MPCA 5L88H 4HMDA 5IQ7H 2FL5B 3K8LA 4JJHA 4KTEL 1GHFL 1RVFL 3L5IA 3QIBA 2EZ0D 2Y23A 4DUVA 3MCG1 3LQAH 4JRWA 3UBXG 3DGCR 5ABDE 2BY0A 1TJHL 3NACH 1DBML 1IE5A 4MDJA 3JV6B 1S7WB 1WWCA 4IMLA 5CZXD 1KB5A 3IB4A 2I27N 4KRMB 4Q6IA 1U8PA 2A9NH 1MFCH 1TMCB 1U2HA 4NUGH 4DKEL 1YMMA 2BVQB 5JUEL 3V0VB 4HKJB 3IAPA 1CXHA 2WM0A 3PV6B 1QSFB 4NCC2 2ARJQ 3QDGD 5E5UB 4S0TD 4JB9L 3MV8D 4JFEA 5IFJA 1RZGA 3BT2L 1UJ3B 4J8RA 1A5FH 4UAOB 3QQ4A 4APQD 2XQBH 1R3LA 4HUNB 4UQ3B 1LEGB 5C7XL 1OAUL 3M1BB 2VZVA 3K74B 3EBAA 3LQAC 5CJOH 1C16B 1RZ7H 1K3IA 1O7SA 4LHUD 5JXAL 1HK6A 1CU4L 3PP4H 5TQ2L 1U91B 4M7ZC 1SJEA 5K9KB 1YEJL 1FIEA 2CDFB 4JAMB 2AEQH 4QXGL 4TRPL 1A4JA 1DSFH 3HUJE 4G6JL 4WHTA 4CNIB 3B5TA 3IKKA 4IIQB 3QZWG 2C3HA 1SYVB 2VZ3A 2X9WA 4U1LB 4YPGA 4JRYD 5DURD 1Q9OA 3U0TA 2XV6B 1JP5A 4TUJA 3S3PA 4R0LB 1JK8B 3UZQA 4GRWF 3TV3L 1BZ9B 2CK2A 5DD3H 1U8HB 1P1ZA 3O4LE 4I9WD 5DD1H 3K2MC 1FSKC 3M8OH 3UJIL 1DN0A 4MXWH 4WHCA 3TO4D 4H8WH 1U42A 2PO6A 4RWYH 3WMSA 4G9FA 3OJDB 4JRYE 4WW1B 1LILA 2NR6C 3D5OF 3GSNB 4LHUG 3K7UA 3HN3A 2CUIA 3MNZA 3FQTB 3BIKB 4G6AC 2J6EL 1JGEB 3KPLA 2X4TB 2BERA 5TH2B 3HPJA 4P5MA 4CMHB 4LVHC 4HWEH 4HKBB 4R26H 4XP4H 5TF0A 5FOBB 1AY1L 3P11H 3RDTA 2DLTA 5C09A 4GS7C 1BJ1J 4RWHA 3DROB 4PJBF 5ENWA 3DX6A 5I75C 2BFVL 4WI6A 4Y1AE 1SY6L 3LEXA 2PETA 3OXRB 3VDBA 4UV7H 3QUYC 1BZ7B 3AB0C 4W81A 1G7HA 2AJVH 4E41A 1I9RH 4UOJA 1KENL 4LCUB 1MNUL 5ALBL 4S1SH 4U3CA 3OKEB 2CMRL 2VXQL 3R1GL 4QF1B 4Q9QH 3FFCB 4BZYA 3NIDF 1FNSL 4GKSB 4U7KA 5IR1A 3L95A 2J88H 2NNAA 3G6JF 1MH5A 4DAGH 4F7PB 2FX8L 2X6MA 3VFSB 4NQVB 3OTTA 2UWEE 3PWPB 2D4FA 2YKLL 5DRWA 1X5LA 2A77L 1HE7A 4Z5RB 1T83C 5GRVK 4R3SA 1JI1A 4W68A 1T0MB 3KPRB 4DQOH 5ANMA 5F96L 4NFDA 2OTUA 3CX5K 3C8HA 3QIBB 2R8SH 4D94A 4I1NB 5JIKA 1LE5A 1MJJA 4C4KT 1EV2E 3HNSL 4N1CA 3BZDA 2VDLL 4MDJB 4IMLB 4PFEA 3S4SG 3HMWL 1KB5B 2DKMA 1CFNA 4XPGH 4Q6IB 1U8PB 2OK0H 2WWKT 3EZ8A 1J5OH 1YMMB 5FHBH 1HEZA 1ZA3A 2FEEL 4YR6A 3ZHKA 1KYOJ 5E8OA 5E56A 4JFEB 3SQBA 4ENED 3MQIA 1RZGB 5IFJB 4J8RB 2DIJA 3U7YL 3I50L 