3HHRB

Human growth hormone and extracellular domain of its receptor: crystal structure of the complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
203
structure length
195
Chain Sequence
EPKFTKCRSPERETFSCHWTDEVHGPIQLFYTRRNEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human growth hormone and extracellular domain of its receptor: crystal structure of the complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Hormone/receptor
molecule keywords HUMAN GROWTH HORMONE
total genus 33
structure length 195
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 1993-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hhrB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hhrB01
3CC5A 3RWEB 1FYTE 2C3GA 1KC5H 4QT5B 3PJSB 4X98A 5LQBH 3IF1A 4Y0GA 2HFEA 3HCVA 4OZFA 3ARBD 3ULVF 5GISH 3GMRB 4M9OA 1ZHLB 4RQQB 1KTDA 3DARA 1GGBL 1RJLA 4LP5A 5E8PA 4MNHB 5DJDB 2VR9A 1JPTL 1QTYT 4YO0A 2YUWA 3HN3A 4BSVA 5LKNA 2YEZA 3QUKB 4ZUVA 3GB7A 5D1ZC 1AO7D 3PGCA 4WRLA 2WWMC 4Y19D 2WUBL 2XTJB 2XI9A 2HG5A 3NH7L 3VGAB 3Q0HA 4ODXA 3A6CH 2FEDD 4D0CA 3DX9B 1GGYA 1YEIH 3RKDC 4CW1B 4CMMA 4KQ4L 1GYAA 3FO2B 3CFDB 4FMFA 4K3JL 4Y4FC 3QUXD 1CU4L 4PS4L 5HYSB 2AJUH 5ETUB 2ZSVA 4GAJL 4NWTL 3ARQA 2EYRA 4PJ8B 1YN6B 4KK6D 1QG3A 3QQ3B 2L0DA 1SYSA 3VXOB 4PJIB 1M71A 4Y5XC 5FO7A 4GG8A 2G5BA 3KDMB 3MFGB 3O6KL 4LQFH 3MNZA 4P5TB 4R0LA 1B88A 1T7WA 1Y18A 3JXAA 4PJCE 1VFAA 4NQSA 2GCYA 1F6AA 4HPOH 1BJ8A 5FDWB 4RGNE 4LARH 5DURD 2NY6B 4DN4L 5JO5A 3RA7L 4W4OC 4HWZA 4K8RD 4G8GD 5ACMA 3JV4B 3F6LA 4NSKA 1U93B 1H3UA 3I50H 3ZDYF 5KSAD 4JANB 2JCCE 3KPQA 2OR9L 5ESVA 5INCB 4MQTB 3DPBA 4PBVC 2H41A 4L3AA 3TIDA 1CGUA 3E3QC 2IBBA 3VFMA 4N5ED 2GSIA 5JPNA 1UFUA 5INCA 2AXFA 5KVGH 1U93A 2Q7YB 1OVZA 5CEYB 3JV4A 5D7IA 5JO5B 4OUOA 4P4RA 2PKDA 4ZNEE 3JSSA 4XXCA 1NCTA 2ZKHL 4XPTH 3U0TB 3QJHB 4P9HC 1RK1A 3RHWF 4JKPH 4MXWH 2GCYB 3PL6A 1NDGB 5CEZH 1YMHA 5JXEC 5EUOF 3C6LD 4OSUL 4KTEL 4R0LB 2ZCLH 3MNZB 4P5TA 1U8HB 4KZEH 2P5WD 5F9DC 1CE1L 3W11C 5GZOD 1M71B 1GZPB 5CCKL 4TQEL 3BIBX 1MFEH 4R3SB 3SKNB 4HS3B 4OTXH 1CK0H 2I26N 4PJAA 3NPSB 3QQ3A 5F93C 3T8XB 3WIHH 1NLDH 2ZSVB 5JOPD 3EUUA 1NMBH 2PYEE 5DLMH 1I3GH 4L8DB 3AREB 1NQBA 4PRHB 5BMFH 5E2JA 5C09A 1JNHB 4CJ0A 1FL5B 4BZYA 4ODXB 3WKNA 3C6LA 3FT4A 2K3TA 5HYQA 1J8HD 4JPIB 5IEHB 1I85C 4O2CB 3UC0L 1RU9H 5A3IC 1EV2E 1MFDL 4Y4KC 3TF7C 3DRQA 4ODTH 4HT1H 1CQYA 3QDMD 3QUKA 4ZUVB 2BVTA 2YEZB 3DETD 3VD5A 4PBWD 3O9WD 4BSVB 4G9FA 3UYRH 3RVWD 1MF2L 1EEZB 1AHWC 1NFDF 3VFNB 3HUJE 4YHLL 3CVHL 2ADIA 5E8PB 2NY7H 1RJLB 2VDRL 3C5ZC 5CSGA 1QEWA 3GJFB 4Z18A 3E2HB 5C09D 2IFGA 4QRUB 4AL8H 3GMRA 3EOTH 4LPYA 1QRNB 5FCSH 5D1XC 2ZG2A 4L3CA 3HCVB 4K9EL 4M62L 1CLZH 2JJSA 4HQQL 1INQA 3TWCH 1BAFL 4CL7A 3M45A 1MHPL 1OCWL 3PJSA 4FA8A 4KVCL 3WSQL 4PRNA 5IHLB 1MCFA 3FQRB 2YC1B 2QQKL 4DZBA 1DUZA 2ESVD 1I1YA 3QWRD 3P4NA 3QULA 4UT7H 3MV01 4V2BA 1FRGL 2WLYA 2MQ0A 3GBNH 4NQEE 3UAJD 3MC0A 4EDWH 5DI8B 2ZUWA 2GTWB 2DJ4A 4HUNB 5TE7L 5GSVA 3HS0B 2E9IA 5KTEL 4KK5C 5KVFL 5E8OA 5KS9A 1UACL 3QDMB 5FA4B 1VGKA 3QDME 1T04A 2H9GA 1TQCC 1R3JA 5DC4B 2ZUQB 5DO2C 2V5RA 3QIUC 1IAIM 2J6EH 4UTBL 2WBJC 5INDA 3MCG1 3T0XA 4NJAH 3DTXA 2DL2A 3GHEL 4ODWB 4D0DA 5EZJA 1JN6B 3MBXH 4HWBH 4PJEF 3P11L 3QIBC 1XGRA 3SDYH 4X83A 1BD2D 1MJUH 2YPVL 3MV8A 3O3BA 4XCNB 5E9DA 4JM4H 1N3NB 4HWEH 5J1TC 1KYOJ 1RJZB 1ZMYA 1R0AH 2AAVA 2AEQH 5JOPE 1AGCB 4E41E 2H45A 2V2TA 5HTSA 5IBTL 5K9JL 3ILPB 3BIKA 5ADOH 3VWKD 4G5ZL 3U0PA 3MXWH 5KG9B 4F7MB 1MQKL 1J0ZA 4OM1L 5MEOB 3I84A 1LILA 3AS0A 3DETC 1PZUB 1CFSB 1QD0A 3C8HA 5L2KB 3I9GL 2NY6C 3D69B 1JBJA 2CDEA 1YQVL 3FCTB 5GJSL 2NY2B 3FQTA 3X3FH 3BEWA 1MHHB 4ZUSB 4M1DH 3QUZC 4YHKL 4MS8D 1NMAH 1GSMA 3OZ9H 4LVHB 3BGMB 1HHGA 1V3MA 3RUGA 3OX8A 4KK8D 1JHKH 2IAMA 3O6FC 2HT3C 2DM4A 4HDIB 2O61A 4KI5D 5LJYH 5EO0B 2A6IB 4U1GB 4XNQA 3NA9H 2EDBA 2KUTA 4GW4B 4NQXB 4YLQT 4CADA 4PRHE 1IGYA 2VLJB 5E2UL 5F70A 3CXHJ 3OKNB 3QHZH 4QTHA 4R7NB 1MREL 4FQ1H 2AJXH 2FEDC 3HUJF 4URTB 1S9XA 4LKXA 5DTFA 2X1QA 2ZUUA 2Z91A 4O02L 5ELIA 1HNFA 1MCBA 1QLEL 1XIWD 4PJ9B 5DVLA 5DK2A 2CXGA 1GHFL 1RJYB 3HG1B 4KHTH 2VXVL 4KVNL 3S4SB 4NKIL 3NPSC 3WEXB 4EUPG 5CJ5A 1CCZA 4DKEH 1O7SA 2F8XC 3LQZB 4F7EB 2RFXA 1X5KA 3P0GB 4I3RH 3X14B 43CAA 1I8IB 4PJFA 1NBYB 2H26B 1FGVH 2FYYB 2GT9A 5BW7A 1T3FB 3REVB 3PV6A 3KPSE 4XMPH 1QQDA 1HZHL 3RVWC 2W1NA 3DURA 5E8NA 5HI4C 2MHAA 1KPVA 2IQ9L 1EEUA 4U1LA 1BBDH 1OY3B 1F02I 2X1OA 4MA1C 4YHPA 3ZDZF 4ELKA 3K46A 2NR6D 4ONHA 2DI9A 1HCFX 2PTVA 2RQ8A 2D0GA 3IDMA 4GRWB 5KBNC 3I3BA 5H94B 5KSBB 1YMMB 4MAYA 1MHPH 2DM2A 1XF2A 2VL5B 5EC1A 3T65A 3NBNA 5BXFB 5EO9A 4QNPF 4G6JL 2DLIA 1FFPB 4WEUD 2VE6B 4X6CB 4DUWA 5IJVA 4I2XB 2VDRH 2IG2L 4Z5RA 3ZYIA 4MD5B 1KCUH 4KZDH 3T09A 3OB8A 2FJGB 2BXZA 4K3DL 1YNTA 1KPRB 1XGQA 2QSQA 1JPFB 4GRLB 5I1CH 3D18A 2X4NB 1WAAA 4OLZL 3FOMB 2EYSB 3T1FA 5B4MD 5AEAA 4XCEB 4FXKA 3HZKB 1F4XH 4TULL 3IFNH 5CGYD 1DBAL 4N0YH 4PJCA 4MA7L 5DSCB 5ICYB 1ZTXL 1FFRA 2C4FU 4X6CF 4TNVF 1SY6L 1UXSB 3UJIL 1G7LA 2R0LH 5IQ7H 1NGWB 2HWZL 3GMNA 1JGLH 4WI2A 1TLKA 4BSJA 1Z2KA 5B3JF 5F9OH 2H3NA 4GSDL 4OQTL 4F37K 4G80B 1EHLH 3MV9A 4Y2DD 4O00A 5EU6B 4OF6A 