3HIFA

The crystal structure of apo wild type cap at 3.6 a resolution.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
199
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catabolite gene activator
publication title Structure of apo-CAP reveals that large conformational changes are necessary for DNA binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 51
structure length 199
sequence length 201
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hifA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hifA01
2XASA 3C7JA 1YFHA 2MA3A 1R7JA 5D8KB 3V8JA 2BE5F 5D5XB 4BH9A 4LLOA 2DK5A 5CVJA 3DPTA 1TQPA 3ZDSA 4OIOF 1S7AA 3U10A 1A04A 1OYWA 3WODF 1ZRFA 3PQKA 1OMIA 4UNOA 2EJRA 3I53A 2DU9A 1QZYA 1G3WA 4HLYA 3SHRA 2XKOA 3JSPA 2P5LC 1NE6A 2KJCA 1VTNC 4G6DA 4BHPA 1Q1HA 2IXLA 2W24A 3FMSA 5I0UA 3IKTA 2EVXA 3FXUA 3RKWA 4KUMA 4OMZA 2K27A 1OPCA 2O61A 2IXCA 4WX9A 1L3LA 1I1GA 3NJZA 3H1WA 3IRRA 4XF1A 3WW1A 4E70A 1RZ4A 1E17A 4MEYF 3BY6A 1IXCA 1UPIA 1EV7A 4O5VA 3QRFF 3ECHA 1Q5OA 5JSRA 3F8BA 2P5KA 3SHFA 1HKTA 3ZN1A 5E18F 3VB2A 3PLQA 3CEWA 2OU2A 3H1MA 1BI0A 4E2GA 4AVAA 1XDSA 2O03A 5FB2A 1WRJA 3HOTA 4HVRA 3VODA 1UCXA 4GULA 3I58A 1WQ2A 4HOBA 1RUOA 4IERA 2A6HF 5F6FA 4RB3C 2M45A 1EH6A 4GYIA 5ICGA 3GX4X 4LLNA 6PAXA 4YARA 3V8LA 3ZMVA 2PFWA 2LF7A 2ZMEB 4I0AA 3D5LA 3FHZA 4G9YA 2PQ8A 5LGUA 2Y0OA 4EJOA 2VT2A 4HV5A 3E5QA 3H9AA 4G7ZF 3IBMA 1Z91A 4BXUA 4P9GA 2Z3YA 4IEUA 4G6QA 2ZJ2A 2HQRA 3F72A 4P5OA 4ZYEA 2VBZA 3QU3A 1PMIA 2F2EA 3SCHA 3J81K 3BJ6A 4ASNA 1RGSA 3IIAA 3U0ZA 2D45A 3ZMDA 4MGKE 2MD5A 1TTYA 2PHLA 4G7HF 1X7NA 5FLXK 4PJYA 4MH0E 4A6EA 3WTYC 3CJXA 3FHIB 1RUNA 3BPXA 4KMUX 5BPIA 1ZG5A 1FI2A 3PVBB 4JV4A 4UVAA 2UXNA 4IVNA 3QP6A 4MGRA 1DGRA 4Q47A 1SFNA 1YS7A 2IA0A 2OYZA 4NB5A 3K69A 5J3UA 1Q3EA 1XE7A 4EM2A 1KU2A 1UHMA 2W25A 4PIZA 3HHGA 5DUKA 3T0YA 3WU0A 5IT9Z 4UUVA 3CUQA 4LTAA 2QBYA 2P8TA 1RIOH 2D2WA 2H0VA 2K4JA 1CAUB 4MGZE 2H09A 5FDBA 5CVRA 3HUGA 4X6QB 1J5YA 1T38A 2A5YB 3CLOA 4PIXA 1GQGA 4N9HA 4O3MA 2OZJA 4META 5E1ZB 3L2CA 5BMZA 3IC7A 4KL1A 4GXOA 5L3FA 2O8QA 2M8EA 5HOOA 1SFXA 4I09A 3WGGA 4XBFA 2QZ8A 3T8TA 2Z69A 5FFXA 2P6TA 4AWXB 2WTEA 5FQ0A 4HYEA 4L9TA 5D4RA 5AVPA 1Q43A 2ZO4A 2PMUA 1YG2A 3IKVA 3N97A 4AVBA 3GFIA 1S3JA 2WC2A 2C6YA 4LB6B 2WV0A 4LA2A 4JTNA 4M6XA 4LG0B 1FYMA 2OBPA 3QU6A 2GZWA 2FMYA 4L5IA 2H6CA 1D8KA 2IXKA 3KP4A 2VOOA 3IDBB 2PN6A 2L02A 2FBHA 5TRDA 3H7YA 5HI0A 5EEHA 1FBSA 1G3TA 1IN8A 1LR5A 5EFUA 2UYBA 4HW0A 3BALA 1SFUA 4OMYA 2PYTA 3OD0A 3SQNA 2E1NA 5D1IA 1DUXC 3CO6C 3ETQA 3HRTA 2Q0AA 1VR3A 3SMHA 3O3KA 1ZG1A 2YSRA 1XGSA 3TOAA 3T8RA 3ISPA 1ZAOA 5AIPA 4CHUA 2D5HA 1TQ5A 1IW7F 3GXOA 2R3SA 1CAWB 1KU7A 4U7DA 2QYOA 3F22A 2PAKA 2B9UA 3B02A 5LHIA 1J3RA 1TNTA 2QWWA 3BU7A 3BPVA 1JGSA 1CX4A 4YSFA 3HSEA 4LLGF 3HOSA 2ESHA 1YW8A 2XAQA 3I71A 2ZKZA 3K0LA 3JZVA 3RI4A 5AONA 2JPCA 4Q0VA 3HRMA 2ZMEA 1YS6A 4BHCA 4L9JA 2RVCA 3DP7A 5D8LB 2NS0A 2Q30A 5I0SA 2DBBA 2DT5A 3JSOA 5H6RA 1SAXA 4CICA 1W5TA 3FWEA 4B8XA 1QNTA 2L4AA 4D0PA 3U1DA 4HDUA 2IXJA 5DD8A 4NHJA 2D1HA 3GW2A 1PP7U 3GEZA 3L9FA 4JBAA 4BHBA 2IA1A 3GO5A 4KN4X 3H8UA 2QLZA 3HT2A 2FQ3A 3C3WA 1U12A 3U2RA 3UKTA 4EWDA 4UV8A 4WXHA 2FU4A 2HKOA 1P4XA 4OIRF 2STTA 3MDPA 2M1BA 1J58A 4YG2F 1F4KA 1I1SA 3LOIA 4LJZF 2COMA 2R7FA 4LGWA 2CGPA 4UBGA 1RI7A 4DINB 3R61A 1U8RA 4N9IA 3ULQB 4QMAA 1QO0D 4M9SA 2VBXA 4FX4A 3KZYA 5ED4A 2ET1A 5FD5A 5KVRA 5HVQC 2PAEA 3H1YA 1IAWA 4U0VA 1XE8A 2GA2A 2EFPA 4HA8A 3EO6A 3CUOA 2FSWA 1CAUA 3F3XA 4K8FA 3M3IA 4JQFA 1BM9A 4TV7A 3QOPA 3KLOA 1J75A 3W6KB 1P6RA 2FBKA 3KLNA 1DZTA 4ONUA 4ZYGA 1ZHFA 2LF8A 1DPUA 4Q0UA 5H20A 1R23A 1F1ZA 2OD5A 2RGVA 4M6YA 2EV5A 4BQAA 2RN7A 4EJWA 5DV5A 3OCPA 1QWRA 3OV8A 4EGYA 1R1VA 2EFNA 1YLLA 1FSEA 2GIVA 4M73A 1RL3A 3EDPA 2QQAA 5J6XA 5FD6A 4LG0A 2XAJA 3WG9A 2MC3A 4R1HA 5E16A 2ISYA 1MKMA 2MLGA 3RDIA 3T1BA 4ZH4F 4M9XA 2YR2A 3TDUC 4BAYA 4WZCA 4RGXA 2D1VA 4ZYDA 4P9UA 4A12A 5HDNA 3S7EA 1XMAA 4P9FA 5JSOA 4KIBA 3HRSA 1U2WA 3MEXA 3FZ3A 1T2KA 1ZX5A 4HVOA 3I64A 1XN7A 1V3FA 3NVCA 2Z9OA 4R52A 1FPQA 3F23A 5BPDA 4E2SA 2E9QA 4L11A 1TW3A 2GC1A 2EFWA 3RKXA 4HQMA 3ERED 1FYKA 2FXAA 3DEUA 3CUQB 4Q48A 1MJAA 3F8NA 4WXCA 3LWFA 3E6MA 4KA4A 2MLKA 4PGGA 4YFXF 1OYIA 5L3GA 3J80K 4WXDA 4DQ2A 4TLFA 1SD7A 4CDGA 1Z1DA 1X82A 4UHTA 1BC7C 1Z6TA 4JTOA 3E3VA 5D4SA 5JFRA 1CAWA 4YIFA 1UW8A 1FZPB 1EP0A 2VPVA 3CUQC 4XLNF 1YYVA 4P55A 1ODDA 3N4MA 1RC6A 2PLYA 3I59B 4HSLA 3U11A 4Q4ZF 4KIFA 1ZGJA 4L9VA 4XF9A 5FPZA 4QWQA 4U88A 4DNCA 2ZXJA 1TQIA 4F8AA 1UIKA 5E8IA 3KMHA 1ZRRA 1IZ1A 2VBWA 3U9GA 2PEXA 3SFZA 2UY9A 1ZZ6A 3ECOA 4OU0A 2XL7A 4AXOA 3KGLA 2F5FA 2HEOA 3CO2A 4L0ZB 2CV6A 3GWZA 1YO5C 3E5UA 3EQLF 1FLIA 3F6OA 1OYYA 3WGIA 5CADA 3L09A 5IT9K 1O3QA 5CJ9A 1WKMA 3WTXC 4XF3A 3IHUA 2PI0A 1YQAA 1ON1A 5K1YA 2V1UA 2JSCA 4I98B 2IVMA 2ADUA 2V1DA 4MUVA 5TJJA 2A3SA 3CTAA 5LRRA 1USSA 4EM1A 3FX3A 2QENA 1J0RA 1ZGAA 4BYYA 1MJBA 4MQ9F 1AWCA 2VONA 5LEKA 1ZZCA 1UIJA 1S6LA 2HKXA 2KJBA 3GFMA 3SCFA 2XRNA 3J7AO 5BV6A 4CZZA 2MH2A 3OF1A 3LA3A 2MNGA 1LKNA 1O5LA 2Y0MA 1IPKA 4HX8A 1DGWA 5LGTA 3RJPA 5BQTA 2HYGD 4QLCU 5C6CA 2D40A 3MFKA 4R79A 1IUYA 4AIJA 