1P6FA 1R3LB 1VSCA 3EIFA 4WFED 4GKZB 1J0IA 1B9ZA 4PRIE 3UTQA 3U0PA 4CAGA 2R0WL 2YPVL 3H9ZA 3RVVC 5BMFH 2DOCA 1SJEB 4PJ8D 2DQJL 1YNKL 5GGVL 3VXUE 4HX1A 3P4LA 3BGFB 3D69B 1A4JB 4P46C 4OI7A 2NY0C 1XGQA 4WHTB 1B4JH 1MIEH 1IGML 4D0CA 4YPGB 2ZP0T 3U0TB 2DQEL 4S1QL 2WQRA 2HT4D 4I8DA 4OFKA 4TUJB 4JPVH 1W8NA 3PQYD 3HZVA 1CICC 1P1ZB 3EYUL 1EJOH 3ME0A 4JM2A 1BIHA 1DN0B 4DN3H 5FO7A 2A6JA 4ODSH 4GRLD 4X80H 4LEXL 5B3JE 2PO6B 2XKSA 4G9FB 5CWSA 1U92A 2R4RH 4J3OC 3FFDA 3IKCA 4IDJL 3L3DA 5AAWA 4ZUVA 4HXBH 3MNZB 4WO4D 3PWUA 5IROA 3KPLB 2IFFH 1I8IA 3B9EA 1ULVA 3HPJB 4P5MB 3WJJC 5CCKL 4OZHE 4Y5XC 2KZWA 4TVPH 1R0AL 5I74B 4NO5A 3K1DA 4ZXBD 3QZWA 2IQ9H 4Z7OF 3RDTB 1AJ7L 4LQFH 5E8EA 5C09B 4L8SA 3TT1L 1FAIH 4X83A 3VWJD 5ENWB 3DX6B 4U3HA 5HVGB 3LEXB 1VEMA 4WW2C 3VXTA 1HQRA 2DL9A 4APQA 4DZ8A 1IT9L 3G08A 4HWZA 4H1LG 1MJ7H 2XTJE 2VLLA 1G7HB 4E41B 4U1GC 3T2NH 1EGJH 2EKSA 5FV1L 5BVPL 4PR5A 4NQSA 2IGFH 2C1OA 3ULVD 2YA0A 1MAML 1CGSH 4ODHH 2Q20A 4QTIL 2QHLA 4Q74A 3GRWL 3UO1L 4JGUA 4D9LH 3EYSH 5IR1B 3L95B 5IBTL 2NNAB 4JRYA 4OGXH 1UM6H 1K8IA 2A83A 1F4AA 1EO7A 1LO3L 4QWWD 4DCQA 5DRWB 1DR9A 4ZTPL 4R3SB 1G7MA 5EZIH 4MS8C 1L0XA 3BDXA 4Q7DA 5ANMB 4XCEA 2R0ZL 2OTUB 2ZOLA 3L3OA 1D5BA 3QDMD 3BDYH 4ZS7L 2YK1H 1LE5B 1MJJB 1IAIM 2E7HA 2H8PA 1BBDH 5DLML 4BELD 1J7VR 4PJFA 5HI4C 3O3AA 1OSPL 1GL4B 4E42A 5IB3A 4C56E 2HTLC 5I19H 3QDME 3NA9H 5DJYA 5F6IC 5F7MC 4XP1H 3TNMA 1HEZB 4U6VL 1ZA3B 1F4XL 1I7RA 3S37X 2O5ZH 4YR6B 4OAWA 3ALWA 5T33L 5E8OB 2D7TL 3AREA 2BZDA 2ZG2A 3DJ9A 4G7YH 4NZTH 2OP4H 4HBCL 5HGDA 1UXWA 4HEPG 3L3GA 1OY3B 1A6PA 3QPQC 5HDQH 2EXYD 2H2PD 2JK5A 3U0PB 3UTQB 4EDWL 5KSBE 2UWEA 1JCKA 3U4AA 3KR3H 4PTUA 2IPUG 2W59A 2H2SC 5IVOA 4G80A 2GK0A 3LDBB 4WU7B 5ITBH 3IFLL 3TJHD 4Z7OE 4XXCC 4FQLL 1ZS8A 3CXDH 4HX1B 3I02A 5C92A 3S4SA 4FTVE 3QISA 4CU6A 1XGQB 3TPKA 3D25A 4D0CB 2GFBB 3NCFB 4IRZL 3KG5A 4BK4A 3K1KC 4N8CH 4ELKA 5EOTA 3Q6GL 4LLVA 3HZVB 1KELH 5JW3L 2FR4A 3HI5H 4JM2B 2BX5A 2NY2C 3FT2A 1BGXL 4Q0XH 1CK0H 2K9UA 5FO7B 1T1WA 2A6JB 2IAMD 3MLWH 