3HI4A

Switching catalysis from hydrolysis to perhydrolysis in p. fluorescens esterase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
271
structure length
271
Chain Sequence
STFVAKDGTQIYFKDWGSGKPVLFSHGWPLDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylesterase
publication title Switching catalysis from hydrolysis to perhydrolysis in Pseudomonas fluorescens esterase.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 106
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2009-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hi4A00
2VSQA 2J4FA 3KOOA 2OCGA 2XUKA 3FYUC 4HXEB 3L1JA 5SYNA 4BRSA 4BCDA 4C4XA 3O9MA 4W1PA 2O2GA 4BBZA 2VAVA 5AKIA 2WIDA 5I7UA 4KAJA 2DR0A 1DQYA 1CR6A 4QZVA 4Q3OA 3IVMA 2RHTA 3FLEA 1DQZA 4J03A 1QZ3A 2VA9A 4Y2QA 3GBSA 3GUUA 2ZSIA 3N0TA 4C4YA 4F21A 5HFAA 2QKYA 3HC7A 4EB0A 4TVKA 1BRTA 4Y7DA 4BZZA 4FBMA 4BE4A 4FLEA 3RK4A 1DWOA 3GROA 1MPXA 5LLSA 3MVEA 4FKBA 3FBWA 5DJ5A 3UMJA 2VTVA 2J4CA 1SFRA 2GBIA 4YPVA 4Y2SA 2HA5A 1XLUA 3S8YA 3WK6A 3PUHA 3C87A 2XUJA 3L1HA 3G0CA 1YAHA 5K5EA 1BEZA 3NGMA 2ZJ6A 2HA3A 3BIXA 4L9AA 1XQYA 2PU5A 5LZ5A 4Y2YA 3W06A 2XI4A 2VAXA 2WFLB 3CN7A 4H7IA 4XIIA 4WDQA 1AQLA 3DKKA 4KE7A 5FDFA 3HXKA 5ISMA 4KE8A 4MYDA 3AZPA 5DTIA 3WWDA 3I2JA 1XLVA 1HQDA 5BV7A 6YASA 1QIFA 4ARAA 5FPPA 4FDMA 2WTNA 1WHTA 2H7XA 1DX6A 3BF8A 1ZJ5A 4G9GA 1SOMA 3AZQA 1DTEA 5DNWA 4B7ZA 1R3DA 3STVA 5KREA 4U2GA 1GT6A 1XZIA 4DSAA 4Q34A 3R41A 2XQJA 2JGEA 2Q0XA 1JKMA 1CUSA 4WFJA 2PSDA 1UZAA 3O9VA 3TEJA 2V9ZA 2ZJ7A 1K6EA 1EDEA 5H3HA 3IDAA 1T2NA 2AJ8A 3WYNA 4BAUA 4H7EA 1VJ5A 4XWGA 3WKBA 1QE3A 4I19A 2PSJA 1CUUA 1IZ7A 2WHPA 4MQMA 2RIPA 3ESDA 4U2DA 3I6YA 1G4HA 2PBLA 1F8UA 1FFAA 4G1FA 1Q0ZA 4CCWA 4HXFB 1UKBA 3GA7A 3A70A 2WQZA 2JF0A 3I2FA 4KR0A 1CUFA 4G8DA 1N5MA 5LZ9A 5ALQA 4KYVA 5AI9A 4Y2RA 1P0MA 3H17A 4HZGA 2XMSA 3H2JA 1EXWA 3PUIA 5DYYA 1R4ZA 3BDVA 5ALZA 1W6RA 3O0DA 5T4HA 4PSDA 5A7GA 3WK8A 3TJMA 5D3ZA 4EBBA 4UBKA 5SYMA 4HTAA 4Y2UA 4UFNA 4FNGA 4AN1A 4H7HA 4DSZA 4KJXA 1VZ3A 4HXGA 2WIGA 3EIOA 3D4LA 3WL7A 4HRYA 5DLPA 4OPMA 1TCCA 2PUJA 1XROA 2OG1A 3G9XA 4ZV7A 3WA6A 2ZYIA 2OGZA 1CLEA 2ORYA 1J2EA 4QEKA 1WPXA 4C6HA 3E3AA 1TK3A 1SCKA 2H1IA 4Y2JA 5JD5A 1OXMA 5JARA 2OQVA 2JEYA 2K2QB 2YYSA 4UFOA 2QRUA 2O2HA 4CI9A 1UK9A 4JYMA 2WFMA 4EY7A 1XLWA 3FAKA 5K3BA 1CUDA 1QIIA 3HABA 3LCRA 1S8OA 3VISA 4Y2XA 4EY8A 3FLAA 4K6KA 1XZHA 1BEEA 1YSCA 1FSSA 1ZD3A 5EGNA 5C7YA 3B12A 5AJHA 4V2IA 4JH0A 4B81A 3AILA 2CBGA 1G5FA 3HACA 3STUA 4IH4A 2WUEA 1CUVA 5AM4A 2XUIA 2HRQA 3WKEA 3WKDA 3FCXA 3DEAA 4KE9A 5A7FA 5JZBA 4Q1VA 2HFKA 1QGED 3W05A 1DT3A 5AKYA 1QFSA 3WWCA 4Y2TA 1ORWA 1BCSA 3FOBA 2WIFA 2WG0A 1VXOA 5AKKA 1LLFA 2XLBA 3G0GA 3HSSA 4OYLA 2PSFA 4UPDA 4G8CA 4CFSA 2AJBA 4GXNA 2QJWA 2Z8ZA 3WI7A 2H7CA 1DINA 3WQHA 3FSGD 2OCKA 4U2CA 1OCEA 2BAGA 5AIBA 1BU8A 2HL6A 4BATA 2WHQA 5BWCA 5AM5A 2BCEA 4J0IA 3ZWQA 4IQ4A 3P2MA 3FYUA 4O08A 1IZ8A 4EY6A 3FSGA 1NX9A 1CFJA 2B9VA 1L7AA 5AKJA 4X93A 3DYVA 3PDCA 1XZFA 4X91A 1I6WA 2AXEA 4RNCA 2HA7A 2VF2A 1THGA 3DOIA 4FWBA 4G4IA 5DYTA 4N5HX 5LKAA 2HA4A 2I3ZA 4LHEA 5CBKA 3W2TA 4ETWA 5DYWA 2PX6A 4W1RA 2YH2A 2VJCA 3JW8A 1XQVA 4JEIA 4OU4A 3V1LA 1EI9A 2QVBA 3X3HA 4GWLA 1M33A 1WCYA 4F5ZA 5BOVA 3AINA 1R9MA 4ZI5A 3G9ZA 3ESCA 5LIPA 3Q0TA 2PL5A 4QDTA 5AKHA 4BP8A 2OXEA 4MWSA 3SWWA 4E15A 1NU8A 4AZ3A 3D3NA 4GI1A 3WL8A 4AZ0A 5CURA 4NS4A 1BROA 1YS1X 1KU6A 1N5RA 3G9TA 1KEZA 3NUZA 3PF9A 3ZI7A 1VZ2A 2JGJA 5CT6A 1R1DA 1H2YA 1XZLA 2HU5A 2X76A 2Y2UA 4EHBA 1AX9A 4KEAA 1LZKA 2D5LA 1ODCA 4WY8A 2PPLA 3W9UA 1ORVA 3T4UA 4GDMA 1E3QA 3WIOA 4J7AA 1BN6A 5DTJA 2FJ0A 4H35A 4AXBA 3WL6A 2XMBA 5JANA 4ARBA 2XMQA 5AM0A 2Z3ZA 4A16A 1GZ7A 4B85A 2XUHA 3D2CA 1IUNA 1GPKA 1F0NA 5AKLA 3M81A 1ZJ4A 1CPYA 2OAEA 4UHHA 4DLNA 5AI4A 4UBJA 5FUMA 1QLWA 3N2ZB 1ODSA 4QDOA 4B82A 4FMPA 1QIKA 2JGMA 3WZLA 1HDEA 4C89A 4OB8A 3FWHA 2C5FA 2ZVDA 3I2KA 4RGYA 1K8QA 1E66A 5FPQA 1UT6A 1W4LA 1N1MA 1J06A 4IHAA 5ALHA 2Y1KA 5C81A 3C6XA 5CT4A 2QM0A 4Y2VA 4INZA 1ZIXA 2WUFA 5CT9A 1CVLA 1J07A 5C8ZA 5DWDA 4DYHA 2G63A 3YASA 2H7YA 2QUBA 2WILA 4RE5A 3STYA 5I9IA 5AKZA 4JNCA 4XJVA 1GXSA 4GECA 5D3KA 2I3DA 3C5WP 3U0VA 5ALMA 3CCCA 4X92A 4G5XA 5JAOA 3IA2A 3WK9A 3FVTA 4MEBA 1PJAA 3BXPA 3O4IA 2IIVA 4J0HA 1MNQA 1LPOA 2NW6A 4GW3A 2XMCA 2V96A 1MAHA 4H7DA 2HU7A 3D2BA 4FFVA 4AN0A 5K3FA 5HQ3B 1LZLA 1XFDA 4X00A 1MAAA 2V97A 4J3JA 3G0DA 3BL8A 3UUFA 4C01A 3OOSA 2RHWA 1QJ4A 4X3CA 4BDSA 5ALWA 4DNFA 5EHQA 3AUKA 1XRPA 2PM8A 3WMRA 4P93A 4UBLA 4AMZA 3PICA 1VXRA 5AKGA 3FNBA 5JAUA 4DM7A 3MUOA 4OB6A 1UKAA 3OG9A 4MXDA 2FJPA 3QM1A 4JUIA 1XRRA 3ILSA 4QLOA 3O4HA 5ALFA 3G02A 4N8SA 2BGRA 3PI6A 2XUDA 5K3CA 2WJ3A 2JIDA 2XUOA 2VEOA 3E4DA 5FRDA 4C87A 5K3DA 5JAHA 2GBFA 4UBIA 4B0OA 4OCZA 2DSNA 2JBWA 4K2AA 3R3ZA 4AO8A 3I2GA 4P9NA 1SC9A 1JT2A 1EX9A 2JEZA 2IITA 4FTWA 5CXXA 1XZDA 1ZGCA 2HDWA 2WIJA 1QTRA 5FV4A 4QNNA 2WU4A 2ES4A 4AO7A 5ALKA 3BWXA 1JI3A 4UHFA 5ALTA 2HRRA 1TCAA 2BGNA 1EH5A 1QIDA 1LPPA 5HK8A 4M0MA 1EDDA 4DMFA 2CB9A 4B9AA 3ANTA 3LP5A 1ZICA 3PFCA 4DNPA 1X70A 2XT0A 4NZZA 3F67A 5T4FA 1JJFA 1ACLA 2RONA 1Y37A 3E0XA 1BN7A 2GBGA 3ICWA 3I28A 3LS2A 5JD4A 