5AWNL 5HGGS 5AAMA 4OGYH 4P2CG 4X7TB 2PF6A 5KSAC 3G04A 5I0ZA 1GGCL 2D31A 4RGOH 3QPQD 3IS0X 3H9HB 1S5IL 4ZOAA 5E6YA 4L5FL 3NGBC 1I1AB 5LWYH 4R7DA 1D5XB 1KOAA 4ZO9A 3PP3H 2MCPH 4JKPL 4ZFOA 1ZTXH 3QXWA 4LF3B 4PY7A 4E0RB 1XCQA 1PY9A 2VUOA 4P57A 2AQ1A 1KELH 4KMQA 4GAFB 2VZ1A 4MD0B 3P0VL 2I25N 5JHLH 2BNRE 2OTPA 1XR9A 3BVNB 5KAQG 4LPTA 5I1CL 2DJUA 1C08A 3I6LD 2XG5A 4KY1H 4JPKH 1N6QL 5HHQB 4Y1AA 1MI5A 3RVXD 3HG1E 4XPAL 5IK3A 1DFBL 4HWUA 4XBPA 4LVHC 4OCSH 5DJCB 1A7OH 1RIVH 2APWA 4IS6B 4YAQA 4QRRB 2DL9A 3H42L 1AD0B 5CGMA 2X4PA 1I8KA 2G2RB 4XNZC 3HE6B 5HGBA 1E0OB 3Q1SL 5F72S 3QNXA 2WBWB 3O3DA 3ARDA 4M7JL 5I16A 2ENSA 3IYLW 3BUYB 1ZVSB 3N0PB 3M07A 1IM9B 3GK8L 4KDTA 1A3RH 1MNUL 1PY4A 4L29B 4HMDA 1JNNH 3W5NA 1RPQA 3CPLA 4N0UB 5FB8B 1KSRA 4KXZH 1BBDL 5F1IA 2O93L 4H1LG 4GW1B 3MREA 3MUZ1 1KTRL 3BRGC 3VGGA 1FGNH 2Q8AL 3V0VA 1QFOA 2OQJA 3WD5L 1VFMA 1WFNA 1BLNA 4XP4L 4H1LH 1AGEB 2UY6A 4NN7B 3QQ9D 4OGAD 2WIMA 1KXVC 3GI9H 4MZ2A 5C0AE 4RX4D 5BOPA 2ED8A 1U42A 1MCOL 3QO1B 1AR1C 4OV5A 2XV6B 2VISB 1IEBB 1T1YB 4P2OD 4DVBB 3BP7B 1G9ML 2WUCH 1H0DB 5I1AB 3HR5B 4HUWA 4E41B 3IFPA 1ND0A 2B5IB 5HD8C 2GJ6B 3IS1X 1YJDH 3HZMB 1P69B 2BOCB 2X1PA 4XZUB 4N8CL 1SEBB 3CDCA 5GGUA 4WDIB 2BSTB 4EUPH 1OGAE 4MA1B 3IDXL 4XC1L 4YPJA 4JFZH 1UXWA 2AJXL 5GJTH 5IB3A 4NQVB 1RULH 3GSNL 4WCYL 4NQVA 2AABH 5IB3B 4XHQA 4LFHG 1FC1A 5HHOD 1X5JA 5I1DB 1A5FL 1SJEA 1UCBL 2Z8SA 3ZKXC 3CLFL 1KEGH 5JR1L 5DHVH 2OJEA 5IMMB 1SEBA 4NQDD 3UBXG 5I18H 3T0ED 4S11A 4D3CH 1YN7B 5C0CA 5FUZH 5T3XL 2WQ8A 3IFPB 4G8FA 5I1AA 3VXQB 1H0DA 4OM1H 3H9ZA 3BP7A 3QCVL 4ODHH 1LK3L 5IW1A 4K94L 1QFWM 2YR3A 1F45A 3CIQA 5CD3B 3JUYA 4G5ZH 3O41B 3GJFH 1MJ8H 3GJFK 5E6IB 3K1DA 1AFVH 3V4UL 5KSVB 1ZANL 1HXMB 4WGWB 2EH8H 1NFKA 4OZIE 1N4XL 4WO4D 3GM8A 5CEXA 4XHJD 3RKPA 5ABDE 4LSTH 5BZWA 2EIDA 1QRNE 4EQ2A 3KPOB 5IB2A 3MV7E 3P73A 3V7MA 4K7FA 2XQYG 1H5BA 3QDJB 3O4LD 3MREB 1FIEA 4GW1A 1UEYA 1ZSDA 2XA8H 5F1IB 1ORSB 4PJHE 4PRPD 3JTSB 4FQQA 1PX3A 3KXFB 4LAQL 3EGSB 4L29A 5CGTA 3LOWA 3NVQA 4M1DL 1I9JL 1JV5B 1TQBB 1QBBA 4KK8C 3V6OC 3CH1B 2C9AA 3LKSA 5IB5A 1I1AC 4AZ8A 1DQML 5IMLA 2F54D 5I17B 5I16B 1SYVB 2FIKA 1UM4L 1EFQA 4LSSL 4M61B 4QOKB 5DMKA 2AKRB 1YA5A 2QJDA 1KJMB 1N26A 2ORBH 3QCUH 2G2RA 1I8KB 3N06B 2DD8L 2PYEA 1AD0A 4ODVH 4RMVA 2Z92A 5CUSL 3EYSH 4IS6A 5DJCA 4TRPL 4OLEA 1ZLVH 2VZTA 3GDBA 5C09E 1LMKA 5C0ND 2YXFA 3VFVB 1P6FA 2F5BH 1QFUL 1T2XA 3V4PH 4XMLL 5EZLB 2XXCB 2ZUSA 5DHVA 3TCXA 1IC7L 4MD0A 4JLRB 1OTUD 1MCSA 3ZYOA 5TQ2H 3BOVA 4X8XA 5ACZB 4E0RA 3O0RH 1EIBA 4M62H 2P4AB 2YRLA 4TPRL 3WO3B 1VPOH 2X09A 2XOTA 3EKCA 2XY1A 4ONOA 5EO1A 4OT1L 2FGWH 1I1AA 2UY7A 2ZKHH 1J05A 2YN5A 4TVPH 2IPTH 4N0FA 4JPWH 5IJKC 1A6VH 2D31B 3DRTB 1KV3A 2DQIL 3ARVA 5CJOH 3O4OC 5DYOB 1G84A 3OG6B 3PHOB 4QRPA 5E7FA 3AU1A 4BZ1L 4LNRA 4AQ1B 4U1SA 3GNML 4FQLH 5EU6A 3UC0H 1ZGLB 1LEGB 1XEDA 4G80A 1UT9A 2A73A 5T1KB 2H3NB 3VXMB 5IOPB 3RVVC 3RA7H 4P59H 3G5ZA 4M6NH 1KJ2B 4UTAL 3TWCL 2N56A 2IFFH 5ANME 5DHXB 3LV3B 3NAAL 3SPVB 5DJYA 3L5XL 4PJCB 5EOCJ 4ZUWA 3VU2A 5ADPL 2NY4D 3CFCL 3G6JE 3HZKA 4XCEA 2V6HA 5BW7C 2B0SL 2X4NA 3NCEB 1RVFL 2EDWA 1I7UB 3N85H 1C8PA 3JVGC 2CO6B 1YNTB 3QUML 1HHKA 4L9LA 1T7XA 5E70A 4MD5A 1MPAH 4Z5RB 1KLFA 3QEHA 4GAYB 5IJVB 4X6CA 1UADC 2ICCA 5I19H 4LSSH 1FFPA 2CD0A 2HAZA 1CU4H 2C1OB 5EO9B 5A43C 2ADGB 3WE6A 3T65B 1DQMH 2P8MB 3BYYA 4Z7OF 4MAYB 5KSBA 1FVEA 4JHAH 2A77L 5GS3A 2EDNA 4D9RD 3IDMB 3EJZD 3T3PF 1IC5H 5T1DH 2LAAA 3SGKC 3SDDD 3SO3B 2HJFB 5EPMB 1A6ZB 5GRVL 1GVIA 3HI5H 4HLZH 4ZD3L 2E7LC 5DD3H 4H0GA 3SE9H 2XTLA 3NAAH 2CKBB 3O6FA 4D9RE 2MMXA 1K2DB 2GT9B 4HKXA 4P59L 2W9DL 1SVCP 2H26A 3TVMB 3UTSE 5H8DA 5DMGC 2GJZB 1Z5LB 5BRZA 1SM3H 1MUJA 1N8ZA 3N1FC 1I8IA 4MXWL 4IRJA 4F7EA 2CQVA 3LQZA 2E27L 5FA3A 4F57L 3BKMH 5DK2B 4AENB 2ESVA 3QXTA 1A6VL 3KYMA 1CGTA 2QSCL 1HK6A 3WS3B 3STLA 5I74B 3C8DA 2NY4B 2P8LA 2JB5L 3Q48A 4YXHL 3I6KA 3PL6C 4C56E 4KKAD 1TQBC 6CGTA 4KTYA 1MLCA 1IGYB 1NEZB 4CADB 4NQXA 3NABL 2WUBH 3ARTA 4IRJD 3JV5A 3IJYB 2RCSH 5EO0A 25C8L 2R2CA 5K9OA 4PGCA 4WEMB 4GAGH 5IFAL 4G8GE 3P9WB 2WBJA 4PJFE 5BQ7B 3G5XB 4AM0A 4S1SH 3IDYC 3S37L 3U46A 2YD9A 3VXPB 1AR2A 3DGGA 4ZUSA 1MHHA 1VEPA 1YEDB 1FNGA 1XGPA 4ONGH 4GRMB 4J3XA 3FCTA 5JNYB 5HHPB 1Q38A 3D69A 1MCOH 1DLFL 4PJEA 1JI2A 1CFSA 2EIEA 5HGDB 4W81A 3SCMD 5C0FB 2E5EA 5IHBA 2FX9H 5DEGA 3MZGB 1NGQH 2X41A 5KG9A 3ULSA 3NIGE 1EAPA 4I77H 1RHHA 2NTSP 3ILPA 4RCAA 3HC0A 1PG7L 3HA0A 4M8QB 4YXKL 2R29H 4A6YB 1NGYA 2UWEF 1LEKA 4AG4L 3FQUA 5I73C 5IVXA 1B0GB 1M7IB 3KPMB 4XCNA 5E9DB 3MV8B 3O3BB 2QSTA 1CWVA 1XGRB 2C7UA 4Y5YA 3GHBL 2NY6D 5EZJB 3ESVF 3CDFA 4Z9KB 4ODWA 4PJGA 2BRRH 1H15A 4L9LC 3TBWB 2AK1H 4JFQB 1D9KC 3DVGB 3V6ZB 4ZFFB 2EH8L 1T04B 1VGKB 4F7PB 4WFEE 2HFFB 4Z7UE 3VFGH 1N0XH 2Y25A 3D3VB 4EDXB 1XFPA 1E6JL 2GTWA 2R69H 5HI3D 5E1HB 2O5XH 2FH6A 2EXYC 2M8XA 1DN0B 2X4SA 1V7MH 3PQYD 3VW3L 1U8JB 1RZFL 1PLGL 2JELH 4KY1L 4N0CC 2B1AL 5F1KC 1MHCA 3GSOB 3QULB 5D1QC 1J86A 1I1YB 4XX1G 5ESAB 4YBHA 2NY2D 4S0SD 2AGJL 2GHWB 5LCVH 1KIUA 2VQUA 4DZBB 2EO1A 5F7DA 5T1LB 3FQRA 3MRDA 1AP2B 3FN0L 2AJYL 3BPCB 4YDVB 2Z4QA 1RZIA 5C07E 2DI7A 2FSEB 2NPLX 5D96C 4OD2B 4Z8FH 4L3CB 