3MYJA 2R2HA 5JQHC 5CWSB 1U92B 1QZ1A 3FFDB 3IKCB 2OR9L 5MI0B 1BREA 3VFVA 3L3DB 2CIKA 5HHME 2FHCA 3ESVF 3UZEA 5I76B 2WMPA 1FGVH 4ZUVB 1DQQA 1GOFA 4L9DA 5DVMA 1V3MA 3PWUB 1I8IB 5DMJB 3LRHA 1P4LA 5HHXH 4HD9A 4OZFH 5EN2A 4KKBD 3O4OC 1FLRH 2OL3L 4NO5B 3QNYA 4XT1C 1CT8A 3QZWB 2KKQA 4ODTH 4DTGH 5E8EB 4L8SB 1GSMA 5I73B 3O2VL 3HNTL 4LLQA 5KS9F 3RRQA 2H1PH 1JGUL 3BKCL 5GGUA 1SEQH 2J8HA 1SJHA 3VXTB 5EU7E 1HQRB 4APQB 4DZ8B 1DQDH 3VGBA 5FM5M 3G08B 2GSGA 4HWZB 4QEGA 3FOMA 2VLLB 2BC4A 4XNXL 5FV2A 1RJLA 4XNQA 5HDBF 3QI9D 1DBJL 5EOQL 2X9YA 2CLVA 3CJJA 1KXVC 4PR5B 4NQSB 4HPYL 4R7NA 1FL3A 4HJ0D 2C1OB 4OIBA 4PD4J 4PJ8A 1I9IL 3SDAC 3JVGC 1MEXL 1RIHL 4RRPG 4YJZL 5SX4I 4G8GD 2W38A 3FAWA 4M7LT 3WFDH 4JRYB 5DURB 5E6ID 1K8IB 2A83B 4PYHA 3TT3L 4EQ2A 1NANH 3PP3K 5FCUL 5HVWA 4FQ2L 1A7NH 2A0LD 3OKYA 3LHPH 4L8BA 3PQYA 5T3ZL 4UT6L 3O8XD 1G7MB 2EDKA 4XP5H 1VA9A 4CN6A 4OZHA 1M7IA 3T04D 4GRLA 3S36L 1TJIL 4XCEB 4I77L 3AM8C 5IMOA 3HC3H 2DQTH 1VADA 4PJXE 2ZOLB 3L3OB 1D5BB 2Z9TA 3HLAA 5GPRA 1OP5H 1IGIL 4WO4A 3SE9L 3CXHJ 5IB2A 2E8YA 2H8PB 2GKIA 1Q9LA 5MEND 5C0IA 4PJFB 5E4EB 3O3AB 1RHFA 4X5WA 3WHXA 5IGXH 4ZXBA 1S9VA 4PJIF 4E42B 2AJXH 5IB3B 1E27A 1PLGH 3SKNA 4NN5B 5DJYB 1GH7A 3VWJA 3TNMB 1I7RB 2A6IA 2G60H 2BRQA 4JRXD 5FYJL 2HT3D 2DQGH 5BJTA 2KPNA 4OAWB 5DJAA 1QBBA 3TJEH 1LO2H 3VDCA 1FDLH 4J3TA 1T89C 1A6TA 5TPWL 5GGQH 3VGHA 4LHQB 5HGDB 1UXWB 3I85A 3L3GB 5IEKA 3GMLA 4OCSH 2MQ3A 2JK5B 2UWEB 4PTUB 3SJVD 4P3CH 4JKMA 4G80B 2GK0B 3B4NA 5JIHA 4HHAA 3V7AE 4EI5C 1Z0NA 4PIRF 1ZS8B 1WIPA 4K7FA 3I02B 3PGFL 3S4SB 1UM5H 3HR5A 2XRAL 3MRRA 5EUKB 3MACH 3KLHD 5KAQF 3MRCA 1N64L 4NC0B 3PXJA 4PJHF 3D25B 3OAZK 4YUEH 1QFUL 3RQ3A 3LV3A 3DYPA 4ELKB 5EOTB 3WXVL 4QKXB 4LF3A 3CU1A 4LLVB 5F8QC 2FR4B 1D9KD 2BHUA 4IRJC 3VRLF 4MNQD 1N0LA 3FT2B 3C2AL 1TETH 3CAFA 1HDMA 4U05A 4I2XE 3QDMA 4QXWA 2VO5A 1D6VH 4O5LL 1ZLWK 4RFOL 3MYJB 4OZIE 4R90H 3NZHL 2R2HB 4EI6A 1U3HC 4LKCA 1JPST 3RKPA 5GRVL 5GZOC 3VFVB 2CIKB 1KXTB 2QQNH 5ALCH 1HINH 4JN1H 4L4TE 1DQQB 1P53A 4NKMA 3S5LG 