3V1KA 2FUKA 1WHSA 5AK5A 2HHAA 4LIPD 3A6ZA 5ALXA 1DWPA 3WL5A 3M3DA 4ZWNA 5K3EA 1TIBA 3K2IA 4Q82A 2GZRA 3FCYA 5AI0A 1AKNA 3KXPA 3IBTA 4WFKA 1RYYA 1JJBA 4U2BA 1JMKC 5FLKA 1EHYA 1F6WA 2VJAA 1TAHA 3WLAA 3HYSA 3WKCA 5HKAA 2DFPA 2BKLA 5DNUA 4E11A 5JZSA 2XQFA 3EQ9A 4PQEA 4G9EA 4PO3X 5AM1A 5AO9A 2XDWA 3I6MA 4EA6A 2WM2A 4B6GA 5JASA 4PSUA 4HS9A 3DNMA 1TKRA 2WJ4A 4XX1A 4X90A 3QZUA 3KWFA 4H7FA 1KU0A 1CUCA 2WFZA 4K5QA 5HF6A 3R3XA 1YA4A 3C6BA 3W04A 1W75A 5E2IA 1UOQA 5JAPA 3EF3A 4I3FA 1HBJA 2RGUA 2VJBA 4KRXA 3DL4A 3H0CA 1H23A 1VA4A 1UOPA 2OAGA 3WWOA 2ZYRA 3AIOA 3H2GA 3ZV7A 3VJMA 1MNAA 1R9NA 4BVKA 4C88A 4N8EA 5CH5A 5ALUA 4E46A 4DIUA 4ZRDA 3JWEA 2XUGA 3O4GA 1EK1A 1YR2A 4QDUA 3NWOA 2QXTA 3DS8A 4WJLA 3M82A 1CUAA 1TRHA 5AKXA 1EB8A 1CUIA 3B3QA 2YASA 3W9BA 2FX5A 4TGLA 3K6KA 4U2EA 1X2BA 4X6UA 5ALLA 3I2IA 5AOBA 5LZ4A 2DHCA 1LGYA 2C58A 5JIBA 1FJ2A 1HKHA 2HA2A 2VT6A 1PFQA 4KRYA 4BRZA 2CMFA 3VDXA 2E3JA 3D7RA 1HLGA 1XQWA 1U2EA 4AB1A 3FYTA 1YAJA 5C8XA 5AI5A 4UFPA 5FKJA 5AK6A 5LZ7A 3STWA 4LYEA 1A8SA 2BUBA 3EQ7A 4Q05A 5AK4A 5EFZA 4J0GA 5FP0A 3D59A 2EDAA 3WK5A 1CUWA 4DGQA 2HA6A 2DQYA 1ZIYA 4QDXA 2PSEA 4J0KA 2CEKA 3GELA 5A2GA 3VXKA 1QFMA 4UBNA 1UK6A 3R3UA 1IVYA 3LLCA 5A6VA 3KD2A 4CG1A 1ZOIA 3D0KA 2UZ0A 3BDIA 3WK7A 2J3QA 2LIPA 4G4GA 3DD5A 3C45A 3H18A 3SX4A 1FFBA 4L0CA 1ZGBA 1WB5A 5CH3A 2HIHA 2WFLA 5E4TA 5ALJA 4OB7A 5ALYA 3E1GA 3QH4A 4WY5A 5ESRA 2WUGA 4CCYB 5AM3A 3ZPXA 4CG2A 4W1SA 4ZGBA 1P0QA 1QONA 5HZGA 1CUEA 3D2AA 3HLKA 1U65A 3DYIA 4BYMA 5IVDA 2BFNA 1SCQA 3H2IA 1IMJA 5A71A 4MQLA 2PVSA 1CUXA 2HFJA 1LPMA 5HFNA 1LNSA 3C8DA 1Y7HA 4QDZA 4ZREA 1XZKA 3DCNA 4GLBA 3PFBA 3I1YA 3TGLA 1H2XA 5ALPA 3FLBA 4B83A 1L7QA 1FFDA 4J0JA 4CIBA 2Y6VA 3F98A 2WTMA 2EEPA 2WHPB 4JYPA 1N8SA 3AZOA 1CQWA 3QMMA 1P0IA 4YK7A 4Y9SA 3I1IA 1VA5A 4DNQA 3AIKA 5AIAA 4YASA 5HF5A 3FVRA 2HADA 3ANSA 1H22A 2DCMA 4P92A 4G4JA 1ODTC 4PF1A 1PV1A 1XZGA 4FBLA 1G42A 1ZD4A 3H1BA 4EUSA 2BUCA 3WWEA 4MEAA 2XMRA 3BJRA 3V48A 3C70A 2G4LA 4LXGA 5ALSA 2QMQA 4NMWA 2P8SA 5CW2A 1WPRA 3RKSA 1Q84A 4BP9A 3HZOA 3H19A 1ISPA 3V1NA 2ONCA 4MJ3A 3WJ2A 1C4XA 1JJIA 4BTVA 3Q8WA 2Z8XA 4QA9A 1VOTA 5FXMA 1XQXA 1Y7IA 2GBCA 1DWQA 2C5GA 2ZSHA 1W52X 3R40A 5HKBA 1ZD2P 3H2HA 3KSRA 5CT8A 1JU4A 4DMCA 2HM7A 1QIMA 2JGLA 2W6CX 1BE0A 3S2ZA 1E8NA 4U2FA 3HRHA 2QUAA 4G8BA 4X6XA 1W76A 2G5TA 3DOHA 4BTLA 2QOEA 1O6GA 3DLTA 4EY4A 1ZI8A 3C6YA 1OILA 1MJ5A 3STXA 4WCVA 1ACJA 5AH0A 1K4YA 3DQZA 1B41A 4H7JA 3U1TA 4BDTA 3QITA 1XZAA 3A2NA 2XUAA 1XZCA 4PNZA 1VKHA 4LYDA 3R3YA 1HPLA 1A8UA 3H04A 2OGTA 2BUAA 4NVRA 4PV7A 3V9AA 1AUOA 2ACEA 2WSLA 3VKFA 3SK0A 4A23A 5YASA 5AK3A 4B9EA 4N5IX 4X71A 3G7NA 5AOAA 1UOOA 4HAIA 1CUBA 4CIAA 1QIGA 2Z5GA 1D07A 4J0DA 1WM1A 1E8MA 4WDRA 4H7KA 4X85A 2Y6UA 5ALIA 3G8YA 4UUQA 1P0PA 2PKYX 4Z49A 2C7BA 2JGKA 4GHWA 5KWJA 1SCIA 4QWWA 5D7BA 2ZYHA 1XZMA 1E8DA 5EIAA 1CQZA 2GZSA 1CUYA 1XRNA 2RI6A 1CUJA 2XE4A 3FYUB 4BVJA 1R50A 1ZI6A 1DT5A 5CMLA 1CV2A 3ZLUA 3R0VA 5K3AA 1UWCA 1B6GA 2XUQA 4I4CA 5IVHA 3BJMA 3G0IA 1YS2X 4GEGA 4W9RA 4C4ZA 1UFOA 3RARA 5KBYA 1QO9A 3H2KA 4X94A 1G66A 2JGFA 2VATA 1EVQA 2B20A 3F96A 4UHBA 2QZPA 5JYCA 1VE7A 3H1AA 1VLQA 5C8VA 5CXUA 1C7JA 1X2EA 4MYSA 2R11A 5FOQA 3MGAA 5A62A 4X6YA 4KAFA 4UBMA 1MX9A 4W1QA 2GYVA 3WKAA 1Q0RA 2G5PA 1EDBA 1LPNA 1GGVA 3EBLA 2OCIA 5BWBA 4F0JA 5CH8A 1MU0A 3WK4A 4PSCA 3M83A 5AI6A 4IO0A 3WZMA 3B5EA 1GQRA 4CCYA 1QIHA 2O2IA 5IKXA 1AC5A 3QPCA 3QVMA 1LBSA 1FFCA 5D6OA 1GPLA 5JATA 4F60A 2OPHA 2XMGA 1VE6A 1HL7A 3I2HA 4Q3LA 5ALOA 1AURA 1E5TA 1R88A 4ITVA 4H77A 5T4BA 3OPMA 5HF8A 5LZ2A 2YXPX 2XB6A 3A2LA 4KAAA 4MWTA 5LYYA 1IUOA 1JU3A 1O6FA 2J3DA 3C43A 5JADA 3BIWA 2OQIA 5F4ZA 2WJ6A 1W1IA 4DTCA 1NU6A 2XMZA 1GQSA 3WJ1A 4BZWA 3QBJA 4X95A 4Q3KA 5AP9A 4FHZA 1YASA 4AX4A 3C8HA 1YA8A 3QPAA 3BF7A 3ZLVA 2VJDA 2XQGA 5KWIA 5EHZA 5EHNA 1QTIA 2AJLI 4UHEA 3G0BA 1CRLA 4D9JA 3HJUA 3UUEA 3R3WA 3D5EA 4BVLA 4P08A 2QXUA 1THTA 2VT7A 4K6GA 1UKCA 3DL7A 4N8DA 5JD6A 4H18A 5CTAA 4A5SA 5AM2A 2HU8A 5JZ9A 3F97A 4FLFA 3DKRA 4ZV9A 1QIJA 3A2MA 5EHXA 4UHCA 5JALA 2CJPA 2DHDA 2O7RA 3RM3A 1AMNA 1DX4A 2B61A 1EK2A 5LP1A 3KDAA 5HCUA 4RE6A 1WB6A 2I78A 4L3WA 3ESAA 3GFFA 1XRLA 2RAUA 1EA5A 3VVMA 2C0QA 1YCDA 3IUJA 4KE6A 4OUKX 2GYWA 4KACA 4BE9A 3LIIA 1RWQA 1XZBA 1QIEA 3CCBA 2PSHA 1FFEA 2C0PA 4FNMA 5K3FB 1USWA 1QO7A 3CN9A 1ETHA 4X7BA 2WIKA 2AJCA 4QLAA 4DMKA 1EINA 2XLCA 2IX9A 4RPCA 5IVIA 5LZ8A 1MTZA 4UHDA 1T4MA 5CT5A 4S0XA 1GKKA 4DMHA 3RLIA 3F8SA 3WIBA 2V98A 2OGSA 3QMWA 2I03A 4E14A 5ALGA 1U8EA 4BC0A 1DU4A 1GKLA 3KWJA 5CRIA 5HQ3A 3K9BA 2XQKA 5EIEA 3T52A 1UXOA 2H9YA 2QS9A 3DJYA 1A7UA 5ALEA 3F9CA 3OTQA 1UK8A 2X8BA 1MO2A 3EQ8A 2R8BA 1LPSA 5E4YA 1J1IA 3R3VA 4B80A 1MX1A 5EIHA 2EDCA 2Z3WA 4UBOA 4LKOA 1LPAB 2W22A 3GZJA 3QMVA 5ALRA 2DQZA 2PU7A 4HRXA 2D0DA 3AJAA 1GPNA 4ROTA 2XUFA 1K5PA 2ZJFA 1H2WA 5A7HA 4AO6A 5LKRA 7YASA 2XUPA 3BE8A 1XKLA 3WWPA 2CKMA 4BC1A 2QT9A 2WU3A 3O95A 3IB3A 4QE3A 3QYJA 3ESBA 2O7VA 2ROQA 3IUMA 2HA0A 3TRDA 4EY5A 4IH9A 4BAZA 3DDUA 5HF9A 3O4JA 1BCRA 1K63A 1XKTA 3IIIA 3WYDA 1H2ZA 1CUZA 3I6ZA 3L1IA 1AGYA 3CXUA 5AOCA 1C7IA 2ACKA 3VJLA 5AKEA 3HEAA 1A88A 5ALDA 4K6HA 2WG2A 