3HIFA

The crystal structure of apo wild type cap at 3.6 a resolution.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
199
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of apo-CAP reveals that large conformational changes are necessary for DNA binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 51
structure length 199
sequence length 201
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hifA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hifA01
4IEZA 1FY7A 2FBKA 5FPZA 1DDNA 2PAMA 3G7DA 1U12A 4BYYA 1GQGA 4GXOA 2CG4A 2XVCA 1IXSB 3KEOA 4LK1F 3MZHA 4HQEA 1O4TA 3F6VA 1WLTA 2DCTA 1ON2A 1SFXA 1XSXA 4EMSA 4P5OA 1WGPA 5AIPA 3ZMSA 1ZZ7A 1SD5A 1XGSA 3WTYC 3RIRA 2V1UA 1E2XA 3EYYA 4R1HA 4IEVA 3PQJA 2JT1A 4RS8A 4HAMA 3GEZA 1ZN2A 1U5TB 2PEXA 2FF4A 2L02A 2EFOA 5L3DA 5K5QA 5KHIA 2EFNA 1YFYA 1EYBA 2RGVA 4FAGA 5AVPA 1SEFA 3QACA 1HBXG 3D82A 4I3PA 2Y0OA 2GAUA 3ZMTA 3H3ZA 3BJOA 1LR5A 5J48A 2D2WA 3DFGA 1YTYA 3KGZA 1LQ1A 4ASNA 3F3XA 4MGKE 3LQQA 3KLNA 3BALA 4B29A 2BGCA 4EJVA 2XRNA 2UWMA 1YWKA 3ECOA 3EDPA 1GVJA 4WVZA 5BV6A 4L2NA 3HSEA 1FP1D 2FA5A 1I27A 2VC1A 5H20A 1KU7A 1B4AA 3HYIA 5FPXA 5L3FA 5LLQA 1BI1A 2JTVA 4KA4A 5DUIA 4P96A 3KP3A 2DTRA 5JSPA 2IA0A 3GFLA 3I7DA 5ICEA 2PI0A 2IXIA 3NL1A 5FLJA 4A12A 3ULQB 1U6GA 4H0EA 2EA4A 3CUQC 2O1QA 3N4MA 1B6AA 3GFMA 3V8JA 1ODDA 4ENKA 5LGTA 1G3YA 3WW2A 3ZPLA 3IHUA 2ISZA 1FI2A 2EA7A 2P5KA 1HSTA 1QBJA 3E5QA 2DPUA 2E9QA 4HVQA 2F5EA 2KIUA 3MPBA 4JVAA 1QY4A 2HTSA 4NB5A 3TO7A 3L2CA 2JRTA 4PDKA 2P5LC 4EM0B 1LVAA 3LOIA 1ZZBA 5FFXA 4MGYE 2A6EF 4AIKA 3FHIB 1JGSA 4M9SA 3K2ZA 3FFQA 4AWXB 1EPZA 4FX0A 1R22A 4LGWA 1LB2A 1L3LA 4UV9A 5HLIA 1NZCA 2G9WA 3JSPA 1HSJA 5T3NA 2O0YA 4E2QA 1XRUA 2Z2SB 1D8KA 1J7KA 2QNKA 3J80Z 1O3RA 4L11A 4R8HA 2QLZA 2FBIA 1ZRDA 3HQXA 1WKMA 2XKPA 4G8XA 2N7GA 3IDCB 1B59A 4F7ZA 2KJCA 2VOOA 4O9EA 3ERED 5CVJA 2E7WA 4KMFA 2MHFA 2O3FA 3GFIA 5HLGA 2EA2A 3RPUA 3HT1A 3CF6E 1XN7A 1U5TC 1DGRA 1P4WA 1L0OC 4UVCA 1HXDA 2K4BA 5LHIA 4MEXF 1YLFA 4KT5C 2BNOA 4IPAA 3I71A 1IN5A 4EWAA 3DXJF 1RUNA 2D5HA 2CWEA 2Y48A 1RNLA 3QAHA 3VOEA 4QGLA 3C18A 5FD5A 5JHUA 4HF2A 3NSTA 4KL1A 4IRHA 2OQGA 3V8LA 2IC1A 4JTOA 4TV7A 4QXKA 2OA4A 1T0FA 2HGCA 5JR3A 3H3UA 4YIIA 4U88A 2GC0A 2HYGD 1YW8A 1J0RA 4CYDA 3TKYA 5E8GA 1CAVB 1REPC 3R61A 4A0YA 3FXRA 4E2GA 1YW7A 4EWEA 2K4JA 1J3PA 1HKTA 1UIJA 4QM8A 5FLIA 1XE7A 4HV5A 4IRGA 2XV4S 2V1DA 4XF3A 4XFCA 4I7HA 1OYIA 1PP8F 1A04A 3FMSA 2H27A 5LRSA 4ON0A 3E6DA 4L9VA 1TNTA 2ZJ2A 2CGPA 2L4MA 4TLFA 4LMYA 1KU9A 3BDDA 2E1NA 4IHTA 1CAXB 1LJ9A 1JE8A 3KLOA 4MHGA 1XGMA 2NNNA 2OD5A 3TO9A 5LRRA 2O61A 2PHDA 2MLKA 5LHHA 5EFUA 3ETQA 3D0JA 4EROA 1YLLA 2MNGA 2PHLA 3P7NA 1S7AA 3TGNA 3FXUA 5F64A 3M8FA 2EV6A 3U0ZA 2DQRA 2HOEA 3CEWA 4EWDA 1YFUA 4KWKA 3VB2A 2MA3A 2IXJA 3C3VA 4R52A 1R7JA 2GA2A 4MQ9F 1K7AA 3DEUA 4IEYA 1KQ8A 2DLLA 5CADA 1H1MA 2X4HA 3V7RA 3F8NA 1XMAA 4EJTA 5C8WA 4ESFA 2FNAA 1Z6RA 3FX3A 1PDNC 2CSOA 2KRFA 2GIVA 1T38A 4KDPA 2GC1A 2ETHA 2IA2A 4EJWA 3TQNA 3QU3A 3C7JA 5DV5A 1IAWA 3ELNA 2A6HF 4OIRF 4NQWA 4PGHA 2AXLA 5JFRA 5I8YA 3R60A 3JW4A 2V79A 1XDSA 3BPZA 3FM3A 3IWFA 1Q43A 3KP4A 2MH9A 1U8RA 3GX4X 1YHFA 2HQNA 2J5OA 2M5WA 4RAYA 3QPHA 2GZWA 2OPKA 2STWA 4XF4A 3OTFA 1ZYRF 3IRRA 5E18F 3T0YA 4LA3A 2ZBKA 2RNJA 3WTXC 4EM1A 1O5UA 4XF9A 2DK8A 4MEYF 2ETEA 2XL9A 1TQ5A 2GC2A 3BJAA 2K86A 4WZCA 3VEPA 3BZ6A 3R6SA 3KMHA 3O6BB 1F4KA 5ICGA 1V3FA 4HVRA 1CF7B 2OU2A 4M6YA 2M45A 2GXGA 2IRFG 1QO0D 1LEAA 1IZ1A 4DQ2A 5ILVA 3HT2A 4HW0A 2VN2A 1BIBA 2Q2EA 5JAXA 3IWZA 1S29A 5D5XB 2DPDA 4K8FA 4B09A 5KHJA 3L9FA 3HTUA 3KP2A 5HS7A 2XKOA 4FT8A 2Z33A 1RGSA 2QVSB 3E3VA 2A61A 1UPIA 3FXQA 1XGOA 3J81Z 4OFGA 4AQ2A 1Z1DA 5LEJA 3DV8A 5BS6A 2FOKA 1H9GA 1ZG3A 3L09A 2RQPA 1OYYA 2CFXA 2GC3A 2R3SA 3IL2A 1WSUA 4RB3C 2MC3A 3SCGA 2QYOA 4A0XA 2DW4A 2IA1A 3WODF 4M73A 2K9ZA 1EY2A 1ZG5A 3OGJA 4Q0UA 3KZZA 4L9NA 2Z69A 5A2QZ 3ZN0A 4O5VA 3GUDA 3BWGA 2VOPA 3ROUA 2YSRA 1GQHA 4ZYEA 3GW2A 4L9TA 3LA2A 4A5MA 4OINF 4RGSA 5DD8A 5H6RA 2ISYA 3FMRA 1Z9CA 2FNPA 2XLFA 4GULA 4J1WA 1NYWA 4WXHA 1YFXA 2O6GE 1ZG1A 1KYZA 4RAZA 4ENJA 2CV6A 3CJXA 3SMHA 2H94A 2V09A 4KN7X 2CO5A 2PJPA 4QLCU 1V70A 2PFWA 1QQIA 3BP8A 3KE2A 1WQ2A 4XFBA 2IPQX 3C3WA 4KIFA 1LDDA 4AD9A 4J1XA 2A5YB 4MNUA 4KNYA 1F1ZA 1XSDA 1IN4A 3KP6A 5I0RA 4OU0A 1I5ZA 2CW0F 1K78B 1J75A 4KWLA 1UCRA 3S0MA 4N0BA 3FF5A 3COAC 4AIHA 3F8MA 1HW1A 3WTVC 4ENNA 5FLHA 1HW5A 1JHHA 3F21A 1TNSA 1B1BA 3T8TA 1MDMB 5D4RA 3V7CA 1R58A 1DPUA 4UXNA 1EV7A 1IN6A 2Z5UA 2UXNA 4P55A 5EEHA 2FQPA 1ON1A 2PN6A 4HLTA 2G7HA 2FQ3A 1D3YA 1H1IA 4MTDA 