3HIFA

The crystal structure of apo wild type cap at 3.6 a resolution.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
199
Chain Sequence
b'TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structure of apo-CAP reveals that large conformational changes are necessary for DNA binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 51
structure length 199
sequence length 201
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hifA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hifA01
4QM9A 3HTSB 2YR2A 4E2SA 2A3SA 4G6DA 1B9NA 1J1LA 2ISYA 1J3QA 2DO7A 4XETA 1AWCA 5HS9A 5FLXK 1QQIA 1S7OA 4I01A 4H7LA 4RB2C 3R60A 1UW8A 2PAKA 1D5VA 1CX4A 5DUKA 2RNJA 5KHIA 3OF1A 5BPXA 3BWGA 1SMTA 2P8TA 3H3UA 3O6BB 4RGSA 1VJ2A 3I64A 2BNOA 4CHUA 2N7GA 2XAJA 5FO5A 1TNTA 1ZYRF 3EQLF 4NQWA 1YFHA 4WBBA 4TV7A 4U0YA 3U1DA 2MLGA 4U7BA 4EWEA 4L9TA 2LNBA 1ZVFA 5EFUA 5J7MA 1FP1D 3FHIB 4Y13A 3P9IA 2M30A 4XFHA 4ETSA 5EEGA 2PFBA 2GA1A 1SAXA 2FNAA 4P9GA 2RVCA 3R61A 2PAMA 1BC8C 4HBNA 2VC0A 1W5SA 2BEOA 3BJOA 3TO9A 3ZPLA 1HQCA 4UNOA 2ZKLA 3VODA 5FD5A 2PBIA 1OYIA 2ZCWA 3S0MA 2J5PA 3FZ3A 4HF1A 5FLHA 2MNGA 1T6SA 1EH6A 1PDNC 4Q5SF 1OR7A 1ZZBA 1YFUA 2D93A 5L3EA 2E1NA 5K5RA 3H50A 4XF4A 3WODF 4HSLA 5I91A 2IW5A 3RNSA 3UKVA 3H8UA 3T5XA 1QXJA 2IA2A 4AVAA 1FC3A 1R7JA 5FB2A 1WI9A 4FBFA 2B9UA 5KBFA 4A6EA 1SEFA 4IEZA 4AVCA 3SMHA 2K27A 4Q0UA 2V9VA 4S04A 3U0ZA 4IJAA 2FBHA 1CAXB 1T38A 1SFEA 4AVPA 2FXAA 4DNCA 1FOKA 1USTA 2QQAA 1YG2A 2MPFA 3E5UA 1FYKA 2LF7A 5CVIA 1X7NA 2VECA 4G9YA 3JZVA 4MGKE 2OQRA 2Q0OA 3V8LA 3KP4A 4AVBA 1U12A 1K6OA 3SCHA 2QZ8A 1A04A 3HT2A 1XSVA 3H7JA 3K0LA 4J1WA 1IXCA 1FLIA 2Y48A 3LQRA 5HI0A 1R5GA 3B73A 1QWRA 3QAHA 1H1IA 1J2XA 3FX3A 3R6SA 5HDKA 1TW2A 4UXAA 5D5XB 4BHBA 4AIKA 1T98A 3ST7A 4CO8A 2BE5F 4IXAA 5IT3A 2M45A 3TQNA 3E3VA 1YO5C 4HX4A 5ED4A 5I0UA 2HR3A 1WQ2A 4OU0A 1L0OC 5HS7A 2ZMEB 4EGZA 4HA8A 1SD5A 5DV5A 1JE8A 1FZPB 4PIZA 3M70A 3IWZA 2D40A 4D7TA 1P4XA 3N4MA 1ON1A 2G9WA 2FF4A 2L54A 1BIBA 5F1RA 2Y0MA 3E97A 3RTRA 3U2RA 2I45A 1Q1HA 1UB9A 4BYYA 1ZZ9A 4CZZA 3V8KA 4Z2YA 2XAFA 1XDSA 4F7ZA 5D1IA 2EV6A 3H9AA 3Q5FA 1HSJA 3FXUA 2WTEA 3HSFA 3LA2A 3WE2A 3CEWA 1O3QA 2X0LA 2B8MA 4I09A 4QGNA 4KIBA 3RPQA 2UY9A 3RKYA 4OIQF 5ILUA 3DF8A 4JK1X 2G7HA 2EVXA 4A0XA 2BBYA 1UCRA 3Q9VA 4M9XA 4OMYA 3M3IA 5CVVA 2ZXJA 5LEJA 2BGCA 3JAMK 2O8XA 4OIRF 2X4HA 1S6LA 3PLQA 5E18F 3ECOA 3K69A 2K0GA 4HQEA 4I2OA 4KN7X 4RB1A 1BC7C 3O14A 5K1YA 2P7CB 4IEXA 1XCVA 1O3SA 5D4RA 2GA2A 4WZCA 1WWXA 2XIGA 3JW4A 4MEYF 5KK1A 4ESJA 4IPAA 2DBBA 1HW2A 2D5HA 2B0LA 3IHUA 5CVRA 2XASA 1UD1A 4EROA 3CJXA 3NRVA 2VBWA 1ZG3A 1EV7A 2ET1A 3RJPA 2XAQA 4XFGA 3SZTA 2DT5A 1O7LA 4MQVA 2VT2A 3CJNA 3FMSA 1O3TA 3ISPA 4HLTA 2VBYA 2CAUA 3CLPA 1T0FA 1R58A 2QBYA 1IPJA 2PI0A 1HW1A 2VN2A 4E2GA 4MGYE 1IN7A 3GW2A 1ZZCA 2XL7A 3E6CC 4UHTA 1K78B 1MJAA 4BXUA 1CAWB 2OU2A 1YYVA 3FXQA 2HZTA 4GO1A 1VP6A 3HSRA 3WU1B 2ZO4A 5DYMA 4P55A 1DPRA 2COMA 4JTNA 2OQGA 1YWKA 1NHAA 4ENNA 1DGRA 3EQEA 1TQIA 2M87A 4XFAA 3CDHA 4EM0B 2YX7A 1S8NA 3KSCA 5LHIA 2K7LA 5JAXA 4GYIA 4MUVA 3RKXA 1EPZA 3SHRA 4IEQA 2IVMA 1I1GA 4EM2A 2GAUA 3C1DA 1R22A 2L3DA 2P6TA 5HVQC 1Y3TA 4OINF 2OBPA 3GYDA 3QU6A 3DKWA 2BNMA 5AONA 1XSDA 4KN4X 2LSOA 5DUIA 1Q43A 5JFRA 2EK5A 3LAGA 2GIVA 4RGUA 1U78A 2MH2A 4A2UA 3EJKA 5LHHA 2XVCA 1FY7A 1NE6A 1LQ1A 2YPRA 4YG2F 4IEUA 1ZX5A 1YW7A 4HVQA 3FFQA 1DUXC 5FQ0B 3FXRA 2Q1ZB 2V1UA 1L3LA 2K02A 2WV0A 3WTSC 3TNPB 2WWYA 1MDMA 3IWFA 2FE3A 2IXKA 3K1PA 1QXRA 1XMKA 3DQVC 2MH9A 1FT9A 1U5TA 3O3KA 2H6BA 4KIFA 1KYWA 4XLPF 3I5UA 2PJPA 1Z6TA 3T1BA 2PFWA 1YIOA 2J5OA 3EO6A 1LB2A 3KZYA 1PUEE 2W57A 2DTRA 1R1TA 3LZZA 1KU2A 4OLLA 3V7CA 4Q0VA 3WGIA 4IVNA 1PP8F 1CAVA 1WRJA 4CGZA 2ZKZA 3ZDSA 2UXNA 4XFFA 5JR3A 4QMAA 1YHFA 1P6RA 1SQ4A 5I93A 2GC1A 3J80Z 3EUHA 3SXWA 4ENJA 1DZRA 2RN7A 4XLNF 1WGPA 3DN7A 2VOOA 4YYOA 1KYZA 2WC2A 3ROUA 3ELNA 4H0EA 3PFIA 1QPMA 1LNWA 2HEOA 3D0JA 5KVRA 4PIXA 3CO6C 2DFIA 1B1BA 1IXRC 4EJWA 5LLQA 1D8JA 1RL3A 3BCWA 1KQ8A 3H1MA 2NNNA 5AIQA 2PAEA 4AQ6A 5H20A 2K86A 1IUYA 4WX9A 5EEHA 4QLCU 2EA7A 2IPQX 5CU1A 1GQHA 1YLLA 1S7AA 2V79A 3QU3A 2E7WA 4KFCA 3C7JA 3OOPA 1BM9A 2MC3A 4UV8A 2Z2SB 1GVJA 1I5ZA 4UUVA 1HKSA 1FX7A 4PGHA 2HDCA 2DW4A 2ATFA 2BYVE 2FBIA 3V4GA 3ZMVA 1QY4A 4KWKA 1JGSA 1UIJA 4JTOA 3K2ZA 3B02A 1FBSA 3IDCB 1F4KA 4U0WA 5E1RA 4NVPA 2W84A 4BIFA 3CUQB 2GXGA 2ZMEA 3S7IA 4KA4A 1KU7A 4YFXF 3EYIA 2GC2A 3FWEA 4U7DA 4KNYA 1YS6A 2P6SA 3F8CA 1L3JA 4YNIA 5FLIA 3H1WA 5BV6A 5FFZA 2PMHA 1AOYA 4UBHA 1QZYA 4S05A 1LKNA 1OMIA 3CTAA 1ZZ8A 4IERA 1ON2A 4G7OF 3U11A 5FPXA 2DLLA 1EH7A 1OPCA 1FXZA 4RAYA 3J7AO 4WXCA 4N0BA 4B09A 2OZJA 3I71A 4Z82A 4WXDA 2HQNA 1J0RA 1IW7F 1J9IA 3MDPA 1KU9A 4M73A 4A6DA 1QO0D 1IN6A 5FPZA 3EYYA 3NKTA 2K4JA 4X6RB 3ZMZA 3CLOA 3F6OA 1SD7A 3C3WA 1J59A 4HVRA 4CXFA 1UCXA 4KDPA 3I59B 1B9MA 1G3TA 2ZJ2A 4LG0A 5FDBA 2V6CA 3HOSA 2GH2A 2M1BA 1U2WA 3HSEA 4QGMA 1DDNA 3HHGA 3Q9SA 2V1DA 1TBXA 4IETA 4M74A 4R8HA 4Z07A 3ZMDA 3UKTA 4EM1A 1KU3A 2EFOA 1DP7P 1ZH5A 3JTHA 1STZA 1H9TA 4YFKF 3WGHA 4PGGA 3NW4A 3EDPA 5ICGA 3WTYC 4TLFA 1OYYA 4LEJA 2HYFA 4MHGA 4M71A 4GULA 3HTUA 5D5VB 