4YIIA 2DQRA 4IEXA 2O8XA 3ES1A 4QGLA 2B5HA 1ZRDA 5JVTA 3E6DA 4IRIA 1BJAA 4RD7A 2Z33A 1W7PB 5DDGA 2G9WA 1BBYA 5I93A 3OOPA 2FF4A 4G8XA 4ZU4A 3WW4A 2XLAA 3LQRA 1PP8F 3FXRA 2J5OA 5JSPA 3L00A 5HLGA 2PQQA 1P4AA 1O3RA 3KE2A 3Q9SA 3K9TA 3F8MA 4XF4A 5J7MA 1UHWA 3EJKA 4OFGA 1D8JA 2BYVE 4XSZF 1FP2A 4Q0PA 4U0YA 4LK1F 5E1WA 1IXSB 4UVCA 1SMYF 2M87A 4YYOA 3OGJA 2HQNA 3COAC 3IWZA 2QVSB 5FLIA 1STZA 4XFFA 3ABTA 2VN2A 3T5XA 2A61A 2JPBA 3P9KA 2FEZA 3K1NA 1ULYA 1GXQA 2XAFA 1O3SA 5LHHA 2V79A 3GUDA 1R5HA 3CLPA 2NYXA 2G7UA 5CYVA 3TO7A 3C18A 2F5EA 2ZKLA 4I7HA 5L3BA 4RGUA 3ELNA 2OA2A 3ZQ7A 5LHGA 1QXJA 4H0EA 2QNKA 3BZ6A 1KQ9A 4MGYE 3ST7A 5K5QA 3WTTC 2GC3A 4XEZA 4MTDA 4I2OA 1QBJA 2IXHA 2FNAA 1TNSA 1ZZBA 1SD6A 3B73A 3RPUA 4AD9A 4Y17A 2A07F 5HS8A 2MBFA 3DL3A 3EQEA 1J3PA 5KBFA 4S05A 1B1BA 1YW9A 1FP1D 3SZTA 2D93A 5BS6A 4RGSA 3HT1A 4IEYA 3I59A 1KA8A 4XFCA 2GAUA 3EUHA 3NKTA 3RYPA 2OA4A 3NQOA 2JZYA 3I7DA 1OI6A 2GWRA 1LDKB 3RNSA 3MYXA 3BJAA 1DDNA 1EH8A 3SXWA 4U7BA 1S7OA 4GYGA 5BY5A 3ZN0A 2GA1A 5I8SA 3BB6A 4IRGA 1IN6A 2IRFG 4MV2A 1FWZA 2XROA 3EETA 2EA7A 2TDXA 1QXRA 3JAMK 3CL1A 1PUEE 4BIFA 3F21A 5ICCA 2JRTA 2Y48A 1FY7A 2QJVA 4HN1A 4HF2A 2BV6A 2BNOA 3CO7C 2QVOA 1O57A 1GVJA 1LDJA 2NRAC 3GLXA 2CAUA 1I5ZA 2DFIA 2H94A 4PDKA 5BPXA 4WVZA 1WGPA 4L18B 5BOXA 4L0YB 1ZZ8A 2GU9A 3DFGA 1YW7A 1MZBA 2K4BA 1RNLA 4IPAA 4MQVA 4CGZA 1GXPA 1EH7A 1YWKA 4KU8A 2PG4A 1CAVB 4CYDA 2L4MA 5J8CA 3TO6A 2KIMA 5F64A 2O3FA 3DKWA 1SQ4A 5KK1A 3LSTA 3LFKA 5E17F 1SD4A 1OFNA 3BROA 3J81Z 1K6OA 4IEZA 3ZPLA 4HVQA 4E2QA 4P96A 1W5SA 4GGGA 2N7GA 4LFUA 4QM9A 5FLXZ 2AXLA 4I02A 5D5WB 1R36A 3M8EA 2IJLA 1P92A 2UYAA 2HWVA 1V70A 4D7SA 1UCRA 3BP8A 3GVAA 1JHFA 4A6DA 4ENNA 1Y9QA 1LQ1A 5JAXA 1B4AA 1B9MA 3H3ZA 5I8TA 3G7DA 4WWCA 3QACA 2CSOA 1TW2A 1W7PA 2YPRA 2VQAA 1FXZA 4RB1A 1F9NA 3VOEA 4YNIA 2K86A 1KU9A 3WW3A 3PNAA 4HDVA 5HS7A 2A69F 4QGMA 3NSTA 3CF6E 2LNBA 1JUHA 4G7OF 4LK0F 2HR3A 1T98A 3GF2A 1R5GA 2DPUA 1U5TB 5D5UB 4Q0QA 1V4RA 2ZCWA 1W4MA 2D5FA 1X3UA 3KGZA 1YFYA 2CG4A 1MDMB 4OIPF 2ETEA 1FYLA 1SMTA 3Q9VA 1HW5A 4XRFA 4HSJA 1L3JA 3H3UA 2QCSB 1KGSA 5ERIA 4ENJA 1P2FA 2F5DA 3IL2A 4ENMA 1H1IA 3TQNA 3TNQA 5KHKA 1U5TC 5L3EA 2O6GE 2F4PA 1O4TA 5ILSA 5D5VB 1PDNC 2P7CB 1J1LA 4HMZA 3RYKA 3WTVC 3FF5A 4EM0B 2PJPA 4OOIA 1PM7A 2QQ9A 1JXSA 1EY2A 1BI3A 3FE5A 3GZ6A 3P9CA 1RTVA 2E7WA 3ZMSA 4Q5SF 3VEPA 2H27A 2VODA 4O9GA 4JK1X 1W7PD 3RKYA 3V7RA 5H6QA 1XSVA 4KNYA 2X4HA 2ZFWA 4FAGA 3KEOA 4FHTA 1FBQA 2CYYA 2O0YA 3MZHA 5DEQA 3WW2A 4IRHA 4IF4A 2XAGA 2HOEA 2VECA 5C8WA 1UB9A 2GC2A 4Z82A 3EYIA 1UFMA 3CDHA 2RDPA 1IPJA 4M74A 4HF1A 3KEQA 1Z6RA 4MX3A 3ROUA 3EHKA 3WTWC 1NHAA 1BN5A 1SEFA 4Q29A 3O2PE 5I8YA 1LEBA 1NE4A 3I54A 3S0MA 3GYDA 5E1RA 3IRQA 4ESFA 3P7NA 3LAPA 2VC0A 3SCGA 2A6EF 3LAJA 2QQBA 1ZG3A 2FE3A 4O6JA 1HW2A 1H0MA 4OIQF 3DV8A 1ZARA 2Z2SB 2IC1A 5LRSA 1BI1A 5KHHA 2PHDA 2W84A 3ACLA 5A2QZ 3KP5A 4I0BA 3GFJA 5FLJA 4J1WA 4UBHA 1GQHA 3E5XA 3QAHA 2VXZA 2CQKA 1USTA 3VFZA 1XGMA 2ZNZA 3H50A 3ELKA 3HTSB 4HLTA 1KU3A 4QXKA 4XFBA 4M72A 5EZWA 1ZVFA 2QDRA 1XD7A 2M5WA 3M70A 2XL9A 3HHHA 3E6BA 1YFXA 1CAVA 1BI2A 5K5RA 5ICFA 5D6EA 3TO9A 2STWA 3JTGA 4HV6A 3DQVC 2VBYA 2G7HA 3KSCA 4QX5A 2IT0A 3KFWX 3WU1B 3S2WA 4AIKA 4LLLA 3BPZA 4ON0A 1IF1A 1MJ9A 4MZUA 3V7SA 5JR3A 4KWLA 2JT1A 1Z9CA 2W85A 1TLHB 4FAHA 2ZNYA 3KP6A 1LB2A 3RTRA 1KQ8A 3LA7A 1MGTA 3M7GA 4H7LA 1HXDA 1E2XA 2BNNA 3ES4A 2QM3A 4EJUA 2A68F 3HYIA 1XSDA 3HTUA 2RC4A 2HGCA 4LB5A 4RS8A 4LULA 5BUVA 3Q5FA 5DUIA 3PFIA 3HSFA 1R00A 2FQPA 4M9ZA 1R58A 4L2NA 3ZMUA 1LVAA 2XGXA 3FM3A 1JE8A 1CF7B 2F5CA 5E8GA 3TGNA 2XLGA 4KMFA 1KQ0A 2L54A 3G73A 4J1XA 4KT5C 3MPBA 4IEWA 1WA4A 4U0WA 2ZBKA 4IEOA 1U5TA 1DPRA 4K2EA 1QPMA 2P5VA 3ZP5A 4Q0SA 5JI6A 1MDMA 3FMQA 2XLFA 5E20A 5L3DA 2VOPA 5HLIA 1HQCA 2LKPA 3WE3A 4EWAA 1D5VA 3E6CC 3JTHA 4YFKF 3L2HA 4A5MA 2GXBA 1J7KA 2B0LA 1ZZ9A 3ZMZA 2Z5UA 4ETSA 3IDCB 3RYRA 1QY4A 2XHKA 2E7XA 2L01A 2HYFA 3LQQA 2PFBA 5FGMA 3L7WA 3MZYA 3D0JA 2M30A 4KU7A 3KP3A 1YLFA 1F5TA 4ESBA 1IN5A 4IJAA 1IRFA 4YFNF 4RAZA 1YFUA 4IETA 2OPKA 3QP5A 2O1QA 4HZFA 3KP2A 1H9TA 2DK8A 4L9NA 1T6SA 3D82A 2FBIA 4RGRA 1B9NA 1DZRA 3HIFA 1XMKA 4EJTA 1WSUA 3BJOA 1P4WA 4A2UA 2WWYA 5I0TA 1I27A 5JCTA 3WGHA 4HF0A 1ZN2A 4IEVA 2B8MA 4WF2A 2FRHA 3MAJA 3NRVA 3V8KA 2K02A 3F8CA 3R0AA 2CWEA 1UD1A 2EWNA 1Y3TA 3LA2A 2DO7A 1OKRA 2FNPA 2ELHA 4NQWA 1H9GA 1XCVA 1B6AA 1KYWA 3TOBA 1LNWA 2IW5A 2CFXA 4QM8A 4XFAA 3J80Z 3HSRA 4ZU7A 2FOKA 2KRFA 1YTYA 4GCVA 2KIUA 3FFQA 2YX4A 4LA3A 1ZRCA 4KWKA 5DCMB 1YFWA 2RV8A 4ZYHA 1K78B 1U78A 1FT9A 4UVBA 2OQRA 2ET7A 1O7LA 5HS9A 4KN7X 4XFIA 3R60A 5I0RA 5T3NA 1XRUA 3SZPA 4HAMA 2WFPA 4XF0A 4B09A 1IN7A 3FM5A 2PBIA 4EV0A 2DI3A 4ZU5A 1YHFA 4A0ZA 4OINF 3BOQA 3KZZA 3O14A 1C0WA 4KDPA 4IHSA 2MH9A 2LSOA 1BIAA 5J8FA 2V09A 1BIBA 2P6SA 3R4KA 1I6XA 1FOKA 3WE2A 2K9ZA 2GH2A 1NZCA 2UWMA 4FBFA 4RB2C 2IA2A 4MHGA 5LLQA 5KHJA 1IXRC 2GQQA 2HZTA 1Y0UA 2PA7A 3C3VA 4MGIE 2Y75A 4ORFA 4HN0A 2EFQA 2GC0A 1BOAA 3O6BB 1WI9A 2V1XA 2V9VA 1HSJA 4UV9A 5K8SA 2RKHA 2EAAA 3REOA 2UY8A 5CLSA 4OLLA 2HS5A 3I4PA 1XB4A 1G6NA 1ZYRF 4PCQA 5IT3A 2BBYA 3GYHX 2NAZA 4MEXF 3W6JB 5ILUA 5FFZA 