1FBSA 2FE3A 4LJZF 1XDUA 4HSLA 2XAGA 4KU8A 2BEOA 3DF8A 4XSXF 4ORFA 4WWCA 3F22A 1YS6A 1ZZ6A 1YYVA 5FLXZ 1EH8A 4L5JA 5FQ0A 3WW4A 3SFZA 5LGNA 4KIGA 4META 4AVBA 1D8JA 3DN7A 3HTSB 4HDVA 2ET7A 3ABTA 3GVAA 4IXAA 5E1ZB 4QM9A 3GLXA 5D6EA 4HOBA 1LNWA 3CDHA 3LWFA 4MX3A 3NQOA 1BC7C 2Z99A 2B0LA 2H6CA 4P9UA 5EEGA 3Q5FA 1SAXA 4O3MA 1ZRCA 2OZ6A 4G7HF 4I0BA 2VT3A 2HEOA 2P5VA 3Q9VA 4EJOA 1OR7A 5BOXA 4UVAA 5J6XA 3DQVC 1ZZCA 3D0SA 4HQMA 5HOOA 4R79A 1ZHFA 1IXCA 4A0ZA 5BXXA 1RI7A 5FQ0B 2XHKA 3SHRA 1R00A 1I6XA 1UD1A 3TDZC 1EP0A 5DCMA 1SD6A 4P9GA 5E20A 2FSWA 1CF7A 2LF8A 2COMA 1NXMA 4IEQA 5I91A 1O3TA 1G4DA 4WXCA 3GWZA 1PP7U 4DNCA 1QXJA 1ZZ9A 1OI6A 2A68F 1DUXC 3NW4A 1YIOA 1G3TA 4K2EA 1RTVA 2IXLA 2Q0AA 4G6DA 5D8KB 3I64A 4MGRA 3GZ5A 4IESA 4MUVA 3S2WA 3I0TA 3REOA 5HDKA 3T1BA 2OZUA 3GYHX 5FLXK 3BU7A 2HKOA 2STTA 1BI0A 4I09A 2D45A 4BHCA 3MDPA 2XIGA 4IEUA 1EH6A 4PGGA 2XLAA 1W5TA 4HYEA 1I1SA 2VBXA 5D6FA 1BBYA 1P4AA 5IT9K 2VQAA 3ST7A 3FZ3A 4U0YA 4ZYDA 2QBYA 3M3IA 2VONA 2VXZA 4HLXA 2M30A 2XUBA 5C6CA 1QNTA 1CGPA 1AOYA 5E8IA 1ZVFA 1FBQA 2LSOA 5EZWA 3G73A 4YFNF 3EQEA 1DGWA 2H09A 4OIQF 2RN7A 3DPLC 5BPXA 1J58A 2HZTA 5E16A 4UUVA 4RD7A 4CDGA 2HYFA 5D5UB 4FBFA 2ZNYA 2D40A 4PIYA 1IN7A 1FSEA 3WGGA 4BAYA 3LQRA 4I2OA 3RYRA 1FC3A 3LAGA 1FPQA 2HQRA 1U78A 1YQAA 1ZNPA 3ES1A 1IXRC 3HRSA 2B9UA 3FJSA 3RPQA 1BI3A 4YFXF 3RZZA 4LK0F 1BC8C 2KJBA 4L9JA 1O3SA 3H50A 1Z05A 1Y3TA 4LUKA 3U1DA 1XMKA 3IKVA 5K5OA 3CLOA 4ZH4F 3H1MA 2W84A 4U7DA 5FB2A 5E1WA 1NHAA 3MFKA 2OQRA 5DUKA 1CAUA 3UKNA 3FWEA 1XD7A 3M1EA 2D5FA 2FMLA 2L3DA 3EO6A 3J80K 6PAXA 3KZYA 4LEJA 1ZLKA 3OCPA 2DAOA 1YG2A 3QOPA 3JAMZ 4PIZA 1TQMA 2VODA 5DD4A 4F8AA 3TNPB 2ELHA 1NE6A 1F9NA 3GYDA 1MDMA 1SD7A 5E1XA 1FWZA 4I01A 4OLLA 5CVVA 2IP2A 1FX7A 1T2KA 3O3KA 4KUMA 2QWWA 2PQQA 4A6DA 2O8QA 4KIBA 5FGMA 2EJRA 2MPFA 4PZJA 2QZ8A 4ZYHA 2K27A 4UV8A 1O57A 1ZREA 4H7LA 3ZMDA 3M9AA 4I02A 2PQ8A 2RKHA 2PMHA 1QWRA 5CYVA 5ILUA 5JVTA 2QDRA 2IXKA 2BYVE 3W6JB 2QM3A 1ZZ8A 3RDIA 1DPRA 4OIPF 3WGIA 4OIOF 2L4AA 1QGPA 1S7OA 2WFPA 3IKTA 2VBYA 3NJZA 1B9MA 4BHBA 4MQVA 4G9YA 1VR3A 4X6RB 3HRUA 5HDNA 3CUQA 3USSA 3FMQA 1D5VA 1J3RA 5DDGA 2Q0OA 2ZO4A 1SD4A 4OOIA 2O03A 2ACJA 1WRJA 3OOPA 4IERA 1KGSA 1G3SA 3P9IA 3PLQA 2ZKLA 2QQ9A 3NKTA 2UY9A 3U2RA 2MBFA 3ECHA 5L3GA 5KK1A 2QQAA 4L18B 2XLGA 2YU3A 2L54A 5ERIA 3ABUA 3ZP5A 1J9IA 2WWYA 4QMAA 3EHKA 2QENA 1SMTA 3RKXA 2XROA 4BHPA 1R1VA 2QVOA 2O8XA 1T39A 5ICFA 4LG0B 2G7UA 4Q29A 1SFEA 2ZMEB 2P7CB 4Y15A 1TQPA 1K6OA 1LDKB 4Q48A 3GBFA 4LLNA 3EETA 3HUGA 5KHKA 4I0AA 3SQNA 4ENMA 4M9XA 1VP6A 1USSA 4RGRA 2JPCA 3WE2A 3CUOA 2D93A 4E70A 3MYXA 5HLHA 1SQ4A 5ILSA 4HBNA 1K78A 2ET1A 2FU4A 2D1VA 1O7FA 3H7YA 1V4RA 1WI9A 2R7DA 5FFZA 3WG9A 3EUHA 3PVBB 4G6QA 1CX4A 4LLOA 1RUOA 2P7VB 3LZZA 1UHMA 1QXRA 4QGNA 3QP5A 2XAFA 4Q4ZF 1J2XA 3WTZA 5FD6A 3ACLA 3GF2A 1BJAA 2WV0A 4XLNF 3LA7A 2LNBA 2Z9OA 4WBBA 2PA7A 2I45A 1S3JA 5J3UA 4UXAA 1B9NA 4PJYA 3DKWA 1HKSA 4LUMA 3Q9SA 4JV4A 4GO1A 1FSHA 1CAVA 1XE8A 2IXCA 2DU9A 3HOSA 3KFWX 2AS5F 2PAEA 2W85A 2FRHA 4IJAA 5CVUA 3B73A 3H7JA 2J5PA 4BH9A 2RVCA 1X8MA 2YPRA 4LTAA 5BMZA 1IF1A 4MV2A 5AONA 2NRAC 4KN4X 4HBLA 3K1NA 3M70A 4Z82A 2EK5A 1HW2A 3U10A 3I4PA 2DI3A 2GU9A 4XFAA 2XASA 1MGTA 1UW8A 3H8UA 3HHGA 2ADUA 3WTSC 1KYWA 3QU6A 2H0VA 5JSOA 1OD5A 2GH2A 1KU2A 2JZYA 1W7PD 3QPTA 3SZTA 3PQKA 2PTMA 1BIAA 4A6EA 3WU1B 3MWMA 3GZ6A 3CL1A 5CLSA 2E1CA 5DYMA 2GQQA 5K5RA 3DPTA 3EJKA 4QGMA 2FXAA 5K8SA 2JSCA 1OFNA 4EVIA 1XB4A 1R23A 2H6BA 2A3SA 4L0YB 4IEXA 3TNQA 1MD0A 2X0LA 1H9TA 3F6OA 1CAWB 5KHHA 2V1XA 3F8FA 4GYIA 3IDBB 4Q0PA 4Q0SA 5I8SA 3WW1A 3ZMZA 3T8RA 2IW5A 4CICA 1MJAA 1CAUB 3BJ6A 2EFWA 4LLLA 3JSOA 2OA2A 3KGLA 5IT3A 3CO2A 4ETSA 4CHUA 3O14A 2UYBA 1RL3A 3E6CC 1AWCA 1FYKA 3SHFA 2DK5A 3BROA 3P9KA 1HKQA 4YRDA 3CO6C 4FHTA 5K1YA 1UFMA 2MD5A 4IHSA 5LBQA 1ZX5A 4NHJA 1P92A 3K1MA 5JCTA 2K02A 3V4GA 5FCCA 4WF2A 2Z3YA 4S04A 1R1TA 2YR2A 2Q8KA 2L01A 1ZH5A 4MGIE 2YX4A 1DZRA 4HLYA 1Y0UA 1J1LA 4ZZDA 3HRMA 3RTRA 3NVCA 4DINB 2OAZA 1KA8A 4RGXA 2JPBA 5KVRA 1DP7P 4L0ZB 4AQ6A 5L3CA 1T98A 5I8TA 1G6NA 3CJNA 4YARA 2W25A 4BQAA 4WCGA 2VE9A 1FOKA 4CZZA 4M71A 4N9IA 3TOAA 2P6TA 3KCCA 4U0VA 2XAHA 4M74A 2IT0A 1ZRFA 1L3JA 2DBBA 2CYYA 4M72A 1VJ2A 2M87A 5HS8A 2WC2A 3P9CA 4B8XA 3AAFA 1FLIA 4Z07A 2PG4A 1J59A 1IRFA 1W4MA 1I1GA 5FO5A 2Q1ZB 2KIFA 1Q1HA 3WTUC 3IRQA 5I93A 4Q5SF 3BPXA 3QP6A 1LKNA 3LSTA 1YUDA 2EFQA 4U0WA 4CO8A 2HKXA 4JK1X 3UKVA 1ZGAA 4IF4A 3MAJA 2ESHA 3J81K 2HS5A 1XCBA 4LFUA 3SXWA 2PMUA 2V9VA 5H6QA 5J7MA 1YFHA 2P17A 4ZU5A 4ONUA 2A69F 4Z2YA 4MTEA 4A5NA 2MLGA 