4AXOA 2IJLA 4I0BA 4HW0A 3SQNA 2FSWA 1BI3A 1MGTA 2DQRA 2QYOA 1RUOA 2RQPA 2KIMA 5FLXZ 3DFGA 4LLNA 1ZNPA 4AIHA 2O03A 1I27A 4FHTA 2OD5A 3FMRA 5LGTA 1CAUB 3C3VA 2UWMA 3GWZA 3OGJA 4LULA 2P5KA 2HFHA 3ETQA 2A61A 2Q30A 1FBQA 2FU4A 3ZMSA 3BJ6A 5KHKA 3LWFA 3SHFA 3JSPA 5HS8A 1C0WA 4Y15A 1B4AA 4MNUA 3RYKA 2E7XA 1WA4A 4M6YA 1LDKB 2P7VB 3HOTA 4WWCA 4LB5A 2HTJA 4XSXF 4KIGA 1ZG1A 1HXDA 5JSOA 5BXXA 4MGZE 5JHUA 3I54A 3KP2A 3L9FA 3KMHA 2EFQA 2DCTA 4XFCA 3LA3A 1G6NA 2HJIA 3F21A 4LMYA 1X3UA 4P9FA 1J3RA 4I0AA 4KMUX 2EWNA 5BPDA 1P2FA 4KICA 3TGNA 2STTA 1WKMA 3M7GA 1ZLJA 3C18A 2MHFA 2MA3A 3IIAA 3I58A 3WU0A 1RNLA 3PVBB 1Y0UA 2FNPA 2EFNA 2NNYA 2NAZA 4K8FA 4LLGF 5BQTA 4XF0A 2D1HA 3H1YA 1RC6A 2FOKA 3CUQC 2Q4SA 4FAHA 2IC1A 3IL2A 1J5YA 3RPUA 3ZN0A 3H92A 2HKXA 3F6VA 3LQQA 2FQPA 3F3XA 3BROA 1LR5A 5HLGA 2JSCA 3P7NA 1W7PD 1XB4A 1R1UA 5JR7B 5ILSA 4MEXF 4BQAA 4L0YB 4Q4ZF 3TKYA 1HKQA 1TNSA 3WGGA 2VPVA 4CDGA 4M9ZA 3GUDA 4EWAA 2OPKA 1BI2A 1BI1A 1NE4A 3IC7A 4MGIE 2VT3A 5E1XA 1EP0A 3W6JB 1ZRDA 4N9IA 1YLFA 2A68F 5DD4A 4U0VA 1HSTA 3TDZC 2GQQA 4KYWA 2O3FA 1HBXG 2PTMA 4D7SA 1D3YA 4G7ZF 4MX3A 5KHHA 4LJZF 2EFPA 2ACJA 2O0YA 2O61A 2H94A 1XSXA 2GC0A 3J81K 4ESBA 1UFMA 1F1ZA 1GHCA 1G3WA 3GZ6A 3L7WA 1TQPA 4O9EA 3COAC 4RS8A 4LK1F 1QZZA 4YIIA 4XFBA 1R23A 1P4WA 4UBGA 4FX0A 3L2HA 1O7FA 3I4PA 1H0MA 1IZ1A 1LJ9A 3QPHA 3REOA 3KGZA 2IXCA 2QCSB 5C6CA 1ZRCA 3HRTA 1HW5A 1KQ9A 3S2WA 3IRQA 2GWRA 2A07F 5D5UB 3GVAA 2HTSA 1XGSA 2Q8KA 3OD0A 4IRIA 3F8MA 3RKWA 1RTVA 1YFWA 5H6RA 5JSPA 4EJOA 2KIFA 3VB2A 4QX5A 2VBZA 3BOQA 3WTUC 3VHRA 2STWA 5LRRA 3BP8A 1DZTA 2EV5A 5LRSA 2VC1A 1W7PA 3WTWC 1B59A 1ONVA 1XE7A 1UHMA 2GXBA 4JBAA 5JI6A 5AIPA 4EVIA 5KHJA 1REPC 2R7FA 3M8EA 2UY8A 4HF0A 4RGRA 5TRDA 2F4PA 2MLKA 4B8XA 4YFNF 4WK8F 3WTTC 2IRFG 4L9VA 3HYIA 3GZ5A 4M72A 3D5LA 3JSOA 2DQLA 2BV6A 3GLXA 4LD5A 1XGNA 4ZZLA 4HF2A 1J75A 2RC4A 3BPZA 2DPDA 3U9GA 3DEUA 2FMYA 3J81Z 4UVCA 3JAMZ 2XLFA 2KKOA 3R0AA 4ONUA 3SZPA 2P5VA 1W5TA 5HDNA 2F5FA 5HOOA 3PQKA 4RB0A 1VR3A 1GXQA 2AS5F 2D1VA 2CQKA 2PMUA 5J8FA 2KRFA 2H27A 3F8FA 1CGPA 3P9KA 4HN0A 3G3ZA 3D82A 3E6DA 2K9ZA 2GZWA 3TO6A 3F22A 3IDBB 3I59A 5BPIA 4HV5A 3PNAA 4EMSA 2L02A 4LGWA 2CW0F 1BBYA 2ZBKA 3SXYA 3GXOA 1IN5A 4HDVA 1ZHFA 3RZZA 2XROA 5E8IA 2EAAA 5DEQA 2O6GE 1FBUA 2HGCA 3TOAA 2A69F 2QVOA 1KGSA 4HAMA 5DCFA 1OKRA 4LFUA 2DI3A 3QRFF 4O3MA 2A5YB 3ECHA 1CF7B 2CFXA 1I6XA 1SD4A 2L4AA 2FQ3A 2IA0A 4IEOA 1ZGJA 4P5OA 2ZNYA 4QGLA 3CO7C 1Z91A 5BUVA 1OFNA 2XAHA 4PCQA 3G7DA 3WG9A 5J8CA 2DU9A 2QENA 4ENKA 1U6GA 5ERIA 4G8XA 4HVOA 4LB6B 2Z99A 4KWJA 3LOIA 3QP6A 3ABTA 2PLYA 4ZYEA 3HHHA 3DL3A 4BH9A 2VQAA 1Y9QA 1JXSA 2EA4A 3DV8A 1ZZ7A 1R36A 4HBLA 3ULQB 1XDUA 4HZFA 2DAOA 3U10A 5I0TA 3CUOA 2Y75A 4IEWA 3LAPA 1FI2A 3EHKA 4QXKA 1CAXA 5I8YA 3VOEA 5ILVA 1Z6RA 2W85A 5CADA 3ZMTA 2OA2A 1FSEA 4G94A 3IBMA 1IPKA 4IHSA 4MZUA 3OTFA 2CV6A 5LBQA 2V1XA 3L2CA 3NJZA 4MH0E 2XAGA 2BNNA 4GYGA 5FD6A 1HKTA 4M6XA 1O3RA 4XEZA 2IA1A 5DCMB 2L4MA 1UHWA 3S7EA 3MPBA 3H7YA 2PN6A 3F23A 3OCPA 1E2XA 2R3SA 2LKPA 3VEPA 2V09A 5BY5A 2EJRA 1XRUA 2KIUA 2QVSB 1V4RA 1EH8A 4A5MA 3ACLA 1XGMA 1XGOA 2DK5A 1V3FA 2HKOA 5JCTA 2XLGA 4FAGA 3KFWX 4A0ZA 4OFGA 2ADUA 4RGXA 5DDGA 3IKTA 2XGXA 4HLXA 5FGMA 2UZKA 1MZBA 4Q0PA 3IRRA 1DPUA 2UYBA 4G7HF 3KLNA 2CG4A 3L09A 3MYXA 3LFKA 2QLZA 1WSUA 2LDUA 3V7RA 3HIFA 4L2NA 5FLJA 3V8JA 5FFXA 2Z5UA 3KGLA 2MBFA 2Z69A 3KP6A 4HQMA 1USSA 4OMZA 2D2WA 4META 2G7UA 1NZCA 3DPLC 2M5WA 4AIJA 3RI4A 3GFJA 4FX4A 4MV2A 3V7SA 2QJVA 5L3BA 2IXJA 5BS6A 3HT1A 1RGSA 2A6HF 4XBFA 1XD7A 5TJJA 2PG4A 3M1EA 4ZH4F 1JHFA 5HLHA 3NVCA 3MWMA 3SCFA 3FM5A 4YIFA 3LWCA 3EETA 2R7DA 2YX4A 1BN5A 1KQ0A 2FA5A 2KJCA 2L01A 1SFUA 5LGNA 3MFKA 2WFPA 5CYVA 1ZZ6A 4A0YA 1W4MA 3N97A 3KEOA 1FPQA 5D8LB 1ZARA 3KZZA 2Q2EA 5CJ9A 3WW2A 4Q0SA 2HOEA 1BI0A 1H1MA 1S3JA 3F8NA 1QNTA 1YFXA 2ZNZA 2EV0A 3QOPA 2NRAC 3M8FA 4HN1A 1TTYA 2VXZA 2XL9A 2ET7A 1XCBA 2HS5A 1U8RA 1F9NA 2W24A 1YTYA 5A2QK 4LUMA 4Y17A 1ZRRA 1MDMB 2B5HA 1I1SA 5CVJA 1PP7U 1PMIA 4KU8A 4D0PA 3TO7A 2OZUA 2W25A 3MAJA 2PHLA 3TNQA 1U5TB 4BHPA 4LLOA 2RV8A 4YSFA 3USSA 4ZYHA 1G3SA 1G3YA 4BHCA 2CO5A 4Q47A 5K5OA 1IF1A 4A5NA 5CLSA 2ETHA 1BOAA 1ZGAA 1J3PA 2H0VA 2AXLA 4UXNA 5JSRA 3CO2A 4HLYA 1CAVB 1T39A 3DXJF 5L3GA 3AAFA 4I02A 3LSTA 4EJUA 4NB5A 4XF9A 1IAWA 4A12A 1K78A 3WTZA 2D45A 1CAWA 2ISZA 2M8EA 5ICEA 5L3DA 3T8RA 2O8QA 1MD0A 1YW9A 1ZN2A 4QWQA 4JQFA 2QQBA 3KEQA 2IP2A 4HOBA 2TDXA 4O5VA 3DPTA 4PDKA 2EB7A 4L9NA 3UKNA 2ESNA 1XE8A 2OYZA 1IN4A 4ZU7A 1FWZA 1ZLKA 1Q5OA 4GCVA 5DD8A 4RD7A 4PZJA 2D5FA 1ULYA 1ZREA 4I7HA 3RIRA 3HUGA 3W6KB 2IT0A 2CYYA 5I0RA 5IT9K 4L9JA 2P5LC 3L00A 1MJBA 4KUMA 1YQAA 4PJYA 1FYMA 5BMZA 5D6EA 1UPIA 1BJAA 2H6CA 4EQQA 3ES1A 2A6EF 2JZYA 4N9HA 4F8AA 2PHDA 3BJAA 5AVPA 3BY6A 1Z9CA 5J48A 4UVBA 3BDDA 3FM3A 2DPUA 2Q0AA 5A2QZ 3KP5A 5E20A 3ES4A 1O57A 5I8SA 2OZ6A 2IXHA 3BU7A 3R0JA 4M9SA 1KA8A 5FQ0A 3PQJA 3KETA 1XMAA 2P4WA 3F72A 4XF1A 1LRHA 4HX8A 1OI6A 2Z9OA 4ZZDA 1H9GA 4KU7A 3KCCA 2KXLA 5I0SA 3BALA 1TLHB 4XSZF 1YS7A 4KMFA 1NXMA 1YUDA 1GQGA 5D8KB 2QM3A 3HRMA 4HYEA 1SMYF 2O1QA 2QWWA 4IESA 3WW3A 4EJTA 1J7KA 1CF7A 2JPBA 2Z3YA 