3IUQA 1MX5A 3OM8A 2Y2VA 1CIJA 4LXIA 4CG3A 4ZXFA 1Z68A 3PE6A 3V1MA 3ICVA 3PF8A 1CUGA 1TQHA 1XRQA 2XMDA 4X97A 2VQ6A 4GBGA 1YB6A 2BJHA 2XQIA 4L72A 2QTBA 5I8PA 1ZD5A 1BS9A 3IUNA 2OLEA 2B4KA 4OYYA 4OD0A 1E89A 4M0FA 4QWMA 1WOMA 5EI5A 3WA7A 3IULA 3ZLTA 4IH1A 4PW0A 5DNVA 2QJRA 4FFWA 4OSEA 1Q83A 4BCCA 1TCBA 4M0EA 1JMYA 5IH7A 2WKWA 1RP1A 1A8QA 3MUNA 4AMYA 2WLSA 1IUPA 4H0CA 4Y2PA 5AICA 1LBTA 4BAGA 2GYUA 1CEXA 5J3JA 4XVCA 1YB7A 2WHRA 3HI4A 2ZYSA 5IVKA 5ALVA 4WFIA 2C4HA 3C6ZA 4TPKA 4LXHA 4J0CA 4BB0A 4YX9A 1EVEA 1CUHA 1U4NA 1EB9A 3C5VA 1ZI9A 2CZQA 2AJDA 1AZWA 4B0PA 2CUTA 2DHEA 1WB4A 4DNOA 2PUHA 4AQDA 1F0PA 2WG1A 4FOLA 2WUDA 2X5XA 3QPDA 3G9UA 1MT3A 1XZEA 3LIPA 3STTA 5AI8A 1L7RA 1MN6A 3SC2A 5T4EA 1XRMA 4FLMA 2ECFA 3JYHA 3OURA 4BCBA 5E4JA 3NOXA 3AFIA 1UK7A 4W63A 5ALNA 2OCLA 4HVTA 1QOZA 4EZIA 2JGIA 1XZJA 3OC0A 5AHXA 5HK9A 4OU5A 4B84A 3VVLA 3IURA 2QR5A 3VJKA 1LPBB 3AIMA 3ED1A 1JFRA
chains in the Genus database with same CATH superfamily
3OBIA 3O1LA 4TUYB 5ADVA 2Q6OA 2UV8A 2BKUA 4JP3A 1MGPA 1SPXA 1JNXX 1ULHA 1UXHA 4ZT4A 2OA0A 1C4WA 1R9JA 1IEWA 2ZQ5A 5SYNA 3NHPA 2W98A 4HG2A 4C4XA 1ZHHA 4W1PA 5JYEA 3KBBA 1AKTA 4FUTA 4YAFA 2O2GA 3R3HA 4R5MA 4JXZA 2UXCB 3DF7A 1ATIA 5AKIA 8AT1A 2WQ7A 1MBZA 2DH5A 2GZ3A 3EFBA 1TJ4A 1ZN8A 4EVQA 1KPGA 1DQYA 5CDFA 1PR9A 4PAQA 2I2AA 1GR0A 4WLUA 1PK8A 3FLEA 4Q4AA 3U7IA 2OD2A 1QYCA 3OPNA 4E5NA 3MT7A 1WULS 1R4AA 1XTBA 2FW9A 3BMQB 3KSDO 4BLRA 4F21A 3V46A 3Q8KA 3EFEA 4KHZA 5TEWA 1F51E 1FSGA 2C98A 2NNWB 4LDZA 1X7GA 3FJ1A 2IYVA 4EB0A 3DO8A 3UJ3X 3BJIC 3IKTA 2WOOA 3SZUA 3O9ZA 1U7UA 4UREA 1RFGE 4RH1A 3UXEA 4BP3A 3BBPA 1C7ZA 3H1GA 4FBMA 4LTNA 1MW8X 4FLEA 2EZ8A 5M29A 1RWMA 1TVCA 2JA2A 3LF1A 1T3LA 2CCKA 4OXRA 1DWOA 2BEVA 3STHA 5LLSA 3SFZA 1L4EA 1T26A 2AHOA 1ZAKA 1AS0A 3GG2A 4M7OA 1P33A 1JZQA 4RVUA 2B8TA 3GPDG 2F3UA 4QEZA 3TR0A 1E5DA 2JCXA 5EWMA 2ZRIA 3FOCA 4Z9BA 1EIZA 1SBYA 2JBHA 1XOIA 3AB3A 1V5WA 3W6PA 1W7AA 1RBYA 3OEEA 4F12A 4YPVA 3G59A 3PQ8A 4HUTA 2FZGA 4QXPA 3CKKA 2H59A 5HCNA 3U6KA 2RH5A 1BMFA 2VTBA 1B76A 1L8XA 5DTQA 3EIUA 4EJ6A 1X1QA 2R8XA 4WZZA 5BPHA 4B71A 3JRWA 5EJEA 4M9SA 1D0IA 3FN4A 4MRAA 3AKDA 3KJHA 3G0CA 4JVNA 1RRCA 4F84A 2ZSFA 1E20A 3R5JA 3OZ7A 1CJUC 3N8DA 3G82C 1L1EA 3QVLA 1EUCB 1UZUA 3NGMA 1XWIA 3HKDB 4NS1A 1T4BA 4GGMX 3ROMA 1DHTA 4CCYA 3KZ1E 1LV8A 1DKRA 3M6FA 2F3RA 3CPJB 1XQYA 3RT7A 2PU5A 4ZPJA 2J48A 3EH1A 3GLGE 2VAXA 3I6IA 3BRQA 4DL9A 3PFFA 1WSAA 3CN7A 3JZFA 2CXPA 3I2YX 4O2AA 4B6EA 5LNK6 1WV0A 2PZAA 1KQFA 4PHTA 1AOXA 1KFCB 4H7IA 2QUKA 1R27A 3DW1X 1BS1A 1FFXA 4L5AA 4WNYA 3SHVA 1Z5NA 4IDEA 5FA8A 4Z3KA 5JFGA 2N1MA 4F4JA 2PUFA 3CR3C 2ZRQA 2WJAA 3BK1A 1JHYA 2JAOA 4IPTA 3DKKA 1NYQA 5FDFA 5JNVA 3LA8A 1H93A 1PD0A 4BV9A 1H8ED 2R1TB 3FMVA 5IVPA 3AF1A 3PQ2A 3WLHA 2DJIA 4ZIRA 1I0LA 2BPOA 5IYZA 4B2YA 3DKIA 4CTOA 5I7HA 3AR5A 2A9OA 4WLEA 6GPBA 3TQIA 2GZDA 2VSNA 3W9SA 1QIFA 4KXMA 2SICE 3KZKA 4ZOCA 4B8YA 4EZEA 3GLFA 2FV8A 1IDOA 3HJCA 3W5IA 1LDEA 4DBVO 3ML1A 1X1TA 1NDUA 2H7XA 3GP5A 4ZAWA 1VCIA 2HMUA 3TRKA 2JD1A 1EFTA 1OIWA 1ZJ5A 4EFNA 4J6FA 2ZS7A 4KB5A 1XT6A 5BR7A 2XCQA 4W7SA 4UM9B 2POQX 3JAKB 2WDPA 4KUEA 2R751 4TTTS 1XELA 3AZQA 1HEYA 1VKJA 1F60A 2EFJA 1UBGA 4YQFA 7REQA 3TJZA 1C29B 4B7ZA 3KKEA 1SB8A 4FZRA 4JU9A 1CDOA 2A3NA 2CDBA 1UR5A 2ZWOA 3D64A 3QHPA 5CXQA 1OFHA 3CF2A 1DAPA 4PYQA 4LRWA 5AM2A 1J23A 3NHRA 3NAMA 1ISIA 2D3WA 2RGAA 3IAHA 4GWGA 1OI4A 3SQXA 1XZIA 3T5CA 2ERXA 5TNXA 4RZSA 4Z6KA 4B7AA 3A4LA 1I3OA 2A5DA 2AX3A 2PZMA 1M1XB 2Y9MB 3ON5A 4IG9A 4KQEA 4PPYA 4R84A 1N8TA 4X1OA 4C4SA 2XQJA 3KC2A 1QG4A 4E5VA 5IAOA 1EEXB 2PKQP 3QKUA 4P34A 3T54A 2JLBA 1K6MA 2ZAIA 5SICE 4YP6A 4QOFA 3SVTA 3TEJA 2V9ZA 2ZJ7A 5E3IA 4PNHA 1KERA 1DIOB 4KVZA 1YTUA 1QH0A 4CXMA 2QE7A 5H3HA 4EYQA 5EINA 3M4JA 3GFPA 4BIMA 4YV7A 4L3OA 5G53C 4I99A 4KGDA 1AK9A 3EDCA 3IXLA 4JLPA 4MQUA 1IXYA 2AJ8A 4C6TA 2H31A 4H7EA 1ZGJA 3P2JA 4XWGA 1RM5A 3DCYA 1T4DA 2EW8A 3OJWA 3TBHA 5JMWA 5CDSA 1ULBA 1RYDA 1IEVA 2MJLA 2PSJA 1PZGA 1X7WB 4LE0A 2JI8A 4MWEA 2NPFA 3SYNA 2GLTA 4C5CA 2C42A 2WHPA 2H5EA 3TKLA 2DT5A 2AOTB 3SFVA 4L1KA 3DT8A 5DGTA 4C29A 1L7NA 1M2NA 3FUTA 3I6YA 2L19A 1ABBA 3GVIA 1R6BX 3ONVA 2CL0X 3D5QA 5KVQA 3VPBA 1K3FA 4TS9A 4GR5A 4KR3A 1I1NA 3T7IA 2LCIA 1GG2A 2GD0A 3HJNA 5KSYA 3GJXC 1QZUA 1J09A 1UKBA 4HXFB 4NSNA 3NKVA 3Q72A 1Y8CA 4BYGA 4YP7A 3HBLA 4QLBA 5LZ9A 1UDCA 2A9JA 1PL6A 2WSYB 5AI9A 5LLDA 3DQQA 1SC6A 4RCVA 3H2JA 2C7VA 3RWMB 4AY4A 3B5JA 2V65A 4RVCA 1M6VA 4MUNA 1G21E 1GWNA 1W6RA 4J75A 1JTFA 3ZNNA 3DHEA 3VDRA 1DEAA 1V26A 3VR3A 3I39X 3BRCA 1KKMA 5A7GA 1FL9A 2R68A 2P2DA 1REQA 5D3ZA 2BHTA 3KFXA 4ZJZA 3UATA 4EBBA 2AN3A 5FX2A 2MSKA 4GXQA 1GA6A 4HTAA 4IS2A 4EEXA 1XD9A 4FNGA 1SBZA 1TADA 1BJRE 3GDFA 4I1SA 1FQOA 4IRUB 1M0WA 1TFUA 3CIOA 4FNOA 1LQ2A 3KQHA 5IT0A 1P2SA 1QYXA 3D4LA 3WL7A 4DEYA 5FO1A 1UH5A 3K71B 4B6SA 1DUSA 1KMMA 2PUJA 1XROA 5AVRA 2R8RA 1Y1SA 3ZNQA 2OG1A 1L5HB 1NNUA 3PEYA 1Q57A 1QR2A 2X6TA 4ZV7A 4KMOA 3WA6A 5D85A 1U8XX 1OWOA 2ZYIA 3IPRA 3NV7A 3Q88A 3A6LA 1ONSA 1E2QA 1A77A 4O6VA 2B1JA 3VZQA 3VNRA 5IBCA 1SNYA 1AHPA 1J2EA 3S7TA 4QODA 3DMYA 4QEKA 3FOAA 3NC4A 2CNDA 3TTYA 3WGGA 2GD1O 3BTOA 