4G7ZF 2CAUA 1BN5A 4I98B 1ZLJA 3V8KA 5KHGA 4CXFA 3LA3A 3F8CA 1S8NA 2VT2A 1Z91A 3K9TA 3L7WA 2BNNA 3S7EA 4QWQA 5LGUA 3JAMK 1FBUA 1YW9A 4XFFA 1W5SA 4EQQA 2CQKA 1X7NA 1GXQA 5CU1A 2K0GA 5JI6A 3LAJA 3MQ0A 3N97A 4LB6B 4KWJA 3E6BA 1E17A 1FP2A 2BE5F 1P6RA 1FXZA 2ZCWA 1IPKA 5D4SA 3KP5A 4AVPA 4XBFA 1RC6A 4O9GA 3CO7C 4WXDA 5HDGA 4Y17A 2EVXA 4CGZA 4KICA 1YFWA 1XCVA 2BBYA 2Q30A 2WTEA 3E5UA 2ZNZA 2CAVA 4HN1A 4Q0QA 3G3ZA 2PBIA 1ZARA 2QUFA 5TJJA 5I0UA 1UHWA 3H9AA 3K0LA 3K1PA 4HSJA 4FX4A 3U9GA 1PUEE 4FAHA 4LULA 5D1IA 2KIMA 1FNNA 2UYAA 1UCXA 2VPVA 3E6MA 2HDCA 2BV6A 4ESJA 1C0WA 3U11A 2HWVA 4UNOA 2F2EA 2LKPA 2P4WA 2R7FA 2NS0A 3ZMUA 1QPMA 1R1UA 1ONVA 4D0PA 1TQIA 5BPIA 5L3EA 4RB0A 3HSRA 4KU7A 2EFPA 4ZYGA 3OV8A 1UB9A 5E1RA 3E97A 1WWXA 4S05A 4A2UA 3IIAA 1FT9A 3WGHA 2EWNA 2OBPA 4MH0E 2LDUA 2NAZA 1MJ9A 1OYWA 4AXOA 1Q5OA 1H0MA 3ZN1A 4HVOA 3H1WA 1STZA 2M1BA 4RGUA 3RYKA 4KFCA 1XSVA 2NYXA 5HVQC 3CUQB 2B5HA 1FYLA 1DZTA 2C0ZA 1IW7F 2PFBA 2HR3A 5J8FA 2VECA 1BOAA 1TBXA 1U3EM 1PM7A 1O3QA 2ZKZA 2D1HA 2BNMA 1IRGA 3IBMA 4XETA 2DFIA 3W6KB 3F8BA 4M6XA 1Z7UA 4L5IA 2Q4SA 3VHRA 3I58A 4LG0A 2P6SA 2TDXA 4XFGA 4E2SA 4HZFA 5F1RA 3EYIA 1WA4A 2VBWA 5A2QK 4ESBA 3I54A 2ZXJA 3FHZA 4LA2A 3LFKA 3OF1A 1GHCA 5CVIA 2PLYA 4RB2C 4XLPF 1SFNA 4YG2F 3GFJA 4IEOA 3WTTC 1FYMA 4XSZF 3I59B 3NEUA 4PCQA 2UY8A 2W24A 1OPCA 3R0AA 1XGNA 1J3QA 2V6CA 4XEZA 4LLGF 4BNCA 2ESNA 3D5LA 1Z6TA 1CAXA 3VODA 2PYTA 1BI2A 5LHGA 1VTNC 5FDBA 5CVRA 4YYOA 4XF0A 3ZMVA 2FMYA 2W57A 2HJIA 2DQLA 4GYGA 4ZU7A 3HOTA 1SMYF 4YFKF 1U2WA 3FM5A 1R5HA 2VE8A 4AVAA 2XAQA 4ZU4A 3SCHA 5BPDA 4AIJA 5D5VB 3F23A 3MCZA 3ZQ7A 3LWCA 1MZBA 2GA1A 3V7SA 3S7IA 3HSFA 1FZPB 1KQ0A 3BB6A 2IJLA 2QJVA 1S6LA 4X6QB 3HRTA 3I59A 4WX9A 5BQTA 1TW2A 2GXBA 1J5YA 2F5CA 4HDUA 2GWRA 2M8EA 3EQLF 3C1DA 3KP7A 4GCVA 3WTWC 3JTGA 1JUHA 1Q3EA 3GO5A 4RB1A 1QZZA 4ZZLA 2FEZA 2DT5A 1JHFA 3DP7A 2PAKA 1P4XA 4HN0A 2A07F 2FBHA 3HIFA 5DCFA 4KMUX 1ULYA 3DL3A 4NVPA 5D8LB 5DCMB 2Y75A 3J7AO 4YSFA 2KXLA 4UBGA 3ES4A 3FZVA 1ZGJA 3R4KA 5LEKA 3SXYA 1LDJA 2MH2A 4EGZA 3LAPA 3JZVA 4D7TA 4G7OF 4HMZA 4XFIA 5I0SA 4EGYA 2UZKA 5F6FA 3KEQA 4HX8A 4IETA 5KBFA 1ZRRA 1OKRA 2ATFA 1NE4A 4UVBA 1LRHA 4HX7A 1LEBA 3SCFA 4JQFA 4MGZE 1CAWA 2OYZA 4IVNA 2IVMA 3ELKA 4OMZA 4U7BA 3B02A 4M9ZA 2EAAA 3WU0A 3H92A 1T6SA 1YO5C 1F5TA 3KETA 3ML6A 5L3BA 4GGGA 3VFZA 4UHTA 5DEQA 3QRFF 3CTAA 3MEXA 4UBHA 4XFHA 2QBYB 3BPVA 3KSCA 3WW3A 2VBZA 2QCSB 3PNAA 4O6JA 4Q0VA 3TDUC 3TO6A 2EV5A 3HHHA 1MKMA 1K79A 2XAJA 2LF7A 1U5TA 4Q47A 4LB5A 2RV8A 1KQ9A 4BXUA 4YIFA 2HFHA 2F4PA 2Y0MA 3RYPA 2F5DA 1EH7A 3GXOA 1RIOH 4XF1A 3RKWA 2XL7A 4HF1A 4XRFA 2EB7A 1O5LA 4HV6A 4YNIA 4JTNA 3F72A 1IN8A 2HTJA 2DO7A 3M7GA 1R5GA 1X82A 3K69A 1P2FA 4PIXA 4Y13A 5ICCA 3RNSA 2IXHA 3PFIA 4EV0A 5E17F 1MJBA 5ED4A 5IT9Z 3RKYA 2RC4A 2VC0A 3BOQA 2P8TA 4MZUA 4IRIA 2RDPA 4IEPA 2B8MA 4JBAA 1JXSA 4HF0A 5JSRA 1BM9A 3R0JA 4QX5A 1Y9QA 3I5UA 1O7LA 4HA8A 3T5XA 3EBRA 5D5WB 1YS7A 2ZMEA 2KKOA 2ZFWA 3RJPA 3M8EA 3CLPA 4IEWA 3MZYA 2OZJA 1W7PA 5HI0A 1RZ4A 4KYWA 1QZYA 3TOBA 3JTHA 1OMIA 5HS9A 3FE5A 5BUVA 3L00A 3RI4A 4G94A 1UIKA 3UKTA 4HX4A 5AIQA 3ZDSA 2XGXA 5TRDA 1HQCA 3SZPA 4OMYA 2NNYA 2C6YA 5BY5A 3I53A 3O2PE 1IPJA 1X8EA 2F5FA 2QQBA 1KU3A 1TLHB 4EM2A 4P9FA 3WE3A 5J8CA 1PMIA 3H1YA 3E5XA 1IUYA 1TW3A 1SFUA 4D7SA 4N9HA 1ZAOA 4WK8F 3BY6A 5CJ9A 3BCWA 3L2HA 2E7XA 1X3UA 2EV0A 4AVCA 2K7LA 2UXXA 1USTA 1W7PB 4EJUA 5I0TA 3ISPA 1TTYA 4LD5A 4BIFA 5JR7B 3OD0A 2YX7A 1G3WA 3IC7A 3NRVA 1R36A 1GXPA
chains in the Genus database with same CATH superfamily
2KPMA 2WZ8A 4IEZA 1FY7A 3A7QA 1ULOA 2EXKA 1JGGA 1LHOA 1S2KA 2PAMA 2BZTA 1GQGA 2CG4A 3MFCA 1VBA3 3AG3H 4M4PA 2XVCA 4LK1F 3MZHA 1GNYA 4HQEA 1O4TA 2COBA 4FETA 1ON2A 3KV5A 4E9KA 1XU1A 4NBQA 1FJLA 4NPRA 3U37A 1ZZ7A 2I07B 1C1FA 1PVC1 2P37A 2L0KA 3LPGA 3UK9A 4R1HA 4IEVA 4GXLA 3O12A 5IK4A 1ZN2A 1AF9A 2BV4A 2PEXA 2VJ4A 1QOSA 4BQ4A 3RJ2X 4COYA 4YW3A 3J7ZI 2ZEZA 1DBNA 1YFYA 2CV2A 3DLLF 1JZ4A 2EZHA 3QACA 3D82A 2GAUA 3APBA 5IP9J 3ZMTA 3H3ZA 3BJOA 3TEZA 3EPZA 3PNVA 1LQ1A 5FMCA 1PK6C 3LDKA 2GNBA 1PX3A 4CP1A 3PIPF 3HKZA 5FJ8J 2IEKA 1TME1 1SFYA 5FUNA 1YWKA 3DYMA 4F83A 3EDPA 5FKBA 4L2NA 3CDIA 1FP1D 2FA5A 3OR2C 5A70A 1W8FA 3RS6A 1GWKA 2W0XA 5L3FA 2VNGA 5F3CA 4GA9A 1SVMA 3RMYA 1Y39A 2WBKA 2KR2A 1Q56A 4J19A 4MFDA 4XJZA 2DCYA 4C8DA 2IA0A 4PHZA 2W48A 2VZTA 3I7DA 4EZHA 2PI0A 3GTPJ 2DTZA 5FLJA 4YVWB 1U6GA 2L9SA 2EA4A 3V8JA 1ODDA 1G3YA 4BBSJ 2BVVA 3K10A 2P5KA 1HSTA 2HH9A 2CUZA 1SBEA 4HVQA 1JT6A 3MPBA 3GJBA 4IGQA 3O0VA 1RVF3 1QY4A 2A6YA 3TO7A 1QHHD 3R4DB 4PDKA 4XAEA 1K61A 