4RAZA 4XF3A 2K4BA 4P96A 4I98B 3FF5A 2JTVA 5KHGA 2JT1A 1SD6A 5E8GA 4NHJA 3ZMUA 4KL1A 4E2QA 4IRGA 4R1HA 3GFLA 1RIOH 4ASNA 2VODA 5LGUA 3HRSA 3FE5A 3QP5A 2OAZA 4WF2A 2NYXA 5D6FA 5ICFA 3RYPA 4XFIA 3P9CA 3GX4X 4RB3C 2XRNA 2CGPA 2EFWA 4ZU5A 2F5CA 1IN8A 2DK8A 3MZYA 5IT9Z 1EY2A 5BOXA 4MQ9F 1NYWA 4Q29A 5E1ZB 2HWVA 2XLAA 5D4SA 5EZWA 2FMLA 3ML6A 4AQ2A 1F5TA 4ESFA 1RUNA 4LG0B 5FCCA 3G73A 1U3EM 3NEUA 3BPVA 3ZQ7A 3O2PE 3DP7A 2NS0A 6PAXA 4AD9A 1U5TC 1IRFA 2ESHA 3BPXA 4IRHA 3T0YA 4GXOA 2IXIA 1R00A 4IEYA 4L5JA 5DCMA 4I3PA 2OA4A 2JPCA 4U88A 1BIAA 2VE8A 1OD5A 3KP3A 4EGYA 3K1MA 2PYTA 2YSRA 3D0SA 3K1NA 3EBRA 2ZFWA 5L3CA 3BB6A 3GBFA 4MGRA 4LLLA 1E17A 3GYHX 4YRDA 4UV9A 4DQ2A 3GEZA 3VFZA 2F2EA 2XKOA 3NSTA 1RZ4A 2XHKA 3F8BA 3HQXA 3BZ6A 5D5WB 3IKVA 1O5LA 2CSOA 2CWEA 2P17A 3R4KA 3LAJA 4MTEA 5E17F 3MEXA 3CUQA 5LEKA 4KT5C 4Q48A 5F64A 3LA7A 3ABUA 3I53A 3RDIA 1G4DA 1JHHA 3GF2A 4LA2A 2FBKA 3QACA 4KWLA 4LUKA 3HRUA 2PQ8A 2C0ZA 4ZYDA 5JVTA 2GU9A 1LEAA 1Z1DA 4BNCA 3QPTA 3FZVA 4LK0F 4P9UA 1YW8A 1FNNA 3ELKA 2PQQA 3J80K 2FEZA 2ELHA 2HQRA 3MCZA 4E70A 1IRGA 1DGWA 4JV4A 4K2EA 3E6BA 5I8TA 4GGGA 3TDUC 2VOPA 1K7AA 1QBJA 1S29A 4PIYA 1TQMA 4WVZA 1SFXA 2Z33A 3I7DA 4ZYGA 3OV8A 4JVAA 4HMZA 3ZP5A 3ERED 4UVAA 2RDPA 1JUHA 2F5DA 4EJVA 4ENMA 2YU3A 3FHZA 2E1CA 4HSJA 4IHTA 2UYAA 3E6MA 2Y0OA 1UIKA 3GFIA 5C8WA 4L0ZB 2VE9A 4O6JA 1PM7A 4WCGA 2MD5A 4OIPF 1LEBA 3JTGA 5E16A 4ZU4A 3WTXC 1O5UA 1Z7UA 1Q3EA 1Z05A 2QDRA 5H6QA 3GFMA 4L11A 4MTDA 1EYBA 3WW4A 2QNKA 5HDGA 2ETEA 5L3FA 3E5QA 1R5HA 2FRHA 4WXHA 3GO5A 4CICA 2KJBA 4L5IA 5J3UA 2E9QA 4FT8A 2HYGD 1FYLA 2VONA 4AWXB 4HDUA 2QUFA 1LDDA 3RYRA 5ICCA 3FJSA 3WTVC 4XRFA 3KE2A 2F5EA 4B29A 1YFYA 1CAUA 3H3ZA 2LF8A 1SFNA 3TOBA 1V70A 2PEXA 2QQ9A 1RI7A 4X6QB 1ZG5A 4IEPA 4IF4A 3NL1A 4DINB 5CVUA 4YARA 4O9GA 4OOIA 1X82A 5F6FA 2PA7A 3SCGA 3M9AA 5LHGA 1LDJA 1QGPA 2RKHA 2H09A 1D8KA 4LA3A 2UXXA 3CF6E 3MZHA 1GXPA 5HLIA 3CL1A 5K8SA 2EA2A 1TQ5A 1X8EA 1P92A 3FMQA 1FSHA 2JRTA 1TW3A 2IXLA 2C6YA 3E5XA 3WW1A 1XN7A 1ZRFA 1J58A 1VTNC 1P4AA 4L18B 5J6XA 2RGVA 1ZAOA 3KLOA 5T3NA 1FP2A 4OIOF 1K79A 2CAVA 1WLTA 3I0TA 1OYWA 1O4TA 3MQ0A 4HV6A 4EWDA 1T2KA 3SFZA 3K9TA 3KP7A 4CYDA 4LTAA 1R1VA 3NQOA 4QM8A 3WE3A 1ODDA 1MJ9A 3ZN1A 1IXSB 1W7PB 2GC3A 4R52A 4Q0QA 2QBYB 4HX7A 4BAYA 2XKPA 4ORFA 4IEVA 1MKMA 5K5QA 2XUBA 1LVAA 2XV4S 4J1XA 1B6AA 4R79A 4ON0A 1X8MA 3T8TA 2VBXA 4G6QA 5E1WA 4EV0A
chains in the Genus database with same CATH superfamily
1MW7A 4QM9A 4E2SA 3CU7A 2ISYA 4QQOA 5FOBB 3ZQIA 1VF9A 2DA6A 2CS3A 1BL0A 3POEA 4M3BA 4LMFA 4J01A 1AX0A 2R30A 3LGRA 2ELKA 3POWA 1CX4A 5DUKA 3LFIA 2RNJA 2EQRA 3OF1A 4QT6A 1GMMA 2X1CA 1GWMA 4YZ1A 4RGSA 4D7MA 2HXOA 3I64A 1YQCA 3TEDA 2XAJA 3N9QA 1YFHA 1W6OB 2MLGA 4ABZA 2KDOA 2DUQA 4A3DJ 2OUJA 3D3AA 1IV8A 3NNGA 1QEXA 3OIQA 5EFUA 1ORKA 4GJZA 3V65A 3NNFA 2M30A 1D2QA 3ZPYA 3LB9A 4FISA 4JRLA 5F1JA 5EEGA 4RS5A 2PFBA 4Y52J 4GAZA 2XOMA 4OI0A 2DFHA 3VD9A 2RVCA 3R61A 2JD4A 3BJOA 4DOZA 2RMU2 3TO9A 1S0CA 3LD8A 3OYGA 1RUF3 1UELB 5FD5A 3L1PA 9ANTA 2J5PA 5HCAA 2KT0A 1DP3A 1PYVA 3WF2A 2HH9A 5FLHA 3CDLA 1EH6A 4B48A 1R093 2NOGA 1YFUA 2M9HA 3NJYA 2E1NA 4BB3A 3H3VK 3H50A 1JW6A 3WODF 5I91A 3UKVA 3H8UA 1NUKA 3S32A 2DDAA 4FP3A 1SFKA 2I2SA 2OQ6A 2XVGA 1BOBA 5H9PA 3ERMA 1FC3A 3MV11 1ULDA 3KYCB 1JYXA 4NAOA 4AVCA 3Q8BA 3G4SI 1P7IA 3PUQA 4A7ZA 3T2PA 1ACIA 3HNYM 1LUJB 2KL4A 2JRMA 3RQ0A 5FXWA 3V0AA 4DZPA 2X5IA 3TBDA 2KRCA 5C9AC 4AVPA 1SLLA 4GH4C 1E5RA 1WCSA 1FOKA 1R71A 1YG2A 2MPFA 1QQP1 1M06G 4MGKE 2OQRA 1PGL2 1U12A 3GALA 5IVJA 4QX7A 1F9KA 3HT2A 3ZCOA 4B8EA 2VZRA 1IXCA 3I3QA 4BOWA 1NG6A 2ZEZA 5GAGJ 1AA7A 3N9MA 4YG3A 4FOQA 4JKKA 2GOMA 5L19A 5FY5A 3L9JT 3JRBA 4AIKA 4BY1J 2VM9A 3OYFA 2W87A 4IXAA 3ACFA 2HWF2 5FKMA 3E3VA 2UWBA 2G0EA 3ZOBA 1CZTA 4EGZA 1PUFA 4HA8A 5A3TA 5DV5A 1JE8A 1P7JA 4D9JA 3W58A 4D7TA 4LKDA 1GUIA 3VBOA 1QMJA 2G9WA 3OG2A 1OH4A 5F1RA 5DZFA 2Y0MA 4BA6A 3E97A 3U2RA 1OVPA 1VBB2 2X6OA 3IDEA 2L5QA 2OXBA 5C5TA 2JKBA 2J22A 5E79C 4BQQA 1PNGA 5D1IA 3C2UA 1WD3A 2ICWG 4XLFA 3IKWA 4BACA 2BY3A 3RZDJ 3HSFA 3ZIXA 2DYRH 1JJ8C 4D3WA 2B8MA 5A7WA 4XORA 4TN7A 2ID4A 2WY7Q 3PL8A 2I10A 5A7OA 2JG9A 5ILUA 4EN0A 2EVXA 1EA3A 4A0XA 1UCRA 4OMYA 1HQNA 1VBE1 2A7AA 3M3IA 5FMBA 1VQPI 2L9SA 5LEJA 3OIPA 1W8TA 2O8XA 4OIRF 1HJGA 2LG4A 3K69A 5FIXA 2P3JA 4B43A 3GM8A 4TYSA 4CA0A 1VMJA 5FY1A 4AFMA 2GA2A 4WZCA 4AI9A 4PLOA 1WWXA 3OR1C 5IOYA 4AHZA 1OLMA 1QJY2 2XIGA 2TRTA 3VYRB 2DBBA 1HW2A 1FMD2 2B0LA 1UMIA 1DQ5A 5IVBA 3WG1A 4DQAA 1D7PM 1UD1A 4MO7A 4EROA 1ZG3A 1XNTA 3LSHA 1N1VA 4E7JA 3C7HA 4IV1C 2OVUA 4XFGA 3BZCA 1UMHA 1SBFA 1O7LA 3Q0UA 2FDHA 3ATGA 4HLTA 4AEKA 4CH7A 2VBYA 4A69C 2CAUA 1R083 4FETA 3ZSJA 1PZ9A 4C0HA 4N7IA 4E2GA 5FRNA 5FP3A 2ADEA 1GT0C 2DFEA 4MGYE 1IN7A 3HD8B 1ZZCA 2XL7A 1JMUB 4W65A 3E6CC 3WF4A 1K78B 1MJAA 3TW6A 1UMQA 1Z0XA 2HZTA 2W39A 3OMYA 2XRLA 2ZO4A 1HB1A 2JJ7A 2OQGA 1IS4A 1OKOA 4ENNA 1IG3A 1I39A 2VKEA 4XFAA 3CDHA 2Y33A 1TT5B 2NN8A 1W8FA 2R7UA 3KSCA 5LHIA 1XSQA 2K7LA 3RKXA 1EPZA 3SHRA 4F92B 4S2HA 2IVMA 4RQPC 3GMEA 1MVQA 4EM2A 1JBCA 3C1DA 1R22A 2P6TA 5HVQC 4H4KC 1T6BX 2OBPA 2VNRA 2XH6A 3A0KA 4P9JA 