2BDNH 2IBZY 4MNQE 3F7PC 3KLAA 4OSUL 1NL0L 5H94A 1P4LB 3QNYB 2RFXA 2A1WH 4GJTB 1DZBA 1EEYA 3QHZH 1OGAD 1FC2D 2CH8A 4LLQB 3ULUD 2MHAA 1MJUL 5GGUB 1MRFH 1SJHB 3N1PC 4FHBD 4K8RD 1EFXD 1L0YA 1QRND 4ONGL 3B2VL 4WRLA 4YAQA 2F58H 2GSGB 1BFVH 1A64A 4KDTC 2VKXA 4RAUA 3FOMB 2BC4B 1RJLB 2F5BL 3AMKA 4XNQB 4Q97A 2CLVB 2QQKH 3LKPA 3LOWA 4R7NB 3ULUE 1FL3B 2E9BA 2UV3A 3GK8L 4PJ8B 3INUH 4WI3A 4Y16D 1QRNE 2B5IC 3KAAA 4ZFFA 1NUNB 4RMUA 5F3HA 4IRSC 4HCRL 3K4AA 5CJXC 4PGBA 3RWEA 2NY4D 3BAEL 4BZ2L 1G7IA 4M7KH 4L4VE 1EHLH 4L8BB 3K8KA 3PQYB 2V6HA 1NAML 1XF4A 2AK4E 4WDIA 2FEEI 4Y4KC 2IAMA 1UGNA 4ODVL 1M7IB 4GRLB 4BFEA 2JJTC 1JRHL 4TSCH 3AXLA 5IMOB 4WI2A 4QTHA 3IDYB 4H1LB 2VH5H 1VADB 3ET9F 4LSDA 3NCBB 2C3XA 1PFCA 3HC4H 2EH7L 3HLAB 1F6LL 4TOYL 2V2TA 1E4XL 2EDEA 3QO1A 4PREA 3RI5F 1GOHA 2YRPA 4WO4B 4HAGA 2EC8A 1A7PH 5IB2B 3RI5K 1BM3H 1A7OH 1JTPA 4QHLA 1Q9LB 5C0IB 1AD0A 3PGCA 5IMKA 3WHXB 4X5WB 2A74A 1XZ0A 4ZXBB 1S9VB 2XTJB 3KJ6L 3WFHA 5JLZA 1E27B 1UEMA 5HGHA 3SKNB 5LGKA 2VITA 3VWJB 1YEHH 4WJ5A 2VZUA 2A6IB 3QCVL 5D2NC 5D70L 5BJTB 5IOPA 3QDHA 3I75A 3FN0L 4GAFB 5DJAB 3RUGF 3UTTE 4GAJH 4EDXA 3MJ7A 4OQTH 2RGSA 1A6TB 3CSPA 3J7HA 7CGTA 2HTKD 5IEKB 3GMLB 3QI9A 3JUYA 2AXGA 3DECA 3U9PH 2AW2A 2MCPL 4M93B 1JPTL 5JOPE 1RFDL 5J0BA 3P9LA 5AZEH 3RKDD 3EYOA 4J3WA 2N7AA 4AG4L 2NR6D 4PS4L 2DMKA 4HHAB 5AAMA 4F8QA 3ARTA 1CXLA 4G6AD 1LP9F 3CFBA 3MGTA 3VXRD 4K7FB 2AS5M 4PJXA 3HR5B 1FE8L 4GXVL 3MRRB 1KJ2H 1YEGL 3MRCB 1WVZA 4RAVA 3BIAX 3DX9A 5CAYB 4GLRI 1CS6A 3LV3B 3F65A 4E0RA 4LF3B 3B9KC 1R3HA 3MLRL 4JFPA 5K9OA 4OFYD 1YEFH 2OQJA 1G9EA 4P9HH 3NCMA 1HDMB 3EDKA 3W2DL 1NBQA 3QDMB 3CVIL 3QIUD 4PP2A 4YHKH 4YHOH 3QUYD 4EI6B 1AP2B 4LKCB 1L6ZA 4TSBH 5MENA 1BQSA 2ED8A 1TPXB 5BCAA 4NKMB 3PF2A 3KLAB 5ACZA 5H94B 4FXLA 4X8JA 4JFQA 1RHHA 3SKJL 3SE3C 4BFIA 1JFQH 2MFNA 3RX5A 5DUPL 2RFXB 4MAYC 5MEPA 1EEYB 1DP0A 1T20A 1OTTD 4OGYH 1JNLH 4WI9A 2MHAB 4Z8FL 2AGJH 2PNDA 1I8KA 4M3KB 5IHUL 2VDRH 4JO4H 4P9HC 4U0RB 4YAQB 2ZUQB 4J6RL 1F11A 4RAUB 1UWGL 3AUVA 4UTBL 3DBXA 