3A22A 4EM0B 1KRIA 3B9IA 1ZZBA 5FFXA 4AIKA 3CCRI 1JGSA 5T5PA 4AWXB 3ZSEA 3CJIC 1R22A 4LGWA 1L3LA 4UV9A 1MS1A 4CRQA 3FXOA 3RQ0A 2Z2SB 2R16A 2QNKA 3J80Z 4HKLA 1LOFA 4L11A 2QLZA 3OSDA 1ZRDA 5F5AA 3HQXA 1WKMA 4G8XA 1FV3A 1X36A 4ABZA 3WDUA 5T50A 4DYQA 2KJCA 2VOOA 1YRZA 2JUCA 3RI8A 1S0DA 3BPSA 2O3FA 5HLGA 3ZOBA 3M07A 3AMMA 1YQ2A 4BXSV 3DGTA 2HQAA 2ZC2A 1YLFA 5LWBA 4F91B 4XBQA 4NR1A 2HWC1 1OLTA 1XU2A 1RUNA 2D5HA 4D0QA 2Y48A 1U5IA 3VOEA 4ANJA 4QGLA 1YIJI 3C18A 2O8KA 2EZKA 3NSTA 3DEEA 4IRHA 1I9RA 3U78A 3MLLA 2OA4A 4RM2A 4RDUA 4RBOA 2EQRA 2K85A 5JR3A 1UJ8A 3H3UA 4ZONA 3OY8B 3MIDA 4A3IJ 4Q8KA 5EJZB 2L7KA 4QQLA 5EP9A 2GC0A 4B48A 4JGZA 4DQAA 1COV3 1PZ7A 3VYTB 2DMTA 1C8M1 4R9AA 3TKYA 3POFA 2FOWA 1S5LC 1W3VA 5FZKA 3FXRA 4E2GA 4EWEA 1J3PA 1UIJA 2DVDA 2RS32 5JWPA 2GLOA 1FOD3 2XV4S 9ANTA 4XDPA 2VTXJ 4XFCA 3HN3A 4C2UA 3K4LA 2YXSA 1OYIA 1MPXA 4MO3M 2KP6A 1VF9A 4ON0A 2ZJ2A 2L4MA 2BY2A 4TLFA 4LMYA 1O4YA 3BDDA 4LKDA 5FZ4A 3FDYA 3DWLE 4FPEA 4CUBA 5GP9A 3Q8FA 3NV2A 3ZO0B 3TO9A 2XB5A 3ZR5A 2CHHA 1QRYA 1QJY2 5FZEA 1PIV2 1FMVA 1GYKA 1UU5A 1AU7A 5CNAA 2V6EA 3P7NA 5A32A 2YUSA 3M8FA 2XB0X 1T33A 1MNMC 4JP0A 1AR81 1X1DA 3WINE 1DQ1A 4R52A 2MA3A 1AL22 1R7JA 4MQ9F 1SG3A 1IDYA 3DEUA 4IEYA 2X4HA 3V7RA 3F8NA 3C8XA 2DMPA 4OI0A 4FTHA 3N9MA 4ESFA 3VHPA 1R6RA 3FX3A 2AEZA 4N7IA 1PDNC 2RE9A 3B94A 4KDPA 3A01B 2R1DA 2DOFA 2NOJB 3OEAA 1KD7A 4EJWA 3ILFA 4CP2A 4BMBA 4AF9A 3AFKA 5DV5A 1IAWA 2XUMA 2A6HF 1UOBA 4PGHA 5JFRA 2ZEWA 5FZGA 3PUFA 3BPZA 2RREA 2JICA 4XRSA 3BTYA 4LBJA 3GX4X 4BE0A 3BTLA 1YHFA 5FMOL 5FYYA 3T1MA 1V5GA 2X48A 4RAYA 1AYM3 3BOWA 2GZWA 5ABJB 2OPKA 4MGSA 4XF4A 5FY8A 4ARYA 5B1BH 2JJ6A 1AX2A 1V5EA 1IUFA 1NG0A 3T0YA 2IZWA 2W1SA 2CMPA 2RNJA 2YC0A 1AX1A 1VBB2 2DK8A 4XRMA 4BWOA 1HLVA 4FTEA 3K70C 4XW3A 1OA4A 3R6SA 2R073 5LFAA 4B7KA 5ICGA 4FPYA 1LVKA 3LGRA 1V3FA 2CSGA 2JA7J 3A0NA 2IBDA 4KH9A 1CF7B 3ZXAC 2AEYA 3GNEA 2M45A 3C2HA 5EGOA 3NJVA 2NVQJ 4G3YC 4LBQA 1QO0D 1YJLA 4IKFA 1FEXA 3K3NA 5A6QA 2FD8A 2PHRA 1UQXA 5JAXA 2X6YA 3DUIA 1R1A2 5KHJA 2WA0A 3KP2A 4JYKA 3MKZA 2JDKA 3EXUA 2Z33A 1RGSA 1ENHA 2LKXA 1OH4A 1PMHX 2B63J 2LP0A 3KF5A 1TE1B 5LEJA 3P3PA 4BDZA 2FD5A 2WWUA 4OQ9A 2LMDA 3O1SA 3MO4A 2WO3A 5JXIA 3AZVA 4JRAA 5FYBA 4HONA 1PNFA 4OMCA 3JD72 2EBIA 1WSUA 2BBAA 3JUUA 1ACCA 5J3LA 1PO12 2HWE2 4A0XA 4JKLA 3ZX7A 1I3AA 5FYHA 2IA1A 3WODF 3VD3A 2VZUA 3KEYA 4Q0UA 3KZZA 4L9NA 2RMU1 2LRDA 1W8WA 4PDWB 4ZZ8A 3ROUA 3WT3A 4L9TA 4PUSA 1AXZA 3LA2A 4A5MA 2VXRA 5H6RA 1W8OA 1COV2 3RZKA 2FNPA 2WA4A 1UAIA 4OUMA 5FY0A 1NYWA 1N47A 3AP4A 3CJXA 2H94A 2WFF1 2J1SA 4QLCU 1V70A 2IFWA 2QQKA 1WQ2A 2TNFA 1LDDA 4AD9A 1GVDA 4QHZA 5FXXA 5DUXA 1F1ZA 3M7AA 2JJ7A 3FBYA 1B09A 2Y38A 2WIIB 3KP6A 3W2AA 5I0RA 2CW0F 3AX4A 4KWLA 1UCRA 2CY6A 1HRI3 2QA4I 3F8MA 3BTZA 4ENNA 1YX5A 1JHHA 1B1BA 3BG6A 3DBHB 2EINH 4XMIA 1DPUA 3H5RA 1EV7A 4XKVA 3NAPA 4DEQA 1MNDA 3BG5A 3O1MA 1IN6A 4D8MA 3VKMA 1DF0A 2NS8A 2W08A 3J8F3 4YGBA 4A3ZA 2VL4A 4HLTA 2BTVC 4JDOA 1FBSA 4NWVA 1SPPA 3VBFC 4HSLA 3JBG3 1N1SA 4DBRA 2VNVA 4WWCA 1GLHA 3F22A 2VR4A 1YYVA 3AVSA 4DS0A 4DPNA 4L5JA 1A6IA 5FKNA 1S72I 1RUE1 4CXXA 3DN7A 2DVBA 3DYOA 3ABTA 1UO9A 3GLXA 4BQXA 2X5IC 5DXDA 4HOBA 1R1A1 3PMEA 3NQOA 1BC7C 3HPNA 2Z99A 2H6CA 3PNTA 3I3EA 2Y0IA 5EEGA 4C3HJ 5LZ6A 3RCOA 1SHWB 4YEJA 1OHFA 3O7OA 1CR7A 3NWTA 3S1RJ 3WP6A 1AXYA 2M9HA 1QJX2 4J00A 3OOXA 4HQMA 3I49A 4R79A 2E35A 1IXCA 1KITA 4A0ZA 1Y56A 2OS2A 1RI7A 3TP3A 2WS92 2GALA 5FQ0B 1TWAJ 5JOYA 3ZCOA 1PHMA 2ZMLA 4OHWA 2L9NA 2ZACA 2VOVA 5DCMA 3LEIA 2IGMA 4XLEA 2EIDA 5BNOA 3VV1A 2RVAA 4DNCA 3NW4A 3USUA 3VBFB 5DG1A 4K2EA 2IXLA 2GP3A 3ACGA 4AI9A 2Q0AA 4GMP0 5D8KB 4MGRA 4JRLA 3AYCA 4CCKA 2DT7B 1R1A3 4JX6A 2KRCA 3S2WA 1WGXA 2OZUA 1V9U2 5FLXK 1BEV2 4BKXA 2STTA 3ACIA 4RAFA 4BE1A 3OYJA 3S5AA 1AVBA 4BIOA 3D5OA 4DXZA 1ND2A 2BBVA 4HYEA 1G9BA 4P08A 4B43A 3B6AA 4N8MA 1SFOJ 1UOFA 4CSWA 2JN6A 3FZ3A 1FNZA 4ZYDA 4ZKTB 4BS9A 4LE3A 2Z79A 4XN0A 4ZXEA 2VONA 1AL0G 4OI4A 2H8WA 1QNTA 3TWIA 1FBQA 1SMVA 2LSOA 3CCLI 2AACA 2H09A 2PLV3 1S4CA 3RZMA 1JS9A 4IO9F 4UUVA 1VQMI 5EXOA 4QB1A 4TWTA 4PIYA 1IN7A 2VTXA 3WGGA 2VM9A 3LQRA 1VQLI 1H2KA 1JH5A 1I5PA 1PVC3 2TEPA 1ENXA 3LAGA 3AMQA 1U78A 1XC6A 1QNYA 3HRSA 2B9UA 3SKJE 5AFBA 5CKMA 4CDXC 2ZX3A 1AR63 1JW6A 1US2A 5AC92 1WMDA 2XF5A 4D7MA 3JRDA 1XMKA 3OPTA 3CLOA 1GOGA 4Q4X1 1IG3A 1H1AA 3FWEA 2D5FA 4X0GA 3LFMA 4UW6A 4XUQA 3J80K 2J7MA 1WJEA 2VOXA 3KZYA 4XKBA 1W6PA 3ILNA 5BNNB 2DAOA 1AL23 1OCRH 3HOZJ 1BEV3 2WN2A 4KISA 2BVLA 4Y24A 2HWB2 3M1HA 4HPKB 2J22A 1MDMA 2YU9J 2L9LA 4CCNA 4I01A 3Q0VA 2IP2A 2H8RA 5A7PA 