2OZUA 2BEOA 5FO5A 5J48A 5DD4A 2HDCA 5KHIA 2EA4A 1HBXG 2C0ZA 2GXGA 2XVCA 1CF7A 4KYWA 1LEAA 1HKSA 4RB0A 4A0XA 4ESJA 2W57A 2RNJA 4QGNA 3GFLA 1HKQA 2UXXA 2HFHA 4HLXA 3LAGA 5CU1A 4LD5A 3MCZA 2Q1ZB 3RIRA 2ISZA 2ESNA 4WBBA 2EFOA 1CAXB 4WCGA 4EWEA 1MD0A 4N0BA 2XUBA 2DW4A 2DTRA 3USSA 2OQGA 2FMLA 5HLHA 3AAFA 2HJIA 4UXAA 2OZ6A 2EA2A 3F8FA 3MWMA 4KICA 4PGHA 2P4WA 1O3TA 3FXQA 2EK5A 1XGOA 3MQ0A 5E1XA 1SFEA 2FA5A 4EGZA 4R8HA 1XDUA 4YRDA 4AVCA 2XV4S 4D7TA 2P17A 3M9AA 3HQXA 2XAHA 4UXNA 3GBFA 5CVUA 1B59A 2BGCA 1FX7A 1NXMA 4LUKA 3IWFA 1OD5A 3V7CA 4FT8A 2KXLA 1H1MA 1XCBA 2EB7A 3F6VA 2X0LA 4M71A 5A2QK 4HQEA 3DPLC 1WWXA 4AVPA 2JTVA 3PQJA 1REPC 3TKYA 5FPXA 5ILVA 2K0GA 2Q0OA 2MPFA 1ZNPA 4G94A 1R1UA 3SXYA 1ZH5A 4X6RB 4CXFA 4Z2YA 1Z05A 2VT3A 3ABUA 3KP7A 1S8NA 4WK8F 2BNMA 5LEJA 2PAMA 3ZMTA 1S29A 5HDGA 3QPTA 1G4DA 3H7JA 4ZZDA 2XIGA 5I91A 1SD5A 4JVAA 5DCMA 4LUMA 3R0JA 3NW4A 2L3DA 1T39A 5LGNA 4EQQA 1BC8C 1K78A 1YIOA 5AIQA 4IEQA 4B29A 2LDUA 3K1PA 4HX4A 1LDDA 3BWGA 3DN7A 3VHRA 2QUFA 4I3PA 3WTUC 3R6SA 2UZKA 3M1EA 3RPQA 2OAZA 3E97A 4AIHA 2Q4SA 2CW0F 5L3CA 4IXAA 2Z99A 2XKPA 1ZZ7A 3DXJF 4AQ2A 1WLTA 3HRUA 5DYMA 3QPHA 4XSXF 3KETA 5KHGA 3LWCA 1G3SA 2RQPA 1X8EA 3JAMZ 2KIFA 3TNPB 4ZZLA 3I5UA 3BDDA 1J2XA 4NVPA 5FLHA 2VC1A 2CAVA 2YU3A 5K5OA 2DQLA 5LBQA 2PTMA 3G3ZA 4IESA 1FC3A 4AQ6A 1ZREA 1L0OC 1ZLKA 1LRHA 1TQMA 5HDKA 3RZZA 2YX7A 1T0FA 1K79A 1FBUA 4XETA 4HBLA 2AS5F 1QQIA 3D0SA 1IRGA 3H92A 1DP7P 4PZJA 2I45A 3GZ5A 5JHUA 3FJSA 5FCCA 4GO1A 2V6CA 2IP2A 3I0TA 1G3YA 1FNNA 2ATFA 1QZZA 4EMSA 3OTFA 1J59A 1EPZA 1K7AA 3NEUA 2DLLA 2EV6A 1ZLJA 2J5PA 1U6GA 3LZZA 2VE9A 3CJNA 2NNYA 1ON2A 3UKNA 4S04A 5JR7B 1R22A 4Y13A 2VE8A 1D3YA 2DCTA 1XGNA 4EROA 1FSHA 2KKOA 4I01A 4CO8A 4XFGA 3UKVA 1O7FA 4F7ZA 3FMRA 1ONVA 4O9EA 1GHCA 3C1DA 2IPQX 3K1MA 4A0YA 4MNUA 1LJ9A 4FX0A 4IHTA 2R7DA 2DPDA 4HBNA 2DAOA 3EYYA 2HTSA 4PIYA 1CAXA 2MHFA 4IEPA 3FZVA 4HX7A 2HTJA 2H6BA 5ICEA 1IN4A 4KIGA 2E1CA 4Y15A 4A5NA 4ENKA 3K2ZA 5CVIA 1EYBA 2EV0A 4LEJA 1R1TA 3ML6A 1NYWA 4BNCA 4MTEA 2QBYB 2Q8KA 4EVIA 1AOYA 2IXIA 4EJVA 5BXXA 5D6FA 1X8MA 4LMYA 2K7LA 1U3EM 3BCWA 2P7VB 2CO5A 1VJ2A 1Z7UA 3TDZC 1O5UA 1OR7A 5EEGA 4KFCA 4XFHA 1J9IA 5F1RA 3KCCA 1CGPA 1VP6A 1YUDA 1HW1A 2PMHA 2NNNA 3NL1A 4XLPF 1JHHA 3DF8A 3P9IA 3S7IA 3JW4A 5CVVA 2ACJA 4KWJA 4Z07A 1QGPA 3WTSC 5DCFA 4L5JA 1TBXA 1HSTA 1XSXA 1KYZA 2Q2EA 5FQ0B 1J3QA 3V4GA 3M8FA 4RAYA 3WTZA 3EBRA 2ETHA
chains in the Genus database with same CATH superfamily
2FDIA 1AXYA 5LD2C 1W9SA 1YFHA 1QJX1 3MW4A 2C6SA 2R0QC 3M8LA 4R4XA 1LOEA 3U10A 3K4DA 1FYUA 1ZRFA 4RA2A 4BY7J 4XW3A 4XKCA 4IL7A 4XILA 3SHRA 3VDCA 3JSPA 4XRSG 1NE6A 1VTNC 4G6DA 5FKLA 5C3SA 1Q1HA 2VJJA 2IXLA 2WB1A 4Q4X3 5I0UA 3IKTA 2O5RA 3FXUA 1MEC2 4KUMA 3I3LA 2XVKA 4WX9A 1I1GA 3HEFA 1OJLA 3OJBA 1HB1A 2ZS6B 3BY6A 2RJLA 5FBZA 3S14J 4RS5C 1EV7A 4O5VA 4EN8B 3QRFF 2W48A 2VQCA 3DEWA 5JSRA 1EV11 2R6QA 3SHFA 3PVNA 3RI8A 3SYTA 4CU7A 3I2IA 4D7NA 2OU2A 3DTEA 2E19A 2HEVF 2LMDA 4E2GA 1XDSA 1ENSA 3LSIA 1AR73 2KM2A 3L2WA 1WQ2A 2BY2A 4W6XA 5K7ZA 4BK5A 5A3OA 1ZR2A 6PAXA 2OS2A 3K4LA 2W94A 3MI8A 4YARA 4AI8A 3IV5A 2Y6JA 5L19A 4KBZA 4W6YA 4ET7A 2PFWA 5SV5A 2ZMEB 2E2JJ 4G9YA 4H2AA 3P3PA 2Y0OA 4EJOA 2VT2A 3E5QA 3SISA 2W1OA 4KWUA 4WM7A 2BOJA 4BXUA 2JUGA 2Z3YA 5LZ6A 4IEUA 1WJEA 4G6QA 2XUMA 2AR6A 3LSEA 2HQRA 4IOCF 1IGNA 1DCSA 2VBZA 4YVSB 3QU3A 1UWWA 1PMIA 2F4LA 3NAUA 1V5GA 2F2EA 5J98B 3J81K 3BJ6A 2BW8A 3WNOA 2HWF2 1V54H 3SKJE 1NA1C 2PHLA 3UK9A 4G7HF 1X7NA 5FZ6A 4CCJA 1Y39A 4MH0E 3OYWA 1WMEA 3WTYC 3PNYA 4AFBA 5BPIA 1ZG5A 2AHQA 4JV4A 4FP3A 2UXNA 1MZEA 3QP6A 3OYLA 1NXD1 4A41A 3K69A 5J3UA 1Q3EA 4GH4B 4XAEA 2Y2ZA 1XE7A 2ZX4A 4W65A 2XSDC 2CRGA 3EUKL 5IT9Z 4UUVA 1JI6A 3W59A 4XOPA 2ILMA 4CUGA 4OI0A 2H0VA 2WZR2 5FDBA 4X6QB 3N3HA 5GALA 1T38A 3RZGA 9ANTA 2CFOA 3K70D 1GQGA 1R4NB 3L2CA 5BMZA 3KT1A 3IC7A 3H5AA 4KL1A 2D43A 4E4SA 3WGGA 4MO7A 2F4OB 2D6PA 3M3OA 3MICA 3M3EA 4HYEA 3WF2A 5D4RA 1YG2A 3IKVA 2CHHA 2GOXB 2W91A 4XLEA 4LB6B 2WV0A 4LA2A 1ENXA 2WIIB 4M6XA 4W97A 3PUFA 2RV9A 2L2OA 2OBPA 4L5IA 1AR93 3VBUC 1SCSA 1D8KA 4OCTA 3KP4A 1LENA 2CUEA 4XORA 4D3WA 2W68A 3LMMA 2FBHA 3EB7A 1XMXA 3VYTB 1DGLA 1G3TA 1TL8A 1LR5A 2B39A 3ABMH 4UT5A 1JYCA 4BJ6C 1LECA 1JS9A 1SVLA 1T33A 5GKAC 1NY72 2JA5J 3BALA 1SFUA 4JRAA 5C4WC 1YI2I 2E1NA 5EJCA 1UXZA 2PHFA 1N77A 3HRTA 3D5OA 2M8GX 3AMMA 3TEYA 4D1QA 2X5IB 1AU7A 1APLC 2BFUL 1XBFA 3T8RA 5KXBA 2VXJA 2D97A 4JP0A 1MBJA 2CQQA 2XB6C 5AIPA 4B4CA 3ZCOA 3T0BA 1CAWB 4CRQA 2HYJA 2M9HA 3A01A 4U7DA 2QYOA 5FTTC 3FK7A 4RMNA 3LEKA 3HPHA 1EAH2 2P1BA 2VB6A 3BPVA 2GNTA 4AFCA 4YSFA 1S7EA 3I71A 3K0LA 2VMHA 4Y22A 3IH2A 2XB5A 4FFHA 4XJ9A 3BGAA 2DOAA 2RVCA 3DP7A 2BZTA 1UAAA 1H8TB 4AGRA 5CFDB 4A93J 4CICA 4B8XA 4LKEA 2K40A 4E8DA 2V9KA 4IKFA 3AYEA 4BBSJ 1HXS3 1MS1A 4NHJA 3GW2A 3ALQA 1HA8A 3GEZA 4NC8A 1E0EA 3T30A 4BHBA 2CH0A 3H8UA 3H3VK 1HRV2 1QOOA 2GNDA 2RS11 4EWDA 4BQNA 3HPGA 2HKOA 4OIRF 3MW3A 1WI3A 3MDPA 3UNPA 4YG2F 4LIVA 2BY3A 1TZLA 3LOIA 1W0OA 2V7FA 2DJNA 5E79C 4LGWA 2B9VA 1SVMA 2QKMB 1JH5A 3ZYGA 1E3PA 1YCIA 4M3CE 2X05A 3KZYA 1WW5A 1GV5A 1YIPA 2R32A 3RCOA 4CP2A 1WMFA 