1TK3A 2I1VB 1N8KA 3FF1A 3CIFA 4K1LA 1T5HX 3O6VA 1L4NA 3A14A 2H1IA 4LZNA 3I3SR 4KNWA 2VF7A 2Z2ZA 3ETHA 2QT1A 3MWDB 4G2TA 4RHCA 1P1IA 1UODA 4HZIA 3UMCA 5TY0A 3EXFA 2FPIA 1BD3A 4RA6A 1UJ4A 1E7RA 1S8AA 3FWNA 2ODPA 3DB2A 4X1KB 4O4LF 2REQB 5DO9A 5TARA 5LMCA 1YNSA 4JYMA 2I4IA 4CTJA 4B8ZA 3P0EA 3NOQA 4MKZA 4EY7A 2IYSA 1PWHA 3FVQA 5F77A 2EZ4A 1FYEA 3PHHA 1QHNA 3LW7A 2CXNA 5JS2A 1P9NA 4LQLA 4MS1A 3D8RA 1ESMA 5HCIA 3HCOA 4B1FA 3GG9A 3HWWA 3TCKA 1JAXA 3PCRB 4JLUA 3NVDA 5C7LO 1J56A 5F2OA 5G1OA 3W4IA 4O4HF 2HSWA 4XX0A 1AKQA 1Y7TA 4RV5A 4DQKA 1GDHA 4ZAYA 5K0SA 2FLVA 3E8SA 1NV8A 4C7OB 5EZSA 5FR2A 4II3A 2CBGA 3FFXA 5G0SA 4L5IA 1UADA 4JQYA 1PYOA 3FI9A 3ODGA 5LOVB 2IBSA 2I66A 3QOXA 1J39A 2HBYA 2EJVA 2WUEA 4JI6B 1NXVA 3WGZA 1FK8A 2BDUA 3LHFA 3FCXA 2QN3A 4O4IF 4DADA 5BWNA 1E7YA 4OHPA 4WJZA 3KPWA 2HF8A 2WEKA 1JTEA 2F1OA 4DSUA 1QGED 5C5CA 1V8PA 1K1EA 3NT5A 4COKA 2QP3A 4AKSA 1FRQA 1A1VA 1DT3A 5AKYA 2VZ0A 4RUKA 4HBGA 1CF2O 1ZEMA 2AMLA 2CLFB 2NYAA 3COPA 3MK31 4WZBE 3DDWA 4Y9TA 3WWCA 2CCJA 3A32A 5JLAA 5AVVA 3FPAA 3O2NA 3O83A 3OM0A 4KO8A 4C0KA 1V47A 1X3SA 4QICA 1QH9A 2F1KA 1JFLA 3MLAA 1BDMA 2LDXA 2FX3A 1PJ4A 1BCSA 2TRSB 3DDZX 3QLUC 3ZH2A 4UE6A 5K4GA 2O8DA 3G2KA 5LSAA 3KZOA 1KZHA 4PGAA 1PX2A 5AKKA 3G0GA 2V6MA 3MJRA 1C41A 1ADGA 2A6PA 3QKSB 1RIFA 3MGKA 4WKNA 4XB2A 3RVQA 3DF9A 3PX3A 5JXGA 4XRRA 3PWTA 4ZQBA 5LNK1 1SU4A 4G8CA 3LY8A 3D6HA 4R51A 4ZOBA 1MENA 1RU3A 1NVVR 2QD2A 4GXNA 3WBBA 3K0CA 3FZQA 2IKSA 3LY9A 1DINA 3ZV6A 1XD2A 3FW1A 4P81A 2WI8A 3FSGD 4EW2A 1FP2A 4U2CA 4YHHB 4XOUA 3T3HA 3AXSA 3WB1A 1CP2A 2B6HA 1EFRD 1OCEA 1E3WA 2ZUBA 3OPYA 4J9VA 3U17A 3K09C 4EJSC 2E2WA 5JSZA 2EYQA 2GI4A 4XM0A 4II7A 3VR2D 4JI3B 1Z4LA 4A2QA 4DUZB 3SMQA 4QPDA 1EFCA 1J9ZA 2UKDA 3BMCA 3ABZA 3ZD7A 2ZYWX 3GEBA 4IMPA 3L41A 2D06A 3QWIA 1MLDA 4IIEA 4KUHA 2QQ0A 2BCEA 2H92A 4FZ5A 1C0IA 3ZWQA 4BP8A 4OY3A 3DL2A 3Q0IA 4N5DA 3DV2A 1I33A 2IYNA 3F9IA 3V1TC 3FYUA 2RC6A 2AR0A 1GPAA 1P44A 3FTEA 1O94D 3F47A 2FN4A 2NZJA 2ZVPX 1S2DA 3TTXA 3EY4A 1O97C 3PA8A 3FSGA 3ZV5A 1L5YA 4Q19A 4V3BA 4Z7NB 4C7BA 3UXYA 5AW3A 3IMEA 2CL6X 5JQGA 4MB0A 4M3NA 2P27A 3COZA 4LJSA 4MAAA 4N6OA 4X60A 1ML4A 1GZSA 1UP7A 3PWKA 5AKJA 4AL4A 4F7DA 4LZJA 4MGHA 4CEIA 4UD6A 3ILHA 4LVNA 1KMHB 1RLIA 4MULA 4HVLA 3DMGA 4HPXB 4M38A 4NU6A 1RPAA 1GZUA 3AEQA 3GMIA 3R6WA 1V5FA 4RGBA 3QFFA 4QULA 1THGA 5B7QA 1A5AB 1NTRA 5GPBA 2XT9A 3Q8XB 5CA0A 5LXTB 3DOIA 3FOFC 3U56A 4FWBA 5BNWA 3EULA 4H27A 3U4QA 4QVKA 4FINA 1SUBA 4AG5A 4U6QA 5EZ6B 2C59A 1V8BA 1IHXA 4RADA 4ZQEA 2Y68A 2QRLA 5SZJA 4RTSA 2HH9A 3N28A 4MRMB 1NI4B 4ZRNA 5DULA 4DVJA 5LWQA 3N1UA 4ETWA 4JBYA 4ZVVA 4L4XA 1EFHA 5BYJA 3KJFA 3HUTA 3AR9A 4RJJA 1DQSA 4WN9B 3WG9A 4ENRA 3LTNC 1KIMA 4YP1A 4L0DA 3IAM6 4CLEA 4PU0A 3KKKA 1KOLA 3TE6A 4CMCA 4W5OA 5D01A 3PQFA 3KKMA 4JEIA 3LUJA 2Q29A 3ORYA 4CWAA 4I3HA 5KQLA 4L7VA 4OXQA 5ITVA 3SR3A 5F7JA 3TZCA 2JAPA 1FRNA 1P1FA 2E4AA 2W2QA 3IR6A 1U9CA 3HJBA 3N87A 4R2IA 1OB2A 1JXOA 1QC5B 4OEHA 2Y66A 5L4NA 4JI5B 5KNCH 5EWLA 3X3HA 2P68A 1PR2A 4B3FX 1TDJA 4TMTA 4ZI3A 1RM4A 3Q2IA 1KVQA 3I04A 3VOSA 1L4KA 3NFRA 2H0QA 3KT6A 3AINA 4MH0R 2GXUA 2IYXA 4U5QA 4Y1FA 3WS7A 1E9EA 1TF7A 2DPXA 3ESCA 4N9QA 4R9UC 4ND3A 4WKPA 4DLYA 4DLBA 4I50A 5DNAA 2A0KA 1SWVA 1CVIA 4LS3A 1ZIDA 3IP8A 3IUSA 4R05A 5BSHA 4A36A 4FW9A 4JD5A 4R2HA 1GAWA 1YC5A 4ZEVA 1FP1D 1NU8A 3NVKI 4XVQA 1CJSA 1QCCA 3OZGA 2Y8EA 5DHAA 3QPBA 2QU7A 2OEPA 4Q4LA 2EFDB 2UZIR 4HADA 4HP8A 4OBWA 5C0OE 4AS2A 3UK2A 3NHSA 4Q48A 1XVIA 1L9KA 5CURA 3A7EA 1M1NA 3OE5A 2R7NA 4FYIA 4IP0A 5HDQA 2CUZA 1NY6A 2Q62A 2J6CA 4HB3A 2C4NA 2PJUA 4NS4A 4ETNA 2WV7A 4LDPA 4MQFB 3I32A 5FTWA 1FDTA 5DLQC 4RTQA 2W6JA 1YS1X 4EUEA 3PSAA 1N5RA 3IELA 4C03A 2WF7A 2WHEA 1FP4B 1NXXA 2C8VA 4YO7A 3TB4A 4B8WA 3VKWA 4DC1A 3X0DA 2O8FB 4EENA 1X1DA 2W6IA 2QORA 3GUYA 4DBZA 4DWVA 2P35A 2P2YA 3GR6A 5A4KA 5FWYA 3ZBQA 4BNMA 5FUYA 1C2YA 4ZO4A 1Y8QA 2X9QA 1QTNA 3CO0S 3P19A 5CXSA 4KEAA 4ZHQF 1LZKA 3T7CA 4K05A 1W2WB 3RSSA 2ZJYA 2PPLA 2QAGA 3THYA 3W9UA 1ORVA 3VOBA 3AI3A 1WMDA 3WYBA 8MHTA 4WLNA 2VPZA 1U7TA 5GONF 1E3QA 2QENA 2Q1WA 1VG8A 5H1YA 2UUPA 2YC2C 1SM4A 1U3VA 1VIVA 3CX6A 3CT4A 3NC0C 1Z4NA 1IXRC 2P6OA 4QUBA 2HT1A 2D13A 5EYPB 1DJPA 1Q3KA 1UDWA 3SSNA 4UCQA 4K9NA 1DADA 3WL6A 1AE1A 5IP5A 2WKQA 4I4TA 1G20B 5LVAA 2OR3A 4JLNA 3ZIAD 2P1ZA 3MMZA 1PK7A 4UD2A 4B85A 3B20A 2PL9A 4Q5IA 2IVZA 4HT3B 1R0XA 1IUNA 1GPKA 1F0NA 2QSUA 2VH2A 2Q8NA 3KUDA 4ARZA 2CNOA 5BYBA 1CPYA 3IILA 3MGGA 4TTVA 1JQ3A 2GRJA 4UVHA 2WMOB 1TO6A 2OAEA 4IDOA 3HWRA 1JFVA 1OPXA 4O0MA 4QQFA 4DLNA 4F5EA 1CIVA 1EZ1A 3KEGA 3I8SA 3RC9A 4IF4A 4ND8B 4OQNA 2W8BA 1I2CA 1Y33E 4KPFC 1QYWA 3D0RA 2GN6A 4BVHA 2XDQB 3ZLTA 3COJA 3L0IB 3VHRA 1B26A 1QLWA 3IKVA 4GS5A 1H2HA 5A6SB 4EK9A 5INTA 1IN5A 2VWGA 1A5TA 4QDOA 3COWA 2GN8A 2G9NA 4CM1A 3WDSA 4LYJA 4UUPA 4RV9A 5ARCA 2QVGA 2R5NA 1HDEA 1T9AA 3WL3A 4C89A 3GQVA 2VDPB 1U0OC 1Q22A 1HO3A 4UMDA 4DJAA 2ACVA 5KQSA 2DG2A 1W93A 3BDAA 1R15A 4CMEC 5GVRA 2VJNA 4DR2B 1X15A 3RS2A 2IT1A 4P8RA 3CUUA 2H2WA 1QHYA 4TM7A 1BH2A 4IIYA 1MJGM 3GZ4A 1Z74A 2H8KA 1EGVB 1JMVA 3OIWA 1DTSA 4KO2S 1NUQA 2IU6A 5ALHA 4M36A 4IHAA 1O57A 3LUKA 