2AO9A 3JRHA 1T2KA 3O3KA 4KUMA 3OIOA 2VJ5A 4Y22B 5E89A 1WI3A 1GDTA 3GHNA 5F2WA 3OGRA 3WG1A 4IHWA 4CUAA 4PZJA 2QZ8A 2JMWA 4ZYHA 2HDDA 2VBDA 1X1AA 5LA0A 2K27A 4AAPA 1QJU1 3WF4A 4Y1UA 4COWA 3ZMDA 3LSRA 3M9AA 2RS52 2CRGA 2VNRA 3M3CA 1RKTA 1LE8B 2QDRA 2JVGA 3CCUI 1HV1A 2X09A 1UY0A 1MS5A 2BW3B 3H0DA 4NC8A 1QGPA 3K6GA 1F15A 5FYSA 1W6QA 4BHBA 4AHXA 1D5VA 3KVBA 4GMP1 4XZUG 2R7TA 2KZVA 3FXMA 4HL0A 5DDGA 2ZO4A 4ZDPA 2A6VA 3RGBA 2O03A 2XQXA 4XTPA 1E0EA 3WY6A 4B1RA 1KGSA 5FPUA 3NNJA 4LBQB 1G3SA 1XNTA 3PLQA 2AXTC 3WDXA 2P81A 3ECHA 1Z7S2 4QPQA 2R043 3FFZA 5FPVA 1S2BA 4L18B 5LBBA 3MKWB 2G9FA 2Y6GA 3Q8EA 2WNEA 4QMAA 1DG6A 3VZOA 2DCJA 1SMTA 2XROA 2WYSA 3CP2A 1R1VA 2WQ8A 2O8XA 4YWAA 2LG4A 3TP0A 2QSHX 4RS5C 3GBFA 1TWGJ 1HJGA 2NXNB 4ENMA 3OB8A 2A3XA 4MHUA 4FCYA 4H14A 2P6CA 2VOWA 4E7HA 3MYXA 2XOMA 5HLHA 4QB6A 1SQ4A 5ILSA 1K78A 2ET1A 1YXWA 2FU4A 1LOGA 1UXZA 3S6PA 1WBLA 3BG9A 1C5HA 1QF3A 2ELKA 4HXCA 4G6QA 4B3NA 1RUOA 1AA7A 4QPOA 1LOCA 2PHUA 1UHMA 2WQ4A 3GTMJ 1ZR4A 5T55A 4EJRA 1TWHJ 1NCRC 3TEXA 5FR3A 3KM5A 1TC3C 2WLPA 5FROA 1BJAA 4XLNF 3ZQHA 2RV9A 2QUOA 2BFUL 4QPYA 1JJ8C 3LEGA 4YG3A 4PJYA 4BLIA 1HKSA 1CAVA 1XE8A 5DDJ2 3HOSA 1GP4A 1RINA 2AS5F 2M0CA 5CVUA 4LG3A 4G9SB 5FWEA 5FP9A 4JHTA 3BODA 1D1AA 3OS0A 4UF0B 1ZK8A 4A3GJ 1QDOA 4XIKA 2WWSA 1F5JA 2GNMA 4TTGA 1QZEA 4Z82A 3M4OJ 3OUJA 2QSGX 3A21A 1H30A 2GU9A 4RS5B 1QPIA 2HYXA 4XICA 3NAPB 2ADUA 3WTSC 5CFCC 5IT6A 1V6JA 5JSOA 2IGKA 1YJNI 1HN1A 1V9U1 4QDRA 3SZTA 5FZ8A 3U1KA 2WKKA 4XJUA 4WM7C 4ZXKA 1EKEA 2GNDA 4H2AA 3MWMA 1H8AC 5CLSA 2E1CA 1KS4A 2R7XA 4QGMA 3W2WA 5FP4A 1MMGA 2V1NA 1RXGA 2JSCA 1OFNA 4XQ4A 1BVP1 2XJSA 4IEXA 3OD4A 5J09A 2CQQA 2JDZA 5KHHA 4M3FA 3PU8A 3GMEA 5GAHJ 3TEDA 4A7KA 2V1XA 3F8FA 3AG4H 4Q0SA 5EWSA 3WW1A 1T6GC 4AC0A 1XSQA 2IW5A 3AL0C 2ZMEC 2B39A 3BJ6A 3CO2A 4ETSA 3PUBA 3W2VA 3ZPYA 2DK5A 4XAAA 4FHTA 3OBTA 1UFMA 4RYDA 2BY0A 3WZ1A 1P92A 3K1MA 2WDBA 5IWFA 5FZFA 1VBA2 1C1LA 3NNMA 2LOOA 3UETA 1V5FA 4GD4A 2JD4A 4XJ9A 4ZZDA 3HXLA 3NJXA 4XZPA 3CBNA 5EZGA 3C2BA 3ZXSA 1MNEA 1H2LA 3N3HA 5I8TA 5FRNA 3BCAA 4CP9A 3CJNA 5C4JJ 1Z77A 1FOKA 2P6TA 3KCCA 4U0VA 4AU7A 3WNNA 1BR4A 4XILA 3OS1A 2CYYA 1VJ2A 1X4OA 5HS8A 4Y1XA 4XIDA 3HOWJ 1D4VB 2VMFA 1OA3A 2HWB1 2TUNA 3NQHA 2LK2A 1UZVA 5C3EJ 4QHBA 5HCAA 2DJNA 2BW8A 4Q5SF 3AL0B 3DU6A 5D8AB 4DY3A 2GNTA 1JXNA 3RSJA 3LSTA 4YM3A 1FOWA 2JEMA 3DPUA 4U0WA 4XLAA 5LY1A 3MAJA 3HR9A 3I3DA 3SEQA 2UV1A 4Q4Y2 3VYRB 3AC0A 3J81K 2A73B 4LFUA 2JG8B 3E1F1 3ZQQA 5J7MA 2IVJA 2OUJA 3K75B 4Z2YA 1OLME 4BL0B 1BN5A 3FK6A 4CXFA 3LA3A 1VBD2 2WO2A 1UMQA 1S8NA 1MS0A 5EPAA 4FASD 4DZGA 3K9TA 1FAYA 1Q8VA 2HOSA 4XFFA 4CA9A 2CQKA 1SANA 4CH7A 1GXQA 3AFHA 3MZ8A 3LAJA 1W0TA 3N97A 4LB6B 4KWJA 1AKHB 3BTXA 1NCQC 3LE0A 4BXFA 5JVGF 3J7MA 3UESA 1IV6A 2PXJA 3KP5A 4AVPA 2GSYA 3CO7C 2EIGA 4WXDA 1X9PA 4Z2AA 2CQNA 1OFCX 2VCCA 2VVFA 1YFWA 1UMZA 3GTQJ 1S2EA 5FV3A 2PHXA 2Q30A 3MHZA 5BNPB 1DU0A 2PBIA 3VL8A 4UB6C 4ATFA 4FPHA 2JE7A 5JOWA 3K0LA 2HXOA 1W6MA 3U9GA 2JDAA 4LULA 5KHDA 1D4M2 3NNLA 2KIMA 4CA0A 5FRMA 1PGL2 3I2JA 3U11A 2VPLA 2HWVA 2NVUB 4GB31 1MS4A 3UKGA 1UYZA 5BNPA 2DODA 1EJ9A 2R7WA 1QJU2 5CQEA 2EFPA 3HAGA 3UR3C 4ZYGA 3OV8A 1UB9A 1AHSA 4N53A 1M06G 1PO21 5C70A 4UT5A 3A4CA 5IUQA 3IIAA 4AIDA 5F08A 3CMEI 2EWNA 5CKQA 4Q4Y1 1QA6A 1ND2C 2VZ3A 3INAA 3Q9OA 4P9YA 1XNDA 4RGUA 2W39A 4JGYB 3VDAA 1W8HA 5HVQC 1HV0A 1FYLA 4IX7A 2PFBA 2Y9ZA 4URTA 3THDA 4CUCA 3WEZA 4BM8A 1TBXA 1PM7A 3AVRA 5F1JA 2D1HA 1GNZA 3IBMA 5F04A 2DFIA 1XQNA 1RMU3 4PJJA 2LKSA 1KFUL 3JR9A 2ID3A 1VE0A 3ABLH 3C7GA 1G9DA 5AC91 4W50A 5IOZA 4L8QA 3I54A 3WLUA 2B7EA 3OF1A 1GHCA 5CVIA 4AI3A 4Z2WA 1WH5A 4IEOA 1F31A 5D8AC 1C8M2 4MO7A 3OR1C 2WABA 1JU3A 4M0HA 4OMDA 3I59B 3NEUA 4COUA 1J3QA 2V6CA 2EICA 4LLGF 2OTJI 3VL9A 5LHGA 5FDBA 3GBWA 3VLBB 4YM2A 1IS5A 2X6WA 2ZMNA 2SBAA 5CIRA 2HU9A 1N25A 4AVAA 1UPSA 5C3QA 1W06A 5D5VB 4PI0A 4OAYA 5GLTA 4LOSA 2L5QA 2QQNA 5F0HA 1XB9A 4Q8LA 3K4ZA 2F17A 3VDDB 3ZYHA 4CEYA 1TW2A 1MZEA 1UKRA 5DN2A 4GIQA 2VBPA 5J1RA 2JG8A 2JECA 2FEZA 2DT5A 1V6KA 3HIFA 5JXHA 5DCFA 4NVPA 4Q4W3 1A35A 5L7OB 2VJXA 3OBAA 2P1BA 1F2NA 4C1XA 2QQUA 4BE3A 5KAIC 4UBGA 4YPJA 4GALA 5C8CC 1ZGJA 1WZXA 4ZC3A 4Q4X3 2OPTA 3EMRA 2L2OA 1ULGA 1BBT1 3L9JT 5I0SA 2UZKA 2H1LA 4HX8A 3DPRC 4N43B 1ZBE3 3GGLA 3OGSA 4W6WA 3LPFA 1W6OA 3BU0A 1NA1B 2BPA2 1Z0HA 3GALA 1BXHA 3B02A 3HM5A 2EAAA 3WU0A 3GTOJ 5EYXA 3DKXA 1OCZH 3KETA 3ZYFA 3MBWA 3NNGA 3AKPA 4GH4C 4GGGA 4PCRA 1U5YA 2GH8A 4OWRB 3IB3A 4UBHA 4UUSA 4PF5A 2OQ7A 3KSCA 2DBIA 3MIBA 3TW6A 5FZ6A 5JHFA 4O6JA 1OJLA 2XVGA 3B7MA 4Q47A 1NA1A 