1XE8A 3BYWA 2GA2A 2ZFUA 2YU2A 2B7EA 1CAUA 3F3XA 1RUH2 2PN5A 3M3IA 5L9VA 2H1LA 1BM9A 4TV7A 2EPFA 1PGSA 3FMGA 1P6RA 1JZ4A 1GLNA 1ODNA 1ZHFA 3AYAA 1XPWA 5EZGA 4Q0UA 2NVUB 3FIWA 2WA0A 1F1ZA 1APNA 1SMVA 4A69C 4ZONA 5DV5A 5K7FA 4L9BA 2HWE2 1VBB2 2W7NA 4P5YA 2G0EA 3ZQIA 1FSEA 1BEV1 4TSVA 2GIVA 5B2GB 3D3AA 2ZHNA 1RL3A 4XABA 2DUQA 2XF6A 5FD6A 3WP4A 4JOMA 5FZBA 3RKQA 3S2HJ 2XAJA 4DYQA 5DN2A 4IV1C 1IO2A 2MLGA 3WF3A 1VAVA 4ZH4F 1YQ6A 1AX1A 4FVVA 2YR2A 4WZCA 3S16J 5CIRA 2E71A 5ERLA 4XKVA 4ZYDA 1RETA 4A7KA 3OYHA 5HDNA 4QQPA 2YZ4A 1XMAA 4URAA 4Y4YA 4KIBA 3HRSA 3FZ3A 1H89C 4JX0A 5BNNA 3I64A 4DB5A 3NVCA 2Z9OA 1FPQA 2L9NA 3F23A 2WT0A 5HXVA 2CW8A 2VBDA 3DPRC 1BLZA 4LJHA 3CC2I 1QMJA 1NG6A 2B46X 2CNAA 3Q8FA 1FYKA 4A3BJ 2PMZN 3DEUA 1ACCA 2ZAAA 1MJAA 2VKHA 5A7WB 4LO5B 4KA4A 4PGGA 4YFXF 1OYIA 1LHWA 2ZGKA 3OYMA 3J80K 3OYIA 1WW6A 2D3PA 2OXBA 5GPAA 3KF3A 4UHTA 2YGLA 1BC7C 2WYSA 5IVVA 5JHFA 2ARXA 3RS6A 4L99A 1MNDA 5LY1A 1OA2A 5FZOA 1K6YA 2ZEXA 3J8F1 5DZEA 5EHDA 3VGIA 1S0JA 4DFSA 4LR4A 4AI3A 3VYUB 2ZEZA 3U11A 3OEAA 1ZGJA 4XF9A 4YG0A 5EF6A 2ZXJA 1UIKA 5GJ6A 5E8IA 5IP9J 2E35A 3HGGA 3OUHA 3CCYA 2PEXA 3SFZA 1UF2C 4BISA 1NCQB 1R49A 2VUMJ 3CO2A 3DYMA 3T0AA 2EBIA 4L0ZB 3E5UA 1UHSA 5K7PA 3O0VA 5F2WA 4AIDA 2XPUA 1JZ7A 1Z7S1 3KYLA 1YQAA 2WBMA 4UAPA 1K45A 1GICA 2JSCA 3GTGJ 2IVMA 3SFIA 3DEMA 1VQNI 4TLGA 2ZHLA 4OZOA 5LRRA 5DM7F 1USSA 4CEYC 4FISA 3LFMA 3LSJA 4LKDA 2QENA 2JX9A 1X4PA 2XOMA 4F91B 1ZZCA 1S6LA 2HKXA 2KJBA 1VB2A 3POJA 2EQRA 4BY1J 2AGSA 3TAYA 4BQ5A 1DU0A 1RHI3 3OF1A 2MNGA 5LGTA 1RUI1 5FKMA 3LDBA 3T1LA 1CZVA 4QLCU 2KHMA 2YC0A 3MFKA 4RAGA 3B01A 4KGQA 3IT8A 2DQRA 2O8XA 5M3MJ 2PJRB 4QGLA 2B5HA 1UY0A 1SANA 1QPIA 1ZQ3P 1FNZA 4F3JA 5ISLA 1H30A 2YPDA 5DDGA 3HOWJ 5ABJA 4P02B 1X3ZB 4DY5A 2Y33A 3WW4A 3LQRA 3FXRA 4RQPA 2EXJA 5JSPA 1B8IA 1HQWA 3NNGA 4E7JA 4WM8A 3D5SC 5C3EJ 2PQQA 4L8QA 4LBNA 4YW2A 3QOEA 3ZQFA 1WJDA 1V6KA 4A6OA 2TUNA 4AZZA 1K5MC 5E1WA 4PHZA 1IXSB 4UVCA 3RZKA 2M87A 4YYOA 2I07B 3LB9A 3COAC 1OOPC 2JK3A 2VKDA 5FLIA 3ABTA 3M07A 3HOZJ 4PT6A 2FEZA 1PX3A 1GXQA 1SAUA 1O3SA 3CLPA 2OUHA 2WSVA 2NYXA 3PNVA 3TO7A 2JQ7A 2Y6KA 4LBLA 2DVFA 3GBGA 4B1RA 3ELNA 3CJIB 1QXJA 2JVHA 2RJ2A 4H0EA 5FYCA 3BZ6A 3CP2A 1KQ9A 4IGQA 1M06G 2GC3A 4XEZA 1GUIA 2X10A 1AHDP 1OA4A 4I2OA 4RHV1 3GTJJ 1TT5B 1KGYA 1PHMA 2E6VA 2RDSA 1ZZBA 1SD6A 3B73A 5H9RA 2W1WA 4Y17A 1W36C 2MBFA 2WNUA 4S05A 2XVLA 3ZMOA 4QDRA 2ORZA 1B1BA 1YW9A 5IPAA 4Q8LA 2D93A 1BZWA 4IDZA 1GZTA 1RUG1 5FO8B 2GAUA 3NKTA 3NQOA 4FPYA 1OI6A 4CTEA 1D0YA 3MYXA 5BNOB 2VUDA 4ZDLA 3SXWA 3H36A 4YLZA 4U7BA 5FZ1A 1ZELA 3VZKA 2NOJB 4AYUA 1W90A 2QBXA 3CBNA 3JRHA 1QQP1 3JD72 2VTFA 3VHPA 2JJ7A 2GA1A 1RINA 5I8SA 2RS52 2V1NA 3FBNB 4MV2A 4DYCA 2XROA 3NAPC 4AAXA 3EETA 2EA7A 2A3WA 2TDXA 1QXRA 4YVWA 1OF4A 5AC91 1L7RA 2Y48A 2LFBA 2YROA 3CU7A 2A6YA 4D6SA 1QJX3 2OCEA 1BJQA 3HOXJ 1VBE2 3H5RA 2NRAC 2CAUA 1BK0A 4GJZA 3DU5A 5FZCA 5BPXA 1O8PA 1WKYA 4SBVA 4FXGB 5L7OA 2MG4A 1RNLA 5FP4A 3KHCA 1EH7A 4KU8A 2LRDA 1CAVB 4YGEA 1B35B 5J8CA 2L4MA 2G9GA 3P3NA 3TO6A 1TNFA 1XC5A 5FWEA 2K9MA 5HCAA 2O3FA 1LPQA 2DF7A 4ABZA 3J81Z 1MVEA 2M4KA 1K6OA 2AUYA 1YI7A 2KISA 4GGGA 4QM9A 3H9GA 3K10A 5FZIA 1Y56A 3VBFB 3HG9A 1EV13 3VDDA 4AEDB 5GZCA 3AMPA 4N8MA 1GNYA 4XCAA 1V70A 3OYKA 3BP8A 3PJYA 1FV3A 5JAXA 1C5IA 3GTLJ 5GPCA 1OA3A 1ONAA 1JW6A 3KWVA 4WWCA 2CSOA 1TW2A 3BCAA 5A32B 3PFYA 2HOTA 3GLLA 4N53A 3OPTA 4RB1A 3M2MA 1DP3A 4XMIA 3VOEA 2VPRA 1PNGA 4LBOA 1UY2A 1MS9A 4I6ZA 3VUOA 3PHMA 3ZXGA 3NSTA 2XQXA 1FMWA 1JUHA 3BG5A 4M0NA 4G7OF 1IKQA 2HR3A 3VKOA 1T98A 3JBG1 1GWKA 1R5GA 2DPUA 3FUOA 1UZYA 3NQHA 4B4QA 2VMIA 4A3KJ 1HN0A 5F5IA 3RZHA 5A6YA 4OI1A 2CG4A 2BW3B 1ETWA 2JICA 1SMTA 1YE9A 2M7AA 1I3HA 4FFIA 1LU1A 2QQNA 3LF7A 1D1AA 1P2FA 3DKXA 1JYNA 4JHTA 4ZY9A 3TNQA 1E57A 5C5TA 5KHKA 5M0TA 4B1LA 1V6OA 4UF0B 2O6GE 1PO12 5D5VB 3RYKA 1H4HA 1S0DA 2JG9A 3E1F1 4EM0B 3K4JA 1N1VA 4OOIA 1GP5A 4ITVA 3VKLA 1DQUA 1JXSA 3P9CA 2NVTJ 4H7MA 2W46A 3M1HA 2BOIA 1PM4A 2E53A 1BBT2 1PO21 3ZLIA 5FKNA 2F5VA 2DURA 4ZXKA 1XSVA 4FHTA 1IG3A 1UG2A 3ZVXA 4DXRA 3HKZA 3HNBM 1W8WA 1JYTA 2O0YA 3WW2A 4IRHA 1LOBA 3KX2A 4QB1A 1NQJA 2HOEA 1ODMA 3CZUA 4GDFA 2W47A 1IPJA 4MX3A 5FY0A 1MMAA 4LPLA 2HU9A 4NQWB 1BR1A 1A6CA 4F92B 3O2PE 5I8YA 1LEBA 1ERDA 3LL7A 4ATEA 3GYDA 1H9PA 2WL1A 4ESFA 2ZGOA 3LAPA 3WEZA 4XHBA 3LAJA 3B6AA 1ZG3A 4O6JA 1HW2A 1H0MA 4OIQF 5JOWA 1OUSA 2VOKA 2R7QA 1BI1A 2Z1DA 1Z67A 4CU6A 4COUA 5JXJA 5FLJA 1V55H 4UBHA 2EF6A 3E5XA 3QAHA 5F3IA 1W36D 2CQKA 2ME6A 2ENRA 2WO3A 4RDUA 1FOYA 4CDWB 1MACA 5JXIA 1UYXA 3K7AJ 3ELKA 2JIJA 1JMUB 1NX9A 4JGZA 1TEIA 1UZCA 4HLTA 1KU3A 2NMOA 5EZWA 2ORXA 2J1TA 3NRUA 2YXSA 3ZYIB 1UKGA 2QZ2A 5IK5A 2WB1N 4RR3A 1UU5A 1W8TA 1BYHA 3NJYA 5IT6A 3AK0A 4QQ2A 5ICFA 1C5HA 4D69A 2P0WA 2E5ZA 1ORKA 1S2EA 1VPHA 4MGSA 4HV6A 2NVQJ 2G7HA 3KSCA 2IT0A 3SJMA 5FP3A 1WCQA 3WQ1A 3K3OA 3KFWX 3BPZA 4ON0A 1IF1A 4CDUA 1J09A 1D0ZA 2J22A 3BG9A 1UG0A 5L73A 1G7YA 3KP6A 4E7IA 3RTRA 3B69A 5GZGA 1KQ8A 1R71A 2V4JC 4XQFA 2BRTA 3M7GA 1HXDA 2VAUA 4DYRA 2ZX2A 2QM3A 2R5YA 5LA2A 4IE5A 5M5YJ 3MKLA 3HYIA 3NJXA 1XSDA 5EG0A 4LB5A 5F39A 4LULA 4PLMA 5DUIA 