1QHEA 3TW0A 5B3JC 5BP7A 3U44A 3P9YA 2DYKA 2XX3A 1F20A 1FBTA 2V3WA 4UU7A 2UZ1B 4UUOA 4BFXA 4AZTA 4Y2VA 4FMBB 1UMBB 4NCHA 5K8JB 1C9KA 4D6XA 3RWOA 2V54A 1T13A 2BFCA 3EGOA 1SIOA 2V7BA 3BIJA 4L73A 4RK1A 2H2FA 4DYHA 3LCUA 4DV6B 2H7YA 2WILA 5FJIA 3UPTA 2QI9C 5EJIA 2VDRB 3Q2OA 4C3OB 3HJFA 5AKZA 2P9TA 2A1TR 4R9SA 2WOJA 4NWIA 5LR6A 1PJSA 3L4BA 4QEDA 1N0VC 4E5UA 5AUNB 2FW8A 1MHTA 4KLNA 5L40A 1EEHA 3RJTA 4ZZ0A 1CBUA 5CIWA 4Y7CA 4YMTA 2FPPB 1KAOA 1Z0DA 3I76A 1SJ9A 3ET5A 1N1DA 2ZAGA 5JRZA 5ALMA 5KYYA 3AVPA 1LWOA 3DE1X 2PAFA 1V6AA 1NN3A 4G5XA 3JAWB 1JGTA 1MAWA 1Y1RA 1KPHA 2GHIA 2KS6A 2L42A 5C18A 1XPOA 2G1PA 3KAQA 2CNKA 2DUMA 3N0RA 1IMOA 3PXBA 5H68A 1JQBA 3AMVA 2OCPA 1KEEB 1P4HA 4B6QA 5C4MA 2IH2A 2ARKA 4BMNA 3G23A 4IOMA 1ISHA 1OYWA 2CUKA 3DH0A 3IQHX 3L6CA 3B3JA 3LBIA 3Q4GA 4FOTA 2XOEA 4RPHA 5I7AA 3W34A 3PQ5A 5LP6F 1MNQA 2I7TA 2XAUA 2A5GA 2PFGA 2ZUSA 2XMCA 2CBXA 3GNTA 4GW3A 5THQA 3ZOKA 1F7UA 3AETA 4ENWA 2V96A 4PC7A 2PUVA 5JY6A 3JAMA 3L7JA 4H7DA 4KPUB 5T67A 7AT1A 5KYKA 4LJ4A 3R9XB 2CD7A 1AJEA 1JKJA 2PS3A 5CCDA 2QY9A 4CL8A 4HN9A 3KVVA 1NOKA 3D2BA 1DAEA 3UH0A 3L04A 1X1AA 3DOOA 3EDRA 1XSEA 4M4SA 5EJ2A 3H5OA 1JIXA 2CDCA 1IONA 2F17A 1Z8FA 2BMEA 2H4FA 1Q20A 3FB1A 4C08A 5JCZA 1WNFA 4F71A 3ADPA 2IK8A 2ISSD 3QX9A 4DJTA 2ZUEA 4C76A 4YAGA 3CZAA 4X54A 3N6XA 5E2AA 2HDNB 4X00A 2OBYA 1TZ2A 3L7LA 4G81A 2V97A 3D02A 2H4JA 5JAZA 3ACCA 4NDNE 1BW9A 2ZRDA 2A1UB 4L8VA 4N39A 3BL8A 4B7UA 1X1SA 3PJEA 4UMFA 4CHGA 4DTIA 4RTMA 1OYYA 3T5TA 4JI8B 2AW5A 5KAPA 1MPTA 2PMBA 2PX0A 5FNVA 3TNYA 3UUFA 3VZRA 3OOSA 3PEEA 5GTDA 4DQVA 4TWZA 1U4SA 2CUNA 4AWXA 1RYEA 5KO2A 5DI9A 4ADSG 1XRPA 3DEJA 3OZIA 4JR2A 4PLPA 2GK7A 3PVSA 3H9GA 3K9CA 4GPZA 1L7DA 2NU7A 3U4IA 3FPLA 4RDCA 4UBLA 5MDHA 1L1QA 3LOQA 5IJWA 1Q0PA 1T3TA 1ULSA 2XHEA 2XXBA 1JWBB 2DFDA 4N1AA 5ENZA 4ZVSA 3KQTA 4CDMA 3B8EA 1ZKDA 3E61A 3IDZA 1VRVA 4I08A 1VXRA 4EYGA 4U3JA 2RBKA 3QF4B 3WQQA 4AN0A 3FNBA 2K87A 2WU1A 3PC2A 4TX1A 2QYSA 4B33A 2KMLA 1R10A 1SBCA 5F5XA 3RBVA 3QV1A 3N3AC 3VPFA 1XPJA 1NR1A 5IX8A 1FSPA 1IB6A 2ZTMA 2DHQA 2GPBA 1UKAA 3NAZA 2JI4A 2H18A 1JILA 1JSCA 4UQLA 4QQNA 4AZSA 1BXGA 3OG9A 4FT2A 3X1XA 3GQBB 4MXDA 2FJPA 2HO4A 1X0XA 4JUIA 4B09A 4Q9IA 2VAMA 2ZZKA 4JDUA 4NDAA 4QLOA 4D46A 4S2UA 4NMXB 3GCZA 5ALFA 4F86A 4ALJA 2GEUA 4GOND 3VC1A 2IXAA 1JTVA 1TLFA 4MLZA 2ZE5A 4MGYR 5J5VA 3WV5A 2BGRA 1E6WA 2QHXA 3L8DA 4LJ6A 4LZWA 3BIFA 3CLRC 3EXEA 4NK4A 3IXQA 4RPKA 4BVBA 2W43A 4PLYA 2JIDA 3K96A 4OI4A 1XZ8A 3E4DA 5C51B 3MWGA 3OPYI 4Y98A 4EX7A 1XEFA 3QV2A 5JCOC 1RHKA 2FI1A 1XYVA 5D51S 4ZVQA 4OCZA 3AGQA 1BVRA 3UHFA 4PPFA 3TSCA 4AY6A 4EY8A 4RA9B 4NPAA 1YD7A 4OH1A 1E1CA 2BELA 2I2DA 2XB4A 3OZCA 4K2AA 1YQUA 4EVIA 3R3ZA 1G5TA 4CR8A 1FXUA 1EDOA 1T1SA 4P9NA 5B2ZA 4XASA 3CB4A 5KOHB 3C7DB 2JEZA 2I62A 2JGDA 3RC1A 3CZ4A 3GLIB 3C3YA 2FSVC 3TLMA 3JVIA 3OEHD 4NCKA 5A3VA 2D1QA 4LCEA 3R7BA 1JFFA 1IIBA 2FZWA 2PWZA 3LC0A 3OIUA 4FOSA 4FWTA 1GRQA 2BFMA 2GBLA 1SG9A 1JBQA 1NR5A 3A6GA 4JZKA 1XYGA 4YMLA 1HE3A 4PIVA 1GLNA 1CQJB 2MSDB 4EFDA 3MWJA 1DCFA 4FWIB 4OGKA 1H2BA 1GGMA 3O7MA 2WU4A 3WP1B 4YRCA 5KCMA 4DC9A 3NDIA 5ALKA 5IU6A 4Z7QB 4UVEA 2AFHE 3ND5A 2ZEJA 4DV7B 1JPUA 2EWWA 1BG6A 1TCAA 2BGJA 1IRIA 3KKZA 2PZ8A 3NB0A 3Q3GE 5KOJB 4MUMA 4ISCA 2V0GA 3DAFA 3TXAA 2BKVA 1GAXA 4O63O 3PHGA 1KKLA 1J42A 1TZKA 3ZQ4A 1JEYB 1JVNA 5BSEA 3OZDA 4YMVA 3MWYW 4DMFA 2PUTA 2WF8A 5AHOA 3L7OA 221PA 5G4KA 4CUJA 5JJCA 1DHRA 1KZ1A 2XF2A 3Q7PA 1BNCA 2C99A 3E48A 4JBIA 2BFBB 2YY5A 4YJHB 5LMNB 2PUDA 1X70A 2QRQA 3AP2A 3F7OA 1Z7EA 3H2BA 3F67A 4J1TC 2BHNA 4TKUA 2I1LA 3JASA 3C4VA 5FOWA 4WWHA 4F91B 4Y6QA 3TE7A 3E0XA 3L6EA 1U8UA 4M1OA 1U5BB 1X92A 4K9QA 4B3RB 2B1RA 4RIGA 3G3EA 2FVXA 1PS8A 4G1UC 3PR2B 1IU9A 3G8DA 3QYAA 3LS2A 5A4FS 2WSBA 2PGOA 2LRHA 2G06A 2J7PD 2O14A 2PKWA 2FUKA 1U2TA 1WHSA 4KW7A 5AT1A 4ABTA 2E4VA 1EQUA 5DWVA 3HCAA 4LIPD 1R6UA 3WL5A 3MJHA 4ZWNA 3M3DA 1RCUA 3WGUA 1KBOA 3IV9A 4ZK2A 5K3EA 5L4LA 4RH0A 1CY7A 3AUSA 2GZRA 3DZGA 3KL2A 4U9HS 2H1CA 3WISA 1WDLA 4XOIA 4AF7A 5C1OA 1RKVA 1AKNA 1IEQA 3F5MA 4K6OA 1R8YA 1N5KA 1K0FA 1RVV1 2AOUB 1RHMA 2FRDC 3U3JA 4DREA 1SA0A 4O1IA 5EVCA 3RKRA 1X7ZA 1NW6A 3FMFA 1B16A 4U2BA 4KNYA 1AQIA 1C14A 2YXLA 1AQJA 1U5CA 3WNBA 5FLKA 1O03A 1BXRB 6REQB 1JKXA 5HJ2A 3NRBA 3T9EA 2CV2A 3GLGB 1U0JA 2J7PA 1NKSA 1JIKA 1N6HA 1N2BA 4NNOA 3WLAA 3WBKA 1KYYA 4NEGA 3BCRA 3HYSA 1DQNA 4UNQA 5IANA 1UUFA 1I2BA 2EBUA 3MELA 4U7FA 4RM2A 1JQEA 3GYBA 4MRRA 3ROKA 1RXVA 2RBEA 4E11A 1AH2A 1OAOC 1E1QD 1VG9B 4CQNA 2IU0A 1LD3A 1HF3A 4KWEA 4BFVA 3M6MD 2PKXA 3B51X 1OOEA 1H85A 2IOFA 1GG9A 2JBAB 2MYPA 4R5HA 1QUEA 4G9EA 1S01A 1N2IA 3KB2A 2NV6A 4C7VA 3HCFA 1G6KA 1AN9A 5AO9A 3TL2A 5LQCA 4WGFA 3MJ4A 1PEAA 3I6MA 2P5UA 2AJTA 3N8HA 4PYIA 4F4HA 3MCUA 1U7XA 5M04A 4PSKA 2WWRA 2IH4A 1Y6QA 1E60A 2ZE7A 5JASA 4B45A 1E0SA 4ZYUA 4OHXA 3H99A 3DNMA 4AUNA 1E2DA 4MV3A 3NNNA 4BNTA 2CXTA 4CKEB 3R7LA 2VUUA 3MJCA 3QZUA 1E1QA 2YVLA 2JJ1D 5DHSA 4UM7A 5BMVF 3EUEA 4C6SA 2PQMA 1D2MA 4YDRA 5T6MA 3ZY5A 4CLHA 1V9SA 2FMXA 4K5QA 4FYPA 4UAGA 4JBNA 4V0KA 2X1MA 2HDHA 3C6BA 3I23A 1W75A 3MTQA 3W04A 2RARA 4QHYA 2CLEB 3OECA 4MICA 2GLXA 3V6MA 4Z51A 