3ZSLA 1KQ9A 4BXUA 2I8DA 2XB6C 3IH2A 4M3GA 3RYPA 4Q2FA 2VAUA 2E63A 3RKWA 1NK2P 4XRFA 2EB7A 2DA1A 1PGSA 4RGAA 2HTJA 2DO7A 2TBVA 1XC5A 4QD2A 3TEWA 5M5XJ 1H6XA 2GOXB 2VCAA 3V64A 3PFIA 4P9XA 4EV0A 1ZBA2 5E3NA 1MJBA 5ED4A 4IHXA 3RKYA 4FPJA 3BOQA 2XXZA 5E6HA 1JUSA 3B01A 5M5YJ 5LB6A 1SACA 1H8TA 2NVXJ 4HF0A 3JU9A 4PJMA 5JSRA 3T5XA 2MEV2 3VDXA 5JLVA 1TVGA 2HWF2 1WKYA 3H3VK 1ASJ3 1YS7A 1W0NA 2VMHA 3M8EA 3PIOF 4E8DA 2XVKA 3F9KA 3JTHA 1OMIA 3FE5A 1OPMA 5BUVA 4G94A 4BE2A 1UIKA 4GH4B 1BBT2 2J1TA 3OYIA 2JD9A 1VQ5I 5CZKA 3RWKX 3HOVJ 2M4KA 2P5BA 2WZR1 2B45X 3M1CA 4HRIA 2C6YA 1WW6A 3I53A 1YQ8A 1YQCA 4NRQA 3ZN5A 4JAAA 2PHWA 4F55A 5H9PA 2A3WA 4P9LA 2ZTNA 3WE3A 1RUG3 5B1AH 2J1EA 3AP9A 3BR3A 2PJRA 4R4ZA 4OCTA 4FXGB 4FCAA 3BY6A 1D0YA 2XG3A 3BCWA 3L2HA 1X3UA 3TN93 2JE9A 4TZDA 2XPJA 4AUXA 3HOUJ 2K7LA 2UXXA 3E1SA 4EJUA 5I0TA 3H35A 2PHTA 4NDLA 4YZ5A 3V0AB 1UX7A 1REEA 4LD5A 5FYVA 4BIFA 5IK8A 4BLJA 2QZ2A 2JG9B 3OD0A 4AVVA 3ZXLA 2ZSIB 2QQOA 2YX7A 1G3WA 1TT0A 3B00A 1ULEA 4XLHA 2V72A 1TME2 5FPZA 5DMYA 1ETXA 2BOLA 1JZ5A 4PBOA 1U12A 4E7ZA 3ZYRA 4BYYA 4NIIA 2ZMKA 5IHRA 2K5CA 4GXOA 3PVEA 1DQUA 5C8CB 2RDQA 4F3JA 4QPIC 2RAEA 1IXSB 1UG2A 3CCEI 1CN1A 1WLTA 1XSXA 4P9IA 3E0JB 4P5OA 3T2PA 4LKSA 3FKIJ 5SV8A 1SD5A 3WDVA 3WTYC 1VQNI 4A3KJ 4W6YA 1W6MB 4RS8A 2V7FA 4JX5A 2HDWA 1W2NA 2L02A 1I39A 1MQTC 4QX0A 1X1CA 4L5EA 2HWC2 2VL8A 2XC7A 4BGDA 4A42A 1EYBA 2Y0SA 4Q4X2 4E4DX 3I2IA 5AVPA 1IQDC 2F48A 2VU9A 3FN9A 3VKNA 1DU3D 4I3PA 5F5QA 4QAWA 2Y0OA 3PUIA 5J48A 1WCKA 3W20A 2ZA9A 3KGZA 1DIWA 3VSKA 3H8XA 5GZCA 3HQRA 2BGCA 3G1OA 3T4VA 4EJVA 3ZN4A 4XXPA 4K6BA 4M3BA 2QKDA 1VQ6I 2OJED 3ECOA 1Y8RB 4LE4A 5BV6A 1GZWA 5E3OA 1I27A 5H20A 3T09A 1CWPA 1FNYA 4A3CJ 3IM0A 3L2QA 5FPXA 3ZKUA 5FXWA 5IVCA 3LKJA 2VJIA 5DUIA 3RRDA 2OIIA 3WX5A 2DTRA 1UU6A 4W4ZA 5KNLA 4A3BJ 1KZHA 2IXIA 3BQYA 2DA4A 4WM8B 4IV1A 1SPPB 3CUQC 2NMOA 1B6AA 3GFMA 2BXYA 4FVVA 1OBNA 1GOFA 2VI6A 2ISZA 2EA7A 5B66C 1TWFJ 2OW4A 1QBJA 2E9QA 3VBOC 2F5EA 4C1WA 2KRHA 4ZS2A 1W2OA 2HTSA 2MABA 3ASIA 3WQ7A 1S9HA 2ID4A 4LORA 3L2UA 1UZWA 2BW3A 3LOIA 3P1IA 3ZLIA 4MG2A 3LOCA 4CVUA 3K2ZA 3FFQA 5KXDA 1UMHA 2VQTA 2VD7A 1MEC1 5HLIA 5IFTA 1AYM1 2G9WA 3POGA 4DNYA 2VZVA 2D6PA 3JSPA 5T3NA 1PMJX 4E2QA 1QKQA 1XRUA 3AJZA 3QH6A 2VPRA 3WU2C 5FO8B 1APLC 4BU2A 2R0FA 2VZ1A 2XKPA 1VRH1 1MBKA 3GZTB 1A5JA 3IDCB 1BMV2 3AL6A 4F7ZA 4GDFA 4YW4A 5LA2A 4EATA 3VZLA 4LIUA 3ERED 2E7WA 3C7OA 4UB8C 1ZA7A 2DUPA 2MHFA 2EA2A 3RPUA 5M3MJ 3HT1A 4M3CE 1U5TC 1L0OC 1HXDA 4LBNA 5F9TA 1T56A 3I71A 3FL7A 3IAM2 2M4GA 1OXCA 4L9BA 4NPMA 4BK5A 1FX5A 2RR11 5G05L 5JHUA 2E32A 4KL1A 4P9JA 4TV7A 4Q4W2 2K3FA 4IQJA 2HGCA 2ZJCA 3CJQB 2X9DA 4MADA 1C3HA 4BQQA 5J47A 4CYDA 4NRPA 4BQWA 5E8GA 3AL5A 1REPC 1WJAA 2CYFA 2VCBA 3JRIA 4A3MJ 4BISA 5FLIA 4QM8A 1JKRC 1MQTB 2LUWA 4EN6B 4A3JJ 3N9PA 3EB7A 4XF3A 2PN5A 4CEYB 3IV5A 1JT0A 5FUPA 3EUKL 4YVWC 5LRSA 4G12A 5I0DA 1TNTA 2CGPA 1LHUA 1JKPC 4IHTA 4WV8A 1AR62 4YIRX 4SLIA 4C9YA 5LRRA 2O61A 2IAIA 1RUG2 1RETA 2BWCA 3OG2A 2HQ5A 3LFUA 2ECBA 1YLLA 2VBBA 3H8RA 1H8TC 1S7AA 2FHRA 3TGNA 2C4XA 5IVFA 5F64A 3NO8A 1EAH1 5J1YA 4YELA 2JA2A 2QQMA 4YGEA 2HOEA 3CEWA 4EWDA 2OQ6A 3A02A 3C3VA 1BA5A 2XWJB 3OIPA 1H1MA 5DZEA 1A8MA 4LK6A 3VBSB 2Y60A 2AYHA 4WM8C 2HWD1 3VN4A 4AEDA 1VBB1 2RJLA 3AMNA 3TBIA 1DU6A 1W0PA 5FBZA 4AFMA 2VKDA 1TZLA 3ZQLA 2W1UA 1CONA 1T38A 4OZXA 4IGOA 1LUJB 2ETHA 4AHYA 1JI8A 3TQNA 3TN92 4LO8A 4FPOB 3ELNA 3ALQA 4AEKA 4OIRF 3I4NJ 2WS93 1V6OA 4FQZA 3R60A 1RESA 2V79A 1XDSA 4A4AA 2V4VA 3FM3A 2PELA 1X58A 3R4UA 4Z92B 3SQOA 2J5OA 2M5WA 3QPHA 1NLSA 1J09A 2ECCA 4GH4A 4XQDA 4M3CA 1WZ2A 3K4MA 1IG0A 3IRRA 2LC2A 1MBFA 3OY9A 4NOTA 4Q4V3 3MF9A 1OF3A 1IRXA 2OPWA 3ZXDA 4RHV1 1U9OA 4XF9A 2ETEA 1TQ5A 4EN9B 4DEVA 3HJRA 3KMHA 3O6BB 3K7AJ 4DYRA 1F4KA 2F6CA 1UX6A 3FBMA 2YYOA 4CPBA 3ITQA 3OWTA 1LEAA 1CZSA 4DGWB 4DQ2A 4FOWA 2E7TA 2QSFX 1BIBA 1QVTA 5D5XB 5C5TA 5L19A 5L7OA 3L9FA 4JDNA 2YBPA 4ZY9A 2XKOA 3AKSA 1KGYA 4AYBN 3FXQA 1XNBA 4AQ2A 1Z1DA 2ME6A 1WD3A 3VYSB 4FFFA 5C44J 4DRRA 1H9GA 1JZ3A 1WCUA 2AENA 3D6EA 4ASLA 3OYFA 1ZG3A 4FPLA 2J1AA 2RQPA 4AEDB 5EF6A 2R3SA 2JKXA 4J01A 5J1UA 2IFRA 1UXXX 3WG7H 1J1TA 2FDHA 2X53S 2K9ZA 1B35B 1ZG5A 3BOPA 4D7YA 3OGJA 5FZAA 5JI7A 1HN0A 2WAQN 2JENA 3AP5A 2AR6A 5L9RA 3ZN0A 3LSIA 4O5VA 4HNVA 1HQNA 2VOPA 2O0OA 1UN1A 4PF1A 1GQHA 1EUUA 2BGPA 1OOPB 3LSDA 4QSHA 2FDKA 4XHBA 2IS4A 4RGSA 5A33A 5DD8A 1O8PA 2ISYA 2W5FA 3FMRA 5FKCA 1HRI1 3P6BA 3DCQA 1VB4A 1ODMA 4OULA 3WV6A 1KFXL 1YFXA 4D94A 2O6GE 2E31A 1O4XA 3A23A 3SMHA 3NARA 2V09A 1JZ8A 4KN7X 3IAS2 4AGRA 3BP8A 2R6QA 