1IKFL 4BUGA 3MNWB 1XFPA 1F6FB 3VXOA 3LKPB 4DW2L 2O5YL 2IWGA 4XMLL 1MCSA 2CXKA 4XVUD 1MCOL 4IMKC 1SBSH 1CL7L 4ZFFB 5F3HB 5F97E 1ZEAH 3IU4H 4PV8A 4PGBB 3P30L 1HHJA 3RWEB 4DKFL 1IQDA 3JWNC 1G7IB 4L4TA 1UQSA 1QBML 1D9KA 1FO0L 3ZTNH 3EW3B 4MNQA 4Z0BH 1XF4B 4WUKH 1OP3H 5A43C 4WDIB 2X10A 1AI1H 1MHHA 2IAMB 3S97C 3QFJE 3HMXL 4XZUA 3AXLB 3ARWA 3BX7C 3D48R 5HBBA 2NY5L 4XHJC 4QTHB 3K2UL 2F19H 5KSAD 4QHNB 2V2TB 3QO1B 4PREB 5CEZH 1BAFL 3WFEH 3GB7A 2OS7A 4X6CE 5LXGL 3V0AC 4TULL 4JO1L 5B39A 1IBGH 1YC8A 1NKRA 4QHLB 3WUZA 3SQOH 1AD0B 3PGCB 5IMKB 3RVVD 2A74B 1MI5D 1XZ0B 4HULB 3WFHB 3I9GH 2I9TA 5JLZB 4KAQH 4LASL 5HGHB 3A6BL 1QEWA 2VITB 1OGAA 3L1OL 4WJ5B 4OUOA 4NC2B 3PHQA 2JCCF 1OSZA 1DEDA 5IOPB 3I75B 1QRNA 3TWCL 4H88H 4F7EA 3MCLH 4EDXB 3MJ7B 4LU5H 1HHGA 5F7KC 2FEDD 1IC1A 4XAWL 1CICD 4DGIH 4N9OB 3L5WA 3QI9B 5JR1L 2C4FU 2AXGB 1E28A 3HE7D 4PB9L 1OARH 4L4VA 5I1EH 4AJ0A 5E2VH 2VAJA 2W0FA 4YHLH 3P9LB 5E0QA 4C59B 3EYOB 4JKPH 2R29H 1RMFL 4D0BA 7FABL 5C9JA 1N0XL 1P84K 2P8PB 4PJCF 3CFBB 3MGTB 2P1YA 1MREL 4KVNL 1KCUL 3MRGA 2I60H 5D2LE 2VERN 3X12A 4KPHL 3F58H 2ID5A 4RGMB 4RAVB 3DX9B 2JE8A 1AQKH 4E0RB 1KPRA 4KHTL 4D0DA 1KLFA 1R3HB 5DJ8A 1YEDA 4JFPB 3L7FA 4KV5E 5K9OB 2OQJB 2YWYA 2VDPL 4ORGA 2EXWC 3BZ4A 4PP2B 2XZZA 4IOIA 5GJTH 1FYTD 3VFNA 2IG2L 3VFRA 1EFQA 2EDDA 1A7QL 3D85D 5FDWA 2QQLH 1SJVA 4GKNA 2RR3A 5D7IE 4QXUH 5MENB 1TLKA 2E7BA 2F8OA 1MVUA 5ACZB 4J3VA 1RZJL 4X8JB 2Z8VC 1P4BH 4JFQB 4PJEE 1RHHB 1F2XK 5BOPA 4JFHE 4BFIB 5FGBC 3T0EC 4OLWL 5EOCH 1DLFH 2QV2A 2HKHL 5MEPB 1DN2A 3ZLQC 1T20B 3TH2T 1I1FA 2VLRD 2CR3A 3ZYIA 4EIGB 4UTAL 4HMCA 3F7QA 1I8KB 5JHLL 4FMKA 5L0QB 3WLWC 3LMJL 4MXVE 3DI2B 5KG9A 2I25N 1F11B 4TN9A 1DQLH 4TVPE 1EO8H 3DBXB 2GEEA 4OFIA 1AO7D 1W0YT 2R9HD 3TM6A 4ZPTA 1LO0L 4K9EL 3S5LB 4OCLC 3VXRA 4BQ9A 5DK3A 1RY7B 8CGTA 1ZT4A 2VKWA 3O2WL 2JCCE 4OLXL 3D3VD 3FQUA 4WFHD 4PV8B 3GSUA 4YBQC 5K93A 3WNNA 1HHJB 4XPHH 2HTLD 2VDOL 1AO7E 1IQDB 5CIPH 2VSDA 4L4TB 2FHFA 1X4YA 3GIZL 1UQSB 4NN6C 1D9KB 1TIUA 4MNQB 4NN7B 4OFYA 1JNHA 