4Y4HD 3DWTA 2AXGB 3QFDA 1QRNA 2EC9T 3QPXH 4N8VB 3ZTJG 5J6GA 1LNUA 3FQWA 1RUKL 3AY4C 1QEWB 3GJFA 3PG2A 5L0QC 5CJXC 1M05B 5I1LA 4PLNC 4BFIA 1F42A 1EMTH 5E03A 1P7QD 1JRHH 4G9FB 5D2LF 4OZIB 3BH8B 3WN5B 2XZQL 3H9SE 3BMWA 4HIEB 4I3SL 2IBZY 3IU4H 4E9LA 4S1SL 4DKFL 3GSNA 4NNXA 3L3KB 3V6BR 3DRQB 2X89D 4Z7VB 3B5TA 4K7PX 5IHUL 5IROA 1CICB 1P84J 3RZCD 4JFHD 4LIQH 2M2DA 5JHDD 2MPAL 3EDFA 4LLMB 1NAKH 4WV1C 3TA3C 3C6LB 3FT4B 3L5HA 1C5BH 3VFTA 1FL5A 1JNJA 1JNHA 3O2VL 5C0IA 3QO0A 4TN9A 4NZUH 4M5ZL 4L8DA 5C0DB 2CIIB 1KEMH 3TBTA 1IGIL 1C12B 4BA8A 4JDVA 3D0VB 1OGAD 1U41A 2FH8A 3U48A 3O8XC 1MWAB 5JXAL 3VFWA 4HS3A 1GZQB 2QV2A 2EDYA 5I6XB 2VO5A 1DSFH 1NANH 3GMOA 1FZOA 1NCWL 1RQ5A 5FYKH 4J1UB 2I27N 5FKAA 2OK0H 4HMEA 2R2HA 3V5KA 1JYXA 3I3DA 1CIUA 2E27H 2VLRB 4MDIB 5JHDA 1A14L 1CLOL 4RWYH 1YQ2A 4NQCE 4QXGH 4Z7QF 3L3DA 3PL6B 4JG0H 4Y5XA 4MJIA 1RK1B 3U0TA 1A1OA 3BDBA 1U3HD 1OB1B 4G7VL 4MXQC 3D48R 2BNRD 3FO0L 5AZ2L 3LZFH 1FVCA 4JRWA 3BKYL 2ICWI 2WWKT 1NANI 1N6QH 3VFMB 1LP9E 1KJ3H 3UTZA 3TIDB 1R5WB 3DVIA 5FECB 3BW9A 2BOBB 5HI3C 3KPQB 3LEYH 4LRIA 4JANA 2VLKA 3WIFA 1DQJA 3O3EA 2NX5D 1CF8L 3CU7A 4HWZB 5FUCC 3P0YL 5CMAB 4OF3A 2CUMA 1VA9A 1FJ1A 1ZWIB 4S2SB 1UKQA 3LKPB 4ZTOL 1U8MA 1ZEAH 4LK4A 3SJVB 5FDWA 1F6AB 4GXUN 2R1XB 2LVCA 4YHOH 5HHNB 4YUEL 4XBGB 1KN4L 3JWOC 5E2VL 2ADJA 2EEDA 1I9EA 3JV6A 4I8DA 3X12A 4WFHE 4GG8B 1A6WH 2CXKA 1HYSD 1CDYA 2Q76B 4JQIH 5D8JL 4MDJA 2KBGA 1GJIA 3RY4A 1BM3L 1U8LB 1YN6A 1I9IL 2VN4A 2EYRB 2OYPA 5GGVY 2DWEB 4ENEC 1L6ZA 1Y6NR 4S10A 4CKVX 1UKTA 2D7PA 3NTCH 4CMMB 4CW1A 2IFFL 2DD8H 1YEKH 1PSKL 5M94B 2OR8A 4B50A 3WNMA 4HEME 3B9VA 3OJDB 2VLJD 3U2SA 4Z7OE 4RA0C 4MA7H 1U91B 1NCUA 2NX5B 4G8GA 3GSUA 2LE9A 4GBXC 4JHZA 1U95A 2I9LB 4ETQA 2QKIB 3EOYG 1T0NB 2W59A 3GB7B 3BT2H 3HTLX 1NMAL 4WWKB 3PDGA 5HHVH 5L88H 3LRHA 1RHFA 4WENB 3RBGA 4XNYH 3HB3D 5DJDA 3WXWL 3OF6D 3TVMD 1ULVA 3W82A 3D2UA 2YOCA 4Q9CA 3KPNB 1LD9A 4I18B 1K5NB 1ZHLA 1YUHB 4XCCH 1MIEH 4JFPB 4RBPH 3Q6FB 2JIXB 1JYWA 3IF1B 1ZT4B 3WNOA 2PR4H 3VXNB 3SDXE 1NAMH 1TDQA 2B1HL 4XB8A 3IDUA 2AEQL 2VN7A 5I2IA 4RGNB 3O11B 4P5MB 2ZPKL 1SBBA 5L0QB 3MLXL 5F6IB 3S88H 2HFGL 5F89A 4JFDA 5CINH 1GCFA 4NWUH 4XWOD 1QOKA 5F7EL 3IXAB 1OTTD 4UIMB 4Y1AE 4U1MB 4L3ED 5C0BD 4LCWD 5GRJL 3OJMB 2NY1D 1DQQA 1CICC 4IOIB 5CWSA 4KKBC 1DVFA 1JFQH 2NW3B 1A02N 3CK0H 3S36L 4L1HA 4WV1B 1Q0XL 1A4JB 5BJTA 3CX5J 2BC4A 4XXDB 5GRVK 1ZS8A 4MA8H 1T7VA 4P2OA 5I71C 4DKDC 2O5YL 1QSZA 2XZAL 4K71B 4Q9RL 1NJ9A 2HKFH 2HA1A 5KVEH 3N1PC 3IU3B 1PZ5A 1YJDL 4N0CD 4FQXC 2NYYC 3KLDA 3HB3C 3KWWB 5L6YH 1E4XL 4XAKD 1U3HA 4LKCA 4PRID 2D4DA 1ONQB 2WUCL 4IDLA 2Y4SA 4EI5A 4JEGB 4RGND 1X4XA 2F58H 4AIOA 2EC9U 3BDXA 3I2CL 4CMHB 1LE9B 5HHOB 3VXMD 4LCYB 2OL3H 3ALXA 1WSST 4YE4L 4OGAC 3TZVA 4EOWL 5HJ3A 4XI5C 1FZJB 5DFWH 4AEEA 3T0EA 4HK3J 1D6EA 3L3HB 5F96H 4OZGE 3MXVL 4OGXH 1FGNL 2J5LC 1EFXD 2C1PB 1BQUA 4P4KB 3U36A 2Y07H 5C0RL 4OCXL 1PG7W 2I9TB 4P46C 5E1AB 1AXTL 2K7QA 4JM2F 4PJ5E 1A6TB 1F4YH 4JY5H 4NBZB 5C9JB 1JFQL 4NKOB 2IH3A 4PRAB 3CUPB 3A67L 3P30L 4WVRA 3SE3C 1FNHA 3GMLA 3U4BH 3JTTB 3QEUA 3DUHA 3CU1A 3LIZL 1V3KA 2ARJA 3VRIA 3LEXA 4YNYB 3G6JB 1ZT1A 1IKFL 1NC2B 4MCZA 3ARPA 3VI3F 5D7JC 3X13B 1FNFA 1KCLA 3ELAT 3GBML 3I85A 4JQIL 4HWBL 2XN9E 3DX8A 3MV8D 4POYA 1K4DA 4PJBF 1PEZA 3ARGD 2DWDB 2PR4L 4F15B 1GOHA 2W92A 4OSUH 3QXVA 1X5ZA 4YHOL 1K3IA 3VXSB 1Q9LB 1IGFL 1KENH 2PW1B 5IR1B 3OJ2C 1KNOB 1NCBL 3HPJA 3MRMA 1S7QB 1A1NA 5GGRB 4PGDB 5IWLA 3ZE1F 1CF8H 3O6LH 1BIIB 1BHGA 2VSDA 4PRIB 3VGHA 2JJUA 5BV7C 2B2XL 1U8OB 4RAUA 1GL4B 1X5LA 4QHKJ 2VR5A 3FB5B 4BKLA 2B8OT 2F8VA 2Q8AH 1OF2B 2QQQA 2B4CH 3MJGX 5L2JA 3EHBD 4DAGL 3QNYA 1OWRM 4QRRD 2XQYK 1SHMA 5C08E 1KGCD 3W39B 3IXTA 4OIAA 2BY1A 1MELA 3CX2A 3CFBB 3ZDYE 2FD6H 3TIEB 3AMLA 1G7PA 1NSNH 2J4WH 1LWRA 1JZ3A 4ZFZB 4I18C 2A6DA 4ORGB 4PLOB 5HVFB 4GQPH 1IT9H 2HWZH 3FL7A 2ICWA 4GG6F 4OZFH 4YHLH 2P24B 4MVBC 5HYJB 1YYLL 2BZDA 4H20L 5K33A 1U8NA 2F5AH 1UWGL 4MJ6A 3VFUA 4FABH 1RUPH 5B21A 4JQVC 1ITBB 1HDMB 5EIIA 1G6RA 1JZ7A 3UPRB 2H2PC 2QR0A 4D9QE 2P5EB 1ZGLP 4DJMA 5FDYA 1KFAH 1S7TA 1LP9F 2G75B 1UWGH 3KPLB 2YS4A 4Z0XA 2CGRL 2X1WL 4P3CL 4WUKL 2J8UA 1W0WA 1FHGA 1QFWH 3VE0B 4F7TA 4PGBA 1HSAB 3MA9L 3HRZA 4HFUH 4X6EA 1FN4B 2FJHA 4PD4J 5SV3A 5JW5A 3MSPA 5SWZA 3DBXB 3RIAF 2GAZB 1HWGB 1Z9SA 2R8SL 4UINL 1JHLH 2WINA 4XRCA 3CSBA 3W11D 2Q86A 3V9FA 4G8IA 3U7YL 4NP4H 3B9KC 3TEUA 1R24A 3M8OH 3VGAC 4DKAA 5J1AA 4G7VH 3MRKA 1V8HA 5IB4A 4UINH 3OAUH 4XMKH 4QYOB 4ZNEA 1OW0C 2DTML 2FZ3B 1I4FB 3LCYA 1HOCB 3ZKMC 5FXCH 3HUJB 5CZXD 1SJVA 2WQRA 2V9TA 4X7SH 3RWFB 3F12A 1A14H 3P4MA 3MRLB 1YEJH 3QEGH 3RWGB 3WHXA 4DEPB 4PJBE 4HKJA 5J13B 4AIZA 3HMWL 4WUKH 4QY8B 3UYOD 5BOZG 4QF1B 5BRZE 3FHQA 3T0BA 5F1OB 2QLVB 3NIDE 4MNQB 4PYGA 4LLWB 3OKMA 1E27B 1DBAH 3RPIB 3G5YB 4LCCA 1Q72L 4JKMA 1INEH 4KGLA 4TTDC 3STZA 1DQTA 4S1QL 5ID0B 1HYSC 1AGBB 4ZSOB 2X4TA 4D8PB 3MXVH 3CDGB 3VH8B 4YHYB 1TCRB 4LLUA 1KCRH 1RIUL 5CJ8A 3RNKB 4PLJC 4WU7B 1QLEH 4KKLC 4JN1L 3PWNA 3KHOA 1WZ1L 1JGUH 3B3IA 2MJWA 2MPAH 4EI5D 1Q0YL 3SKOA 4DGYH 4PG9A 3ARWA 3L7EB 5CBEA 3O6KH 1SMAA 1ZA3A 1GGIH 3VGFA 1CG9A 4KC3B 3P4OA 3UJJH 3B83A 1S9VA 