4GMP1 1HRV1 2LSOA 1D5YA 3BR5A 2YC2A 4XJWA 2EK5A 3AX4A 3LAGA 1C8M2 1S2BA 1QNYA 3HDDA 1HDPA 2XVCA 2PHXA 2ZZQA 3MKYB 3KHCA 1LQ1A 4AI8A 4IEUA 4FPYA 3K4JA 5FMOS 1E3HA 3CBNA 5JOWA 3K4AA 3RQIA 1LGCA 1DUXC 2B45X 5FQ0B 4PLNA 4A3IJ 2Q1ZB 3N05A 4AU7A 4Z6YA 2VBBA 4LXLA 3QOEA 2FCVA 3CJTB 4XRSG 4Y4RA 4QX2A 3ZN5A 1DLCA 3LDBA 1QXRA 3AP7A 3OGSA 2MH9A 1Q8VA 4KIFA 2WZR2 1KYWA 2WQZC 3OYCA 2PJPA 4RLQA 3LMMA 2W94A 3CZUA 5M3FJ 2LS6A 3EO6A 3KZYA 1STMA 2TUNA 2DTRA 2DVFA 3JBG1 3SISA 4KG8A 1KU2A 3LSJA 2BBAA 4XXAA 3N3HA 2VMDA 4IVNA 1QOSA 3ZDSA 3PVEA 4UW4A 1FNYA 2DMNA 2ORZA 1UYZA 3G2BA 3JD73 3EUHA 3SXWA 1K83J 1DZRA 2RN7A 2M2EA 2E7QA 2LUWA 1WBFA 4FE7A 3ELNA 3MIBA 1S5LC 1QPMA 4D5FA 3POGA 2CTVA 2DCEA 3D0JA 3OBTA 3CO6C 4EJWA 5LLQA 4CDXC 1VBA3 1RL3A 2BZTA 2EIJH 3H1MA 2OPTA 2NNNA 2XJUA 2K86A 1HN0A 5C9AB 4WX9A 1RKWA 1GQHA 2JXAA 1S7AA 1KZHA 5KNLA 1JJ6C 1S72I 1APLC 3QU3A 4QPYA 2E7WA 4LBQB 4KFCA 1REDA 4BEHA 2L7KA 3C7JA 1DGLA 2Z2SB 3MBWA 4ASLA 2VLAA 3T2TA 2FQ4A 1MZ5A 4AFAA 1HKSA 3M3YJ 3M3EA 1DHKB 4PGHA 2HDCA 1JXNA 3RS6A 4QPIC 2XF6A 3OL3A 4AGGA 3WOGA 2W1OA 1E5HA 4KWKA 1JGSA 3K70D 2RNGA 3BG3A 2XC7A 1RUE3 1UIJA 1DIWA 2OKXA 3DEMA 5LW9A 2O9LA 5IATA 4M4RA 3MN2A 1OUXA 5DDJ3 2W08A 2A6VA 3HJRA 2W84A 3K10A 4BIFA 4CDWC 3PU8A 2ZMEA 4MGQA 4IL6C 4YFXF 2GC2A 4KNYA 4OWRB 4CSWA 3I3MA 4JX0A 5BV6A 5AC92 2D44A 1RHI2 1LKNA 2PMZA 3CTAA 1F15A 2D3RA 2R7WA 3AMMA 4XBLA 3FXLA 3PJRA 3U11A 1ASJ3 1MBGA 5J4VA 2C5DA 1VQ6I 3SJMA 3JRAA 2P34A 2CV1A 1OCRH 4WXDA 2A6WA 5H2FC 4BCUA 2C9KA 1KU9A 2R7QA 3OD4A 4M73A 4CCNA 2JA5J 1G9AA 1VIWB 3NV3A 2XF7A 4DIQA 4G9SB 4CXFA 2TBVA 4KGGA 2GH2A 2P2KA 5FZIA 3HSEA 4GWNA 1X1PA 2YUSA 4LT5A 3EUKL 1DDNA 1TG7A 3Q9SA 4GD4A 1TBXA 3FIWA 4M74A 3ZMDA 3UKTA 1NCRB 4EM1A 2CWSA 1ZH5A 3RZLA 5FZ6A 4YFKF 1ITYA 4PGGA 5ICGA 4TLFA 5A3PA 3T30A 3RPUD 3HOVJ 1MS0A 4G4FA 5CKQA 2RR12 2CV0A 4I0BA 3SQNA 1DGRN 4OI2A 2FSWA 3S3OA 1MGTA 2QE3A 1O4YA 5CAZA 1HDDC 3S6PA 3ZR5A 3DFGA 4LLNA 1X50A 3ASOH 3BOWA 3D1NI 4YVWC 4IV1B 2Y9ZA 4KG0A 4MADA 5FYSA 3FMRA 1CAUB 3WHCA 4LULA 2XQRA 3MICA 2DYSH 1CN1A 5HBAA 1Z7S2 3LQCA 1ZA7A 3SHFA 3JSPA 1NK3P 1C0WA 3BR2A 4BQNA 3GBGA 5GAHJ 4AYBN 1LDKB 1PIV1 2P7VB 2J1TA 3IN9A 2NVQJ 5T5JA 3BVCA 5JSOA 3KZIC 4E7SA 2LTNA 3A0HC 3KP2A 3FMGA 1CQTA 4Q4Y3 1VBC3 3P3PA 1QU3A 1J3RA 3DCQA 2EWNA 1OT5A 3M7GA 1ZLJA 3IIAA 2VJJA 3OY9A 3Q8AA 3LOCA 2EFNA 3GCXA 2NAZA 4K8FA 1WW5A 3M3OA 3H1YA 1HRI1 3DYMA 2VQUA 1HKDA 1AR61 1GNYA 3LF7A 2WS91 2JKXA 4B1MA 3IL2A 3RPUA 4WM7B 2HKXA 3BR6A 3F3XA 4IOAF 2QF7A 1LR5A 3G1LA 5HLGA 2RE9A 3P7NA 2X85A 1TEIA 1XB4A 3OS2A 5ILSA 3W2AA 4NDLA 4LO8A 1C5IA 5K0UC 1TNSA 5KC6A 4M9ZA 3GUDA 3J8F3 3U4XA 2PHRA 4EWAA 1BI1A 5FYCA 1Z0HA 1H4HA 2X6YA 4MGIE 1TWFJ 5E1XA 1SFYA 3DLAA 4D7NA 2A68F 1EAH2 4QSHA 4U0VA 5FZBA 2JSPA 5GZCA 1YI7A 4D7SA 3S93A 1QVUA 1D3YA 2QSGX 4PI0A 4LJZF 1JKPC 2IZWA 3IZOA 3KD4A 2Q5TA 2WO2A 1Z21A 1XSXA 2H94A 3QYFA 2GC0A 2AXTC 3J81K 3U21A 2BY2A 3DECA 1GHCA 3OGRA 3LDKA 4TXWA 1Y9GA 3COAC 1JYWA 2ZXWH 2WT1A 4UBGA 4RS5B 3QH7A 3REOA 3QPHA 3KGZA 2V7FA 1ZRCA 1CX1A 2ZJQF 3HRTA 1KQ9A 2A07F 1RMU3 4CDQC 2B4KA 4CDXB 5GZDA 1LULA 1MEC2 4CVUA 1VLNA 2IVJA 3HPGA 1QJX1 3F8MA 1RTVA 1VRH1 5H6RA 5BNOC 4EQVA 1OCTC 1D4M3 2AH2A 2HBTA 4QX5A 3BOQA 3T09A 1ENXA 1JZ2A 2STWA 3E1F1 1R4MB 2OW4A 5LRRA 2XR4A 3H0OA 1ZBE2 4KITB 3MLLA 1TZOA 1XNCA 1X9PA 1ONVA 1XE7A 1UHMA 4Y5SA 2GOXB 1I3QJ 3CJQB 5A3UA 3BTZA 2JA8J 5FBJA 2VZTA 4QPIB 2R7FA 5JOXA 4D7YA 3M8EA 2UY8A 1JU4A 1O4XA 1V9U3 5H9QA 5TRDA 3MD2A 4DRVA 2F4PA 4YFNF 5FKNA 3B6CA 5F8PA 2Y64A 3GTKJ 4CDWB 4K1YA 2BGPA 1RUC2 3SEZA 5JOZA 3SC7X 1SAUA 3V0AB 2RC4A 3U9GA 2DDUA 4UVCA 1LJ7A 3T3YA 1W06A 4DOUA 4HOOA 2VUDA 1S0GA 2M0CA 4IE6A 5HOOA 2NVYJ 2XHNA 3WG4A 4D94A 1GXQA 5EP9A 2TNFA 5J8FA 2KRFA 2PLV2 1XYPA 3P9KA 4YEJA 1XPXA 1SCRA 1W8ZA 2DA7A 2IEKA 5CBLA 5A32A 2L02A 4FOYA 2CRGA 3CMAI 1ACCA 3GXOA 3JRIA 3RWKX 3WDXA 1WBLA 3LOBA 1ZHFA 3RZZA 2LM3A 2EAAA 1VPHA 1PUFB 5KXDA 1GZTA 3TOAA 2A69F 4HAMA 1KGSA 1OKRA 2D6LX 3ABMH 3BR1A 5B2GB 1MZFA 1CF7B 3SZGA 2CFXA 1I6XA 1BYHA 1K4TA 3PO3J 2XGEA 3UYJA 3O1MA 3CO7C 2VNVA 4QQLA 3M3QA 4KBZA 4PT6A 3O12A 3K4KA 2XAHA 4PCQA 2WKKA 3WG9A 3VYTB 4BDZA 1V6LA 2DU9A 3N7JA 4ENKA 1RITA 5KXBA 1NKGA 4G8XA 4HVOA 4LB6B 1DU6A 1VFCA 2Z99A 5DAPA 3ZFGC 2PMWB 3OB8A 3LOIA 1IZ3A 5JLWA 2PLYA 4ZYEA 3TN93 5A6QA 4YVWB 5A7WB 1PGW1 3IAPA 3Q3SA 4BK5A 1VI0A 1JXSA 2Y26A 2R7ZJ 4E27A 2EA4A 2JG9B 2HWE3 2GM4A 4OQ8A 4Q4W1 3ULQB 4HZFA 4YRVA 3VZKA 3U10A 3CUOA 3PVNA 2XSJC 4XJUA 3K6GA 4FTEA 1VQ8I 1LU2A 4QXKA 4NPRA 5FKKA 1HB2A 1JH5A 2W85A 3BR0A 5HV4A 2HWB1 4C3JJ 5LBQA 1BCXA 2XB0X 3L2CA 3RVHA 3S5QA 1LEDA 4MH0E 4GYGA 5FD6A 1HKTA 1O3RA 4XEZA 3K70C 3H9QA 1MACA 2C6SA 2PN6A 2VNGA 2E32A 1K6YA 3WQ7A 2EIMH 3M2MA 2KIUA 4XMYA 3ACLA 1XGMA 2DK5A 1UPSA 1V3FA 2WNEA 5FFOC 2XLGA 3OYHA 2GMMA 1UY2A 2YS9A 1MIJA 2KDZA 4HLXA 4FPEA 1TP4A 2LKSA 3UKGA 4YIRX 4G7HF 1GV5A 1IRZA 1X36A 1H89C 1TC3C 2E60A 2XVLA 3V7RA 3JUUA 3MKLA 1AF9A 2XWJB 4XJ9A 4C3HJ 1OOPC 5FPAA 2D2WA 4ISQA 2ZJPF 4B44A 2ARCA 4LKEA 4N4OB 3ZLIA 1NZCA 3MF9A 5K0UB 4AIJA 2JB8A 3GFJA 3ZYPA 5GZGA 4DXSA 3D8CA 3K7AJ 2QJVA 3WDWA 3AK0A 2W91A 3EUAA 4AYUA 