3SDXE 3LIZH 3MV01 3RY6C 3GZKA 1MHHB 3KLDA 1RUKL 3QIUA 3D3VE 2A9ML 4XZUB 1E6JH 3QUYA 4WEBH 3C09B 3C87A 4YFLI 4S11A 1VPOL 5EBWA 2IQAA 4OZGA 2HKFH 3GB7B 4OT1H 4PJGF 4WHYH 2MPAH 3MRFA 2X05A 4V1DD 3FAXA 5B39B 2H2SD 1NMAH 1I3RA 3O6MH 4FQCL 5GIRA 3TBWA 3K4ZA 2ITCA 4FQJL 3RL2A 4R4FH 4U1JA 4YX2L 4NNPL 2I9TB 4OCRL 2ZNWA 1OM3L 4FFWD 1QEWB 2NX5E 5AYUL 1CD1A 3CDYA 4YDLB 1OGAB 4EOWH 3EJZC 3GO1H 3PHQB 1K4DA 4K7PL 3GHBL 1I1CA 1OSZB 1EFXB 1QRNB 4F7EB 2LU7A 3D39E 4WIQA 5F9AC 1HHGB 1TTUA 1ZA6A 5KSVA 3MXVH 1S5IH 3UROR 3OPZL 3L5WB 4OQ1A 3Q3GA 3P4OA 2C7UA 1E28B 2FX7H 5AYQA 4L4VB 1E6OL 3IETA 2HJFA 3BPLC 2W0FB 1BHGA 1J0ZA 1MQ8A 1GGCH 4D0BB 4OLZL 4ZFZA 5C9JB 2CD0A 4WEMB 4NYLA 4OM0L 5AUMA 3IXTA 1TVHA 2HVKA 4XCCL 1MQKH 4JFZL 1PD6A 3MRGB 2NY4B 1OAZH 1X5FA 4D3CH 1SQ2N 3X12B 2B39A 5KVMC 1B88A 1KULA 2EDXA 3LZFH 4XMPH 5B38G 2ORBL 4PTTA 1DANU 2PKDA 4L3ED 4D0DB 4RNRA 1F45A 5DJ8B 1YEDB 4XPTH 3L7FB 4PYGA 5E9DE 1HWHB 3TEUA 9CGTA 1FFOA 4LSQL 4ORGB 1CTNA 3BZ4B 2R2EA 1F90H 4IOIB 3WE6A 3VFNB 2CJUL 3O9WC 3VFRB 1F6AB 1X5KA 5FDWB 3TYGH 1OAYH 4GKNB 4G5ZL 3BPOB 5CSZA 2VXTL 2GCYA 2ICEB 5JZ7D 35C8L 5IVXF 1G6VK 5JNYA 5IMLA 1MI5A 1KCVH 4M7ZB 4JPKH 3SDAD 1KC5H 4P46A 5BRZD 4YHZH 5E00A 1N6QH 5EZJA 3KPSE 3RFZC 2L4OA 1I1FB 1X5HA 4UINH 3D0LA 3VA6A 2NTFB 5GGVY 1CICA 4X99A 3BD3A 4A2MA 1FSKB 1G7QA 3ZSTA 4K3EH 3BFOA 2YBRA 5D2LA 5KG9B 3MA7A 2WLZA 2KL6A 3MRNA 1WFOA 2XT1B 1MCDA 3WFBH 1PG7L 1JRHI 3DYMA 2V2WA 3PWNA 4OLYL 3KVQA 4F57L 3V52H 4ZPTB 1E4XI 5T3ZD 4P4RA 3U7WL 3VXRB 1PX3A 1DDHA 4NWUH 3NFPA 1ZT4B 3WJJA 1UKSA 4N0UA 4F7CA 4Y5XA 4LVHB 4TPRH 4OZFG 3FQUB 3Q5YA 3F7VA 4FQIL 4HC1L 3H8NA 3GSUB 4KROC 5IV2A 3H42H 2HFGH 3QPXL 4GS7B 4NZDA 3WS3A 5I75B 3OAUH 2DWEA 1JNHB 2YUVA 4WW2A 1FBIH 3STZA 1G0DA 3ZKMC 4ETYA 3UJJH 4PJEA 1KLGA 3QIUB 2QKIA 1FYTA 3MXWH 3QUYB 3VFTA 3N1FC 4DVRL 1TFHA 3BJ91 4LIQL 1I85C 3D85A 2YD6A 4RGOL 5EBWB 4I3RL 2IQAB 3GGWA 4CVZA 5GSVA 4OZGB 3MRFB 1RPQA 2ED7A 3BMVA 4IJ3C 4XCFH 3EOTL 5FYJD 5I8EA 1EK3A 3IF1A 1I3RB 4XP6L 3TBWB 2ITCB 3IRZA 4UMGA 