3C60C 4X99A 1LDPL 3MV8E 4OJFL 4TSAH 5TJWK 4KH2A 2IANB 5ECJE 4MNGA 3SKMB 1SJHA 3DUSA 1N5YL 5D7LA 4H26B 4FQ2H 1H3VA 5CEZD 1EFXA 3IJSB 2VL4A 5D2NC 3EFFB 3EDDA 4OLVH 4WI8A 2DQHL 3O6LL 4NGHL 2XICA 3U1SH 5HBBA 1BZ7A 4WUUB 1Z0NA 4OF8A 4NO2B 3UBXI 3WFDH 5F3HA 3I2CH 5TDNA 4PFEA 2J8UF 2JCCB 4NNYA 5EBWA 2XWBB 4LLAA 4TSCL 1RZFH 3Q3GB 4I3SH 1U92B 1KTLA 4BH7A 3LQAH 1MCWM 4GUPA 1AY1H 1JPTH 4ZAKA 3WS6C 3IVKA 5EZIH 3GKZA 3WUWA 5GRXG 3WNNA 4JRXB 1VFBB 1IKFH 3SGEH 3PNWA 4JG1H 5A40E 2ICEA 1DBKL 5LG1A 1MSPA 1ES0A 5TE6H 3SCMB 3I75A 3QDHA 4WJ5A 1LO0L 1WTLA 4UTBH 4XCFL 1XF4A 2YPLA 1KUMA 2GSGA 5EG6C 3AFLA 3FO9A 3L95A 2WP3T 4XCCL 1MY5A 5LGHH 2JB5H 1A64A 1I3RA 4HK0A 4JREB 1OT1A 3ULUL 2FB4L 3K2UL 3C2AH 3MV9E 3TCLA 5MP6H 1NUFA 3LKOB 1FC2D 4RWHA 1KPUA 1BPVA 1XH3A 4PJDE 2F19H 3HZVA 3MRIB 3HAEB 1GC1L 5D1XB 5ISZB 5C0JA 5ALBH 4ORZC 4DN3H 5F8QC 5CIPB 1IGMH 5CINL 3MRBB 2AXHA 1S7XA 4LHUG 1T0MA 2EDKA 4XH2B 1MLBA 1ZGLM 1I7TB 4EBQH 2DM3A 4TSBL 2DQGL 5EN2A 1N2RA 2W9LA 5FOBB 1IBGH 2FEEL 3MXWL 3T2PA 1BAFH 1ETZA 4ONGL 4OF5A 32C2B 3B43A 4NKDA 4YPGA 1AKJA 2FECI 5E2TL 3QFJB 1BOYA 1ACYH 3SN6N 3OGOE 2NNAA 2IEPA 2I07A 4YX2H 3MRNB 2E9JA 4Z95H 4HCRL 1QFWI 3C8KB 3EO9H 1N59B 5L88L 4NUGH 1A1MB 1TQCB 1RY7B 1NUNB 2ZUQC 1A2YA 1T03L 1W72H 3OPZL 4YZFE 1AH1A 1G7HA 4ZNCD 5LGJB 4YEFA 2R39A 1X4ZA 4OBRA 3T4AB 2KZ1B 4MAYD 1D9KD 3FB8A 2A74B 1EK3A 4YGVB 2XPGB 3MRQB 2W07A 3QXAA 1EEYB 3KYKH 4O5LL 1MFBL 4X8JB 2VH5H 3PWJB 4NRYB 3KLSA 2XRAL 1LVEA 3OKOB 2DBLH 4KRPC 5HI4D 4PJXE 1QLFB 3DVNA 3VCLB 1TMCB 5IFAH 1J5OH 1BJ1H 1CK0L 1NCDH 3QCTL 2HVJB 5LAXA 4RGMB 5EA0H 3TPKA 1J88A 1CVSC 4TVPD 5IM7A 5KSBE 4K8RL 3QFJD 4PUBH 3PHQA 2D9CA 2XFXA 3KYOA 3X11A 4YUEH 3MNVA 1M4KA 4KROB 4FFZH 1UVQA 2HLAA 5ITFB 4F37F 5MHSE 2YK1L 4ZTOH 4XX1E 1WBXA 4N8VG 3GJEB 4UBDC 2Z8VC 2DRUA 1MF2H 4PYHA 3BKML 4WW1B 3DIFA 3U6RB 1EAJA 4TOYL 2Y36L 4TNVK 3EDEA 4X6FA 3AMKA 1OP5H 2WWMD 5TH2B 4N1EA 2AJVH 3OKKB 4CVXA 1NCNA 4HS6A 5HYSG 5JXAH 4CBPA 2BCKB 3ZKQD 3CCHB 4NO5A 2AJZB 4DCQA 1KEML 2BNQA 1AJ7L 4PJGF 2NY5C 5CSZA 4JZJB 1TVHA 4LVNB 4MHHG 1FORH 2V5SA 1OSPH 2OI9C 5C1MB 3S96A 4CAGA 1U3HC 5IVOA 5KANI 4V1DB 4PG2A 4J3SA 5DVOA 3SY0B 4IRSC 3FMGL 3BP6B 2BNRA 3NTCL 4ZOBA 1W72A 1NCDL 1VKXB 5E99L 1UWXH 4LIQL 2IADB 2PO6B 2IGFL 3MRCB 5ITBL 1FH5H 3RDTA 3HI5L 1A8JH 4ONFH 4DKFH 2CLRB 2YPKB 4OZ4B 4CU8A 2Y72A 5CHNB 1ZLUK 1FFNB 3PWPE 3C09B 5E99H 3SDCA 4Z7WA 4M7LL 3OKEA 4U1JB 1CDJA 3O8XD 2I60L 3LQAC 3VFRB 2X4UB 4U0QB 4JHWL 5D71H 3MBEB 4OFYA 3O6MH 2O26U 3B2VL 4QHUB 4PIRF 3HRPA 3B6SB 1P1ZB 3S3JA 4MNQE 4Y16C 1IGCL 1NDMA 1OP5K 2HH0L 3KR3H 4KUCD 1H8SA 1WZLA 4PJBB 3A6CL 1UQSA 4Q6IA 1I1CA 3F7VB 4Q7DA 1MRCL 4HCRH 4YK4B 2VKXA 3ESUF 3WBDA 2M26A 1KJ3L 4PBXA 2VERN 4G8EA 2FCBA 2FGWL 3MFFB 1IC4L 1P5VA 3L3JA 3MV7B 2QADB 1DL7H 5DD5L 3VRJA 3L7FB 1NEUA 2KL6A 5F9WC 2F54B 4JJ5B 5FKPA 4F33B 5JW4N 3MO1B 5TDOB 4MMZC 2H1PH 2DYPA 3H2WA 4JY4B 1X6LA 3G08A 3FRPG 5BVJA 5SX5K 1C5CH 2BVOB 4HH9A 4LLVB 2V5YA 4I0KA 4C55A 3MLSL 4E5XB 3O4LB 2DQDL 3S5LA 1AO7B 4HUVB 4W70A 1NEZG 5I8CB 1PX4A 2BMKB 4OCWH 4PRBA 4BFEA 5D1ZB 3VRLE 1DSFL 2Y23A 4Y4KA 5F9JA 5T5FH 3IDGA 5DQ9B 1A7PL 4JFDE 2ZSWA 5TQ0H 1IEAA 4X0KA 2JJWA 3GMQB 1P7QB 5DFVC 2BNUA 1JWMB 1KULA 3QH3B 4HD9A 4KQ4H 1YEIL 2F53E 1LO0H 3EOBA 4Y4FB 1XCTA 1JPSH 4KJPD 3QIBA 5EORL 2OTWA 4NUGL 5DA0B 2Y06L 1XF1A 2CRZA 2FX9L 5T1MA 5D2LA 5BS0D 1BFSA 1UENA 2Z31A 3FTGA 4LAQH 4ZQKB 1AR1D 2ITCB 1J8KA 4LLDA 5JPMA 3F7YA 1QFUH 2OM5A 3FFCA 2DKMA 4NCC2 4UQ2B 3TNMA 5AD0B 2R23A 3GUTB 2HJKB 3VI4F 3QHTC 3DXAA 3PF2A 5C08B 1F97A 2GUOA 4BK4A 5JXEA 1L6XA 4WO4C 1ZHNA 3QCUL 3MRRA 3G9VA 4KHXL 1K8IB 4DTGL 2IH1A 4W6XB 2IPUK 1BOGA 4NO3B 5IV2B 4TSBH 5IVXE 1A7RL 3TFKC 2BNQE 4LCIL 1KB5L 4O4YL 3L6FA 3ARFA 3KNBA 3S97C 3VG0L 1VFUA 2ILLA 2QADD 5DDHA 5JIHA 3NFNB 1OAZL 5E8EB 2HLFC 3WFHB 3EYFA 2BJML 3DV6A 4MS8C 3RKDD 3QDGB 2RJMA 4X6BA 4P3DB 1J0JA 1NBZA 2FB4H 3QB7C 4N0UE 4MQ7A 1UCBH 3ROLB 1DDHA 1JNNL 1NPUA 2GY5A 2ATKB 2R2BB 1CFTB 1QA9A 1TZHB 4PJDF 4WNQA 1VCAA 2R0WH 3MCKA 5EOTB 4QHLA 1AXSA 4MD4A 4JFZL 4X80L 3NMEA 3TBYB 3FFDA 4XC1H 5J9PA 1F4HA 3K4DA 4JZJC 3IETB 4LVNC 4H1LA 3SE8H 2VLKD 1AD9B 1Q9WA 2R9HC 1BQHG 1HXYB 4QRRE 3TZVD 2R0WL 3LKRB 4J8RB 2J1KA 4NUJA 2E8YA 4P5TD 5DS8A 5HD8D 2C26A 1OP3H 2RAMA 12E8H 1RIHL 3O8XA 1T83C 4PJ5B 3TBSA 5CZXC 1Q72H 5I18L 4M6OH 4ZO7A 2BSED 1FZMB 5D5MB 2DAVA 1YDPA 1BBJB 1MVUB 4AK1A 4LLYB 1A7QH 4JFXB 4RDQG 1MQ8A 2FJFA 3BDYH 2HKHH 4GLRI 2X7LB 4YHZL 3FN3A 4JFEB 3GSVB 3VRLF 2COQA 4U31A 4Y19B 1T5WB 2OL3B 2H8PA 5DJAA 3JWDL 4Y16B 2YN3A 1K6QH 1DEEB 5D7LE 2DN7A 2RBLA 4NIKB 5K9KA 4P0DA 4MQXD 2D7NA 3S5LG 1MPAL 1P9MA 2YZ1A 1CFNB 3UJJL 1AHWB 5C0AD 4YK4C 2W65A 3VJ6B 1A3RL 1MNUH 4OKVA 4TTGA 5DEFA 4MQSB 4EZMA 4L8BA 3FN9A 5A16B 3WIHA 1JTTA 2MFNA 1FH5L 4YHIB 3RWCB 3S8WA 4X4XB 4PR5B 5FHBH 2HT2C 3GSQA 4AYFA 4YZFF 2DMBA 2YUZA 3C5JB 5IJKA 2DIAA 1MFCH 5MEPA 1QSFB 3I6GB 1N7MH 3NABH 4XP4H 2CGRH 4P3CH 1TVDA 3THML 5EZOH 5SX4H 4C56B 5CBAA 1A47A 1E4XI 1IGTA 1JGEB 4XP5H 5I66B 1MFNA 5CS7A 5IB1A 1INEL 4NQDA 1P4BL 3OXRB 3C5ZD 3FONA 2OMNA 5EU4B 2C3WA 4W68A 1RUML 2XACC 5A3ID 3EYVB 3N85L 4PJCF 4M6MH 1IGJB 1KELL 3VD3A 1U8PA 