5D21A 2LYCA 3HSFA 2ZSHB 2FQPA 4M9ZA 1F43A 3ZFEA 3EUHC 4L2NA 2I10A 1CF7B 4RLQA 2F5CA 2XLGA 4HPKA 1KQ0A 2L54A 1EUUA 4J1XA 1AKHA 3MPBA 5A3WA 4IEOA 2DFBA 1QJU1 1T2XA 3ZP5A 2E36A 2ZGTA 5JI6A 5E20A 3V0BB 1W6NB 2ZGSA 3PSIA 5CA6A 5A3PA 3S30A 1IRXA 4ATFA 4D6RA 4AUXA 1LTEA 4YFKF 2D98A 4FTHA 3ABKH 3H3LA 4PQQA 4AAPA 3PJRA 4DXSA 4Y1VA 3ZMZA 1S0IA 2C26A 2CGOA 3W20A 4ETSA 2RS13 1G9CA 2XHKA 5CYYA 5FGMA 3L7WA 2M30A 1N78A 4DEQA 5EYRA 1AR72 1RUD2 3VV1A 1SFYA 2P34A 1DP0A 4MADA 3QP5A 2LVSA 5A6XA 2CU7A 4XZPA 5IYCJ 1RVF2 1OLRA 4B4RA 1T6SA 2FBIA 4RGRA 1W1WE 2QKLB 4MXWA 3ZFFB 2VY0A 3BJOA 1I27A 3SC7X 3ERMA 4HF0A 2CUZA 4AQTA 4BBRJ 3V8KA 2RS31 3HB9A 4C8DA 1D0XA 1UD1A 2BXYA 2DO7A 1NK2P 2WY7Q 1YQ2A 4N43B 1EAH1 1YJKA 1XCVA 5GZEA 1KYWA 1JT0A 3TOBA 1SBFA 1LNWA 2BDRA 3J80Z 4BB3A 2FOKA 2C9AA 3WV6A 4AEMA 5DG1A 3DWLE 4PBOA 3GTOJ 4NNJA 1YRNA 1BEV3 5DCMB 2EXKA 2EZKA 3AFHA 2RV8A 2W39A 1U78A 2Q8CA 3BKZA 1JUIA 4AVVA 1OLMA 5I0DA 5HS9A 3IIIA 4KN7X 4XFIA 1D1CA 3R60A 3OYCA 4AWDA 5C3OA 5LA1A 4FPGA 2DOFA 3SZPA 2WFPA 4XF0A 1PK6C 1RJ8A 4HNVA 4ASKA 1LULA 3O1SA 4M0HA 1W6MA 4EV0A 2I74A 5BYNA 1YHFA 4A0ZA 4NRQA 3KZZA 2XAUA 1C0WA 3ZFGA 4KDPA 1Q8SA 3RZLA 3KB5A 1A3KA 3R4KA 2P6SA 2UWMA 1TME1 3ZSLA 4FBFA 4RB2C 2IA2A 5LLQA 1E5RA 1Y0UA 4MLOA 2EILH 3C3VA 4MGIE 2Y75A 5JXGA 3S93A 2GN7A 3UV9A 2L7ZA 1HSJA 2FMDA 3JRAA 3B94A 1RUH1 1TVGA 4Q1RA 3REOA 3CC7I 1YXWA 1PUFA 1ACIA 4KNCA 3J8F3 2JE9A 2VULA 4PCQA 2BBYA 5C9AC 4B47A 3DYPA 4MEXF 5FZ8A 2OZUA 3HDDA 2BEOA 5FO5A 1BW6A 3CQZJ 4I0WB 5KHIA 1PX4A 5SV8A 4JGYB 5KWRA 4LK7A 1HBXG 5FPVA 1X2MA 2GXGA 1XNKA 4LIUA 4I30A 1SPPA 3GFLA 2IS6A 1U0JA 4BA6A 3LAGA 3OL3A 1GDTA 5CU1A 1DBNA 1ZBE1 4BQQA 2L9LA 2ESNA 4RS5A 2EFOA 1ZA7A 4WBBA 4PSXA 3H9QA 2JKXA 1Z7S3 2X6OA 2FMLA 2TEPA 1JGGA 2X6XA 2LOOA 4QPIC 5T5JA 1UQXA 5FP8A 1G9DA 2YC4A 3DKYA 1LUJB 1RIRA 2A6XA 3N9QA 5E1XA 2OTJI 5EEAA 4AVCA 2XV4S 3NWKA 3J7AY 3PIOF 3HQXA 2XAHA 2BTVC 5CVUA 2ZJPF 1NXMA 3D1NI 1VNDA 1OCTC 3V7CA 1XCBA 3U1KA 5B1AH 4ZHNA 3F6VA 2X0LA 4NBQA 1CESA 5A2QK 5LBCA 3C8XA 4CU8A 1YJWI 4AOCA 4AVPA 3IH4A 5KAIC 2W82A 4CCMA 1S9HA 1SVOA 3TKYA 5ILVA 2BJSA 1HXS2 2VCMA 2MPFA 5A7NA 3BTAA 1LEMA 1JKOC 4CU9A 3SXYA 1COV1 1ZH5A 4X6RB 4CXFA 4Z2YA 2XJTA 2EAKA 1OR7C 3O5SA 3EXUA 5FMOS 5D8AA 1S8NA 3S3OA 4NHLA 2A70A 1S29A 3CZ6A 4O61A 1G4DA 5T50A 3DECA 5CBLA 1WWYA 4XBQA 4V19K 2EIDA 2XIGA 4CDXA 3SEPA 3TOJA 5B4XA 4C2TA 3Q8AA 1W3XA 4TTGA 5LGNA 4QT6A 3DLLF 4FE7A 3FFZA 4XPVA 3RZMA 1M4WA 4IEQA 4JX6A 2LDUA 4B4PA 4QPGB 1BMV2 2D6LX 1LDDA 2QUFA 4I3PA 3WTUC 3CCVI 2UZKA 3M1EA 3E97A 2XB0X 4AIHA 3NMBA 3IN9A 2QCOA 4BOWA 2L0KA 5LASA 4ZJZA 5DYMA 3QPHA 2DFFA 1VQ6I 1G3SA 1X8EA 2R7EB 2JXAA 4IV3B 3JREA 3AJYA 1AL23 4GWJA 1HDPA 4HK8A 2KIFA 2VJIA 1GT0C 4ZZLA 2JDYA 2VGDA 4M01A 2P4EA 3BR3A 3FKIJ 3FHQA 1WCMJ 4XJAA 3ASNH 3VYSB 2HXIA 2DQLA 5LBQA 2X09A 3G3ZA 2NXNB 5E3LA 4IESA 5FZMA 1FC3A 3CDIA 3WG2A 1PVXA 1L0OC 5T55A 4RHV3 3RZZA 5IVEA 4GMP1 2JB4A 1K79A 2BERA 2UU8A 4I99C 1QQIA 4PI0A 1XS9A 4PZJA 2I45A 3GZ5A 2LH9A 1SLBA 4DOUA 4GO1A 2IP2A 3I0TA 1XSRA 2VCBA 3K4KA 4CEWB 1QZZA 4P14A 5K0UC 4BUPA 1EPZA 2A3YA 5FR3A 3NEUA 2DLLA 3MIBA 2O8OA 1Z3YA 1X1PA 2J5PA 2HVSA 4KGGA 1R1A1 1QXPA 2VE9A 2NNYA 2XHNA 1O4YA 1R22A 4CYCB 1QQP3 2LK2A 1D3YA 2EZIA 5JLVA 2KKOA 4I01A 3UL2A 5FLVA 4R9DA 4F7ZA 3FMRA 4WM7C 5JI7A 1ULDA 2Z79A 4QD2A 4LXLA 5HCBA 4FX0A 5AC93 4PIYA 4QX7A 1CAXA 2YMZA 2MHFA 2HDWA 5H9PA 1K4SA 4DJAA 1W6QB 2A75A 2I5UA 2EV0A 1O8SA 3TEXA 4YZ1A 2GSYA 3GTPJ 1UXXX 3KYDB 1OKOA 1R091 4BNCA 2A6VA 2QBYB 2WO2A 4EVIA 3I2GA 1YIFA 3HUGB 1C8M3 5D6FA 3O1TA 4CCOA 2NPIA 1U3EM 4L0PA 1VJ2A 1Z7UA 1O5UA 4XFHA 3HXLA 4AK3A 2IGMA 4FQ4A 5F1RA 4XJUA 1HW1A 2PMHA 1ZM1A 5LBBA 4ASMB 5IP7J 2RG4A 1OLME 1P8JA 1JJ6C 3S7IA 5CVVA 2ACJA 2HBTA 4A3DJ 5DCFA 4DGWB 4YW4A 3PURA 1TBXA 1HSTA 2DCEA 1KYZA 2Q2EA 5FQ0B 5IY5H 3BR0A 2A7AA 4PDWC 4CDQB 2ETHA 5FUIA 1WCSA 5FUPA 2Y64A 5KXCA 5D8KB 3V8JA 2BE5F 4BH9A 4LLOA 3K75B 1CVNA 2KD7A 1F15A 3JD71 3VDAA 2OT7A 2RS51 1LE8B 4LBQD 5DAVA 2EJRA 5FY8A 2DU9A 1QZYA 2IGOA 2R7UA 3OOXA 3B9IA 3JBG3 4NPRA 4QX8A 3HJRA 1REDA 2YS9A 3I4IA 3FISA 1OCCH 5FXZA 3FMSA 2IGNA 2EVXA 2WV1A 4OMZA 2K27A 1OPCA 1RHI2 2O61A 1K61A 3HNMA 3IRRA 1RZ4A 2JKBA 4MEYF 3OD4A 2KDOA 1F31A 3ZOBA 5IOYA 3NNLA 4P00B 1Q5OA 2TCTA 5FO9B 2ZZQA 3OUJA 3WZ1A 3POFA 2BU9A 2PHWA 3CEWA 3H1MA 4AVAA 2O03A 1WRJA 1UZZA 3I58A 1PGW2 3BQZA 3C2UA 5G04L 1PO23 4IERA 5F6FA 3U4XA 3K3NA 3ZN4A 4LLNA 1KS5A 4N90A 3IDEA 3N7MA 2R16A 5AFBA 4YIRX 2FCUA 2YGMA 1GVDA 1QIQA 5EWSA 4BLJA 4I0AA 3ABLH 3D5LA 5LGUA 1QJEA 1NA1B 2WAFA 1AXKA 5LATA 2AYHA 2ZJ2A 2K9SA 3AL5A 4HNUA 2IVIB 3A4CA 5APAA 5B3SH 5EP9A 1V6MA 4KISA 2W95A 1Z7LA 3IIAA 4ASNA 1SLLA 3LPGA 4SLIA 3ZYHA 3AL6A 4PJ0C 1LOGA 3ZMDA 4MGKE 3M3YJ 2MD5A 1VIWB 5FLXK 1VBD2 1PZ7A 1ULPA 3CJXA 2VOTA 1W39A 1RUNA 2XQRA 1FI2A 4QPYA 3OWTA 4IVNA 3OYJA 4RN5A 1BOBA 4Q47A 5JIAA 5GZFA 2OYZA 5GLUA 4WVMA 1LHNA 4AFDA 3VDXA 2OPTA 1QHGA 1KU2A 4FO9A 1EPWA 4PIZA 3MD2A 3HHGA 2OVUA 2GP3A 3PU8A 4XLCA 2YUSA 3BG3A 3U75A 1ZBA2 3C2GA 4LBMA 3TP0A 1W6PB 1PO11 2D2WA 1GV2A 2K4JA 3ZR6A 1NCRB 4FFFA 2H09A 1OCOH 3CLOA 4PIXA 3DEEA 4OMDA 2WLPA 4S2HA 2ZMKA 