1FMWA 5BS6A 3OOUA 3UV9A 4BISA 1FJLA 1S0BA 1XD7A 5TJJA 3M1EA 1PO12 4XUQA 1COV3 5J4YA 2RQQA 3SCFA 2JVHA 4YIFA 1WMEA 2CGOA 3EETA 1F8VA 1SLAA 2LMDA 4E8DA 1KQ0A 4Y1UA 1WW4A 4JOMA 3A7QA 4Y1XA 2WFPA 2OV7A 1G9DA 2ZA9A 1W4MA 2WO7A 5FBZA 1BMV1 3KZZA 2Q2EA 2HOEA 1BI0A 2HXIA 4XIOA 1S3JA 3F8NA 3BTCA 2NRAC 4HN1A 2K40A 2XL9A 1XCBA 2HS5A 4AG4A 1F9NA 2EBIA 2Y60A 2CH0A 4OAZA 5JPNB 3LSKA 3MIDA 5FK7A 1I1SA 1PP7U 5A80A 1PMIA 4C1WA 4Q4V1 2OZUA 5C3QA 4LLOA 1PVC3 4YSFA 4FQGA 4DUXA 4RGKA 2WYFA 2L7FP 3W5MA 5FYIA 2VPRA 5BNOB 1J3PA 1ZGAA 1LVKA 2XMLA 2AXLA 5JMOA 1RUJ1 5JSRA 3OPWA 4HLYA 1LKXA 1T39A 3DXJF 3AAFA 2VVFA 4DUWA 4ZXKA 4CRQA 3LSTA 1IAWA 4LO4B 3V64A 4A12A 3WTZA 2ISZA 1JYNA 5ICEA 2BW3B 3PUSA 4PF5A 3M7AA 1DQ2A 1YW9A 2BHZA 1VQOI 4JQFA 1Y6IA 2QQBA 5DXDA 1R4NB 2DVAA 4HOBA 1OSGA 4O5VA 1C3HA 4PDKA 3VV1A 4QU1A 1XE8A 3VPRA 4DBRA 2ZHNA 4ZU7A 2JECA 4RD7A 1L7QA 4FPLA 1ZREA 4IL7A 3W6KB 2CYYA 3AL5A 4R4ZA 5IT9K 3C7FA 2BW8A 1GLNA 1FYMA 2ZMNA 5D6EA 4BPZA 5M5XJ 3ES1A 5C4WA 1T0FC 3K3OA 5AVPA 3BY6A 3J26N 3NV1A 4UVBA 3BDDA 3CCJI 1JUIA 5A2QZ 3ESWB 2R072 2OZ6A 2IXHA 3BU7A 4M9SA 3B6AA 4LBMA 4RL7A 3KETA 5JLVA 1YOVB 4XOTA 1OI6A 2Z9OA 4ZZDA 4KU7A 1ZGWA 4IQJA 2DA1A 5I0SA 3VD4A 2WN3A 2HEVF 2AR6A 4IUGA 1W8NA 2HZDA 5D8KB 4A3EJ 2ZKNA 1SMYF 2O1QA 2QWWA 1AKHA 4C3IJ 2L7MP 1OFCX 4A41A 2Z3YA 1OBNA 5FZ7A 1WLWA 3TWIA 4I98B 4YW6A 3CLQA 5E8GA 2CW8A 5BNPC 2MEV3 2X51A 4DEQA 4E2QA 5ACA3 1RIOH 4ASNA 3GNEA 2A5ZA 5AFBA 3O0XA 3J7NA 4JHZA 4XRSA 3L2RA 2NMOA 2BXYA 1HXS3 3ZFGB 1V6KA 4XFIA 3P9CA 3GX4X 4RB3C 1RXFA 3VDDA 2QQOA 1VBB1 1IN8A 2CQQA 2BFUS 5BOXA 2JIJA 2W82A 5E1ZB 2GP3A 2HU9A 4FCAA 2XLAA 3ML6A 4AQ2A 5FZ3A 4F93B 1RUNA 5FCCA 2A6XA 3BPVA 3FL7A 3DP7A 2NS0A 4AD9A 1U5TC 1IRFA 3BPXA 3VZJA 2D98A 3PUAA 4HG6B 2IXIA 1RJ8A 4V1PA 4IEYA 2IXSA 3G1OA 4L5JA 2WYSA 3WNXA 1URXA 2V5DA 3O1RA 3GTLJ 3AC0A 3HNMA 1R092 1RUH1 3BB6A 2K3PA 3OYKA 5FP9A 2W2IA 4MGRA 5IT6A 4LLLA 1CZSA 3I4IA 3A01A 1GUUA 1XYNA 2Y9YA 4EN9B 3VFZA 2JDPA 2WAQN 1RZ4A 4N53C 1R49A 3THTA 1T6GC 1POV0 1O5LA 2CSOA 2CWEA 3LAJA 3B69A 1W39A 3ZQHA 2EICA 2DOEA 2IGOA 3CUQA 5LEKA 3LA7A 2DVGA 3WHBA 1JHHA 1ZBA3 5FYUA 3ZFFA 2C0ZA 4FFIA 3CQOA 5JVTA 5LY2A 1Z1DA 1FYUA 4FTSA 1ULPA 4C90A 1UY3A 3H9GA 2N8GA 4XILA 3ZQLA 3ELKA 5IVCA 2PQQA 5GPCA 1RXGA 2X29A 4MSVA 2ELHA 5A70A 4E70A 1S4CA 1DGWA 1VQ5I 1MQTC 4JV4A 2L0KA 2ZXIA 3L2WA 3CC2I 3TDUC 2W7NA 4UFLA 1QBJA 1O8PA 4BQ2A 2Z33A 3O7OA 4ZYGA 5KR7A 1UYYA 4HPQA 1DU0A 4UVAA 1CPNA 2FDIA 5T50A 1X1AA 4LORA 2W0XA 2E1CA 2W52A 4IHTA 2UYAA 4M3GA 2VASA 3B9CA 2NOJB 2K46A 3DXTA 3GFIA 4L0ZB 1U9NA 3VLBB 1ENHA 2MD5A 4OIPF 1LENA 2DBNA 5ANNA 2BY1A 3JTGA 1I50J 1NG0A 1Z7UA 1Z05A 4RHV2 2QDRA 3ORJA 5E3NA 4E7KA 2XBO1 4XKBA 2QNKA 2YU2A 1W05A 2ETEA 2RMU3 1CD3G 5C3SA 5FZEA 4B47A 3H35A 3H0GJ 3TEZA 3VBRC 2ZBJA 2M7BA 2E63A 4CP1A 3O0WA 4IE0A 2VONA 4HDUA 3FFZA 1OVSA 2QUFA 3RYRA 3TBIA 3WTVC 4XRFA 2ZGKA 3KF3A 4KMQA 2F5EA 5A1AA 3RZOJ 1YFYA 1CONA 3L2UA 3D5RC 2DUPA 4BUPA 4QAWA 1WJDA 1W8OA 3CMGA 5ERLA 4IF4A 2B63J 5J47A 2ZHKA 3JB4C 4LE3A 2PA7A 5LHGA 4D0QA 3P5BA 1LDJA 5KCMA 4M4PA 2RKHA 4XKCA 1D8KA 3DPRC 1WVRA 3FHNA 2JDYA 3E0JB 4Q4X1 2IXLA 5E8AA 3N9PA 3E5XA 5L9RA 3WW1A 5J6XA 1YO8A 3PMSA 2HWC2 1K79A 2CAVA 3I0TA 1H2NA 2GN3A 4S2FA 3SFZA 3AZYA 2LALA 4QM8A 1UHSA 2FDFA 4AR2A 3VBSA 2QBYB 2VI6A 2WAFA 1AR81 1QVTA 5K5QA 4P9IA 2VOKA 5CQGA 1AU7A 4IHYA 3AM2A 1XG1A 2DMTA 3PNVA 3RKQA 2HWF3 4P00B 3FBYA 3HTSB 4GB31 2GLOA 4G6DA 1J3QA 1ND2A 5APAA 1VBE3 3JB8A 2ID6A 2EZKA 1RUI2 4C9YA 4K8RB 3RWNA 4RB2C 1UW8A 2PAKA 1MPXA 5F2SA 3POSA 1WPKA 2BWAA 5DZGA 4KH9A 1W03A 3H3UA 3O6BB 3BCBA 1X58A 3MI8A 5IFTA 1QHHD 4NIGA 4P5YA 1QGLA 5GTIC 1K5MA 1NY72 3UJQA 5FO5A 1LOFC 5DAXA 1N47A 4U0YA 4AAPA 4U7BA 1S0DA 1ZVFA 4AEDA 5J7MA 4YFWA 3ZM8A 5FV3A 2ZJRF 5EF6A 4NC8A 4Y13A 1AR91 2VB6A 3H9JA 2VJIA 1MBEA 1PVEA 1ETQA 2RAEA 5A32B 3THCA 2FNAA 4IV3C 4BLJA 2ZEWA 5K9YA 3WF3A 1BC8C 2M8GX 1PX4A 1J83A 1OH3A 5J1YA 2XG3A 3ZPLA 4RR3A 1AYN1 4NOTA 2R7VA 1HQCA 4ZS2A 4B7EA 3VODA 5F3EA 3RMYA 1AXYA 1OYIA 2JA2A 1QJY3 4CXXA 3S0MA 3FZ3A 3CDZB 1KJLA 2DA3A 3OWTA 5IP9J 2IGKA 2A5WA 1OA3A 3I56I 3QCWA 2RS52 1DQ4A 2D93A 2VZUA 4FXGB 2VGDA 5LBEA 2OIIA 2IW5A 2BVLA 2IGNA 4N53B 4AVAA 2QKLB 3ZN4A 5FB2A 4FBFA 2B9UA 4N43A 5KBFA 3LL7A 3M8JA 1HRV3 4Q0UA 4S04A 2NZ9A 1BEV2 1RUG1 4K9SA 1KGYA 4COUA 4HNUA 3NNJA 1VBA2 2ZMLA 5IAVA 1I5PA 4FFFA 4HKLA 1USTA 1IDYA 4XLHA 2VECA 4G9YA 3JZVA 4L0PA 1K6OA 1UY0A 3VN4A 2QZ8A 2X10A 3AFGA 5FKOA 3K4ZA 4XMIA 1KQRA 3K0LA 2JDHA 1RVF2 2P0WA 1FLIA 3J7HA 3LQRA 5HI0A 1YIFA 2UWAA 4XICA 4XN3A 1J2XA 1X3ZB 3K4LA 3ILFA 2JX9A 1W3XA 4BHBA 1T98A 5EZGA 1IJWC 2BE5F 5IT3A 2M45A 3JBG3 4HX4A 2XWBB 3HMYA 1ENQA 3MLJA 5LD2C 1L0OC 1N78A 1AL21 4FXKB 2BPA2 1WLDA 4Y22A 2DFBA 1FZPB 3O5SA 4PIZA 1SZBA 2D40A 3K4BA 1GVDA 1W0OA 1WMFA 2GXAA 3IB3A 4B3NA 3PSIA 2RG4A 4K20A 1BIBA 2CV2A 1ULFA 1P8JA 4RFRB 4GRIA 1HJFA 1UB9A 4BYYA 2HVQA 1ASJ2 2D6PA 2V1NA 4OULA 3J7AY 1F35A 4F7ZA 2EV6A 1A78A 2WINB 5JXHA 3H9AA 4LOCA 1HB3A 3PUHA 3IAM2 3OBZA 3CEWA 4CP9A 1O3QA 3M1CA 4I09A 4HG2A 3OSDA 2UY9A 3GCMA 2DCZA 5A3NA 1FX5A 5FZ8A 2G7HA 1JODA 1H0BA 2VXRA 5EEAA 2BBYA 2Z1DA 4M9XA 