5FM8A 5B39A 4X7SL 2C3VB 1KJVB 1A3QA 4X6DA 3QIUB 3MUGA 1D9KA 3UTSB 3D39A 1FYTA 4F3FA 4BM7A 4WO4A 3Q2CA 2GFBA 1JPGA 4U4BA 5DJ0B 1L9NA 5A2FA 2H1PL 2WK2A 5B38G 1JZ2A 1G7IB 3H3BC 1RIVL 3C5SA 3E6FB 3PGDB 4NC1E 3FQNA 4PP1D 1SEQH 5SWZE 4NO0A 4KJYB 2P49B 1DL7L 5I8OL 35C8L 2B4CL 2VABB 1CTOA 3QQ4A 3E1F1 3VFPA 1L7IL 2QBWA 4U0RB 1M7DB 1AIFA 4NBXB 5DUBB 4L4TE 4B53A 4LEOB 5ISZE 3H9SA 4WO4B 4F3FB 4PJGE 1FYTB 1NCBH 3I02B 4GH7B 1UB5B 2DF3A 2JB6A 3DI3B 1WGOA 1JHTA 4X6DB 1U8PB 3O0RL 2PTUA 4MB5A 1NMCB 2X9WA 3IAPA 2APTA 5EUKA 1CIDA 1I9JH 1JTOA 2I60H 4MJ5A 4F2MB 3KPRD 1QVOA 4DZ8A 3GBMH 1BVZA 4H20H 5DUPL 3FONB 1OT2A 3PQYB 4O02H 3OXRA 5DHYA 4KI5F 5FYKD 1QO3B 1IT9L 4OGYL 1H3PH 2AI0L 4ELMF 2R9HD 1JGEA 1F2QA 4UDUB 4GSDH 3UTPE 4NFDA 1BFOA 3VWKB 5D7KD 2PYFB 5DVMA 1QSFA 1UWEH 3I6GA 2F53D 4OLYL 1YECH 3VH8G 2DIJA 3BZEA 1NLBH 3AGVA 2OZ4L 1OWWA 2OP4H 3CLEL 4OQTA 3K80A 3QHFH 1OAYH 1JNLL 3PDOA 4Z6AT 1A4KA 2GK0B 3FFCE 3BXNB 4BZ1H 1OGTB 4Z76B 4OKVB 2CLZA 3PHSA 3MLWL 3OKDA 1Q9KA 1AHWA 2F19L 3GGWA 3WNPA 4D3CL 1P2CB 1J9CT 1YQVH 2V7NB 3GSXB 3MLRL 5L2KE 2BK8A 4JPWL 4MA3B 1FFOB 3BZDA 2YZ8A 4BQCA 1DEEA 3FHAA 1LP9B 4M03A 5MEND 5DJ6B 3E6HA 2OL3A 2J88L 1RZGB 2X70A 5ADOL 1FO0A 1ZT7B 2IMMA 1BWMA 2X7LA 3EO0A 2VOTA 4XNUH 2FJFB 2OCFD 1FLRL 3LMJH 4LLYA 3DMMB 5B38A 3ES6A 4C4KO 4P9HH 1OAXH 4HWEL 2CJUH 3DV4A 4HIIB 3ZL4L 2IQ9H 2X42A 3KS0H 3MUY1 3TA3A 3MGOA 3P11H 4PJ5A 3NIGF 4V2CB 2IBZX 4NC1C 4R4NC 1FLRH 2KQNA 5C0GB 2X05A 1BX2B 2VLLB 2F53B 3WO4C 4WU5A 5CD5C 1HXYA 2P8PA 1AD9A 1Q9WB 3UYPA 3MRJB 2ORBL 2CRIA 3FFDB 4M48L 1P9MC 1S7VA 1CS6A 3U1SL 1IAIL 3L5JA 5FFLA 1X7QA 4RISL 3CAFA 4G3YL 4WNQB 4RMRA 1QA9B 3PGFL 3ILQC 2ENYA 4OCMC 4QTIL 4KHTL 4KVNH 2VDOH 1JYNA 4HXAH 3IDXH 3V6FA 4MQ7B 3VXUB 3HC4L 5HVWA 4YIQB 4PJHB 1OAYL 4X6BB 3QDGA 2EEBA 4N8CH 3BQUB 5SWSD 4MNGE 1P4LA 2XWJB 3OV6A 1GGIL 4OLYH 3D39D 1Y0LB 1ZA6A 5A2LH 3KNBB 3FB7A 1HEZA 4FQHB 1ZVYA 4HGKC 1YEGH 4W4OA 3BHBB 3ULUE 3NA9L 3LRSA 1MIEL 3IDIA 1ZKAA 4JAMB 5BS0A 2FWOB 2BSRB 4RX4A 5IESH 1EJOL 4ELME 1C5DA 1HHIA 2GUOB 3TH2T 4OI8A 3H42H 4AT6B 3DXAB 3HG1D 1BVKA 1EO5A 2D2OA 3MLRH 4UQ2A 3PGFH 4U49A 3KXFD 2CDGA 5ICZB 4BQ9A 5JPMB 1IAIH 1G7MB 5F8RC 1D5ZA 1PYWA 3FTGB 3U7WH 1J18A 5DRXB 5T1MB 1T6WA 5FK9B 3AS2A 1CFBA 4Y4FA 2JIXD 4ESKA 3BPOB 3RX5A 1LO5B 3VXRE 3GMQA 5HYJE 2RHEA 4X0KB 4Z7UB 1IEAB 5MENB 1WK0A 4NM8L 1WWBX 4Z77A 1PBYA 3OR7B 4P48A 1NMCC 3LSOA 4HUUA 3IDGB 4I0PA 1I8MA 5EZIL 4WFGE 2IALB 3OR6B 1OAXL 3QI9B 4P9HL 3VXUD 4ERSH 4PRBB 4YBQD 3GHEH 1A9EA 2GJ6E 3AC0A 4U2YA 4PREA 1FNEA 1HILB 3S5LB 3SDAC 1CLZL 2ZOLA 5E24E 1RURL 4LLVA 2J88H 2A9MH 4HH9B 4JFFB 2F8OA 1B0WA 1EHLL 3ZHKA 2CRYA 4BELD 3LD8B 1LHZA 3VWKC 3WFDL 4UUJB 1QZ1A 3DROA 4GG6A 2X9XA 4HS8L 4HJGB 3CVHH 4F33A 2DQHH 2F54A 2QQNL 2CPCA 2MCPL 3L7FA 4H8WH 1RZKH 1EDQA 3EYOB 3N9GH 5IFHH 5FYJL 3PWUB 4MSWA 3MACH 3EYUH 1R3KB 3RL2A 3B8YA 3TBVB 1ZOXA 3KPRA 4OLZH 4TSAL 3K74B 2CIKA 3QXDB 4UNVA 2BY2A 5BCAA 2XWTA 2JK5A 3DSNA 3FO0H 5AZ2H 1UQSB 2GEEA 2XNAB 4EIGB 5DUMH 4O58H 2ICES 1P53A 4ZPTA 1OQOA 4Y7MA 2XN9B 1JWUB 2FL5A 4HPOL 5JLZB 3DO7A 1Q0YH 4P2RB 5EC2B 4QHUA 3QQNA 1TXKA 3RIAK 1IAOA 2X4UA 3QUXC 1FL3B 2B5IC 3TN0B 1F90H 3SQOL 1NCWH 3CSGA 1T20B 4YR6B 2VLME 3BYTA 4POZC 3SDCB 1A9BB 1UA6H 3EOAB 4OCSL 2EZ0D 1NC4B 5B8CA 3AAZA 4KUZL 4M6ML 4K2UL 4BUHA 5J06A 4OCYH 3BP5A 5J11C 2VXQL 1H8OA 1KN4H 5D96B 3EHBC 1A0QL 4NNPL 2VDPL 3T2QA 1OLZA 2BNRB 3BP6A 3WXVL 3L9RA 4XC3L 3PABA 2CH8A 5T33H 1W8NA 1YEJL 3QEGL 1T5XA 4ZUTB 1KENL 2XTJE 3U9PL 4Z7WF 2X4OA 3BWAB 1KG0B 2AJZA 3WIHL 5F7LB 1MFAL 1IAMA 1SQ2N 1WCQA 5I8OH 4OD3H 4NYLB 4HS6B 5TH2A 2FHFA 1ED3A 4WW1A 4LQ1A 5DVKA 4P46A 5AG8A 3C6LC 3RGVC 5H35B 4CJ1A 1T1ZB 3C6SA 4GMTL 3GM0A 4YGAB 4CNIA 5CZVL 4XAKE 5DK0B 3RY5A 4V1DD 4O2EA 1F6LL 4FQ1L 1MCRA 1TNNA 3CFEB 3X11B 1F3JA 2XFXB 3PHQB 1CT8B 5C92A 3V0WH 3IDJB 3FN0H 4CUCA 4X7CC 4KRNA 4G9FD 2HVJA 1WIPA 3PWVB 4O51A 3L3OA 2EDRA 2VAAB 3MODH 3QZWA 4AH2B 2HKHL 1OGAA 3VCLA 4EI5C 4MCYA 4TULH 5DK3A 4AIXA 2P7TB 5T3XD 2V2XB 3OKOA 4P2YA 3WFCH 1CXHA 4K3JH 1HQ4A 4PJ7E 2IWGA 4X9HA 1FQ9C 3UBXA 3BZFB 1EEYA 1YYLH 4GKSB 1IL1A 4IHOA 3ULVH 3QRFM 4Q74A 3SE8L 1NAKL 1UM6H 4FZEH 2CDFB 4GMSH 5LGJA 3UTOA 5IQ9A 4NT6A 5FYJU 2GYSA 1NBVL 4IJ3C 4WWID 4JJHA 2DOCA 5LBSL 2EKSB 4GRWE 3K8LA 5DQDH 4I48B 3C8KA 2BHUA 4JM4L 1DQLL 3ZDXE 4JFYB 3CJJA 4ODUA 4HULB 1OPGL 2FBJH 5JUEL 3QFJA 1J1PH 2K7PA 4LSQL 4YPGB 3L3GA 3DX6B 4GKZA 4HIHA 5J6HB 5HGAA 3SDAB 1ETZB 3AB0C 5CP3A 4DK3A 5JTWA 5JZ7C 5FOBA 4XPBH 5FM5O 2J12B 1JK8B 2X4RB 1TTGA 2YD1A 1CD8A 5HY9B 3BAEH 3W9EA 1EO7A 3FB6B 1X6NA 2YD2A 5I1JH 2ERJB 1OLLA 4I5BA 2YSSA 2JJSC 3K81A 2OS7A 5ISZA 1RIHH 1MWAH 2BSSB 5DRNA 5KSAA 4M1CD 3SEPA 3ZKNC 1AQKL 3LKOA 4RIRA 5HDBE 1EJ6A 1ODAA 4J2XA 4QXUL 4OI9A 3TCLB 3BJLA 4GAGL 4M43L 1NAMA 4HUMB 4ZFGL 4QRTA 3MBXL 4FQXD 3D1MC 3HI1A 3NN8A 5I30L 4GBXD 5CAYB 3QWOA 4HBQA 4OGZA 3MYJA 1QSEB 2UZXB 2BY3A 5E2UH 3U4AA 1QSEA 1R3IH 3MYJB 4KPHL 4WJ5B 3BD4A 1FNSH 3EJYC 3R1GH 3QWOB 4JY6B 4NFCA 2G9HB 3I75B 2BRRL 3SCMA 5C8JA 2OTUA 2MOVA 2ICEB 1VDGA 1II4E 3ZZ1A 4QRTB 4TNWF 4LBEB 1UC6A 2HLFD 1W0YT 4JRXA 3LAFA 4X5XB 3PWLA 4JDZA 4OM0L 3RJQB 4GW5B 2PO6D 9CGTA 