2IY7A 3IKLA 4KWHA 4E2XA 1LNQA 2CXUA 5EJ4A 4I3FA 4GGPA 4RV4A 4X6LA 5AUQA 4PCUA 2VJBA 4AJ2A 5K0TA 4FVTA 4RGVA 1G55A 3HB4X 3IEUA 5TLSA 1NMXA 4BB6A 1T9KA 1YU6A 4GOJA 3IXMA 4P7KA 5EXDA 3H0CA 2WTEA 3VYTB 4RLSA 3T4EA 2OAGA 1GUFA 2FGJA 2P4SA 2VP2A 3EZFA 3MTGA 4EMBA 5D86A 1JIUA 2C9ZA 1O0SA 1RFLA 1W5AA 2EEZA 2V6IA 2O8VA 3H2GA 1R9NA 3MIIA 3VVBA 5KNBD 5ALUA 1CNFA 2IU3A 3ACDA 4KQ2A 4DIUA 3FPJA 4M37A 3A1UA 1NXWA 1R0CA 1ZISA 4K46A 2ONJA 2Q28A 1T9ZA 3ZUGA 2PWBA 3MBOA 4MTCA 4QAQA 3KYDA 3DLBA 2XCUA 4CQMD 3G7UA 3C5EA 4S12A 4EAQA 4N5LA 4XI9A 2WMYA 4TOIA 2Z09A 4MITA 4W5QA 2H3EA 4TWRA 2PKCA 5CM8B 3K9WA 4WJLA 4JUFA 4QBKA 3W78A 2Q1SA 3IPXA 2BR3A 1GZ4A 2Y27A 1KEPA 3M82A 2O8BA 2EFHB 4BRUA 2FQXA 2XF8A 1H3FA 3A6FA 3N2NA 4PR0A 3NYWA 1EB8A 2FHSA 5ITSA 3NTRA 2BF4A 5KJ6A 4MYTA 3TLJA 1T0BA 1R3UA 1R5OA 1KSGA 1CUIA 2GWHA 3GHYA 3GCGA 3NDBB 2TSYB 2WJPA 4G65A 3O4RA 4QD3A 3VH1A 3COYA 4O25A 3RPEA 1CULC 2PXXA 4ER3A 2KSQA 1G16A 3WGNA 3SFTA 1CWUA 3GPLA 3PXCX 3INYA 1NM5C 3M6LA 4KQJA 1YKGA 3C1OA 3DQPA 2Z98A 3LWZA 2P4QA 4U2EA 4XGNA 4L50A 2VXYA 4X6UA 5ALLA 3QEAZ 2ZIWB 2WT8A 2VCYA 2P41A 5LZ4A 4UEWA 5I4IA 1A69A 2ODBA 1TT5B 1ZW6A 3L6OO 1J2UA 1VG1A 4D0GA 3IQWA 1X8JA 1IM5A 1FJ2A 3LXUX 4AROA 3BXOA 1M74A 2PT9A 5FPYA 5M2QA 4BX3A 3P71T 2E3JA 2Q4BA 1HLGA 3G88A 1TQ2A 1U2EA 2IDZA 1DEKA 1M54A 3DO5A 1W5TA 3OCVA 4NYJQ 4RY0A 4HTFA 5AJWA 4Q0MA 2JNWA 3VDMA 1FXWF 1YAJA 3EMBA 4BV2A 4BWGA 5JV5A 3BC1A 4KR9A 1DAHA 1GP2A 2CZGA 1YDGA 4AJHA 1G5IA 4Z53A 1YU9A 3IERA 5EP1A 1A8SA 3EQ7A 4I36A 2FCAA 4DE5A 5AK4A 2CXHA 2R6JA 5FNZA 4M2LA 3ADBA 2EDAA 1YGPA 3SXUA 1RI2A 3RGGA 1OLXB 5H81A 1EGMB 3WK5A 2GDJA 1CUWA 1Y4AE 4RTKA 5JHHB 5CM2Z 5TIIA 5J2UF 5JO9A 4DKJA 1JG7A 4D9IA 4YRRA 4HNUA 4Y0VA 2WK1A 1SQGA 1YDEA 2XEDA 3DE5X 4GMFA 4AI6A 1XMIA 2Q6IA 4N7BA 3MTEA 1VI6A 3O8QA 3QOFA 2Q5JA 1M2OB 4EJFA 2F1JA 3HBFA 2DQYA 1ODLA 1KC1A 5B2EA 1MB0A 1ZIYA 2QD4A 2G80A 1QGUA 4J0KA 4TKVB 2Q4TA 4TSRA 2C5LA 3QU7A 2VZ8A 5F2EA 1U5AA 3JALA 4S04A 4WUTA 3GJ5A 5JYBA 1ADJA 3NKFA 1AV7A 3I9NA 3UGTA 1WOYA 3HO6A 3F2IA 2RHGB 4PTYA 3RE1A 4F5YA 2RGNC 1UK6A 2G4CA 2R00C 3C3EA 3FPFA 4K7JA 2VTEA 3PUJA 3CLKA 3K94A 4UZEA 2ZI6A 1DC7A 1SEVA 1Q50A 2HRZA 4QJ4A 3UMVA 2XZPA 2YNMD 4X1YA 2Q1YA 2PRIA 3D7MA 2JA1A 4BNIA 3B3AA 3L0OA 1P1CA 2CHEA 3EXIA 4LBWA 1NBMA 3BDIA 5EXEA 5ILQA 1ISRA 3O31A 4IXTA 4WT7A 4QT0A 1TVKA 4IDAA 3PKJA 3E4CA 1OI7A 1FQWA 1RT9A 3M2TA 3VTZA 1MO4A 2A58A 1Y1KE 4RZ3A 1H69A 3QW4B 2BZ1A 4IX1A 4B3DA 4CMIB 3I4CA 3H1FA 3OO1A 1QQ7A 2X0NA 3L92A 1RDFA 4FJ0A 3LUHA 2GMWA 3AR3A 3KXDA 4L0CA 3RR2A 5BN3A 2QPOA 3KLNA 5JVDB 2W2KA 2WINI 3NORA 5CH3A 1DLJA 2H29A 4DUYB 2O54A 1E6EA 1WZ2A 1SCUA 2R8OA 421PA 2ZKLA 4C2AA 1PTJC 1DTWB 4PC6A 2YYYA 5ALJA 3H5RA 4G41A 2FPMA 1NXSA 4FFBA 2WZCA 3PNLA 2JKVA 3QH4A 1F9EA 5BVHB 3ES9A 3SR0A 3THWA 3ZPXA 1MF7A 3PUWA 2G1UA 4Q16A 5CITA 1KAEA 4CG2A 1ORRA 3GJSA 2AMJA 3LU1A 4W1SA 3K1ZA 4RFSB 5B1SA 3UK7A 1VMIA 1Q16A 1QONA 1SRQA 4YDSA 1CUEA 1FFSA 2IOHA 1Y3AA 2PR2A 3HLKA 1U65A 4FYYA 4ZT2A 1EUZA 5HHTA 2ID8A 3LRTA 5K0CA 2EBWA 5K01A 1LK5A 3EMKA 3LSYA 4CGZA 2I99A 1YR1A 5KB3A 1XQ6A 1RLTA 2XVYA 1KC3A 4BL5A 1QP4A 2P7HA 5ABPA 2VDWB 1QK4A 3DOFA 1XNRB 2OTCA 5A71A 1M0SA 3CYFA 3Q7IA 5HJ5A 1YRQA 2PMKA 4LPKA 4UPVA 1E4EA 2G76A 2G67A 3HR8A 4MLCA 1J99A 1OZAA 3EVTA 5CLIA 3R7NA 1CZNA 1HXHA 4GLFA 3LX8A 1N6LA 2Z2XA 1Y7HA 2A5FA 4QDZA 1VB3A 4TMZA 2WD9A 3KU1A 3S4YA 1DIRA 4D9KA 5DXAA 3DCNA 3CBQA 3FG9A 2CY0A 4M1EA 4AULA 1JVBA 2ZW9A 5E38A 2ATEA 3BH6A 1MXFA 4KN5A 1HDRA 3IDQA 4UDNA 2JAHA 4JNKA 5J63A 1ZOLA 1SO8A 3UBMA 4D56A 2OO5A 1E1DA 1UQTA 5ALPA 4B83A 1U0RA 3SZ3A 1L7QA 4LBVA 4Q4JB 5H80A 1J25A 3IO3A 3L9XA 5FUWA 2IWHA 3VH4A 2CLCX 3W3AA 1Q2UA 1AU9A 5CCEA 3H9QA 4YJ3A 5D8DA 5KVSA 3WP0A 1XXLA 4U9IS 4EYEA 3SZOA 4ZVLA 1GLGA 1A9XA 1NSFA 3FHOA 1PZFA 3QKTA 2QWXA 2WC1A 1I3MA 4HJRA 4PZZA 3WRXC 5FI0B 1IATA 4DNXA 2RJNA 5DU2A 3VGJA 4WZAA 4Y9SA 2G82A 1XI2A 3GF4A 4M60A 4F3TA 1FFGA 2RKOA 5IUNC 4KO1S 5AIAA 5DWQA 2ZRHA 4MV5A 4YASA 5HF5A 3FHCB 5KYNA 2ZR7A 4JROA 4TV8A 5KHAA 3FMPB 1LLCA 4RHYA 4MA5A 1U4OA 4PGHA 3NVAA 1HUQA 2P1RA 2AE2A 5I5EA 1QTQA 2O0LA 3OLYA 1U1FA 1SIBE 3DE2X 4P7JA 1GVHA 2P78A 4FB5A 4GM1A 1I9GA 4G4JA 1ODTC 5BV0A 2WWYA 3NTVA 4BEBA 1HE1C 2GEDA 2PRKA 3KLPX 3A9RA 3NH9A 2J9GA 2PGNA 4RIEA 1PF7E 2ZREA 1ZD4A 5EMNA 1OPRA 3IEMA 1MABA 1DIBA 2PGIA 4DMGA 4HWKA 5IW8A 2X8LA 1GT91 5B3AA 4R71A 2MYTA 4G1EB 1QQAA 4GKJB 2Y1XA 2R6HA 3QVGB 2G4LA 1H65A 3EEIA 3AVUA 1O2DA 3RK1A 1L5QA 2X9LA 1G6OA 3VU3A 2X40A 2ZSKA 4WCFA 4GQAA 3RIGA 3KUKA 1VBFA 2P3LA 3K70B 1GZ5A 2AQIA 4UOEA 4OOFA 1U02A 2P8SA 4IIJB 1MMFB 1C9YA 3RKSA 1TL7C 1ZITA 2EQ5A 3GUVA 5KOIA 4XLTA 5HXAA 1ZM4A 2OESA 1PAUA 4BQIA 5B3LA 2FZCA 5K0GA 3EB9A 2XYPA 4IVQA 3U0BA 4TMKA 3ZV4A 1ISPA 3TZLA 4AUKA 3SYMA 4MJ3A 1IULA 3LCVB 1F6DA 1P73A 1R16A 4GPIB 4R8VA 1U9YA 4YRPA 3JWIA 4MW9A 3DDOA 3D9QX 1V4NA 1VYTA 3L0CA 3BX1A 3E15A 3T1NA 5TF0A 1P4JA 2E6KA 1E2IA 1GU1A 2N3ZA 3BHMA 4LHSA 1G5QA 1TF5A 3KSBC 1CB0A 1FYFA 1L7XA 2ZSHA 3FCOA 4I4IA 4WESB 5B55A 2X4GA 4DBLC 1ZD2P 5H82A 2EERA 3VOTA 1KYIA 1MDBA 4Q00A 5CT8A 3ZHYA 2NUAB 9GPBA 3GN2A 2JLRA 3KXKA 3BB3A 5DNDA 3ZLBA 1C8KA 1YMQA 