5CEHA 3MKLA 3O1VA 5F37A 3A0HC 4YW6A 3P5BA 3CCVI 3FBNB 2EIEA 4F92B 1LGBA 1OOPA 1NUKA 4OU0A 1I5ZA 1SLIA 4CZCA 1CQTA 4N0BA 3COAC 4AIHA 1U5XA 1TEIA 1TNSA 4Y1VA 3MIGA 5D4RA 1AHDP 5CKNA 3V7CA 3CMGA 1GT0C 4UXNA 3VBHC 5CISA 1ETOA 2P34A 2HYJA 1EV12 2Z5UA 4IXLA 2ZGLA 2HVRA 2FQPA 2PN6A 2FQ3A 2JWTA 3FBIB 4XLCA 4MTDA 4LMFA 1VQ4I 4KJZA 2E19A 4KU8A 3ZKYA 1CPNA 2BEOA 5FZOB 5HV0A 2OF7A 1ZZ6A 1UY3A 5FLXZ 4E4ZA 1RUF3 5FQ0A 1I3QJ 4N53C 2A5ZA 4AVBA 4UAPA 2LFBA 1HDDC 1MIJA 2ET7A 3GVAA 4XCAA 2WAEA 1RIRA 3SDGA 2MGQA 2B0LA 5FK7A 2RJKA 4PI2A 5F27A 4MGTA 2BP6A 1SAXA 4BQ1A 2OZ6A 5J98B 2NP0A 4F52A 4E8CA 4I0BA 2VKEA 4M00A 1O8SA 2L7MP 3NV3A 5FYIA 1OR7A 5BOXA 4UVAA 5J6XA 2HEYF 3DQVC 2L9RA 4Q26A 3D0SA 3QODA 3OYMA 2LS6A 5BXXA 1I6XA 5IYYA 1EP0A 3WHCA 1AXKA 2F5VA 1G8XA 1SD6A 2G1MA 5E20A 1IV8A 2RS51 1GZTA 4A3DJ 1O3TA 1G4DA 1ZZ9A 1DUXC 4QTRA 1YIOA 1G3TA 1RTVA 2R0QC 3J9SA 4AYBA 2I5UA 5F0CA 4W1UA 1QJX1 2YU2A 4AQTA 4G6DA 5IP7J 4IESA 2A3YA 4MUVA 1TG7A 2ZPXA 5FYUA 1V6MA 2JUGA 1OA2A 4I09A 4HT1T 4BHCA 1GZCA 2XIGA 2PX9A 2LALA 1B35C 2KIQA 3RKQA 3MIFA 2QKMB 1ZELA 1BBYA 1ERDA 2DXIA 1IS4A 4LO5B 2QBYA 2BDRA 2GMPA 5K0UB 1T2XA 4CCCA 4CCLA 4HLXA 1OOPC 1DQ2A 1KS5A 1SAUA 1YRNB 2XUBA 2M30A 4GKXA 4B8EA 1AOYA 2DA7A 2MG4A 1ZVFA 4WZFA 4YFNF 4MXWA 1DGWA 5C9AC 3KT7A 5F39A 1E3PA 1R093 3S17J 3HUGB 3S14J 1E5IA 4FBFA 3AG1H 4E7IA 4NC6A 4BAYA 4Y4RA 1FC3A 1FPQA 1QJY3 2WO1A 3P3NA 4JCKA 3ES1A 1ZBA3 2Y0SN 3RZZA 3QH7A 4LK0F 2PMWB 2E2HJ 5GZDA 4L9JA 1VRH2 2WZR2 4LUKA 2KFDA 3POJA 3IKVA 3RZLA 3CDZB 5LW9A 2A1XA 3H1MA 2W84A 2KMUA 5E1WA 4NWWA 3MFKA 2OQRA 5DUKA 3THTA 3PL0A 2JG9A 4LO6B 3S8PA 4HEA2 4PJ0C 4KI5M 5IY5H 2F4LA 4QXHA 1LULA 3F95A 1YG2A 3WQ0A 4U36A 5JI9A 4KMQA 4PIZA 1TQMA 1AJKA 4XUOA 3TNPB 1F9NA 1BK1A 1COV1 4MLOA 1SD7A 3LDBA 2LM3A 3EUAA 1HB1A 2PLV2 2RDSA 4KIBA 2VQLA 4WVMB 3V42A 2VE1A 4H7LA 4Y3OA 2B42B 5FZDA 5FWJA 3OJBA 1PO11 5ILUA 2IXKA 2QM3A 2Z4FA 3DEWA 1ZZ8A 1DPRA 4OIPF 4NHKA 2QQPA 5DM6F 1VRH3 3WGIA 4UFMA 4A93J 3HL2A 4OIOF 5LA1A 2E1MB 3HNYM 1DP0A 1S7OA 2VBYA 4AZZA 3K51A 3PDQA 4MQVA 1VR3A 4Z6YA 4X6RB 5HDNA 1SLAA 3J7LA 4I0WB 3FMQA 1MMNA 5ABJC 3N9QA 5IYDJ 1SD4A 4OOIA 3OOPA 2WNOA 3HEFA 1G86A 3GTKJ 4XNFA 1IPSA 2QQ9A 2K46A 2ZBJA 2MBFA 3D1NI 5L3GA 1ZYBA 3IT8A 4HPKA 2LYCA 2R7SA 3ZP5A 3H8OA 2XGCA 4Y20B 4HNTA 2P3KA 3EHKA 3Q0UA 2ES3A 1AR72 4CU7A 3RQ4A 3OY8A 2QVOA 1T39A 3JD73 1F8VA 1QU3A 3SEZA 3S1NJ 2ZMEB 4Y15A 4WM8A 1TQPA 1YJKA 2HWD2 2R32A 3HN1A 3EETA 3HUGA 4I0AA 4M9XA 1ND3A 1TL8A 1Q8PA 1VP6A 1USSA 4KBBA 2JPCA 4Y26A 3CUOA 2D93A 1WBFA 2WL1A 3ZXFA 4E27A 4NIAA 5KXBA 2V5YA 3ETPA 1OCOH 1C8M3 4HBNA 2KLOA 3H7YA 1WI9A 4M3DA 1NLQA 4NN0A 4DW6A 3O8HA 2CJJA 1ULPA 2E53A 5CFDA 1UY2A 3AP6A 3GTGJ 4LLOA 1WFXA 1W2TA 3B93A 2XAFA 4Q4ZF 3W59A 4FTBA 1J2XA 1PVC2 3WTZA 3AG2H 5FD6A 5EV7A 3GF2A 5CQGA 2WLQA 3ZIWA 5DPNA 2P3JA 4WBBA 1MMSA 2I45A 4XIOA 3SLIA 1S3JA 1ETKA 2IWGB 1B9NA 3DKWA 4PFOA 3U14A 2PQSA 5A1LA 2ZX0A 2PAEA 2W85A 2B7YA 1D7PM 1HRV3 2VQUA 3B73A 2DMUA 1F36A 1K5JA 5FYZA 1YITI 2Y34A 2CW7A 4MV2A 1H8VA 3BQZA 5FZIA 2WRAA 1C5IA 1JYWA 2M3AA 2W7NA 1HW2A 3U10A 5FK8A 4B7EA 5SV5A 2GMMA 1FTTA 1MGTA 1RUD1 3H8UA 2IXSA 3HHGA 3PNYA 1HC8A 2ZZJA 3ZRGA 3LQCA 1OD5A 2GH2A 1BKZA 2JZYA 1X3WB 1F4AA 1DLCA 1W7PD 2DCEA 3HBLA 1RUJ2 1NKGA 1K5MB 2QKLB 3SDBA 3B69A 1Y9GA 4A6EA 3GZ6A 3VZNA 3AK0A 5K5RA 1ZA4A 4D5CA 4HPQA 1SFPA 4CEWB 4IV3A 1R23A 2H6BA 4L0YB 4IGPA 5FO7B 1H9TA 3F6OA 1LCLA 1HXS2 5KC5A 3SFIA 1POV1 4CYCA 2YPJA 1RR7A 2YBSA 3JBG2 4CDWC 4JGYA 4Q0PA 2E1MC 5I8SA 2WUHA 4M01A 3ZOIA 3T8RA 4BQ2A 4CICA 1MJAA 4LLLA 1LEMA 5IT3A 3O14A 4AL9A 2LY1A 3T0AA 1AWCA 2R93J 2Y6FA 2BVBA 2J42A 3BROA 3M8LA 4YRDA 5K1YA 4MVTA 1ALYA 2MD5A 1ND3B 5LBQA 2DTWA 1LECA 1ENSA 2BXZA 5C71A 4LHNA 4RSUA 3CZ6A 3V4GA 5FCCA 1HXS1 2Z3YA 4LXLA 3H1CA 3SH5A 1ZH5A 1KJRA 4OUSA 4HLYA 2LR8A 1Y0UA 3QYEA 1JZ7A 3VBOA 4P02B 3BG3A 1JYXA 3UGFA 2OAZA 1I6HJ 3M3QA 3LNQA 3N7KA 2V73A 2LTPA 1F9KA 1V54H 1DP7P 2VUDA 4L0ZB 5L3CA 1NZIA 1G6NA 2ZGMA 2W25A 4XE9A 1NOVA 4OI2A 1I1EA 1HX6A 4N9IA 3TOAA 1JMUB 5LY2A 5A32B 2DT6A 3N36A 2IT0A 1ZRFA 2DMNA 2DBBA 4M72A 2WC2A 1Z3YA 4B8XA 4Z07A 2PG4A 1OCTC 5F2SA 3ZN6B 2QQJA 2RS31 1PZ9A 1GWLA 1O59A 3GLLA 1JOBA 2VCMA 2DFEA 2ZS6B 3OYDA 2OT7A 4MGQA 1HB4A 3IRQA 1HRI2 4YW7A 3V65A 3I3BA 4AAXA 2DYSH 5JPMB 1G9FA 4PSWA 3GZEA 2ORZA 2EFQA 4CO8A 2HKXA 3UKVA 2Q5TA 4IF4A 3NKGA 4KG8A 3K46A 2ESHA 2CW8A 2L7FP 4BA6A 3VWBA 3IAQA 2DBNA 2HS5A 1XCBA 3VBHA 4GAZA 3I4IA 3SXWA 2BHZA 2VMGA 3PMSA 2UU8A 5A3PA 4IQ4A 3BLYA 4ZU5A 4ZDLA 2FDIA 4NROA 2A69F 4V2FA 4MTEA 3DKQA 3WP5A 5A3MA 5GZGA 4G7ZF 1TT5B 