4L4JA 3PUCA 5I9QC 3GIZL 4NKMB 5AYUL 2BSSA 5DRNB 3DHJA 5HHVL 5EBGA 5F7WC 2UZIL 5HI5D 1KTLB 4BH7B 1U92A 5KJRL 3Q3GA 2KQMA 4L8SB 3SBWC 3X3FL 2FO4B 2YSSB 1INDL 1FRGH 3KXFE 4KI5C 4I5BB 4I77L 1IGCH 2JCCA 4KK6C 4U3XA 4U6XB 5CJQL 3FB6A 3VDBA 4NZRL 3P77B 1WWAX 3B2VH 4DTGH 1DBJH 4PTUA 5D71L 3KLHD 3GRWL 1F11A 1UWEL 4NN6C 4DW2H 3QWQB 1XT5A 4OZFG 2DLFH 1GIGH 5HGAB 3SDAA 3REWA 3UROR 4K9EH 4G9DA 3DX6A 3QPQC 1QYGL 4HIHB 3SO3C 5J6HA 4LGPB 1QKZH 5EBLA 4GXVL 4ZO6A 3IJSA 4YC2C 5CJXA 4H26A 3HC3H 3P9LB 1NLDL 1JUFB 4ONFL 4MNGB 1VADA 3QYCA 4HBCH 5I1HH 5FIEA 3VWJB 3RVXC 4X99B 4KKCD 4PTTB 4P9MH 3O2DH 1CG9B 25C8H 5DJXA 3ARGC 5HDQL 3IT8D 3KJ6L 1F8TH 2EC8A 1RMFH 4NT6B 3WFEH 1VFOA 5IQ9B 3MLVH 4LMQI 1RU9L 2X6MA 2AV1A 3IAQA 4ZXBB 5ESQA 1RFDL 4U1NA 3PWNB 4WFHD 1U9KA 4HG4K 3JWNC 1F58H 1L0QA 4BH8A 4WU7A 3RNKA 5FYKU 3SQBA 1TCRA 1S7WA 2E3VA 3RZCA 2V2XA 3DNKA 1OGAB 5K9QG 4AH2A 5ERWA 1E27A 3QZWB 3AM8A 2Q87A 4P46D 4QWWC 4CMHC 1EO8L 4YFLF 1YEHL 4XWOC 5ITBH 1TCMA 3WSQH 4HKJB 3LKQB 5E6ID 3MRLA 1JWSA 1KB5A 3IFLH 1WBZB 3IFOB 4HKZB 3RWFA 3CFEA 4Y5YC 5EH1A 4G6KH 4Y2DA 3SE9L 1HKLH 2XTJD 2NR6C 1J5OL 1OSPL 2FZ3A 2ZNXA 4CVWA 1CLOH 1BVLA 4XTRC 3RVTD 1JMXA 1MCDA 4KJWD 4R96B 3ZTNL 1S7SA 3LHPL 3NCYP 5J1AB 1JGVL 2W0PA 4P46B 5E4EC 5FHAH 3UP1A 4F8TA 4YHNB 1QPXA 2DTSA 4XI5D 1OD9A 4LCUB 5D7IF 3OAZK 4LSDA 2Y7QB 1P7HL 1P4BH 1J8HB 1WVZA 1RFDH 2VC2H 3DBXA 3VXSE 3B9EA 1KG0A 3WJLC 5FHAL 4M5ZH 4CVUA 4X6EB 3S34H 5I19L 3MRFA 3HRZB 1CDUA 3ARED 1T5XB 1HSAA 3CH8A 4XWGH 5T3ZE 4MWFB 1MCEA 3FAWA 1E28B 5I1EL 2AV7B 3RTQA 5KZCD 2F15A 1MIML 1EUUA 5JQ6L 2XIDA 4L4VB 2F9BT 3CDYA 1S7TB 1DANT 2G75A 5I1HL 4BQ8A 3K8MA 2HVKB 3V4PL 3TJEH 3O3AB 1T21A 1HDMA 5B8CB 2ATPA 4FFWC 3BN9C 3PQYE 3VWJD 1PG7X 3HZYA 3MOBL 4KK5D 1T20A 5CCKH 4HC1A 3KYKL 3FMGH 2DLFL 2ZJSH 5CUSH 5GRUH 5HYEA 2ICWB 1G9NC 1PW3A 3RX8A 3FJTA 4LHJB 1U3JA 1FSKB 4P2RA 2DQGH 2A6DB 5JLZA 3DO7B 5E9DE 2FL5B 2XN9A 3PV7A 2CMRL 3EZJB 4FMKA 3T77B 2NXYB 1W72L 2E6QA 3OPZH 4CDHA 1G7PB 2EH7H 4LASH 4FFVD 2XNAA 3P0YH 4X7DC 5HYFA 2XWTB 3HR6A 1RMFL 2APBA 1NFDA 1CI5A 5ICXA 5ISZD 3O2DL 3ZLQC 1R3KA 5FUOH 4MJ4A 1OF2A 3VD4A 3CX5K 3PWUA 4MSWB 3SKUD 2YK1H 2X2YA 3GSWB 4Q97A 5TE4L 4KAQL 4LVOC 3UTPD 2OMBA 4N1HB 1EZVX 1U8OA 4L8SC 2C5DC 1BFVH 1FNAA 2VXTH 4KPHH 1Z9LA 2XKSA 2NY5L 4PGDA 4HJGA 1IBGL 4GG6B 1QKZL 1O5DT 2XN9D 1A7BA 2XA3A 4UUJA 3LDBB 3UTQB 4F58H 4GO6B 1P7KA 3F7QA 2ZOKB 5E6ZA 5DJ8A 4EBQL 3KPRE 3ARDC 4DW2L 4UIKL 4M1GH 3FT3B 2VDLL 1A21A 4OCNC 3OGCA 2DWDA 4LFHD 4OFKA 1Q1JH 2EYTA 4PJXB 1FNEB 3OF6A 1A9EB 3WV0A 3CSPA 2A6JB 4HGWA 1YPZE 2BVUA 4I0PB 4FFWD 1W2KT 4HUUB 1NC2A 4PJ5D 2EDHA 4RAVB 4BZ2H 3BGFC 1PAMA 3EDKA 1W0VA 1HH9B 3VA2C 1X9QA 3WJLA 4XP1H 2R29L 4DK6A 2KZWA 3GSNH 4WCYH 1BQLL 2HRPL 3WLBA 4YXLL 1HI6A 1GAFH 1KLUA 5F88A 5FK9A 2EIZB 2IH3B 1A6TA 5ILTH 3EO9L 1NFIA 3IRPX 4Z0BL 3MR9B 5SWZD 2YMXH 3ARBB 3RDTC 3LEVH 3BKJL 1G7MA 1QACA 2Q7NA 1F3RB 1AY1L 2C1PA 5GGSA 4HAGA 1QBLH 3M1BB 3LH2L 1CFQA 5T3XE 4WW2C 4QRQA 1KF9B 2NTFB 1DVFD 2DQTH 3UO1L 4TSCH 1G9MH 4J4PC 4AT6A 2VDQH 1EGJL 1MRDH 5JDSB 5HJ3B 3N1GC 1C5DB 3M17A 3F62A 3LQAL 4LSRL 4F9PC 4RMQA 3V5HA 5HHOA 2A9NL 4HXBH 1LE9A 1J12A 4MAUH 2YHGA 3UTSD 4U6VH 3BHBA 4TTDD 4JN1H 2QTEA 4RDQF 1HEZB 4FQHA 1X5IA 2G60L 4QEGA 4DN3L 1DP0A 5I75C 1ZA6B 1Y0LA 1XZ0B 4KKCC 1DBML 5T3XH 3ZT7A 4K7PL 2DQUL 1B4JH 4ZUUA 5IVNA 1V7NH 2P45B 3BQUA 4JM2B 1B90A 4PJHA 3UCRA 4OD1H 1VEMA 1PLGH 3EJYD 5LGHL 4UMGA 3VMPA 3W81A 1AGDA 3KVQA 5AAWA 3T4YA 4DGYL 3V0WL 1K4CB 4JHBA 1ZS8B 3TJHD 1HINL 4EVNA 1TJIL 3KPPB 4HGMA 1FDLL 1QNZH 3EZ8A 4UIKH 1A4JA 5FGBA 1V5JA 3CXDL 4W6WB 4H0IA 1DVFB 2E7HA 1YYML 1D7FA 3MRJA 3FQXA 2K1MA 5GZND 5CWSB 4P2RE 2P8PB 3RVVD 4ODSL 4JQXC 2VAJA 5EU5A 4E42B 3QR2A 1BX2A 2N7AA 4U1MA 4A6YH 3WL9B 3CVHB 4AEHL 5D2NB 4JN2B 4TVSa 3MGOB 1JYVA 5F89B 1MRFL 1RIUH 1R3LA 5EWIL 4QKXB 1MRCH 3O11A 4Y1AD 4FQXA 5B38B 2DQEH 3DMMA 3EO1A 4HJJH 5GRWA 4P23A 1A3LL 5M95B 3GI9L 3C9NA 3VXNA 1XGUA 1M1SA 4Q9QL 5JMOC 1BD2A 1ZT7A 1MJJB 4WHYH 2HH0H 1RZ8B 4FQIL 3HNTL 1U8QB 4NZJA 5CILL 4M3KB 4GBXB 5DJ6A 2EO9A 3SDXA 5J1SC 5FO9B 3S7GA 3KPNA 3QNZB 2AEPH 1C7TA 4MA3A 3NCJH 2BERA 2V7NA 1MJ7H 4JFFE 1LDPH 3BEVA 4NP4L 3K0WA 2AQ2A 4YQXH 4WWKA 3OKDB 3SCMC 1LE5B 5C70A 1A4KB 1WCBA 2GK0A 2QKIA 4ETQB 1TFHA 3S6CA 4LGRB 3NACH 3TN0D 4LEXH 1OAUH 5HYJD 3U2SB 5C6PB 4JFFD 4ZG1A 2FO1A 1I1AD 4GKOA 4UTAH 5GPRA 2I5YH 5KSUA 3U9PH 3LDBC 3VWKA 5F7MC 4WFFD 4ZODA 2VITB 4APQA 3VFOA 5T33L 4UDUA 3W0WA 1B6UA 2DWEA 4HV8B 4M7KH 1U8LA 1QO3A 1FZKB 5DHYB 1RZKL 4DOHE 2DQIH 1QVOB 5D7SL 4K3DH 3MV11 4JQXA 4Z7VF 3X12B 2GITB 1KN2L 3D39E 3GRWA 1WUNT 3UJTH 5EUKB 1CL7L 4S1RH 2ADJB 4XTRD 3RVTC 1ZXQA 2W0LA 3OL2A 5HHNA 1S9YA 4Q6IC 2IPUG 4NDMB 2R1XA 4P2QD 2A9ML 2JB6B 2CR6A 3LS5H 4LSPH 5CZVH 3IKCB 5FEBA 2ID5A 4HX1A 3H9SB 5CMAA 1Z3GL 4LEOA 2XTJC 4G9FE 3O3EB 3G5VB 1JL8A 2YD8A 2VLKB 2Z93A 5DD3L 1JE6A 3O3UN 3CSYB 2VABA 4HFWB 4XMLH 1J10A 3UTZB 4J12A 4L3EA 5C0BA 5KZCB 1MCWW 3WFZA 4KJYA 2XKNA 4JO1H 5C0CD 3BPLB 5E00B 2N1KA 3U0WH 3C5SB 3QEQB 3EYSL 1G7IA 3VXUE 2LV4A 3K1KC 2P44B 3LPWA 1F58L 4K3HA 1JPGB 5FYJH 1OTTC 3D0LB 1QFWL 3D39B 5IKCA 3NIFF 1A1OB 1BMGA 2AVGA 1F4YL 4JY5L 