5E1ZB 4UFHA 2ZGLA 1MS3A 3RQ4A 1BBT1 5L3FA 1WLWA 2M8EA 2P3YA 3GZEA 4I09A 3VBUB 2VJ5A 2V4VA 1C1LA 2Z69A 2WTEA 1YEWA 2P3JA 4GB31 4C1XA 4DBQA 2EZHA 4L9TA 3ESWB 5AVPA 1Q43A 3AXEA 2PMUA 3KIOA 3MLKA 3N97A 4AVBA 3GFIA 1S3JA 1YO8A 5JR2A 3BIWE 1FYMA 2GZWA 1IS4A 1QRYA 4H55A 1DZQA 1VRBA 4FPHA 1QU0A 1WHUA 2IXKA 4ZC3A 5C4WB 2PN6A 2L02A 3OGRA 3WD5A 4NWWA 1RMU1 2BY0A 5HI0A 3OYAA 5EEHA 2R93J 1GWLA 3OS1A 1IN8A 1XE0A 1DYKA 4HW0A 1QJU3 3VHNA 2IEKA 3LSPA 1ZA4A 5F08A 3OD0A 2Y6HA 5D1IA 1ND3A 1HOMA 1NUKA 3AG2H 3SMHA 3OOUA 2YSRA 5F0HA 1G2HA 1EV12 1G9AA 2ZMLA 2CU5A 5BNNC 4MG2A 1BQPA 3VZOA 3T4HB 4DW6A 2IS1A 3GXOA 2WQ8A 2EH3A 3VZNA 4A3CJ 2HQ5A 1HIXA 1KS4A 4XDOA 3V42A 4QXBA 5LHIA 3ZXKA 2HWB2 5DG2A 5FPBA 3HKZN 3BU7A 4NHYA 3CD6I 1Y7BA 2CYFA 1NLSA 4XZUG 1YW8A 1W2TA 1DQ4A 1J1TA 2CQ7A 5C7GA 3RI4A 5AONA 1TWAJ 2JPCA 1WJFA 3HRMA 4Q0VA 4CP9B 5LW9A 3VHOA 2DTWA 5D8LB 1HF0A 3PO2J 2NS0A 2RS33 2Q30A 4DOZA 1K5MA 2LBFB 2ZA9A 5H6RA 1SAXA 4CA9A 3T2PA 3FWEA 1EAH3 5CISA 1H2KA 1DQ0A 1OOPA 3U1DA 1KDMA 3PVEA 5DD8A 1PZ9A 1POGA 3FDYA 2R7SA 5T5OA 1MZ5A 1QA6A 4QX1A 3C3WA 1VQ7I 1U12A 2QQKA 3U2RA 1ETQA 3UKTA 3QODA 2FU4A 3ZXAC 2STTA 1KJLA 2M1BA 2VO5A 4M6VA 1I1SA 4IOAF 2COMA 4DO0A 3GTKJ 3ZYFA 5C8CC 4BGDA 2CGPA 4UBGA 3L2UA 4TYSA 4DINB 3ZGKA 1GLHA 3BR6A 3CESA 3WF4A 2R1DA 3TN91 3M3QA 1QO0D 5KHDA 2VBXA 4FX4A 2FDHA 2QQOA 4LKFA 2PAEA 3H1YA 3KYCB 2E60A 2VZQA 1AR71 2GMEA 1RUD1 1LFBA 2Y26A 4JQFA 4LO8A 1AUYA 3KLOA 3LEGA 4COVA 5F27A 1J75A 3RZJA 1X58A 1TME3 3VB9A 1RVF1 4QQOA 2LF8A 4Y4RA 1W03A 3PUQA 3WINE 5H20A 2Q1MA 1R23A 2O14A 2C4XA 2Y0SA 4QQHA 2EV5A 4BQAA 4IV1B 1X1BA 4EJWA 1VF9A 3NNFA 2W1SA 1AYM2 4P9JA 3CJRB 4FOQA 3OV8A 2DVDA 3ZQQA 3INAA 2DA7A 1G59A 2WNVB 4M73A 4XUNA 5JPMB 3VDBA 5J6XA 1HB2A 1SLTA 1W2NA 4LG0A 1A6IA 2YU9J 2MC3A 4E9KA 3DPRB 1GMMA 4I3GA 3HNYM 5ABJC 3T1BA 2XWJB 5GADJ 4RGXA 1N3OA 1U5XA 4B7EA 2EIMH 1V6NA 4RQPC 1HB3A 1YI9A 4WM8C 3MEXA 2JEMA 4C3HJ 2RDQA 2R7XA 2AXTC 1SEUA 2NVYJ 1XN7A 3MBWA 1V3FA 3W2VA 3HOVJ 4FTBA 5BPDA 2VZVA 1TW3A 1ZBE3 4B48A 1JT6A 4GALA 3ERED 2M2EA 1Z0XA 3DBHB 4Q48A 3F8NA 5J1YA 3LWFA 2DDAA 3E6MA 2MLKA 2XVGA 4E4ZA 2VTXA 3HQRA 2OJED 1CPNA 2XXZA 4ZDOA 4CDGA 2XR4A 1TC3C 2BBAA 3E3VA 5D4SA 1Y8QB 4YIFA 5FYMA 1GV9A 3VD3A 3AZZA 1YYVA 1XXNA 5IYDJ 3AP5A 2JG8A 3Q9OA 2PLYA 4NOTA 2ADEA 1OQYA 2O9LA 1F2NA 4FOVA 1S2KA 5FPZA 3X2QH 1HC8A 1CJDA 4QWQA 5JOZA 1W2UA 3J4UH 2WNUC 1TQIA 4QPWA 4F8AA 5FZFA 3CMMA 3MIGA 3C7EA 2LRPA 1DG6A 5DPNA 3WDUA 4PLOA 4OU0A 3KGLA 1COV3 3S3NA 1LGNA 4CEYB 3F6OA 3WGIA 4W1UA 4LQRA 4QQLA 2RS12 2X8KA 3L09A 5IT9K 4HONA 5AVAA 3AG4H 1O3QA 5IJRA 5DXDA 3LSDA 5IWFA 1QEXA 3I3EA 3IHUA 4XF3A 2XUEA 1RUJ1 4I98B 2ADUA 1VQ4I 4J6GA 2B42B 2JB8A 2V73A 5HNFA 2DDBA 2A3SA 1C28A 4YVWC 4V2VA 5F0CA 4MGTA 3KM5A 4BYYA 5ACA1 3T2OA 1MNMC 4OZXA 1FEXA 3MF9A 2XMLA 3SH4A 4P9IA 1UIJA 2ZMNA 2M4GA 3A2KA 2YBSA 4XC9A 3SCFA 2XRNA 2ZX3A 3ZXFA 2MH2A 2RHPA 3ENRA 1VB4A 1LOFC 3LA3A 3MV11 1W3VA 1LKNA 5L7OC 1C3HA 1IPKA 1DGWA 2DA1A 3JB8A 3RJPA 2HYGD 3HOBA 5L36A 3RSJA 1AJOA 1HDKA 4R79A 4Y5Z0 1H4GA 3GMEA 3PNTA 4BXSV 5LK5A 1N75A 3E6DA 1GZWB 3CNAA 1K5JA 1BEV2 1BJAA 3RQIA 3B6CA 4OYUA 1QOSA 2FF4A 4E7SA 5FMDA 4ZU4A 4RSUA 4XIKA 3VDDC 4XUPA 1PP8F 4XIDA 1SFOJ 2PXJA 5HLGA 5IVJA 1P4AA 4J25A 4E4HA 1BA5A 1OLQA 5A3UA 4BQXA 3WVJA 3K9TA 4OHXA 3F8MA 2ZMEC 5BNPB 4OFGA 1D8JA 3QD6A 4XSZF 2R1BA 2FCTA 3FXMA 1H2LA 2PLV1 4N53C 3NKGA 1R1A3 1SMYF 2HQNA 4LHSA 1FOXA 5CQEA 4M3GA 4MFEA 3IWZA 2QVSB 4YVSC 4C2UA 2A61A 2JPBA 3P9KA 3KV9A 2A1XA 1BK1A 1DU6A 5LHHA 3GHNA 1R4MB 1L7QA 1ZTRA 3C18A 4I7HA 2CQXA 3AZYA 4EZHA 3CCUI 1XU2A 4CA0A 3ACFA 4JKLA 4V2FA 4MGYE 3WTTC 1JUPA 3VBSB 1WW4A 3UKGA 4MTDA 4GH4C 4C0BA 1QBJA 5IAXA 1JTXA 3POYA 2CMPA 4B8EA 3DKQA 3RPUA 3J8F2 3LPFA 2LREA 2A07F 1YJNI 1R093 3EQEA 1J3PA 2JG9C 4P08A 4RGGA 2COBA 1FP1D 1IHMA 3SZTA 4RGSA 3HT1A 4IEYA 4QPOA 3I59A 3NAPB 3EUHA 3RYPA 2JZYA 3I7DA 1LDKB 1JZ6A 1X50A 4BQOA 5LBEA 3JRBA 5CNAA 1W99A 4AI1A 3MO4A 5BY5A 3AX4A 5DTDA 1D4M3 4GWMA 1IN6A 1GZCA 5FK8A 3ZQCA 2BUKA 2YC2A 4XK4A 3CL1A 1MZ6A 1PUEE 4BIFA 3F21A 1FY7A 2QJVA 2BPA2 4HN1A 4HF2A 1WA6X 2KZGA 2BNOA 3CO7C 4F55A 1GVJA 3GLXA 3J7HA 4Q4W1 1RXFA 1KFUL 3H5NA 3WQBA 1I50J 1DGWX 2ICWG 3A7QA 1MZBA 2EINH 4MQVA 4CGZA 2JDUA 2XF5A 1CJPA 3JRCA 1GXPA 4QX3A 2K9NA 2Z42A 2KIMA 5F64A 3ACGA 1XU1A 3DKWA 5E17F 5H2FC 1OFNA 2G4IA 3JXSA 4JGZC 3BG6A 5CFCB 3GDBA 1RUC1 4HVQA 4E2QA 1QNYA 1W5SA 4LFUA 4AQSA 5FLXZ 4RR3C 2C24A 2AXLA 4I02A 3DCQA 3M8EA 2KT0A 2L9VA 2UYAA 3SNMA 2HWVA 4NHKA 2F4MB 4D7SA 2RMU1 3LDKA 4A6DA 1JHFA 5A3TA 3X29B 4V1PA 5F37A 4AU7A 1B4AA 5I8TA 1XNCA 1W7PA 4B43A 1SBDA 2YPRA 1LAJA 1I39A 2VQAA 4QTRA 1Y43B 5C5UA 4OVEA 2P2KA 1AX0A 3U14A 3CF6E 2EIBA 3GF2A 1N1YA 1PK6A 2P6CA 5JUVA 3HM5A 2ZXHA 2ZCWA 4LITA 3LEIA 1SFPA 1IPSA 4QWNA 5HPOA 2DA3A 3H8OA 4XUOA 3DUIA 3ILNA 3Q9VA 1JHJA 4XRFA 3GJAA 1L3JA 3ZFEC 4DPNA 3WCRA 4D7MA 1AL22 4DUWA 4W6WA 5FY4A 2DCJA 2F5DA 3ZYJB 3ZX7A 2HBUA 4BU2A 3IB3A 4Q26A 2LW8A 1US2A 2KA3A 2G19A 2F4PA 2R5ZA 1O4TA 1J1LA 1LGBA 4B1MA 4COZA 2PJPA 1EY2A 4RLFA 3GZ6A 1RTVA 3U78A 5A33B 4RHV2 5KNLA 2MC4A 3ZMSA 4Q5SF 4AVZA 3VEPA 4JX5A 2HVRA 1OPMA 4XVHA 1OPOA 