3DO6A 3DTVD 1KKUA 2HMYB 5ESDA 4EA9A 5CA1B 1I3CA 2ZVQX 3E81A 2PLAA 5LXTF 4UZSA 1XA0A 3BA6A 1B15A 2R5WA 3AV0B 4ZMBA 3S2ZA 4RZXA 2GYYA 3QOYA 2QUAA 1E9AA 2ZWVA 3N7AA 1QGZA 3U7QA 4PG4A 2FPXA 1QLHA 2PLWA 3U40A 3NIWA 2NU9B 3SBXA 4BTLA 3BQMB 1LDGA 3LLMA 4U7JA 1HM5A 2YJTD 3WR5A 2VNSA 3HJGA 5JSKA 1MIOA 4IY1A 3T7RA 2YJ3A 1ZI8A 2GN1A 1NF9A 3NT2A 4IRMA 4BECA 1A2OA 4ARIA 1XXHE 1ZUIA 1OASA 3PPIA 1AN0A 1PLJA 2HRBA 2ZWMA 2G28A 1Z9BA 2MOKA 3QKIA 5IARA 2ST1A 4ZYLA 5C1PA 2XGOA 1Z5OA 3DTVA 1B41A 4B43A 3G2IA 4JJGA 2J9XB 1T2EA 2A9QA 2JJMA 2PMDA 5FA5A 3SLGA 1C0EA 1NW5A 1ZFNA 2CMDA 2XUAA 3CE6A 3CINA 2G6TA 3EBOA 3JWJA 4PNZA 2XSZD 2YJ5A 3R3YA 3J81A 2VDKB 3DR3A 1FUUA 4DCCA 1BHQ1 4RD3A 3NFYA 3ANLA 5GMOA 1WSDA 4CQMB 4PG6A 2I3AA 3R6DA 1JEYA 1JL3A 2ID4A 2OK8A 3EPLA 1GL9B 1SOAA 2Q6KA 1TKAA 3CR8A 3OU6A 2HWKA 3ASUA 1VL6A 2GN9A 4UM8B 4X62B 3ZHVA 3M8KA 1N2HA 3TTTA 3HKBB 1N6PA 2C82A 1WU7A 3KFLA 4Z4QA 3H8SA 1KH1A 3O8LA 3FHJA 1X74A 2J0UA 1W0CA 2QB5A 1TYDE 2PBFA 5AOAA 4IJKA 1UBJS 4E31A 3CKLA 1I3LA 5DLEA 1WG8A 5MN5A 1A8IA 3S81A 2JLWA 3DXFA 4ZCPA 5BRAA 3ZS8A 3GRCA 3C8ZA 1MVOA 1E9BA 1SB9A 1KZ4A 1ENZA 4P3YA 3NOOA 4XFKA 1EXVA 3LDGA 1SN7A 1D07A 3E9ZA 1QK3A 1KH2A 1PJZA 1Z4PX 3E9QA 2XSZA 3Q3HA 5T8KA 3TSWA 3FNGA 3TZQA 2H1HA 3ZUPA 4YLGA 2OC4A 2EZ9A 1T5DX 7GPBA 2JGNA 5IPFA 1U0NA 4UE3S 4HFRA 3NV9A 2VHTA 4X85A 2C4KA 2NX2A 4KKXB 1V7PC 3WB2A 3JQFA 5TMPA 5F21A 4LFAB 2F59A 2RHHA 1JR4A 2Y6UA 4KXFB 4X1IB 3G8YA 5EZYF 4JVOA 5FULA 2ORED 4A0QA 4BFYA 1GEGA 1WU8A 2BP7B 1CJKC 1T29A 1EM8A 3P2OA 4TTSA 3VRHA 3PQ3A 1HLFA 4IXNA 4KQWA 4F3KA 1O94C 4N01A 4NAHA 4DEXA 1B0PA 2WAOA 1NXQA 1Y5IA 4IWXA 4MVJA 3R20A 5H3LA 4R69A 2FMFA 5LUBA 1T2VA 3IOYA 4ZO8A 3D4NA 3ZU6A 4BO9A 2C3MA 5KPDA 3GCDA 3VR5A 2RGWA 1SVNA 2A7QA 3HA7A 2CMGA 3HVKA 5E95A 3RS8A 3DVRX 4Q9JA 1XJQA 2QBYB 3M2PA 4IAOA 4YA6A 2I6GA 3EUWA 5E6SB 4F92B 4BWVA 2FCRA 1TUIA 1ZCFA 2AQ8A 3BJMA 3RRFA 4U1RA 3G0IA 2IYRA 2O2JA 3H11B 5BV2P 4GEGA 4L8FA 2IZ6A 4GPTA 1EQ2A 2E4UA 4PIMA 3SQDA 4C4ZA 3F73A 1Y9ZA 2IPLA 4PYLA 4HDRA 1HYGA 1DBPA 4V39A 5HS6A 3T0IA 3FWKA 4IMIB 3G1UA 3PNSA 1PNQA 1L4UA 1T2DA 2XZDA 3GD7A 1Z4IA 1Y5RA 2JGFA 3NONA 4JEHA 2C1ZA 4TXNA 1Z28A 1MG0A 1OU0A 2D00A 2IUEA 3B70A 3BREA 1Y42X 2FQ1A 3ETCA 4C6RA 1CY0A 2DHRA 1AZTA 1QB8A 2MMCA 3G1TA 1VLQA 1HSZA 2CL7X 2SECE 3A4TA 1P9OA 1GAJA 1YCHA 3OOJA 4PM4A 4QGHA 5C8VA 2O19A 4LNAA 2QN7A 1C7JA 3A1SA 3C24A 3A7DA 3OQPA 1RTKA 4ML3A 1K75A 1ZUWA 2P3QA 1VE9A 1CZUA 1F48A 1KARA 2QSJA 3SBEA 5BWMA 5UKDA 3WNCA 1T2UA 4JYZA 2CHVA 3O3OB 1WDKA 1M6HA 1SZJG 2QMOA 2O3JA 3NEYA 2YL2A 4KDEA 1MX9A 4RTNA 1WCXA 3OMLA 1UM9A 5G1NA 4KK4A 3WKAA 5AXBA 5GY7A 2Y4NA 4I66A 4F04A 4CLRA 2RK3A 4I0WB 1LPNA 1PR0A 1RC1A 3Q2KA 1MC4A 3EE6A 2CDNA 4EARA 3M5PA 1L5LA 2RFLA 4JP5A 4EATA 5BWBA 2DP4E 1W30A 1VHWA 1R4MB 2IFTA 4AG3A 4N48A 1E1RD 3TZHA 3CLTD 5AVXA 4F9FA 5KYUA 1Q0UA 2H8GA 1BHO1 3AX6A 3MC1A 4MZXA 1MU0A 1T8TA 4F9EA 1P4AA 1XD8A 4DF3A 2XECA 3DXZA 5AW2A 1XX6A 3ORQA 1CD5A 1EXMA 3JATB 6Q21A 3DWGA 3RF6A 5JQWA 1GAEO 3QPVA 2H08A 1EUQA 1VM6A 4QRDA 2BFAA 3TEMA 2MINB 4HX2A 4X3PA 1EGAA 3WZMA 1YB1A 2QAGC 1LI7A 4N0PA 4XR4A 1PFWA 3WFJA 3U19A 5IKXA 2XRZA 2BGWA 1MEEA 1F4VA 3DR5A 1ZK1A 2PJRA 2ZPUA 1C4OA 1H2RS 2P65A 3KOYA 5D6OA 4AZ3B 4DJJA 1MC1A 1IG3A 3IPAA 3L0PA 2ZJ5A 1QZZA 2YHIA 1O96B 3ISTA 3G5TA 4NXMB 1T9CA 4ZU1X 4QRIA 1J9EA 2ZXEA 1FDUA 1E1RA 3M6IA 1Y48E 2AEFA 2Q5CA 2RCYA 2DTEA 3IUYA 3PHBE 1UZLA 3CPHA 4UQPA 2IY8A 1AURA 1E5TA 2ANCA 2R44A 2I5PO 5IDVA 3E3LA 4D96A 4R1NA 1B4DA 3LGSA 5CYGA 1Z4OA 2VDJA 1TQ4A 4A8JB 2X7HA 2BM9A 2I67A 4OKIA 3GLQA 5GP1A 5LZ2A 3IO5A 4LC1A 3QWBA 1AT1A 4RPLA 3VZCA 4NC9A 3A2LA 4MWTA 4RK0A 3B6KA 4QPJC 3N7UA 3VUEA 1YI0A 2LTAA 4XRGA 4B3MB 1YQDA 4HLUA 3GH3A 1TK2A 1KAMA 2ECQA 5JADA 3RVJA 2VRNA 2FWAA 2IUSA 2X5KO 3OFVA 2OQIA 5G1PA 4AZVA 3ZY3A 5I45A 1MORA 2WJ6A 3H3JA 4JLVA 1W1IA 1FQJA 1KJIA 4YCLA 4Y2HA 3OZBA 1QFJA 2E37A 3LKBA 3R5TA 2C2ZA 3W7VA 1R66A 1JPVA 3P9NA 3AJRA 1NBHA 3K8QA 1PW7A 1X38A 2Q9AA 4RQAA 1MCZA 3C39A 4I5FA 2FWIA 4UHKA 4IW3B 5CLFA 1X7XA 1ZN2A 1U8FO 1CT9A 1Z0KA 2FE4A 2RGCA 4ID9A 1OGIA 3W7AA 1OZHA 3QBJA 5CFNA 2XDAA 2DFVA 4X95A 1EVJA 3A4NA 4G89A 4IFEA 4Q3KA 4WK4B 4GR4A 3WOVA 3JX9A 4FM9A 4DRYA 2YZNA 4XIJA 2P9HA 3CURA 3FUVA 2VVTA 4DQDA 1KDYA 4K3VA 4JEUA 4AX4A 3C8HA 3X44A 3TTVA 1YRHA 2QGZA 3L8HA 1E62A 4FFPA 4Q9KA 2ZJ4A 3MWFA 3BF7A 1OX6A 1TJ5A 4Z54A 5B6IA 4I5GA 2CE2X 3A8TA 4IEFB 2EIXA 3ZLVA 4NLLA 4MHTA 5T7BA 1J2RA 2XQGA 1F3LA 3BB1A 3W5UA 1U11A 1IPHA 2RK4A 4WUVA 4YP9A 5KWIA 1WE2A 2DFNA 2KQUA 3P26A 1C4KA 3BWEA 5DFAA 1UZNA 3GLUA 3JQAB 4KQCA 5DSTA 3K20A 3QIVA 5DLDA 5F1KA 3RHSA 1AF4A 2H1WA 2J3HA 3BXZA 5DSXA 2W83A 2WY2D 3WYEA 2CEAA 1KR5A 4GEKA 2Q21A 4YDQA 1KYVA 3OO0A 3QXJA 5H7XA 1GRCA 1LS1A 2F00A 4EUKA 4F8JA 4IFTA 3E9RA 4UU8A 1XCLA 3D5EA 3COSA 3SY8A 3UUEA 4EF5A 4ZKDA 3FWZA 5AVZA 5KMGB 4EDHA 4F9GA 5LN1A 1JHXA 4P08A 1KP3A 1B7GO 4QYIB 2O5EA 4QO8A 2Q2QA 4G09A 4Z1OA 4WXRA 1WSBA 2EYUA 3REQA 5CLQA 3FUCA 4BZPA 1JHUA 4KWCA 3DLIA 1SPBS 3EWNA 4KCGA 4L4YA 3SQNA 2XYRA 4RS4A 1JS1X 3PRKE 2AFHB 2I6TA 2FFHA 2PH1A 2WR8A 3QLVC 1ZD9A 2EWMA 5FWAA 5CTAA 3DLHA 3EVFA 3LQYA 2B94A 4FLFA 