1YQ5A 3MFAA 2IUWA 4M3CB 5LASA 2ZXJA 4XRMA 3PM1A 4HRIA 3PLQA 2OCEA 3ECOA 2Q2EB 3BTJA 4PDWA 5C8CA 1K4SA 1BC7C 1VBD2 3DPRB 4IEXA 1XCVA 5D4RA 4XIDA 3KPHA 1FOWA 2VY0A 2QQPA 4UT5A 1MSFC 3JW4A 3OYEA 4IPAA 2IVIB 5FOJB 2ECCA 2VUCA 3ZX7A 4HNVA 2BFUL 2WIIB 2RM22 3PU3A 1BR2A 3HBKA 2VT2A 3FMSA 3ISPA 4GWMA 5CIRA 3CLPA 2HOTA 2H8WA 1ETKA 1IPJA 4W6WA 2XPWA 1UY4A 3I3EA 1GICA 2VN2A 3GHNA 5CISA 3I2IA 5EYXA 3QPLA 3Q8EA 4LO5B 1KONA 4P02B 3NO8A 5FRMA 4UHTA 3S1QJ 2B9SA 3S2DJ 3JQXA 1OHFA 3FXQA 2NLRA 4Z1VA 1WW7A 2GMEA 5DYMA 3KVBA 2R7EB 2COMA 1AUYA 1N77A 2ZMKA 2KP6A 2R7TA 2WJSA 2DTZA 1UMZA 3EQEA 3PVOA 5IK8A 4EM0B 2YX7A 1VBC2 2LY1A 3LIHA 2YGLA 5FZOA 5AC93 1JT6A 1IUFA 5F3GA 5JAXA 4GYIA 4MUVA 4IEQA 1DCSA 1I1GA 1GOFA 3BKZA 1FIAA 3JRGA 1ZR2A 2L3DA 1Y3TA 1MMGA 4B4QA 3LSRA 2HDWA 2A3YA 2O0OA 3EXUA 1XSDA 2L7ZA 5DUIA 2WV1A 3JR9A 1Q43A 5J3LA 5JFRA 5C4WB 3GTOJ 2LY9A 1U78A 3C7OA 4UF0B 1I3AA 4A2UA 2WLPA 4XPVA 2V5YA 3JXSA 5LHHA 2W4SA 1NE6A 1J1TA 4NMIA 1H8TA 5CKTA 2OPWA 4JX4A 4RA0A 5L36A 3FXRA 1FPN1 2WV0A 3RFRA 3WTSC 1RB8G 4QX8A 3AP9A 4IV3B 1GNZA 1MDMA 2FE3A 4KT6A 1YQ6A 1SVLA 2LKXA 1YQ2A 2H6BA 2PLV1 2XONA 4JKLA 3J8F2 2HWD3 1Z6TA 3T1BA 2VOWA 1TNFA 4J6GA 1Y1VJ 1PUEE 2WO3A 1R1TA 1APNA 5F3CA 4OLLA 2HOSA 2R5YA 2VW2A 1WRJA 4CGZA 3AXEA 2UXNA 4ZC3A 3IV5A 3OUHA 4XABA 1YHFA 5KHDA 2VOTA 2W3JA 5I93A 2GC1A 3OS1A 1QOTA 4ENJA 4D5CA 5DM7F 1V5GA 1OLRA 1PM4A 4AI2A 3DN7A 3URFA 4NHXA 2V26A 2VOOA 1Z7S3 2YUEA 1KYZA 3ROUA 3W3CA 5HPOA 2E31A 1HRI3 4D6QA 1AR63 3FK6A 4XCBA 4QPGA 2D6OX 4BZ4A 3NJVA 4Y1VA 1KQ8A 2VMIA 2WSUA 3A22A 2Z79A 5H20A 1IUYA 4INDA 2LR8A 4AQSA 2WY8Q 3KWVA 1YLLA 1TME1 3H5AA 2VQ0A 2Z5WA 4AZZA 2V79A 3HC7A 3I2OA 1BM9A 4QXHA 1I5ZA 4AFDA 2WFF2 5EGOA 1TWHJ 2DTWA 4NIHA 3A01B 1O91A 3CF2A 3F9KA 1DYPA 2ATFA 2BYVE 2LRPA 3GHMA 3V4GA 5F5QA 2MC4A 3WP3A 4M00A 3K2ZA 1JYCA 3PFYA 3S5AA 1FBSA 3B01A 1VAKA 5E1RA 4NVPA 1BW5A 3CUQB 4QPOA 1QJU2 2B46X 1ODMA 4P5HA 4U7DA 2NMNA 3ALQA 3KS7A 1YS6A 4KQ7A 4YW7A 4A3BJ 5DZEA 4MIMA 4XZUG 3ZFFB 4YNIA 5FLIA 5SV5A 2PMHA 1AOYA 4S05A 1ZZ8A 2ZX0A 4G7OF 5FPXA 2DLLA 4ISRA 1FNZA 4PF1A 5FZMA 4C91A 1FXZA 4RAYA 3C8XA 5FPVA 4NIAA 2W92A 4K40A 4ASMB 3GTMJ 2RDRA 3H36A 2HQNA 1J0RA 4R9CA 1QJX3 1IN6A 5FPZA 3EYYA 3NKTA 4X6RB 4YGCA 3VD3A 3I59B 1B9MA 5FDBA 2EZIA 2M1BA 4YM2A 5D8AC 3LPFA 2E6VA 2V1DA 4BY7J 4OQ9A 4IETA 4CE8A 4Z07A 1QDOA 1UKRA 3JTHA 1STZA 4X6AJ 4UFHA 3H0DA 3EDPA 2ZEYA 1R1ZA 4U2AA 1OYYA 2HYFA 2VUMJ 1MEC3 3HTUA 4AXOA 2IJLA 4U87A 2QYOA 3AKQA 3VBHC 2KIMA 4LR4A 4AEJA 3BG7A 1AJOA 3HBZA 1K61A 4XM3A 3P3NA 3VL9A 4LPLA 2ZXHA 1I27A 4FHTA 1GBGA 2UWMA 3GWZA 2A61A 2VMEA 2XJVA 1ND3C 2WN2A 3OOXA 1WFXA 2HWE2 3AL0C 2GDFA 1G9BA 1MH4A 1TMF1 4QU2A 4M6VA 1AJKA 2DWRA 4Y15A 3WVJA 2FX0A 4MNUA 2Z4FA 4WWCA 4QHBA 2HTJA 1NQDA 4XSXF 4KIGA 2EXJA 1ZG1A 1HXDA 2YBPA 3OYIA 1JUPA 5JHUA 3L9FA 1RUC3 1Z77A 4ET7A 2DCTA 3UESA 1AHSA 3ZXFA 3VBFC 4P9FA 3KQ4B 2BVBA 4A42A 4RA2A 5BPDA 4IE4A 1P2FA 3TGNA 1B35A 4B3AA 3C18A 1IDZA 2MHFA 3EMRA 4YGEA 4ES9A 3I58A 2KHMA 1RNLA 2ZC2A 2FNPA 2CFOA 1UOGA 4D69A 4FOWA 1JKOC 5EG0A 2XGDA 2ZOEB 2CUZA 1YX3A 3HNBM 2VVEA 4XONA 3VBSB 2Q4SA 3S30A 2ZX2A 5FR3A 4B1LA 1VQ4I 3ZN0A 3H92A 1K5JA 1ZKGA 1R9TJ 3LQQA 1XTAA 1OXCA 2JSCA 1SFOJ 1R1UA 4LG3A 4XOGA 5JDBA 3TYJA 1POGA 4BQAA 1MMSA 2HNHA 3TKYA 1ND2B 4YWAA 2ME0A 3HOXJ 3WGGA 4CDGA 3M4OJ 5IVFA 2OPKA 5LWBA 4UB6C 2R042 1NE4A 2XSDC 3MFCA 2KQRA 2VT3A 1EP0A 1ZRDA 4NBQA 3C2BA 2VL4A 5DD4A 4XUPA 2LYCA 1X33A 3RSJA 1OUSA 3UL2A 3TDZC 2GQQA 2HWB3 5FREA 2GP5A 2PTMA 1KEXA 4MX3A 1K5MB 2JA6J 1QF3A 3KV6A 2XJSA 1GU3A 4B3XA 4F3QA 2ACJA 2ARBA 3CCYA 4AEDB 1RUD2 2O7OA 5A7NA 2YC0A 1F1ZA 5A3OA 1AR72 3GZ6A 3L7WA 4Y3OA 1RPWA 1TQPA 2WA0A 4CU6A 2TEPA 3RSNA 1O7FA 3I4PA 4L9BA 1JS9A 3T08A 4OHWA 5JZGC 2IXCA 3C2HA 3IM0A 1MMAA 3S2WA 4L5EA 3Q9OA 3GVAA 3FUOA 1XGSA 2Q8KA 2XJPA 2IS1A 1DG6A 3NAPC 4GH4A 1PVC2 5JSPA 4EJOA 1VAMA 2KIFA 3VB2A 2VBZA 3WP5A 3SEQA 3TP0A 2JDNA 3HN3A 2JA7J 4ZDOA 4FI9A 3BP8A 4DXZA 2R061 1DZTA 4LBQA 2JD9A 4JDMA 5B1AH 2VC1A 4JCKA 2HOAA 1B59A 2HPIA 2GXBA 4JBAA 2R5ZA 5JI6A 5AIPA 3POIA 5BYNA 1RUF1 3EB7A 1REPC 1R1A2 1JYTA 1SLTA 2D6KA 1E3OC 1VB4A 2YGMA 3K4DA 1AYM1 1FOD2 1R091 1MNEA 2IRFG 2DA5A 4L9VA 3N7KA 4NIIA 3D5LA 3GTQJ 5FXZA 2DQLA 4HF2A 3W6VA 1IS3A 1SMVA 3DEUA 1TVGA 3A02A 3NKGA 3IPVB 2EIGA 5A33A 2XLFA 3MF6A 4IQ4A 3R0AA 1CPMA 2LP0A 3SZPA 2GIZA 2P5VA 1W5TA 1WJBA 2L9VA 1FAYA 2F5FA 1CIWA 3KV4A 1YJKA 4LOSA 4RB0A 4AIDA 1PO13 2AS5F 4A3FJ 2BVMA 2PMUA 1N1SA 3MMYB 4HN0A 3KYDB 1KDMA 2Q8OA 4YW1A 2K9ZA 1OF3A 4B7KA 3F22A 1KD7A 1G2HA 5FTTC 1WA6X 4H7MA 3KQRA 1UU5A 4MHRA 2BERA 4IOCF 3PNAA 2ORXA 4EMSA 5FY8A 1OQEA 3AKRA 5ANQA 3OYAA 1S0FA 3SXYA 4HDVA 5GP9A 5FZCA 5IK4A 2VUJA 1FBUA 4Y22B 2P81A 4RLFA 3ZSKA 3K75B 5HCFA 5DCFA 3QRFF 3ASNH 5AFEA 1PGSA 1NH3A 4Y7NJ 4P5OA 4W97A 1Z91A 1OFNA 4LHNA 2X1EA 2H0BA 1AXZA 3V0BA 3ACHA 5J8CA 2QENA 2A70A 1U6GA 2FDKA 5ERIA 5ACA2 1YJNI 1JUMA 4HEA2 4IV1A 4IHVA 3ON7A 4CP9B 3AYAA 1HXS2 2VQAA 1EV12 4UW6A 3CP2A 1OLME 3UR3C 4HBLA 4UFKA 2DAOA 3DTEA 5F08A 4Q8KA 1WMXA 2NP0A 2JDZA 3MUY1 2QDNA 1Q1VA 3EHKA 3ZXAC 3FKJA 1CAXA 3VOEA 2IFRA 4J25A 3MIHA 4FP2A 1Z6RA 5CADA 