1TWFJ 1SDDB 2VODA 2EXIA 1H9WA 2ZFWA 3KEOA 1FBQA 2CYYA 1V6IA 1U5ZA 3SZGA 4IUGA 3MZHA 1PO13 1MMSA 1AR81 3P5JA 5EQUA 4Y20B 4L97A 4HT1T 1UB9A 2GC2A 4Z82A 1V6LA 2QTWB 4LT5A 1W06A 1X1DA 4M74A 1X1CA 3ROUA 3EHKA 1RUE3 1NHAA 3WTWC 1BBT3 1QQP2 3HL2A 3OBRA 2XPJA 4XOGA 3IRQA 2WN3A 3L2YA 4LLFA 3W9AA 1S1AA 1D1BA 4WVVA 2QQBA 4EN9B 1ZARA 3M3CA 4GB33 5AC92 3QYFA 1WPKA 5FYVA 1DLLA 4M4PA 2BV4A 3ACLA 3KP5A 2D6MA 3GFJA 3GXUA 4J1WA 3SQOA 5FYTA 4FOWA 2AQFA 1OURA 4BEHB 3THTA 4GMP0 1USTA 3VFZA 1NKGA 1SFKA 4M3EA 3FL7A 2YUEA 3UJOA 1RMU3 4IZZA 2OUJA 4QXKA 1HDDC 4M72A 5FYBA 4BCUA 1TT0A 1Y1VJ 1XD7A 1VBD1 1C8M2 4XYXA 3HHHA 1YFXA 2ZX0A 1BI2A 5K5RA 4G9SB 1WVRA 5D6EA 1JUSA 4E7HA 3T08A 3TO9A 1XG1A 3JTGA 1FAYA 3DQVC 5FY7A 1VMJA 3M7AA 2QQUA 4FQZA 3S2WA 4LLLA 3I97A 4MZUA 2WWSA 3V7SA 1OC1A 2IZWA 1US3A 2W85A 4XN0A 2DFEA 4NUBA 1ZBA1 2VZ1A 2W87A 3K51A 1D4VB 2VVFA 1EKEA 3LA7A 3GZNB 1NT0A 3ES4A 3DBRB 2VZOA 1RUF1 5A80A 3HTUA 4A7YA 2HGCA 2DMQA 1VBA1 3VBOA 4AI9A 2JA2A 5BUVA 4NIDA 2DMTA 4ARYA 5A3NA 2VI6A 5CB7A 4YW6A 3POSA 4CVUA 1PZ8A 3JBG2 3ABZA 3ZMUA 2XGXA 3FM3A 1JE8A 2QKDA 1MBGA 5GZDA 4XAAA 4MHRA 3WP5A 3QYBA 3G73A 3MIDA 2VMCA 4IEWA 4N4NB 1U5TA 1DPRA 4K2EA 1QPMA 4LO7A 2ZGQA 2DFCA 3WR0A 1HV1A 4U2AA 1S0CA 2DBNA 3G71I 1V9U1 1MDMA 3FMQA 4HPQA 5L3DA 5HLIA 1XB9A 3GM8A 1WZ2A 4JKMA 4XCBA 3F0CA 3E6CC 3JTHA 3L2HA 2LY9A 2GXBA 1ZZ9A 3I3MA 3KEYA 3RYRA 3NJVA 2E7XA 2L01A 2ES3A 5FKCA 1HJGA 3KP3A 1F5TA 4ESBA 2GDFA 2XC7A 1IN5A 1ULOA 1YFUA 1CQTA 4IETA 1PO22 2OPKA 5FZ0A 2DK8A 3J7YJ 2AZ5A 2YBPA 3TN93 3I4NJ 2OUMA 1B9NA 3PUIA 4EJTA 4YGBA 4U36A 1OUXA 4A2UA 5DM6F 2WAOA 5JCTA 1RUD3 1ZN2A 4HANA 3MAJA 5K0UA 3U07A 2X6WA 5EGOB 5FMCA 4H14A 1RVF3 1OKRA 1IZ3A 4MOAA 2FNPA 5DUWA 2HWB1 1H2MA 1B6AA 3WQ7A 4UFKA 3NNJA 4NC6A 2KRFA 4IHVA 2KIUA 4B7KA 4LA3A 2BGPA 5IFPA 1YYNA 1ZRCA 4E8CA 4QDQA 3B3QE 4AYBA 1WMXA 2GXAA 2GP5A 1FT9A 2X1EA 2ZXIA 1O7LA 3USUB 5FYIA 3TW7A 4BMBA 5D8AC 5ANNA 2FHRA 4KITB 2FJ1A 4XKWA 2SLIA 1XRUA 1JTZX 1QKQA 3ZOIA 4HAMA 4CDXC 2R0FA 3BVCA 4B09A 1IN7A 2HWD1 2AH2A 2NQYA 3BCBA 3HAGA 4PFOA 2PBIA 1FMD3 5GLTA 5CZKA 3PTYA 4HOOA 4XE9A 3AMNA 2BP6A 3O14A 1TNRA 4DXZA 2Y6GA 2MH9A 4IGPA 2KFDA 1BIAA 2GH2A 1ND2B 4MHGA 4K40A 3VD9A 2QQVA 2E1OA 5IK8A 2PA7A 5C9AB 3CMEI 1DQ1A 4ORFA 2EFQA 4DXTA 2WAQA 2GC0A 3O6BB 1WI9A 4UV9A 5IUQA 2A5WA 4PDWA 5K8SA 2UY8A 4CXXA 3S2DJ 4BDYA 3POGA 3MVPA 4BZ4A 2HQAA 3AFGA 1QJFA 3ZSEA 3S57A 1LHOA 1MS5A 1TE1B 5J48A 1UX7A 2K85A 3LNQA 1X33A 2C5DA 4LHNA 1AYM1 1YHQI 2EA4A 2WO1A 4Q2FA 3SDBA 1REEA 2XVCA 5HNHA 4RB0A 1QJU2 5FJHA 4NPLA 1RYYA 1AHSA 2VMDA 3BG7A 1HKQA 4QPIB 3C2HA 3TB0A 1L7LA 1IJWC 4LD5A 1O59A 1TWCJ 2Q1ZB 3VBRA 3BU0A 3CJTB 1R1ZA 3O1OA 5J40A 1N25A 2XUBA 2DTRA 1YIJI 4Z2AA 4P9YA 1F4HA 4XONA 1RUJ3 5HLHA 3FC0A 3BUCA 4UXAA 2OZ6A 5J1UA 4LBQB 3TBIA 2LS6A 4OHVA 2VUAA 2EK5A 4FPFA 3MQ0A 1SFEA 5ACA3 3GZAA 3N9NA 4D7TA 3O1MA 5HXMA 3PIPF 5B1BH 1VQ9I 2F6BA 2BGCA 4LUKA 5C3QA 2V5YA 1OD5A 4FT8A 2RS32 5FJ8J 5FYUA 1H1MA 4HQEA 3DPLC 5A1LA 1V5EA 2K2SA 1WWXA 1ULCA 2JTVA 2W2IA 3RJ2X 4XXPA 1BKZA 5FPXA 2K0GA 4M3CB 3KCYA 3BLYA 4BWOA 2HEYF 2Y0SN 4G94A 1VI0A 1Z05A 3H1CA 2ZHMA 3KP7A 4WK8F 5GAEJ 2ZHKA 5IOZA 2RNGA 5C4JJ 3H7JA 2UWAA 2MSYA 3AMQA 4JVAA 2M0CA 3FLPA 3NW4A 2R061 5CKMA 4MO3M 1T39A 1BC8C 1K78A 2EIJH 4NO4A 2EZLA 1VBC1 2DDUA 2BVBA 4PBPA 4NJ4A 4V2WA 4HX4A 2ZPXA 1XC6A 4PF1A 1QOTA 3HBKA 2XBO1 2PLV3 3CQOA 3GTMJ 1Z78A 2EALA 2Q4SA 3WOGA 3POWA 5L3CA 3W6VA 5F04A 1T95A 1UL9A 1WLTA 3HRUA 3N9OA 5JLWA 1JZ3A 4BM8A 2RQPA 2KRCA 1TME2 4GA9A 4EE2A 2FZ1A 1U9OA 1ETVA 2WADA 3I5UA 4IGOA 3BDDA 2FD8A 2WFF1 1ALYA 4B3NA 2ECBA 3V56A 1VRH3 4UFMA 3N9MA 2CAVA 3WDYA 5FO7B 3OUIA 3AB0A 4XM3A 2NOGA 1T6BX 5K0UB 4URTA 5HDKA 1AYN2 4BDZA 1FBUA 3BN6A 4XETA 2PHUA 1JOBA 2AS5F 4Y26A 3H92A 1O4XA 5JHUA 3FJSA 4XLFA 2V6CA 2ZAHA 4BJTA 1G3YA 4HSTA 3JCIA 3K6GA 4WM7B 4AGVA 3OTFA 3K4NA 2DMUA 3VKFC 4FFGA 1ETYA 5FZDA 1UMZA 4BDVB 3LZZA 3SH3A 4A3MJ 1UY3A 2I2SA 3CJNA 4S04A 3QH6A 2J1AA 2DCTA 3ZXJA 2RREA 4QU1A 4OI2A 2JD4A 1ZBE2 1O7FA 3VD4A 4XRMA 5DAQA 1X2NA 1ONVA 2OV7A 3GJBA 3OYWB 2IPQX 3K1MA 1W6OA 4YGDA 1LJ9A 3CDZB 4IHTA 5M3FJ 4XICA 1E3OC 4HBNA 3KV5A 2DAOA 2DYCA 3WG7H 2X1CA 5FMOL 3KZ4C 2HTJA 2H6BA 5ICEA 5EPAA 1B72A 1IN4A 1WH5A 4KIGA 5JMCA 2W3JA 4Q4W3 4A5NA 2D3RA 4ENKA 3K2ZA 2FQ4A 1LCLA 1RR8C 2XPWA 1H6YA 1R1TA 1WJ5A 2M7BA 1NYWA 1V5FA 2Q8KA 4AI2A 4FQGA 5BXXA 4Y5TA 4OULA 1X8MA 4DUXA 2K7LA 1KFXL 2P7VB 2CO5A 2XPVA 1MS8A 1RUC3 1YQ5A 2VQTA 3CKHA 1YRZA 4Q4V3 4UY8I 1YUDA 1BL0A 5FY1A 4NIIA 1P7IA 2G9ZA 1R9TJ 1JZ5A 3V0AA 1COV2 1JHHA 3DF8A 2MABA 2ID4A 4KWJA 4Z07A 1E3HA 1EA3A 3I2JA 2RMU3 2L7KA 1UNBA 4D6QA 2R041 4JCKA 5FYSA 2C9KA 4GXLA 2W1QA 4UYBA 3EBRA 1W2AX 5FZAA 1JHNA 3HQUA 2XASA 3C7JA 3F95A 1R7JA 3UESA 1QHDA 5D5XB 1SZBA 5CVJA 1UOGA 3DPTA 4BK4A 1VLNA 4OIOF 4HXCA 1S7AA 5IYBJ 3FK6A 3WODF 3PQKA 1OMIA 3D8CA 3W5NA 3A1YA 3MUZ1 3AKSA 4NAOA 4HLYA 2EIEA 5C8CA 2XKOA 4QU2A 2P5LC 4RFRB 4FPKA 2KJCA 1Q1VA 3V65A 4BHPA 3QH7A 1WMDA 3FHAA 4C90A 3V64A 1TWGJ 1JJ8C 3WW1A 5F9TA 4E70A 1E17A 1C4RA 1LFPA 1IXCA 3U21A 4OAZA 3E0JB 3ECHA 1S0FA 5EJ1B 3N35A 3ZN1A 5E18F 3VB2A 4KH9A 1ULGA 3LEMA 3PLQA 3A01B 