3RL2B 4DJMA 1JZ8A 4U1JB 4G7VL 3WFCH 4PUBH 4ZO9A 1NMCB 1CD1B 1NLBL 3BWAA 3FT3A 3V4PL 1ETZA 1F00I 1K4DB 4TQEH 1XF2A 4OB5H 5IESL 5DTFA 3BPCA 5K9QI 5J12C 1AKJD 3T65A 5HYQA 4LVEA 3GRWA 1A02N 5F7DA 5E2UH 1ZA6B 5KSVB 1Z9MA 1FPTH 4L5FL 3Q3GB 3P4OB 2C7UB 4NO0D 1AO7A 4O58H 3IETB 1T21B 1ZHNA 1NCCL 1RZFH 3MR9A 3SDXA 4GQ9L 5GZOD 3V6FA 2NY7L 1LO5A 4ZFZB 1YEIH 3TN0D 3D3VA 3RTQC 4NYLB 1TZGL 5AUMB 4NCC1 5FGCB 3IXTB 1TVHB 2HVKB 1CDYA 2OI9C 3VFUA 3FONB 5CGTA 4FN0A 3X14A 4XVTL 3BKMH 4UIKL 5DT1H 3CD4A 1NCWL 4Z78A 4LPTA 4JQXC 2C9AA 4PTTB 3AAZA 3X13A 4QHUA 4RNRB 4ELME 1FP5A 1OCWH 2C5DC 2IMNA 1D5ZA 4OV6F 5CILL 1FFOB 2DQIH 2ESVD 5F1OB 3ROOA 2R2EB 2WUBL 2HFTA 5LG1A 3WE6B 5C0NC 3UPCA 2XA8H 3HFMH 3PDOA 4V1DA 4JKKA 1MCRA 4OF5A 1F4HA 1T7ZA 5I8CA 5CSZB 2GCYB 2BP3A 1I1YA 5JNYB 5IMLB 1KJVA 1MI5B 5CJQH 1M1SA 1QNZL 4XXCA 4ZAKC 2XICA 2DM2A 3QUZC 5LCVH 3SCMD 4BFGA 5J06A 2D03H 4P46B 4XCYB 5CINH 4ZYKA 1IFHL 1OGTA 5E00B 5EZJB 1CL7I 1XEDA 1IQWH 4TYUA 4U6TA 3UTSD 3X17A 5B38A 1MWAL 3D0LB 4EUPG 3FKUS 1KCSH 1CICB 2AQ2A 2JJSC 1RURH 4X99B 2VDQL 3BSZH 3KJ4C 2DQHL 3S6CA 4YXLL 1G7QB 4Y4KD 2YBRB 3KLSA 4LLDA 5D2LB 3MA7B 4YBLC 1J18A 3MRNB 5KVDL 1DL7L 2V2WB 4PJ7E 1NFDA 3AU1A 3P3YA 3PWNB 4ZS6C 1MCIA 1BQUA 4Z7QE 4P4RB 3MRKA 2IALA 3VD4A 4U31A 1DDHB 2E9JA 2OYPA 3NFPB 1AGFA 1I75A 1QYGH 4N0UB 4F7CB 4Y5XB 3MUY1 4ZODA 4CN1A 1YPZB 4PP1C 3O6LL 3F7VB 15C8H 4AEEA 5IV2B 5MEQA 2Q1EA 2VC2H 3CMOH 3Q5TA 4NOBA 1QHOA 3WS3B 3VFGH 4XPAL 3O2DH 2DWEB 1X4XA 4HIJA 3STZB 4WW2B 5DA4A 25C8L 4NQCE 1KTKE 1MJ8L 4ZFOL 4PJEB 1KLGB 3VFPA 5J89A 2OL3A 2QKIB 1FYTB 3VFTB 3WDIA 2XN9D 3D85B 3KPSA 4U1GB 3KPNA 1GGTA 1HKFA 3GGWB 4CVZB 4CGTA 2ZUSA 5GSVB 1N5AA 1UKTA 3GI8L 4JM4H 3V4VH 2DD8H 1QA9A 2OBGA 4FQHA 1IAIL 2FDBP 2J4WH 5I8EB 2FGZA 3IF1B 1PKQE 3SDAA 3QEHA 3JVGA 3U79A 4X9FA 1P69B 1CXFA 3MLVH 5BRZA 1QLRA 4OZFA 2DB8A 1RZKH 2FH8A 4YBHA 1EUTA 3IJSA 4I0KA 5DFVC 2VLRB 2F9BT 1JF1A 3FT3B 3BWAB 4MHHI 1CWVA 1J1XL 1ETZB 4HPOH 3LN5A 1RQ5A 2R2BA 5DTFB 2RB8A 5AEAA 3BPCB 1AFVL 4F15C 1FGNH 3T65B 