3ZMTA 2OA2A 3TEYA 1FSEA 5F37A 1IPKA 1VALA 1ALYA 5LA2A 1E0EA 5C8CB 3OTFA 1LPQA 2WA3A 3NJZA 2HQ5A 1TT0A 1LE8B 2BNNA 5FP8A 4M6XA 4TTGA 5DCMB 3R0RA 3CCVI 3S7EA 1DF0A 3MPBA 2E7TA 3H7YA 4RQPA 2R3SA 3VEPA 2V09A 5BY5A 2WSVA 1IG0A 2QVSB 1EH8A 4A5MA 5C3PA 5JVVA 1UNBA 4NWVA 5A7PA 3HKZN 2QTWB 3GJBA 4FAGA 4OFGA 4W8JA 2ADUA 2F4MB 4AHYA 3IKTA 2ELJA 2BZDA 5FGMA 5FZ4A 1YX5A 2R073 5FMCA 1ZM1A 2UZKA 1MZBA 4Q0PA 3KLNA 4ZZ5A 2ZACA 3VKOA 4CU9A 2LDUA 4M0NA 3B3QE 3HIFA 4DS0A 5FLJA 2Y69H 3V8JA 5FFXA 5FPUA 2Z69A 3U14A 3AYCA 2DCJA 3SKJE 4HQMA 3KV5A 3OUJA 5A7QA 1Q8SA 4NRQA 2VD7A 1R081 4MV2A 3V7SA 3WUCA 1G8XA 5L3BA 2YFZA 3AKSA 3FDYA 5FZOB 3BCAA 1B35C 4XBFA 4A3MJ 2YYOA 4ZH4F 3FBIB 3CF5F 1JHFA 5HLHA 4QXBA 1IKQA 3AZXA 4KI5M 2IS6A 3FM5A 3LWCA 4CDUC 1JI8A 5C4JJ 2FA5A 2L01A 2BOIA 1SFUA 4L99A 5CYVA 1ZZ6A 5KC5A 4C2UA 2Y0SN 3KEOA 1H8TB 3EYPA 4DBQA 1H8AC 3WW2A 3MVPA 1UF2C 1GWLA 5JI9A 3THPA 1QNTA 3ZXSA 1QJZA 1JZ5A 1RR7A 3QOPA 2BBVA 2ET7A 3VL8A 2WAAA 2DU1A 1N25A 2W24A 4QKFA 2QSFX 4BBRJ 3HOZJ 1X9TA 1ZRRA 2BWCA 1MDMB 5LBCA 4J00A 5CVJA 4CDXA 4D0PA 3TO7A 4YW4A 5K7ZA 4BQ5A 4BHPA 3WQ1A 4R4XA 3ILRA 2PHFA 1SHWB 5D21A 1G3YA 4BHCA 2CO5A 1NA1C 2W9XA 1W2AX 2EINH 4Q47A 2PJRB 4A5NA 2ETHA 4ZY9A 1V6JA 5CNAA 2WNVC 3KX2A 3ACGA 3BC8A 1OCZH 2R5YB 4BKXA 1BVP1 1QQP2 5LBBA 4MXWA 2M3AA 4FTBA 4A3ZA 4I02A 4NHKA 1XS9A 4QPIA 2GNBA 2XPVA 2D45A 2XJQA 2Y6KA 2M8EA 4NHYA 5L3DA 3UNPA 2RS31 1GKBA 1V6NA 3S57A 2W1SA 2VMGA 1MD0A 4QWQA 2FOWA 2WL1A 2P5BA 4QKBA 1Y8RB 3KEQA 2ZGPA 3DPTA 2EB7A 3AG3H 2OYZA 4CDWA 1DYOA 3QYEA 3BQZA 1ZLKA 3CD6I 3HAGA 4E7ZA 4CCOA 5FY4A 4YZ2A 4QPGB 5IPAA 4L97A 4EN7B 2GMPA 4HK8A 4JX5A 5I0RA 3JD71 4L9JA 2P5LC 4QD2A 5JXIA 5DUVA 5F39A 3M8LA 4PJYA 5BMZA 3ZOIA 1B8IB 1UPIA 1BJAA 2H6CA 4WVMA 2Y34A 1X1CA 2ZFUA 4N9HA 2NPIA 2PHDA 3VDCA 3VBUC 2J1RA 1HV1A 2DPUA 3KP5A 1W6PA 1T8IA 3ES4A 4CZSA 4IZZA 5JI7A 5EGOB 3WF1A 4HSRA 2YY1A 5IFPA 1KA8A 1H2LA 1MR5A 1E5SA 1XMAA 5J1XA 2RDSA 3F72A 5M3MJ 4HX8A 3N7MA 4BE0A 3HGGA 3ECQA 3SLIA 4S2GA 3BALA 4TZDA 4UY8I 5FJHA 1YS7A 1D1BA 3BTIA 3ZYIB 1VBE2 1YUDA 1A35A 1VQ7I 4HYEA 4RHV3 5A3WA 4YPJA 1CF7A 2JPBA 2X05A 4XF3A 2K4BA 3T1LA 2BRTA 4LHKA 4HL0A 5HV0A 2XUMA 1RUE1 3FF5A 1F31A 3S1RJ 4FQZA 2JTVA 1H6XA 2JN6A 1AXKA 3GZTB 2J1VA 5JR2A 4NHJA 2KZVA 5DDJ1 4IRGA 4R1HA 3ZSLA 2A6YA 4OHXA 3HRSA 4NQWB 2RJ2A 3FE5A 4EE2A 3OYNA 1X4PA 3DBHB 5FY9A 5D6FA 2K9LA 4YVWA 3KT4A 3B00A 1QJFA 4F3JA 3UGGA 1EY2A 4XZPA 4NO4A 4Q29A 1H8VA 3MO4A 3T0DA 4YM0A 2WADA 1X1DA 1DU3D 3NEUA 3ZQ7A 1AL0G 3O2PE 1G8WA 6PAXA 4E4SA 3WXPA 2HYKA 1Z78A 1IGOA 3I8TA 4XAAA 4I3PA 3MZ8A 2JE8A 3DLLF 4U88A 3IDAA 1BIAA 3GZNB 2Y30A 2PYTA 2HWC3 4EEFG 2JG8A 2WWUA 4BXSV 4LE4A 1HV0A 3GBFA 1FIPA 4UV9A 3QD6A 3GEZA 3IUOA 2XHKA 3TP3A 3HQXA 4I0WB 3BZ6A 3BQYA 1OJLA 3R4KA 4PJMA 5FZKA 1X2MA 4ANJA 5FUPA 4MTEA 5E17F 2E5ZA 3MEXA 3T2OA 1XU1A 1HB4A 3IH2A 4KT5C 2XF5A 2VTXJ 3ACIA 2UV1A 3RDIA 1HRV2 3GF2A 3HPNA 3QACA 3FN9A 4P9WA 4AL9A 1LHOA 3TB0A 2PQ8A 2DV9A 2R6QA 4BNCA 4FASD 2ZAHA 5K0UA 3WG3A 4QHZA 1UZZA 1JZ3A 3FZVA 1RUI3 4P9UA 1JHJA 2QQMA 5FZ9A 1YW8A 4HKWA 1CWPA 2C24A 3K4CA 2FEZA 3J80K 5DUUA 3FXKA 3VHOA 3MCZA 5IY5H 5FWEA 1B35B 2AYHA 3K46A 2F4LA 4K2EA 3ME2A 2VOPA 1Z3YA 1TQMA 4Z92B 4CDUB 2NVUB 1C1LA 3T4HB 5EG0B 4HMZA 3AG2H 3ERED 4Q4Y1 4XC9A 2RDPA 3UT0A 1JUHA 2F5DA 3P1IA 3AG4H 1HC8A 4ENMA 4XHXA 3JBG2 2VZ3A 4BQ1A 2Y0OA 5FLMJ 2QQWA 3WQBA 2VE9A 1U0AA 3ZYHA 5DG1A 4UUTA 5E16A 5JIUA 4ZDPA 3HM5A 1LGBA 4S0HB 1N75A 3ONQA 1V0AA 1JGGA 2RHPA 4MTDA 4BE3A 5F9TA 1R5HA 2F6CA 4WXHA 5GZFA 3GO5A 3ZDVA 4CDQA 2SLIA 4YFZA 1W6MA 2KJBA 4L5IA 3R05A 2LBFB 4UW5A 1POV1 2E9QA 4FT8A 4JGYC 2HEYF 4XLAA 2HYGD 1LAJA 4AWXB 3OSGA 2DN0A 2ZSIB 5BNOA 4Y20A 4JC1A 3U4SA 3RI8A 1NA1B 2MGQA 2YB7A 3TEXA 2RS53 1REFA 1SBDA 1JKRC 3A03A 2P6HA 4X6QB 4IEPA 1W99A 2E34A 2V4AA 2ZB9A 4QB6A 2QBXA 4DINB 5CVUA 4YARA 3W2VA 5J09A 5F6FA 2WNUC 2BOJA 2BW3A 3AB0A 2VZSA 2H09A 4LA3A 4A45A 3CZJA 1AX2A 1BBT3 4IQPA 5JOYA 1BEV3 1TQ5A 3FMQA 2D43A 4BIOA 3S15J 5H9RA 2ADDA 3PUFA 2F5VA 2PQSA 1VTNC 2JK3A 4L18B 1JZ6A 5DUXA 2RGVA 1ZAOA 1RESA 2CDOA 4OIOF 1TNRA 5C3EJ 4XE9A 2UU8A 4GH4B 3AMHA 1T2KA 4A3JJ 2AEZA 4Y26A 4COYA 3NQOA 1PNFA 1RVF3 1W5CC 4AGRA 5GLWA 1MJ9A 3OGGA 1W6NB 4GKXA 4R52A 4Q0QA 4EJRA 2E7AA 4LO7A 4XBNA 2XKPA 5FZGA 5FYHA 1RMU1 2R5ZB 3O1UA 2XUBA 2VE1A 2DBIA 4UFIA 3BU0A 5E89A 1D4M1 2E5NA 4R79A 4ON0A 4D8MA 3MKZA 2VBXA 4GXLA 4EV0A 2ENRA 3DTIA 4H14A 5DMYA 2VUAA 2YR2A 1B9NA 2DURA 4FTHA 3POFA 2DO7A 2WNOA 4XETA 1AWCA 1KFXL 5HS9A 1QQIA 1ZELA 1S7OA 1GSLA 4H7LA 3N35A 1UKGA 3R60A 1D5VA 4A6SA 3PNTA 5KHIA 1VQMI 3BWGA 1V9U1 2FHRA 5A33B 3SDGA 3WNNA 1B72A 2CWMA 2DMUA 3PL0A 5ISLA 2BNOA 3ZXJA 4CHUA 2N7GA 5DTDA 1TNTA 1YITI 1WZXA 1BA5A 4TV7A 3U1DA 4EWEA 2LNBA 4FVVA 3ZFGA 1FP1D 3FHIB 1FATA 4DEVA 3M3CA 1XXNA 4H55A 1FMVA 4XFHA 5BNQA 1XB9A 5KAIC 5FZFA 3DUIA 3VGIA 2PAMA 2VC0A 1W5SA 2BEOA 3D4KA 1VBD3 2RJKA 3ZGKA 3F95A 2PBIA 3GTJJ 2HWD2 4UI9L 1A5JA 1D0HA 1DLLA 5L7OA 4HF1A 1T6SA 4O7XA 4Q5SF 4LO6B 5GTHC 2RM23 1FOYA 3V0BB 1DZQA 3HR9A 2VC9A 5K5RA 4BDYA 4XF4A 5C7GA 5LCWL 4LBKA 5CYYA 1PO21 3RNSA 1YJLA 4AM3A 4HFSA 4I99C 4BJTA 2QQIA 4ZTJA 3J7YJ 