3PNYA 3KX2A 2D5IA 4UASA 3RRNA 3W4JA 1N5DA 1QIJA 5EIXA 5GINE 1COZA 3KS9A 5CG1A 3Q9LA 3UKJA 4LSWA 1P17A 3AF0A 4PBTA 1Z88A 4INOA 2GPSA 4QASA 2CJPA 1O6ZA 1YUBA 4W6ZA 1M66A 5FTNA 1ZP6A 2O7QA 3SEFA 3WVNA 1NVMB 1VYVA 1WY5A 1FW6A 2H9IA 1S2MA 3GW8A 4D9GA 1OWLA 2RI0A 5K0LA 1SOVA 3OU2A 4HQFA 3RM3A 4A82A 1AMNA 4C21A 4LYFA 1Q1GA 4GBED 1VP3A 3KDAA 5LP1A 4QHTA 4W4TA 4HDMA 3OQNA 5ADHA 1JEDA 1M72A 1W6UA 3AUYA 3MT8A 3NVMB 1KF0A 4HWSA 4JQZA 4RE6A 3ZKAA 2Q0SA 3RGWS 3A9VA 2BEWA 4YCBA 4EG8A 4L3WA 3ESAA 1ZQ9A 2MCFA 3U3OA 3PPWA 1OXBB 3R76A 3DPUA 4YUXA 4GZLA 3SDBA 5CD9A 1EA5A 1PFKA 4XVUA 1YCDA 4YGXB 1RBMA 1QX3A 5I3ZA 2JIPA 3G17A 1T36A 1YFKA 5ER9A 1KSFX 2UXDB 3DL0A 1NT2A 2BV3A 3V55A 4EI7A 2ZJBA 2BH9A 1ID8A 1KJQA 4EAAA 3BCSA 2X8AA 1HH4A 1QZXA 2YMLA 3DTNA 3CCBA 4QTTB 2X1HA 5DM1A 4G4SP 1GD1O 3BGSA 3TBFA 2N0SA 2F67A 4BGVA 1VIDA 1X8XA 4W5WA 1XYYA 3D43A 3GZNB 5GGYA 5ELXA 5FBKA 3ZVRA 4O4IB 5I9MA 2KLHA 4M8SA 4IDCA 3ILYA 2RHOA 1PGPA 4BLSA 4HQRA 1G2QA 4O4JA 4KXQA 3TUJC 2AJCA 4QUAA 3A06A 4R1PA 3U3DA 3V7NA 5CW1A 3V8VA 1PLKA 4C22A 4DMKA 3UCFA 9ABPA 4QDKA 3T9DA 3WNZA 4GMGA 3C8UA 2I4OA 3KTAA 1Y63A 4M7PA 2QAJA 4NJMA 2RAPA 4BQEA 1SHUX 3CRNA 4JB3A 1TFRA 2NV2B 1VHQA 2XLCA 3PC8C 2UZ4A 1QX4A 2Q3FA 3CH5A 5LZ8A 1TM4E 4OH7A 3E7DA 1VG0B 3M6XA 3LPNA 3VOAA 5C1IA 2H1FA 1AKVA 3KEFA 2Z9BA 3MCAA 3WIBA 2FEKA 3WZ2A 5CX4A 5EWMB 3ZXXA 3C3DA 3E7WA 4WVFA 3QMWA 1VRCA 2I03A 2WWIA 4IJ6A 4N3CA 1U8EA 1WCWA 4E14A 1I7QB 2ZXUA 2CJYA 5ILOA 3N5CA 1L0BA 5ITZA 1GUDA 4DYVA 2BFDA 3HLYA 3GO4A 1Z83A 2OV4A 1L8LA 3K0AA 1DU4A 3DZHA 3KWJA 3F46A 3NBUA 1DSSG 3NYIA 1UMCA 2LXNA 5DGXA 3AU8A 5GZ6A 2VTBB 3ZVNA 1IPFA 2C2OA 3ECAA 1M8PA 3U7FB 3S2YA 1H1LA 1U0TA 3FZGA 1A7UA 4LYAA 3ZGLA 3HYLA 2FW6A 1NUAA 3F9CA 2A0UA 3BH7A 1RABA 3GEHA 3LJKA 1V25A 3ND7A 4C7XA 4RAQA 3RG2A 1MO2A 3MIZA 3EQ8A 1CF9A 2JIOA 1OLSA 2YFKA 1EE2A 1WDWB 2AT1A 1J1IA 2H57A 3R3VA 1FBNA 1TZBA 3N86A 5J2TF 4A0HA 3QBTA 1DX9A 4B80A 4UXIA 4LK3A 4RMIA 2WTXA 5FHQA 2VPQA 3VR6A 2ZTVA 1XMSA 1K6XA 1KHHA 4DPMA 3PXUA 3QMVA 1UDRA 4P22A 3O5AA 5ALRA 3UYKA 2XWJI 2QF7A 4DARA 3N8NA 2GARA 1NAIA 1ZD8A 3K1AB 3AJAA 1KJ8A 2YXBA 1AKRA 1HNZB 1A04A 4WKGA 521PA 2JFQA 1DIHA 2PIDA 1PJCA 4FFOA 2OFXA 4AO6A 3LQFA 3OA0A 3K9HA 3R09A 4NPCA 3GD5A 2D4HA 1SKBA 2CL5A 3P4YA 4H6XA 4Q9DA 1WXQA 3V3TA 5IYZB 3O4FA 2XUPA 3RG8A 4KGXA 4CM9D 1WDMA 1XNHA 3BD6A 3LM8A 4CF6A 1XKLA 3U7HB 4BC1A 2VQSA 1RRKA 4MVJI 2BFPA 4E33A 4EZBA 5C32A 3EZ6A 5D3MA 4NI5A 5I9TA 3GLFB 2VYND 2RAVA 1HE8B 1BS2A 2C97A 1NE7A 3OE1A 4MQ6A 2DR3A 3JWGA 1GM5A 5JDCA 1M3SA 3PVCA 3QE9Y 1UBEA 2ROQA 3AUUA 1V3UA 3JQEA 4HAVA 4JDPA 4L07A 2B8JA 2DF8A 3A1WA 3IUMA 2FXIA 2GERA 2HA0A 4M9XA 2X0DA 4XIGS 2RCNA 3S1AB 3VU0A 3JQ9A 4EIWA 5FOXA 1MC8A 3KHUA 4ICIA 1BCRA 1L5ZA 4P84A 3UM9A 1F5SA 2X2FA 4RULA 2PX3A 4GOOD 3TAHA 3DE4X 1JHDA 1O1YA 3IDSA 1VSBA 4R1QA 3B9PA 2H11A 1XU7A 2OCDA 2BTOA 2PXHA 5F7XA 3SEZA 3RHZA 2ZRCA 2ZPTX 2VYNA 1V96A 1DBWA 3NI2A 5B6PA 2HCJB 1WPGA 3K15A 3DHWC 1G5PA 1V1RA 2AI3A 3U81A 5AKEA 2KBEA 2YX1A 5ULLA 3WYCA 1A88A 3KSMA 4YRJA 1LF0A 5ALDA 1P60A 2F1HA 2IPNA 2WG2A 3IUQA 2F9MA 1KI2A 5HUQA 3PYXA 1BQ4A 5HA5A 2V7QD 1M6WA 1VC2A 3IAEA 2BLNA 1VKRA 2Y2VA 1JSLA 3EDYA 3K31A 4GBMA 4N3NA 2GK4A 4GOKA 4IUDS 3U80A 3R8FA 4K9MA 2VDMB 3K2BA 4ODIA 4DWJA 3KJQA 4O5AA 5C8YA 4BUJA 3DYBA 1NI3A 2QD1A 3W9YA 1NULA 2QXYA 3ICVA 3ZHRA 1WVIA 1ZK0A 1XRQA 1NI5A 4X97A 1GILA 3EEQA 4C6TB 3TZKA 4A8TA 3ETNA 3CSUA 2CLLB 4CRWB 1WJGA 1RZUA 4M1KA 2CSXA 1PE0A 5LQAA 3MFYA 3W1VA 1ZD5A 3I6BA 5CVVA 2W42A 3H2SA 3OQIB 2ZIAA 2OAP1 4KGZA 1TF2A 4M0UA 2NZUG 3WX0A 3KEMA 1CQIB 2BSQA 4URFA 2DECA 3II6X 3K70C 1WOMA 3QEOA 3BTUA 3PIIA 2YDXA 2QM3A 3GYGA 2HRDA 4WXEA 2YV1A 3HI6A 2MIIA 1B6SA 2Z1DA 2NM0A 1NF8A 3WLNA 2IXBA 5TT1A 1N75A 1FS5A 1Y89A 3A04A 2CNBA 2F3QA 2VSXA 4IGFA 4PW0A 1T8RA 2V3VA 4OSEA 4TLEA 5DNVA 2AG6A 4YPOA 1ZCAA 5H4HA 1T3GA 2D2FA 3JQ8A 1W85A 1TCBA 4DQLA 4B2PA 4DFDA 3GRZA 4A6EA 4H0FA 3R74A 2HZBA 3B1ZA 5TQJA 3RT9A 4DA8A 1JMYA 4WXYB 2IPXA 3QUTA 4ZHQB 4ZI7A 5A4AA 1TNDA 2ZUFA 2JCSA 1TLTA 1T4GA 3KSZO 1VLJA 1W9HA 1HRDA 1FTWA 1B2RA 3TPZA 5BN4B 2ZIGA 4R6WA 2P9QA 1A8QA 1NJSA 3MUNA 1U7OA 1WKBA 3T7SA 3TRHA 3OJFA 5CAEA 5K20A 4YLEA 4HH4A 3QEJA 2Z56A 3HP1A 2Q2VA 2A2ZA 1B1CA 3H6KA 3QVJA 5BUQA 3EWSA 1FNMA 4QECA 2I7XA 2D2XA 4CU5A 5AICA 5MF6A 1S9DA 4Z99A 3KYCA 3ZU2A 2YV3A 1ZINA 4MVXA 1FNCA 5BYKA 3DZBA 5K6AA 2BFOA 4H60A 5KDDA 1BYUA 2IXFA 4JT9A 1O9HA 3EPKA 1E3MA 1NRJB 1ULUA 3D6UA 3HI4A 4B6JA 3UHJA 4BKMA 5LDGA 5IVKA 3G2MA 2FMKA 4S1WA 4DIEA 2YWJA 3E6AA 3HDQA 2BHSA 2NSDA 3DVAB 3KOUA 5TDHA 2JFWA 1TCUA 1O8CA 2C4HA 3W77A 2HZ7A 2FN9A 2EKPA 4LWZA 4ZDJA 5KNCD 2PUEA 1FDRA 1HDIA 1YS6A 4LOKA 2Y0DA 4G26A 4AJIA 1DFGA 2H06A 4A2PA 4F97A 4ZYWA 3R8XA 1U4NA 1RW4A 2PZEA 5EIOA 5EUBA 4OX9B 4LTDA 2V45A 4EG7A 2CZQA 3AY7A 2SCUA 3FOZA 1N6OA 1QFYA 4GSYA 5GJWC 2QMYA 4D4KA 2A35A 5KAMA 1P39A 4D5EA 4E7PA 2IELA 3A1NA 2CUTA 2DHEA 4IUBS 4MS4B 5A5FA 3RJZA 1Z2OX 3GZTB 1RPZA 1XN4A 3ZJYA 1ISMA 2ZYVX 5HKLA 2PXAA 2VJMA 3ESQA 2BFEA 4AQDA 2R8EA 2OBNA 4ZCTA 1F0PA 5JFOA 1L6RA 1TGYA 3FTQA 1I7LA 5FLEX 1JYSA 4FOOA 4FOLA 2WUDA 4YRKA 2YMMA 1KVRA 3HPRA 1T43A 2EX4A