4MJIB 5CP3H 2CO7B 4PJHF 4Y5XB 1HE7A 4QXWA 3ULVE 2GI7A 3TH4T 4Q9QH 3CMOH 4F8QA 3IFNL 3JBG7 3R0MA 2Q20A 4MDIA 3V5KB 4FS0A 2VXVH 1VENA 5FYJE 4XVSL 1FZOB 4P9ML 3V5DA 5GSRB 3OKLA 4NQCD 4AY0A 1GZQA 4XVUC 4P4KC 1QUNA 4YDLC 1MWAA 4NQDB 4HBCL 3S36X 5IB1B 3S9DB 1WLHA 5C3LD 3D0VA 4G7YH 1HIML 1YNKL 3F5WA 4CN6A 5EU7C 5I66A 2VSCA 5CBAB 5C0DA 3ZE2F 1HCVA 4FQJH 2R15A 1MH5A 4JFOB 5E8DH 1YEGL 3VFTB 3HE7D 1I75A 2R2EA 1ZANH 2ZP0T 3C5JA 1DVFC 2EE9A 2VLRD 1CZ8L 1ZLWH 2DQFB 3ECBB 5LGKA 3GNMH 4FQLL 2QL1A 5KVEL 4LDOB 5D7JB 3H3KA 3NCBB 4TVPE 3QRGH 4NO0D 1BWWA 3L3KA 3GSNB 4NNXB 5D6DA 1E4JA 5KJRH 2ICWJ 4H88L 5KN5B 3VJ6A 4Q9RH 3DI2B 3B9DA 4YHKH 5FUZL 2MSPA 5AYUH 2D4FA 3L1OH 3T2NL 1YEFH 1CFNA 3FFCD 4O9HH 5GS1B 4FTVB 2DQUH 2MQCA 4EOWH 4IRSB 3FAXA 4L3EE 5C0BE 1IGFH 2K9UA 4PRDB 3PP4L 5DJAB 3F58H 3QFDB 5DRZB 4NBYB 4Y19A 4OD2A 1KCKA 4RFEB 5I0DA 2Z4QB 1FCGA 3BPCA 1N5AB 1OOAA 5GRJH 4P5KA 1WISA 2C4XA 2F58L 2J2ZA 3INUL 3MRDB 1NCAL 4GJTB 5IP4A 4M3JA 5GGSY 1YDPB 4IDJL 5D5MA 3TH3T 5ESAA 1DTUA 2FNBA 2ZCHL 3RNQB 3TBSB 2HKFL 4PLJD 4UB0L 3B9AA 1U8JA 4JB9H 4UAOC 1DN0A 3GSRA 4KV5F 5DS8B 4F7CB 3INUH 5F7NC 3V8OA 2EZ0C 4D2NA 3LKRA 4J8RA 4NUJB 2O5YH 1PEWA 5F7HA 1X4YA 1WBYA 4LAJH 2ZCKL 4Z0BH 3U4BL 4CU6A 4G43A 3SHSA 2AEIT 1Z9MA 3DOSA 1FO0L 3BUTA 1LEIB 4KJWC 4RISH 5J9PB 1UM4H 4R2GD 3TBYA 4MD4B 4ZFFA 3R06B 5I76B 4QHLB 3KPTA 3MCKB 4Z7WE 1FP5A 3DVGA 5E4IA 1CGYA 3E2HC 1CE6A 3BD5A 2YWYA 4PJGB 1I7RA 2Q3AA 5DF0A 3HKFA 1DDHB 1FIGH 5D93B 5F9WB 3S3SA 1NBZB 4FNLH 3T08A 2R0KH 5L7XL 4JRXD 3IRZA 4P3DA 3I3EA 3KPMA 4APQD 1DQLH 1M7IA 4QWWD 3MBED 3CLEH 2OP4L 3WFHA 1PGRB 1S7RA 5BV7H 1CFVH 1LEKB 5JOFB 1DUYB 2V9QA 5IHZB 4M8QA 1REIA 2CKBH 3KYNB 1EAPB 1GOFA 1WZKA 4XNXL 5KW9H 4Z7NE 4M7JH 1WC7B 1JTPA 3MPCA 2IH1B 4G6FD 5DURB 3CVIH 2HTKD 5HGDA 2OSLA 1ZHNB 1C16B 4LPWA 1XIWC 5HHPA 2YPVH 4PGEB 5C08A 2PCPA 3QCVH 4ODHL 1YEDA 2MNUA 2RB8A 3FOLA 3DGGB 2X10A 2HJKA 3GUTA 3U46B 1PKQB 3TA3D 2LAGB 4TUOA 3ARUA 3TNMB 2B7DT 4Y5VB 2WBJB 3ZT6A 4BJLA 1NGZA 3CLFH 3BPLC 1KEGL 3MA7A 5JIPA 4G42B 2VWEC 1RSFA 2OTWB 1NGXA 3QIBB 4DEPC 1IAKA 3OG4B 4NOBA 2DKUA 1GOGA 3QH3A 1KXQE 1JWMA 3OQ3B 3V6OA 3I6KB 1YEKL 5EBMA 1WAAE 1QSFE 5AUMB 1E6OL 5BVPH 5JW4M 1EGJA 1WEJL 4LPCA 3WS3A 3DGCR 4JZNA 4YHYC 4BFGA 3KYMB 4NM4L 3FRUB 2BMKA 1MCKA 4R97B 3LMJL 5ANMB 5FA3B 1XR8B 5GHWL 2VJXA 5FV2A 2NY2C 3LS5L 4LSPL 5AWNH 4GQ9H 1DANU 3MRPA 1Z5LA 4XWGL 5BVJB 1J0HA 2CKNA 5TDPB 1U58B 3MJ9A 5T1KD 4HKXB 3CMOL 4XNYL 3MO1A 4JJ5A 2D7MA 4UV7L 1V05A 5FYKL 3O6FB 4N5EC 3ARFC 2CKBA 3K3QA 3VRJB 3ZDXF 3LN5B 4N0YL 1WTGT 3MFFA 2LFGA 1XR8A 3LB6C 5T1LD 2HN7A 4RMTA 1JNLH 1A6ZA 5F6HI 3FRUA 5EPMA 5I8KH 3H3PH 3F7VA 1R5IA 1UA6L 2UWEE 2XG4A 1CR9H 1FVEB 1N7ML 4PJBA 2GW5A 1BQHB 5AUMA 3ABZA 3AY4A 3MOAH 5EBMB 2VKWA 3H8NA 4PJ9C 3BKYH 1NDMB 1P1ZA 2H32H 3RAJL 4X4YB 3RU8H 2AS5M 3Q1SH 3QEHB 4G42A 3QP3A 4N8PA 3MA7B 4LL9A 1QNZL 4L4VE 2NXZD 2BNQD 4JGMA 2DLTA 5CHNA 3NCJL 4TUOB 2CLRA 2YPKA 3SGJA 2H6PA 5F21B 4QOKE 4UAOB 3FOLB 4ZUWB 3N9GL 5E56A 5DJYB 4LVEA 4PGEA 4XGZB 4Z8FL 3LV3A 1C16A 1MCPH 2VQ1A 2DDQH 3B8SA 4YHZH 3W2DL 4Y16D 1WC7A 4WY7L 5IOPA 3VMOA 1TVHB 4JZJA 1JIBA 2A73B 4K07A 5CSZB 2IAND 4JREC 5KVGL 5C7XH 1LEGA 3KYNA 2BNQB 2YRPA 1GH7A 4D0BA 4ELMB 1C5BL 1DUYA 1RURH 1O0VA 1ZLWK 3AU1B 3MJ7B 3WHE0 4QRPB 3IGAB 5ACLA 1IM9D 4CVXB 1QSED 5ENWA 1EA9C 5DYOA 4A6YL 1GHFH 2PUQT 3BX7C 2P1YA 1A7NL 1O7VA 2VRAA 5JIIA 3UO1H 3QDAA 1MCLA 4APQC 4PJXF 1QFHA 4DGIL 1YNLH 4GRLC 2HLAB 1EPFA 1CDHA 1MREH 3BGAA 3WUWG 1CGWA 4X6DF 3UPAA 3KYOB 2DLEA 1WT5C 3QG6B 2XZCH 3O2WL 2W9EL 4MMXC 3NZHL 4G43B 4FQIH 4Y4HA 4JLRA 1IMHC 5LAXB 4YXLH 4KRPD 2HRPH 1WBYB 1JRHI 5FV1L 3TP4A 5J3HD 1F4XL 3GSRB 4F7CA 1QLFA 1JPST 3VW3H 3UTTB 1NKRA 3VFVA 3RNQA 4AG4H 2NY3B 4EN3D 3GMMA 4Y5VC 3PWJA 1P4IL 2Z92B 3NA4A 4JPVH 4KROD 1EBAA 3FB8B 5F71A 3NH7H 5A1AA 2AKRA 3K2MC 5DA4A 4M61A 1N5AA 5DMKB 4L8CA 2FIKB 2VDLH 4G6JH 5GS0L 4B7LA 5IMLB 5DRZA 2R1WB 4YFDB 2J8UE 1KLGA 4F58L 2DQTL 2R4SL 4LIQE 3K4ZA 4H5SA 2NYYD 5EFIA 5F3BA 1F4AA 3S37H 3PXHA 1QR1A 3EGSA 3V52L 4WFFE 3WLWC 2F54E 1ZAGA 3KXFA 3SO5A 1EMTL 1AQKH 1ZSDB 1CTNA 2I07B 2NNAB 4RGMC 2VZUA 5SWSE 4HUKB 3T2OA 5EORH 3ULUF 3IAGC 5TPWH 5I1JL 1GAFL 32C2A 5CEXB 4U6TA 3LS4L 4IOFD 2EDDA 3S98A 3BDYL 1HXMA 3IDNB 2P5ED 5F9AC 4M4PA 2R2EB 4RMUA 1FGVL 1VEOA 1UGNA 4YXKH 4H0HB 5EN2B 1LDSA 1B2WH 4R26L 4RFOL 5MERA 3O41A 1MH5B 1CQKA 1Z0MA 5T5FL 2V5TA 1S7XB 4Y2DC 2W38A 4XNZB 5J7CC 1DBBL 3LRGA 5EULV 2FATH 4G8FB 3F5WB 5D1XA 1DLFH 1Y6KR 3BKCH 4XVTH 1JZ4A 3BQUD 5L8JB 3OKLB 4K23L 1CXFA 1QBLL 2BVQB 5J0BA 5I1DA 4OAWB 4KK9D 2RCSL 2OI9B 1YMMD 3L95B 4XHJC 1BGXL 1MEXL 4NRXA 4P2RD 5GS0H 2EE6A 2E9BA 1IFHL 2X5PA 2DLGA 4PJDA 5FCUH 1F3DJ 5I1EH 4OKDA 5IKCB 1FLTX 2PYED 2RR3A 2UWEB 4HWNA 3QEQA 5D5MF 4NN7C 4R8WH 2BSTA 2IPKB 5E00A 1WZMA 4WDIA 1IARB 2Y9RT 1LO2L 3WUWB 4X6DE 4ZAKB 4ZTPH 3IVKB 3HZMA 2H2SC 2ZNWA 2B4CC 3BO8B 4XBEH 3NZ8B 5CEZE 1UJTA 3HR5A 5J3HC 3MBEC 5GJSH 1IEBA 4FFYH 2VZOA 4FRWA 1KB5H 4F57H 1U36A 3G5VA 4WI6A 4OV5B 4JE4B 4UU9B 2VR4A 5KS9F 5TDNB 2ITDA 1NCCH 5D70H 3IKCA 1BZ7B 4JHWH 1AGEA 4NDMA 1T80A 1S9YB 1T83A 1NH6A 3IFLL 3MOBH 2OQJB 2OXHA 5FF6B 5T3ZL 3V0VB 5MEQB 