5DYOA 5HYQB 1L0QA 2V9QA 3B9KD 1NCAH 3RX7A 3AM8A 1BD2D 2X7LA 4KJPC 1AO7B 1INEL 3E8UH 3G6AA 4YEEA 4DEPC 4XC3L 3JV4A 1ZHNB 3V2AR 3ISWA 4NZUL 2GYSA 3MR9B 1IZJA 3FQXA 1C5CL 2HRPL 3F6IA 4JHAH 1MRDL 3V6FB 1LO5B 3D3VB 3UPRA 4NJ9L 1JNNL 4NKIH 3TO2A 5IWLA 1BD2E 1UWXH 2R69H 3VFUB 5D72H 3UX9B 1IGJA 3X14B 5JHDE 2BXZA 5D5ME 4Z78B 2GUOA 1J9CT 3GI9L 5IBLC 3NH7H 2EDTA 3AAZB 3X13B 4L1HA 2QSQA 3GEWB 2XWBA 4YHIA 1D5ZB 2CLZA 5TF1L 4Z7VF 3ROOB 2ZSWA 3T0AA 4HUVA 3R8QA 1AGDA 5LGHH 5K9QG 1VFMA 1GRWA 4NOFA 3PDOB 3PJSA 1YYLL 2DQUH 4JFOA 4V1DB 2PYED 5I8CB 4YWGH 1CF8H 3X3GH 3N06B 1I1YB 4EI5A 2ERJB 5IM7A 2ZG1A 1DCLA 1J0KA 2DKUA 1KJVB 2EECA 1U8IA 2I9LA 1RIVH 2YXMA 4M3JA 5DMKB 2LVCA 2VR9A 1LGVA 4LK4A 4HJJL 5D7KD 5L7XL 4ZYKB 3VXNA 1OGTB 4N0YL 1ADQH 2PYEE 4RMSA 3OB0H 3UYOD 1AKJA 2L7UA 3CH8A 5B38B 4YHPA 4NZRH 1INDH 2HLAA 1Q0YL 1T4KA 1YECL 4OGAC 4IRJA 1MSPA 2ZZUT 3VCLA 5ELIA 3DETC 4NO0A 4P4KC 2XZQH 4LLDB 2V9TA 3HS0A 1AE6H 2DLFL 4OCWL 1U3HA 3VI4F 5EWIL 4HT1H 1NFDB 3AU1B 4PJAA 4UT9H 2E6JA 3TN0A 3KYKH 4HG4J 3VE0A 3SGDH 3MRKB 2QEJA 2IALB 1QBAA 5TE4H 1NMBH 5GRUH 1AGFB 5D7LE 1N3NA 3LS4L 3O4OB 3G6JA 3MLSL 3QAZC 5H8DA 5MEQB 4JQIL 5F9OH 3JBG7 1DQJA 1JJUA 3D0VA 5K59E 1REIA 3ALPA 3ARVA 3MBED 3OMZA 3B8SA 2R1YA 5A1AA 4NT6A 1GJIA 3OGCA 4HIJB 3TA3C 4HUKB 2ESVA 4BYHA 1KIRA 1FCCA 2WLYA 3EOYG 5GS0L 3VFPB 4JFDD 2OL3B 3ZDZE 2VRAA 1A6VH 5CSGA 4KDTA 4MJ2A 1Q0XL 1T03L 4XPBL 4UT7H 3KPSB 2FBJH 4XNZC 5TDOA 4GW1A 1N5AB 2IPKA 4MB5A 5C0BD 1QA9B 3SE4C 5CEZD 4FQHB 1IARB 5C0AE 5T5NF 4HK0A 3MROA 1UJ3C 3SDAB 4CUCA 3QEHB 2DTMH 4FP8H 4JFDE 4N1HB 2Q8AH 5BRZB 1BJ1H 1QLRB 1YQVL 3MRLA 5FKAA 5SWSE 1T5WA 4OZFB 5CJXA 4U6HA 1CGWA 1X5GA 3IJSB 2ADFL 3RPKA 3GSNH 3RA7L 1JF1B 3UTSA 2R56L 5CEZE 3LN5B 2R2BB 3HNVH 4LRNH 4NM4L 4CU7A 1T5XA 2J8OA 2W0PA 5DYOB 2X4RA 4Y4KA 3QUKA 1CLZL 2JJTA 1T7VA 1YY9C 5I6XB 4NPYA 4EIZC 4LNRB 2X7LB 1QVOA 1CIDA 2XG5A 2EXWD 3FB7A 3G6AB 3K3QA 3HZMA 3JV4B 1ORQA 1YJDL 1WCBA 2V5YA 5IEHA 1WEJL 4YZFF 1NAMA 5EULV 3FQXB 3UC0L 3O41A 4NQCA 3UPRB 5D1ZD 1OWWA