1G86A 2CGNA 1NCQC 4Y1YA 1JU3A 4XMAA 1R7JA 2MSYA 4QKNA 2K3FA 4A6EA 1EKEA 4IEZA 3SMHA 3KB5A 4AF9A 2V9VA 4XUNA 1HRI2 4IJAA 2EILH 1OKQA 1CAXB 1AR62 1T38A 2WS92 3VKNA 4I30A 4X0GA 3TN91 4DNCA 1OOPA 1YE9A 3KVAA 2QQAA 2F4OB 3E5UA 1X7NA 5GZEA 2VMHA 2YBSA 2HWE1 5JWPA 1JOBA 3AJYA 3KP4A 5JMCA 5FMDA 1A04A 2JG8C 1XSVA 1BR1A 4J1WA 3LEIA 4XDOA 4URAA 1R5GA 1QWRA 2ZXQA 2X9DA 4RQPB 3R6SA 5HDKA 1TW2A 5D5XB 3CIHA 2CL2A 3MEPA 1YO5C 5ED4A 5I0UA 3SNMA 2HR3A 4OU0A 3MLKA 5HS7A 1QA6A 1ZK8A 4Y33A 3BTXA 2ME6A 5F3IA 3OY8A 1SD5A 4QHOA 4RGGA 2E2JJ 3IWZA 3N4MA 1RR8C 5M0TA 3PNYA 1W04A 2FF4A 1KDKA 2F4IA 2JJ6A 4MFEA 5HNHA 2WWSA 2I45A 3BI3A 1Q1HA 4BQ4A 4CCLA 2YU1A 4CZZA 2MABA 4M3CE 3V8KA 1EF4A 3BG6A 3B5LB 2XAFA 1KS4A 2FCTA 3ZSMA 4XKWA 4C1XA 3Q5FA 2DVBA 5A6ZA 1OCCH 4BQOA 3RI9A 1MMDA 4QGNA 3ZFEC 4YM1A 1QJX2 4OIQF 1VRH2 4RGAA 4JK1X 3HVDA 4OHYA 4LBJA 4M01A 5CVVA 1ULCA 2BGCA 3JAMK 2HYXA 1V6MA 2WNUB 1S6LA 5E18F 2K0GA 4HQEA 1COV1 3I2GA 4KN7X 4RB1A 4R9AA 5K1YA 3VHPA 2P7CB 3JQWA 4BE2A 1O3SA 3HBLA 5CG9A 1NLQA 4FCYA 1F36A 4OHZA 3DU6A 3CCSI 5KK1A 4ESJA 3VDXA 2D5HA 3IHUA 1OF4A 1BK0A 2VKVA 1PZ7A 3T4VA 5BNNA 2O8OA 4YVSC 2R0QC 1DQ6A 1WI3A 4BU2A 5DABA 3RJPA 2XAQA 4MQVA 4DYQA 5M5YJ 2OCCH 3I9V2 1T0FA 3S8PA 2QBYA 2PI0A 2WFF3 2QQUA 5LK5A 4MXWB 2UURA 4Y24A 1W6QA 1MSEC 2W1QA 3BPSA 3QPSA 1NQJA 3APBA 4PHZA 4BXUA 3KYLA 2OU2A 1PK6A 1YYVA 1VAVA 1VP6A 3HSRA 4P55A 5FUIA 4JTNA 4NAMA 1QJU3 2X6XA 1YWKA 2VTXA 3OBAA 2RJLA 1DGRA 3B94A 1S8NA 4ZPIA 3ZXDA 1HIXA 3RJRA 5FYZA 4E6KG 3QU6A 1LNSA 2V4JC 3DKWA 3CMMA 5BNPA 2B7YA 4WVMB 3GTGJ 2ZAAA 2GIVA 2QQ8A 4RGUA 3HOWJ 2K9QA 4GQ7A 2MH2A 1XSRA 3NWSA 3S1MJ 4NWWA 3AMNA 4AYBA 3EJKA 3LSDA 1FY7A 1W6PB 5LATA 5A3LA 2BXZA 2YPRA 3VWBA 1ZX5A 4HVQA 3FFQA 2WZPP 2YU9J 2Y6FA 3CMYA 2XVKA 2F17A 1S1AA 3FBMA 4ITVA 2V1UA 1L3LA 2G9FA 1BK1A 4UUSB 4BQ3A 4N8MA 3TNPB 3LSIA 1PGW2 3INAA 3CJIC 2OX0A 4WVWA 3S1NJ 2IXKA 3DQVC 4Q4W2 1FT9A 1U5TA 5FXVA 3FKIJ 3W59A 4O61A 1U5IA 4CTEA 2P1BA 2PFWA 4BJ0A 2J5OA 4F83A 4QDRA 3VYSB 3ZMOA 4DRRA 5F5IA 1VMHA 1SPPA 3PIPF 1LB2A 4OUEA 2VNOA 2W57A 4XTMA 5K7FA 4I3GA 5FMOL 2HWB2 2W5FA 3V7CA 1S2EA 2OQ7A 4URTA 4I76A 2ZGOA 1U5XA 1CAVA 2CW7A 4G6TB 5AVAA 3LDRA 4XFFA 4B1RA 5T55A 4AI0A 4QMAA 3VSLA 4AC0A 1P6RA 4LK6A 1MS4A 4N53A 3J80Z 4QB1A 3I4NJ 3W9AA 5HXVA 3WY6A 4XLNF 5GLZA 1WGPA 3OPTA 1FTTA 2EIKH 1RRJA 5E3LA 3WP6A 3NNMA 1IO2A 5I0DA 4N7UA 2MEV1 4P9YA 4AUXA 5KVRA 2RREA 3SH5A 3MW2A 1IXRC 4IGPA 3SKVA 1D8JA 4LLFA 1YIPA 3BCWA 3UGHA 2E71A 5AIQA 3QQAA 1Q8PA 3LCPA 5L7OC 3FC0A 2DODA 2IPQX 5CU1A 5EV7A 5EJCA 2X48A 3CZ6A 1RINA 1M1EB 4Q5OA 4PJLA 1GP4A 2JICA 2JG8B 3OOPA 2COBA 2ZX3A 1GZCA 4UUVA 1W8WA 2FBEA 2RS11 1MQTA 5FUNA 3ZYFA 4P9XA 2DW4A 4HXCA 2FBIA 3ZMVA 1QY4A 3TAYA 4I6ZA 2VTFA 3OYDA 1IS5A 4JTOA 1MNDA 5JLXA 1QH6A 3B02A 1H9PA 3ZN6A 1F4KA 4U0WA 5FYVA 1V5FA 4Q1RA 1MBHA 3HXLA 4KA4A 3O1OA 3EYIA 5HLTA 3WR0A 1UZCA 1L3JA 3O8GA 1OMIA 3J7LA 4ZYAA 1BMV2 1ON2A 3LFMA 4AFCA 2R043 2AUYA 4LBNA 4M0HA 3VBRA 3I2JA 1O59A 3CCRI 1ZBA1 5ABJC 1IW7F 1H2MA 3MDPA 3WG7H 4Q4V2 5GALA 4A6DA 1QO0D 2Y6HA 2LH9A 3ZFEB 2K4JA 3H8OA 1SD7A 3C3WA 1US2A 1Q8OA 3BTAA 1UCXA 2R063 1X2NA 4M3CA 1W9FA 1G3TA 1RUD3 4LG0A 4XXPA 1MZ6A 2OF7A 4A44A 2D6MA 1AR73 1U2WA 4EZHA 1RUJ2 3K4MA 4QGMA 1SC7A 4YZ3A 1TWGJ 3I3LA 4LIUA 4JQTA 2V72A 1UAAA 3DPRA 4NRPA 3CCEI 1T56A 1KU3A 2EFOA 1QZEA 2YDEA 2QQJA 1F2NA 3NW4A 4RAFA 1AYM3 4MHGA 1Y39A 4GULA 1VB2A 2CY6A 4CDQB 4HW0A 1W6MB 1A31A 4YVSB 3J4UH 4K3UA 2RQPA 5DG2A 2A73B 3RQ4A 3ZMNA 4A7KA 1ZNPA 4CEWC 4Y20B 1S7EA 5LGTA 1B09A 3OGJA 2HFHA 3ETQA 2YV8A 1ULGA 4XIKA 1W28A 3LEKA 2Q30A 2RMU1 1FBQA 4B4PA 3BTLA 3BJ6A 5KHKA 4COVA 3LWFA 4CEYC 2ECBA 2WWJA 2EZLA 3ABKH 2ZEXA 1R1A3 4BJ5C 3PSFA 1BVVA 3VKFC 4AWDA 3AZVA 2E7XA 4ZZ8A 4SLIA 1WA4A 4M6YA 3HOTA 5HXMA 4LB5A 1K45A 1H1AA 2W47A 4CU7A 1FOD3 3F2ZA 2HI3A 1WCKA 3G6JB 5BXXA 1VQLI 4MGZE 1QHGA 3I54A 3KMHA 3LE0A 4XACA 2EFQA 4XFCA 3QWLA 5G05L 2HJIA 3F21A 5TISC 5BNNC 4KMUX 2IAIA 1WKMA 1WJAA 3BTYA 4E7HA 2RDNA 3A0NA 1UOBA 1Y0UA 1GOHA 4JHTA 2NNYA 4ARYA 4UYBA 4F52A 4H2AA 4LLGF 3O8HA 5BQTA 4XF0A 4XL9A 2ZGTA 1LOFA 3MUZ1 4MYEA 5CKNA 4UF0A 3U07A 2FOKA 3ZQCA 1W2TA 3K3NA 1YEWA 4FAHA 2JWTA 1J5YA 2HYJA 5DM6F 3DPUA 2FQPA 1PK6C 4AK3A 3BROA 4BQYA 1PGL1 4QDSA 1W9TA 1V55H 3DBRB 4W6XA 3WEZA 1W7PD 3CESA 1MMNA 3ZQFA 5JR7B 1J84A 4IV3A 3FHAA 4L0YB 4Q4ZF 1HKQA 2VPVA 1AX1A 3CJIB 2KFDA 2VMFA 2HVRA 3VZLA 3OYLA 3H42B 2HPMA 4IE5A 4YG0A 4ZTFA 2CUJA 4N9IA 2GNTA 1YLFA 4BWOA 5LK7B 1MS9A 2HWF1 4KYWA 2O3FA 1HBXG 1B72B 1MS5A 5FP4A 4PFOA 1XJAA 4G7ZF 5KHHA 4HKOA 5DUWA 1S9HA 2JDMA 2O61A 2W1UA 1DYKA 1YCIA 2CU7A 5FJ8J 4M3CF 1EV13 1NK2P 2QGUA 1RUH2 1G3WA 4O9EA 1NCRC 4RS8A 1FTZA 4XFBA 1R23A 1P4WA 4DXTA 1H0MA 1VE0A 3ENRA 5E6HA 1ULEA 1LJ9A 2GNMA 2QCSB 4IDZA 1EUTA 2LC2A 4AW7A 2ZHLA 2GWRA 4IGOA 3USUB 3LFUA 3OD0A 4IRIA 1WW6A 1YFWA 3POYA 1OQYA 1OFSA 1RIRA 3NMBA 4P08A 3WDTA 2DA4A 1A3KA 2OUHA 3VHRA 4UW3A 3RZKA 5L7OB 2PMZN 1D4VB 2EV5A 5LRSA 2C1FA 1W7PA 4IW3A 5C4XJ 2XUEA 4F55A 3WTWC 5IVEA 3SEPA 1ETYA 4AVZA 2O8KA 3ZKUA 4PJJA 2OC6A 5CEHA 2ZGRA 1QDCA 1D1CA 1L7LA 1QJY1 2M4GA 4TWTA 4HF0A 4RGRA 2W95A 1FMD1 1W2NA 3D5SC 2WA4A