1ND3C 1VFCA 3MKWB 2ZB9A 5A3MA 5FB2A 3HOTA 3AL0C 4HVRA 3N36A 2NS8A 4HOBA 5F2SA 5H9SA 4Q4Y1 2A6HF 4RB3C 2M45A 3EPZA 4FCYA 2R7ZJ 2VQGA 4EN7B 2VKEA 3V8LA 1P9QC 2H1KA 3ZFFC 3SITA 3ZMVA 1AR83 4FP2A 1OVPA 4Y22B 2LF7A 4YW1A 3LOCA 3I55I 1W05A 3AM2A 3FHZA 2PQ8A 3OY8A 4TWTA 3VLBB 3H9AA 4G7ZF 2IWGB 3IBMA 1Z91A 5B5EC 3M8JA 3VBHA 1R1A2 2YHJA 3OBZA 2WNOA 4UUSA 4NROA 4IL6C 2WUHA 2OIIA 4ZYEA 4QKBA 2QZ3A 3SCHA 1S5LC 4JQTA 3ZXDA 2D45A 1TTYA 4K1YA 2B4KA 5JZGA 4DNYA 3KQ4B 1JKPC 3JUUA 1V6JA 2WINB 5C4XJ 3FHIB 3BPXA 3U37A 4QSHA 4UVAA 4TXWA 3ZMNA 2H8RA 1DGRA 1O6UA 2IA0A 4EM2A 2E34A 3VYRB 1AL21 3IAM2 5GAHJ 1MQTA 3ME2A 1R092 5DUKA 5F7UA 4BJ5C 3WU0A 2ERFA 1GWMA 1VBD3 5JWPA 3OR2C 3ATGA 1XNAA 4LTAA 2P8TA 1RIOH 4BQWA 2E26A 3W2WA 4X8NA 4C0HA 4C2MJ 3CF5F 1CAUB 1CIYA 3AG1H 4MGZE 5C3RA 5CVRA 3MGUA 2L7MP 2A5YB 3M4OJ 1MBEA 2AENA 4N9HA 4O3MA 2CQNA 2OZJA 4META 1R64A 1YNAA 3DXTA 1ZRIA 4V2GA 4PJLA 1D4M2 2O8QA 4DRRA 4TZDA 4XBFA 4W4ZA 2QZ8A 3T8TA 1ZBA3 3ZPOA 1IGOA 2OC6A 1D2QA 2KDZA 2FX0A 4AWXB 1RKTA 4AR2A 1RUF3 2ZC2A 1HQLA 2ZO4A 4LORA 2D3SA 4AVSA 2WC2A 2C6YA 1OFCX 1VBA3 1W9YA 1ENQA 1X4OA 3QU6A 3T0DA 3Q8CA 3Q0VA 5E89A 5GLVA 1XNDA 3BOWA 2L7FP 1RKWA 1UOJA 4FE4A 4AL9A 2VOOA 4Q8KA 3H7YA 2JA6J 2XJQA 2JDMA 1SDWA 3PUBA 3RWKX 5EFUA 2LG4A 4D0QA 1T56A 5BNNB 3ZKUA 2O0OA 4B3AA 3GNEA 4UB6C 1H88C 5C70A 1V9U3 3SQNA 2VASA 3ETQA 4MGQA 1CR7A 1LOFA 3HOUJ 5AFEA 2Q0AA 2LY1A 3GCMA 2R49A 1ZG1A 2X51A 1X9TA 1OH4A 2DN0A 3FLRA 1C8M1 1MH3A 4XBLA 3PU3A 4C1WA 4UB8C 3O0XA 1Y9MA 1FOWA 2LM3A 2R3SA 3NV1A 2X29A 5FZOB 2FDGA 1GP4A 4QKFA 3RWNA 3PUSA 4IHWA 4R9CA 4HKLA 2QWWA 1NLRA 5F5AA 1JGSA 1CX4A 5CQGA 4LLGF 2DVBA 2ZKZA 3OG2A 3JZVA 5KXEA 4QHBA 3MIFA 2ZMEA 4BHCA 1WJAA 1I1EA 5I0SA 2DBBA 1W9FA 2JG8C 4M3DA 1UY1A 5FKBA 3KQRA 5HCFA 3I2DA 4KG8A 1W5TA 3I49A 2L4AA 5M5XJ 2HWB3 4IHXA 4HDUA 2IXJA 4YVSA 2D1HA 1PMJX 3ZQGA 1PP7U 1QH7A 4MHUA 1OH3A 1GNZA 1R083 3L9FA 3VPRA 4JBAA 3OL4A 2IA1A 3HT2A 2VM9A 1LHVA 2FQ3A 3I2OA 4KJZA 1PVEA 2M0MA 4ES9A 2Y60A 1P4XA 3BC8A 2JWPA 3WDVA 4YFZA 2V26A 3OYGA 1J58A 5A3LA 1F4KA 2JA8J 3SDGA 3JQWA 2JDHA 2R7FA 2BGOA 1LVKA 4GH4A 1RI7A 1KZHA 4QPGC 1TMF2 3R61A 3PVOA 3S6PA 1U8RA 4N9IA 2BHZA 2HWD3 4CCCA 3ULQB 4ZTFA 4QMAA 4M9SA 3CCJI 5ED4A 4IQJA 5FD5A 5HVQC 2VQ0A 1IAWA 1Y8RB 1SLCA 4K20A 3CUOA 2JVGA 5DMYA 2VW1A 1RUE2 5FBJA 3H0DA 2E7AA 4IV3C 1RB8G 2G9FA 4BE3A 1DF0A 4NMIA 3OIOA 1DPUA 5F6KA 1K83J 2DMNA 4XMAA 1JZ8A 1R5ID 3LSRA 2Y6FA 3OSDA 4GB32 1UZVA 3KVBA 2RGVA 4M6YA 3SLIA 5ABJB 3OCPA 1QWRA 4MXVA 4EGYA 1R1VA 1OF3A 4BL0B 2EFNA 1YLLA 1WFXA 1N47A 4GWNA 2K9QA 3LFIA 3AZVA 4RQPB 3KZIC 1B8IB 3EDPA 2WAEA 1HJFA 4WM8B 3WXPA 1JKQC 4AFAA 3WG9A 1RMU2 5LFAA 1MKMA 1UOBA 4PFPA 4XDPA 2R071 3WY6A 4CEWC 1REFA 1UYZA 4BAYA 3KF5A 3WSOA 1AYM3 1HLCA 4RL7A 3S7EA 3FXLA 4P9FA 5JSOA 3ZKYA 1T2KA 4HVOA 5J4VA 4HKOA 5J96B 4XQWA 3SEQA 2B63J 4ZXEA 2MGQA 2E33A 2GC1A 1F4AA 1HX6A 3RKXA 4HQMA 2FXAA 2HOSA 1T8IA 4OHZA 3UT0A 2RM21 3N7LA 3UETA 1WW7A 3R05A 4DQ2A 1SD7A 2WNEA 1Z1DA 1X82A 1XYNA 4JTOA 1Z6TA 4IE4A 1CAWA 1UW8A 1FZPB 3MEPA 3IAQA 3C7GA 4RAFA 2WNUB 1OFSA 4LNVA 3BOPA 5LCWL 1IS6A 3OBAA 4D9JA 3CUQC 3MFAA 3CHXA 4N4OB 4P55A 1ODDA 3N4MA 4FOYA 1OVSA 3KVAA 1HV0A 2Y30A 1LODA 2LTPA 1Y6IA 3ZIWA 4KIFA 4L9VA 5D2AA 2WO7A 1UMHA 1FIPA 1XNTA 3UGHA 1ZRRA 1H8TA 3ZR5A 1W8UA 2VBWA 1GP6A 2E7QA 5HV0A 5CFDA 4YW7A 3ECOA 3UGFA 1NG0A 2XL7A 4AXOA 3FHNA 2E1MC 4CPBD 4XDQA 3WG3A 4YVWB 2CGNA 3GWZA 4ASLA 2AACA 2MW8A 2WT1A 1FLIA 4CDQC 3A4UA 2TRTA 4FTEA 5CADA 1ETOA 4CCEA 4AYBN 3WTXC 3S3MA 3OR1C 5K1YA 2R063 2V1DA 5FPUA 5TJJA 2HYXA 2DU1A 2VC9A 1VBC3 4Z8BA 5L7OB 4XACA 1HRI3 3OS0A 1NK3P 3S1QJ 3TN92 1UU4A 1J0RA 2XBO3 4C91A 5E88A 1S0GA 2RDNA 1MJBA 4MQ9F 1AWCA 2VONA 4ZYAA 5LEKA 1W8HA 5IVFA 1RITA 1SC7A 1LFUP 2IBDA 4Z92B 3PIGA 3E7LA 2A6ZA 3J7AO 4GWIA 5A1AA 1UX6A 3JCUC 1GOHA 2Y0MA 3GTQJ 2NM1A 1A78A 4JDOA 3VDDB 4NAMA 2WFF3 2FBEA 2ID6A 5CAZA 4XUTA 3LFUA 1FMVA 2WAQN 3ZN6A 1RPWA 4JQRA 1BCXA 2VBPA 1U5YA 1D0HA 3NV3A 4ARXA 5JVTA 1N1TA 3JRDA 2Z33A 4N53B 3EMRA 4PK4A 4JDNA 1X9PA 2R0HA 4LMFA 4K7JA 4L5EA 3C7OA 3L00A 2I8DA 1K4TA 2LTNA 3Q9SA 4XF4A 1UHWA 3EJKA 2WZ8A 4A3EJ 2BYVE 4Q0PA 1FP2A 4X0GA 1WCKA 2WS91 5E6HA 1FMD2 4LK1F 2LY2A 2P5BA 5FPAA 2CTVA 1XQNA 5K7HA 5J3LA 5EDNA 1STZA 4XFFA 4A3LJ 1A8MA 1GU3A 1YC61 1ULYA 1A31A 5DQ0A 3HEIA 4ISRA 3GUDA 2B45X 2G7UA 5CYVA 2F5EA 5FZHA 2ZKLA 3LCPA 1QZEA 2JG9B 4ISQA 5L3BA 4YM0A 4NC7A 2OA2A 3VL9A 5A7WA 3ZQ7A 5LHGA 3JB4C 2WQZC 1FJLA 1W5CC 3ILFA 2DOEA 4CUCA 5K5QA 4MIMA 1ITYA 4YFWA 2IXHA 3CMAI 2DYRH 4K9SA 3DL3A 5KBFA 1FOD2 2PELA 4NDLA 1VQOI 3PL8A 3R0RA 1K3IA 3R4UA 4Z6YA 2IGKA 1NCRC 3GGLA 4UFJA 1KA8A 3ZYPA 4XFCA 3NWTA 3K4ZA 5F1JA 3QLQA 4A44A 2GWRA 4XMYA 4QAWA 1F36A 2QQMA 1DDNA 5FYHA 2KRHA 2O8KA 1AYN1 2P3IA 4UW4A 1XJAA 2MEV2 1S7OA 4GYGA 3VKMA 3ZIXA 1MBHA 3ZN0A 2WZEA 3BB6A 3A0BC 2IRFG 3F9KA 4KMQA 1WBLA 1NCQA 2R043 5FYYA 4XKBA 4EYUA 1U8BA 3WDXA 3IAS2 3HVDA 4JHZA 2JRTA 3NO8A 1RUJ2 4X1EA 3BTJA 2QVOA 2Z5WA 1LDJA 4CP0A 1I5ZA 4JGZB 3C7FA 2DFIA 4PDKA 1WGPA 4L18B 1ZZ8A 2GU9A 5ACA2 4A3GJ 1YW7A 2W52A 2K4BA 4IPAA 4RR3B 4XXAA 2PG4A 3RPUD 2Z16A 2YPJA 2VTXJ 4M3BA 1EF4A 1SQ4A 1IKPA