2XZZA 5D7KE 3WO4B 3SKMA 2OBGA 1KIRA 1RZKC 3CPLB 4OD3L 1IC5L 3LKNB 5T1DL 3RGHA 5FB8A 5FUOL 1TVBB 3SKJL 3SDXF 3ZKXB 3SBWA 3D9AL 1A6WL 1IM9A 3W0WB 2RGSA 4PG9B 1TTFA 3SKOB 2VITA 4APQB 1AGFA 5C6TL 2EE2A 3BUYA 3WIIH 5FAAA 3G6JF 5KSBF 1AJ7H 2IJ0C 2PTTB 3O3DB 5AZEL 4IEFB 3MNWB 5HGBB 3QG7L 1AQDA 3OSKA 4MX7A 4X5LA 2X4PB 1IC1A 1MAJA 3A6BH 5F44A 4X9FA 5CP7B 2EDEA 4UI2A 4OCWL 5E6IC 3WFEL 1WCBB 3VH8A 1MI5B 3DYMA 3ILQD 4LU5L 4L4TD 1AGBA 4Y1AB 5E94B 5C9KA 1G0XA 4NFBA 2YKLL 4K3EH 3LN9A 1T2JA 4PJ8D 4YWGL 3G5YA 4LCCB 3RRQA 3TO4D 8FABB 2NY3C 4FQPA 4X4ZA 3I50L 4QY8A 3QNZA 5C0EA 1KCVL 4AIZB 4KRLB 4P57B 5FO9A 3RWGA 3SDXB 3WHXB 3L5XH 3JUZA 4LF3A 4PY7B 4QHKI 3F12B 1U8QA 1NC2D 1RZ8A 2VZ3A 6FABL 6FABH 2O5ZH 5C0NC 4JG0L 3GBLA 3EOTL 1XGUB 4KDTC 4R7DB 3C9NB 3W0WD 4QYOA 5F6HJ 3EO1B 3H9HA 2NY0D 2DBLL 1R24B 1OM3L 5D1ZD 2C3XA 2VC2L 1INDH 2APFA 3L5IA 3KPSB 3V95A 2AJ3B 2WINB 4XRCB 2PN5A 4X7TA 1RUQH 5H2BA 3CVHA 3WL9A 5CJOL 2UUDH 43C9B 4OT1H 1FYTD 5D5ME 1IGIH 1J87A 1MOEA 3MV9B 2PXYC 3MLVL 3FQXB 3QIBD 1OTUC 4XP9L 1MVFA 3QUZB 4MB3A 1W0WB 2E9WA 1FNSL 3QI9C 3KPPA 4EVNB 5DQJB 3TO4B 1AGDB 5KS9E 2P5EA 1BFTA 5IFJB 1GXEA 3UPRA 4FXKB 4NHCL 3SKJH 2P5WB 4ERSL 5ADPH 3BZ4A 4M43H 4GRLA 3K4AA 4K23H 3NCCB 3LD8C 4JM2A 3ZDZE 2PNDA 3MJ9L 4YEEA 3RIFF 4M6NL 4Y88A 2P43B 3WDHA 1MCQA 1L4IA 1EXUB 4JGJA 3O4OB 2V5MA 4K94H 1LGVA 3BN9D 3BAEL 1XF2B 1IGML 1YMMA 3V5HB 2AJVL 4PLKC 5GS0C 4ONHB 3MROA 2APVA 3IXTB 5C6TH 1CGVA 4U1LB 5EIQA 1LO2H 1N0LA 4OLXH 4IOFC 1KB9J 5L2JB 1KPVB 1CFQB 1CXKA 3M1BA 2MHAB 1R6VA 4G6ML 4KMLB 4M93C 2BRQA 3DURB 1CGXA 2E6PA 2IANE 1TENA 1I85A 3R1GL 4TPRH 4M9PA 4ZPVB 1AI1H 1QQDB 5DQDL 4P99A 4OUUB 3MQIA 4JVUA 2EIZA 3HPJB 2FYYA 1AFVL 4XNXH 5IR1A 5EA0L 1KLUB 1Q9LA 4EJ1C 1HI6B 5JQHC 4R4FH 4UV4L 3RUGE 3VGEA 3DMMD 1QHOA 1J1OH 4M1CC 5I15H 1DBJL 1HH9A 5AYQA 5CLTA 1RJCA 1UM6L 1NCCL 4RAVA 1UM5H 4KI1A 3RI5F 5MENE 3S4SA 3C2SA 3GHBH 2D7TH 3X13A 3R0NA 2A6JA 4HGWB 3BKCL 4OI7A 1GC1H 4MAYC 2NY0C 1J11A 2L7UA 1ZT1B 4EXPX 2YD5A 4LKXB 4PJXA 1A5FH 2EYTB 4YHML 3LEXB 2DQCL 4ZTPL 3ARDD 2BXYA 4NGHH 3QEUB 1RULL 5DJ8B 1CGSL 3D3VD 4R26H 1P7KB 2H2SD 4ENED 3CUPA 4M4RA 5JUEH 4OUUA 5C9JA 2IAMB 4XCFH 5E1AA 4ZPVA 2I9TA 4P49A 2OZ4A 3OX8B 4P4KA 3VI4E 2VDMH 4Z7VE 2QEJA 5ICXB 3BESR 3L3HA 1D6EB 1NFDB 5TF1L 3T0EB 1ZLSL 2VLKE 4LCCC 3MROB 3U30C 1NCAH 5L2KA 2CR3A 3V4UH 4XNUL 5B4MC 2FATL 1DBBH 3T77A 2UVFA 4L1DA 3PE9A 1JPSL 4EI5B 1ONQA 1RUAH 3KAAA 3NCMA 3D2UD 4N68A 4XPBL 1EXUA 3KWWA 1AGCA 3Q6GH 1TJGH 1YJDC 5C07D 1MCPL 1S3KH 3IU3A 3NGBB 4JDTH 5MP6L 1A7PH 3HZYB 3WD5H 1OL0A 1T6VN 3BZ4B 2ATPB 2JJTC 2P5WA 2P5EE 5IUSA 4U0RC 3MLZL 1T21B 3O3AA 3F7RA 5IFJA 2HVKA 4TUKH 4OJFH 3TO4A 4P2OB 2XKUA 2VXSH 5DQJA 1QSEE 4P2QE 1ZLVK 5BJTB 5DD0H 1R3JB 4WV1A 3QUZA 1YNLL 1SM3L 5F7KC 4LSUH 1OQXA 3QDMA 3RU8L 1GC1C 5DT1H 3M8OL 1A7OL 3KGRA 1YZZA 4FZEL 43C9A 4RA3A 3C60D 4JKKA 4OBSA 5DUML 5H2BB 1J8HA 4JPKL 2AJ3A 3KPSA 3JWOH 1EZVY 3P4NB 3ZE2E 1S7SB 1DUZB 4R96A 4RFNB 4F80A 5DZNA 4A2LA 1J1XH 4X9BA 2ERJC 5TFSH 3T04D 1WBZA 4QLRA 5FGCE 1LQSR 4I0PD 1E4WL 1YUHA 3LKQA 4QRUA 1K5NA 1IJ9A 1J1XL 1T7ZA 3CGTA 5C0EB 2LVEA 3D2UB 3QIWC 3QSKB 3UZEA 3S3PA 4KQ3H 1EEZA 3S4SG 8FABA 1NUDA 3HMXL 1OAQH 3GK8H 5E94A 2YD3A 1CLYL 4LPVA 1T0NA 3MLUH 4GRLD 4M93B 2I9LA 1U95B 5CP7A 3PWPD 3GSUB 4Y4HC 2NX5A 4G8GB 3UTTD 4RSVA 4O2CA 1U91A 4JPIA 5DMYA 3UDWA 4NQTA 4PB9L 1AQDB 4MX7B 3ZE0E 5ESQB 4ZXBA 1WZ1H 4U33A 3MNWA 1RZ7H 2FD6L 2PTTA 2Z31D 2YUVA 3AREA 5I9QB 1AGFB 4OIBA 1T0PB 1ZV5A 4HPYL 1KN2H 3UJTL 4HF5H 4ZFOL 5DJXB 1NL0L 1T89C 3MLZH 1TVBA 3WNKA 3EYUL 4PTTA 3LKNA 1NGPL 4NC2B 3SKNA 2A1WH 2Q76A 1KIRB 5A2IH 1GZPA 1VADB 1KCUL 4KZDL 3K8KA 3JV6B 1MCCA 4HPYH 2VZSA 1OTSC 2NY0B 1SJXA 5MEQA 1U8HA 3P4LA 4HS8H 5FF6A 2NZIA 2KKQA 3HFMH 4G9DB 5EU6D 3REWB 1NDGA 4GQ9L 5CKGA 2IG2H 4JRYE 2HT4D 3QJHA 3SDDC 3UEZA 4S2SA 1FJ1B 3CZJA 3P77A 4P4RB 2ITDB 3ZSTA 4PGZA 4UU9A 4NKIH 4U6XA 5KOVC 2Q7YA 3WIFB 2IAMC 2AXFB 4MQXC 4L8SA 1F4WL 3BW9B 4JO3H 4N1CA 4LHUD 2GSIB 2VUYA 5JPNB 5CD5D 3NZ8A 3BO8A 4OFYD 4NKMA 5SX5H 2F5BL 1FCCA 4NN5C 5I8KL 4KU1A 3ULUC 2IPKA 4TRPH 2R0KL 3T0EC 2VH5L 1YEEH 1HZHH 2UWEA 5FGSA 3WCYA 1WJ3A 2OTUB 4MXQD 2G9HA 4PJDB 2V17L 2FLRT 4JY6A 5GGTL 5JW4Q 1QRKA 1U6AL 4NRXB 1Y18B 4HJ0D 1XGYH 1EVUA 5DEZA 1JI1A 4OAWA 4B0MM 2BVQA 5FO7B 5F96L 1V3LA 3GMOB 1FPTL 4PJIA 1H3GA 3VXOA 2DI8A 3T0WA 1SBSL 1IQWL 1T66D 5D4QA 3TBTB 4LPUA 2CIIA 4IRJC 1D6VH 4JRXE 4BK5A 2DQJH 3F65A 2XQBL 4I0CC 3CFDA 3QO0B 5L2KD 1YC7A 4IM8A 5MERB 2X4RA 4D0CB 4WFED 1C1EL 4C54A 5LVEA 3IDNA 5E4EB 3NCYS 4LLMA 3VXME 1MJ8L 2HG5B 1JHKL 2D03L 1CICA 2GY7B 4OF0A 3ARXA 3L3GB 4GS7B 1F00I 3RUGF 2Q8BL 4KFZC 4HIEA 2VDOL 4JFYA 4QTIH 4OZIA 4FTVE 4NJAL 4Y19E 1CXEA 2WMPA 1J0YA 5I1LB 1XAUA 4MNHA 3KYAA 5E7BA 5GGQH 4XVUD 1QR1B 4H5SB 5EFIB 5F3BB 1QBAA 3VDAA 4RQQA 2RIKA 1KLGB 1LNUB 2R1WA 4N8VA 5J6GB 1DCLA 4OZFB 1EJOH 3V4VH 1T89A 2EDTA 4L8CB 4YDVA 1NLBL 1UYWL 1QR4A 4X98B 5T5NF 4DKEL 4YDIH 4QT5A 5B8CC 1AP2A 5T1LA 1VACA 4GKSA 4NWUL 2A38A 2JJVA 3GMMB 3JWDC 4UT7L 1MHCB 4LHQB 2ZPKH 3UTTA 4OIIL 3QA3B 3GI8L 1IQWH 4LNVA 2X4SB 4EUPA 4MCYB 3BKJH 1ZLUH 2AK4E 4HK3N 2VAAA 4FNLL 3L3OB 1U0QA 3L5WB 3RVUC