3FHAA 1YCIA 3I4MJ 5KHGA 3F8CA 5DZFA 3WG3A 4DXSA 3T2TA 4AI1A 1K4TA 1Z91A 1TMF2 4QWQA 3JAMK 1YW9A 2EAKA 1W5SA 4EQQA 3A01A 3T08A 3UYJA 4QT6A 1LFPA 1PO13 3E6BA 1E17A 1RUI1 1WA6X 2R5YA 2CL2A 3O0XA 1W5CC 2BE5F 2W87A 1FXZA 1POGA 2ZCWA 5D4SA 1ULDA 2G9GA 5CFDB 4Y17A 2EVXA 4CGZA 2V26A 3LDRA 3N7JA 2CAVA 4FOYA 1ZR2A 3S15J 3O1TA 2D3RA 1GV2A 3KD4A 5TJJA 1LODA 5I0UA 2JVHA 2CH0A 4CEWC 4S0HB 3ACHA 3ASNH 5C3PA 5K7ZA 1UY1A 5JIUA 1PUEE 1AZDA 4HK9A 2HYKA 4FE7A 1YI7A 1OKOA 3AB0A 5JPNB 4XR6A 1S0JA 3E6MA 2EPFA 1WH7A 4JDMA 4ESJA 1J84A 2XJVA 4AHWA 3DTEA 3ZFFB 2GMEA 1GUUA 4PK4A 1Y6IA 2NS0A 1QPMA 1R1UA 2XF7A 4ES8A 4FQ4A 5IVEA 4AOCA 4D0PA 4RB0A 3HSRA 3OYLA 1GQPA 3BTJA 5L7OC 4KU7A 4DXRA 2NVTJ 1BLZA 2Y6KA 5E1RA 1D0XA 3E97A 1WWXA 1KDMA 3FK7A 5LBEA 2XJRA 3DBLB 2OBPA 4MH0E 2EXHA 3TYJA 1MJ9A 1XPXA 1Q5OA 2OUMA 3KYCB 1URXA 2RQQA 2ZGPA 1W6QB 2WINB 4KFCA 2CGOA 3K4AA 4A6SA 3CUQB 2B5HA 2JIJA 1H0BA 2UWBA 1BCXA 1IW7F 3GTLJ 2VTFA 3HBKA 1LHVA 2VECA 5A3WA 1BOAA 4AK3A 5HXMA 2TCTA 1O3QA 5HODA 1XTAA 2BNMA 3AKRA 4P14A 1RUJ3 4PLOA 1D4M3 1YOVB 3IH4A 2QTWB 2WO7A 2NS7A 4QXCA 2DTYA 3VHRA 5A1FA 1R9TJ 1SCRA 4XFGA 3V0AA 2WADA 2VQGA 1WA4A 2QBXA 4FPGA 4BPZA 2ZGUA 1Y8QB 3LFKA 3GXUA 2V5DA 2PLYA 2YGMA 1AR73 4E4SA 1RJ8A 5IW0A 3RPUD 1FYMA 4NAMA 1QJX3 1LGCA 5FP7A 1PVXA 3VD9A 2W24A 4PJLA 3UGGA 3ZXEA 1DGRM 3D5LA 1VBE1 2W92A 1CAXA 1D0HA 4UFIA 4FE4A 3BN6A 5CA6A 3V0BB 2C9KA 2RDNA 2W57A 2LH9A 2P3YA 1PNGA 2DQLA 2HJIA 2YBKA 3HB9A 4XPVA 1JI6A 4ZU7A 3HOTA 3CDLA 2Y6HA 1R5HA 2VE8A 3THPA 2XAQA 1IOAA 5BPDA 4XVHA 2E5ZA 4CDUC 4IW3A 3CZUA 3F23A 4HKOA 3MCZA 4HOOA 3JRFA 3LWCA 3V7SA 3RFRA 4EYUA 2DU1A 1QU0A 3AYAA 3ZR6A 2IJLA 2ZGNA 1S6LA 1POV3 4WX9A 5L9VA 1U8BA 5C5UA 1DYOA 1J5YA 2YY1A 2GWRA 2CS3A 2RR13 3C1DA 1OVSA 5FPAA 3PJQA 1DFQA 2KISA 2PAKA 2JB4A 4XTMA 1F35A 4ATEA 5DCMB 2Y75A 2VVDA 3J7AO 3WQBA 1QXPA 1VPHA 5T5LA 1HLCA 3SISA 1GUIA 4WVVA 3ES4A 5EHDA 1T6BX 5LEKA 1OVPA 3KLSA 2MH2A 4CEYC 3K4NA 2B46X 4MOAA 1RKWA 3R4SA 4HMZA 4XFIA 2WAAA 5DQ0A 1QJZA 3KEQA 4IETA 4C3JJ 1GWMA 2B4KA 2ZAHA 1NE4A 5C7GA 1CIYA 3M3EA 2ZX2A 2LTNA 1BBT3 4M9ZA 1T6SA 1FATA 4CEWA 3AM2A 2XGEA 4UHTA 1DZQA 5DEQA 5J40A 1JYIA 3O1RA 5AFEA 1H8TB 3WW3A 4FFHA 2LRPA 2EXIA 2OUHA 4Y22A 1KDKA 4Q0VA 2AHQA 3TDUC 3TO6A 2I2SA 1WW4A 2CGNA 1K79A 2XAJA 1SEUA 4Z8BA 4J25A 5LK7B 1U5TA 5KCMA 5GKAC 4FQGA 1E57A 4YIFA 2HFHA 1DQ5A 2F5DA 4E7LA 4LBOA 1RIOH 5FKLA 2XL7A 3X29B 3ZSMA 1O5LA 2WNVB 4DFSA 1TP4A 5FTTC 2X29A 2ICWG 1IN8A 1MMAA 1YQ6A 4LQRA 1R5GA 4HG6B 3K69A 4PIXA 5ICCA 2IXHA 5E17F 4FO9A 3V56A 2NVYJ 1QHDA 1ETVA 2VH9A 1N78A 5CYYA 4R4XA 4MZUA 1JN2P 2RDPA 3ERMA 3MPPG 3LIGA 3OYEA 2WV1A 2WZEA 2VXJA 2ZAAA 1TNRA 3R0JA 4II2A 3TW7A 4HA8A 1SCSA 2QE3A 3EBRA 4FFGA 1YO8A 4QKDA 1K42A 1O4ZA 2KKOA 1IG7A 4RQPC 3RJPA 3MZYA 1SLBA 2OZJA 3WUDA 1UOJA 2ZGQA 4KYWA 2WSVA 5F3IA 1E3HA 3UKTA 1CJPA 1PGW1 1RUJ1 2BVMA 2I10A 5TRDA 1LEDA 3SZPA 3G4SI 4OMYA 1K5MA 5DABA 5J37A 4CCEA 4A7YA 1OPOA 3G2BA 3CJIB 3RZHA 3CQOA 2QF7A 1JHJA 3GZUC 3ABZA 4XN3A 4EM2A 4IOCF 3H1YA 5E79C 2HBUA 5TGTA 1SFUA 2Y8KA 3J7YJ 2AZ5A 4QKFA 3JBG1 2HWE3 3ECQA 2E7XA 2EV0A 4MXWB 4AVCA 1OLRA 2AH2A 1W7PB 1XS9A 3HPHA 2RM21 3OPWA 4CZSA 1TTYA 1APNA 1QH6A 1JUPA 1W90A 4GWMA 3NRVA 3G1MA 2RNGA 3GF6A 2PJRB 3JRAA 5JZGB 1DDNA 3I8TA 3G7DA 1QOTA 4PDWA 1GANA 4AW7A 2VASA 1MQTA 3SNMA 2J1VA 1NCQA 4AVTA 2JB8A 3L2RA 4BJ6C 4XABA 1X9TA 5GAGJ 3F6VA 4UWDA 3I2OA 5FZ0A 1SFXA 4X8NA 1WGPA 4S2FA 5AIPA 1VBB3 5A3UA 1YHQI 2V1UA 3JXSA 3EYYA 1U9NA 2JT1A 4HAMA 3GEZA 1U5TB 4QPIA 1BMV1 2HOAA 2FF4A 4IV3C 2EFOA 5L3DA 2D5VA 1D0GA 4B4PA 5KHIA 2UUZA 2IS2A 2ARCA 2RGVA 4FAGA 1EAH3 2FQ4A 1RUI3 1Z7LA 1VB2A 4GJZA 4XURA 1UNBA 1Y9MA 5EZHA 1HBXG 3H0OA 2EIBA 1LR5A 5EQUA 3WXPA 1AR61 1K3IA 3DU5A 3DFGA 4NQWB 1YTYA 1VBD3 5A7WB 2DVFA 5JOZA 3LQQA 3BYWA 2HLEA 3QD6A 4B29A 1WJ5A 2A7AA 1UKGA 2XBO2 1DQ6A 5GLZA 3VBSA 2ZABA 3K2OA 3MUZ1 1W2AX 4O65A 1GVJA 4WVZA 4RLFA 3HSEA 2VC1A 3MD2A 1KU7A 1B4AA 3SKVA 3TAYA 1FIAA 1POV0 2R062 3A03A 1U5ZA 2R7UA 4GZ9A 1UZCA 3NWSA 4KA4A 4AM3A 4P96A 5JSPA 3GFLA 4AVZA 5ICEA 4RN5A 4E6KG 3ZIXA 1WMEA 3TL4X 3NL1A 2VIXA 4A12A 3URFA 4H0EA 2R0HA 4NIHA 2O1QA 4Q4V2 1C4RA 1A3KA 4ENKA 1AYN3 5LGTA 1EA3A 1PM4A 2D3PA 3IHUA 5A6XA 4LKFA 1G7YA 4CDQB 1Q1VA 2DPUA 2D98A 4K1YA 2FJ1A 2TRTA 1JOJA 1LE8A 4JVAA 1PK6A 3MMYB 2JQ7A 4AWDA 3FIWA 3H5NA 3ZGKA 2ZJQF 2SLIA 2P5LC 1FIPA 2W95A 2M7BA 2X51A 2WNUC 2A6EF 3PIJA 1EV11 3KZIC 5FYTA 1EPZA 2ZGTA 1LB2A 1NZCA 4GMP3 1VBC1 1AJOA 3C7HA 2W94A 3PJYA 3RZGA 2O0YA 3J4UH 2IGOA 3BR1A 4XKCA 3WNLA 1OC1A 1J7KA 4EN7B 1O3RA 2AQEA 2ZFUA 1LNSA 5FKMA 4D6QA 2NZ9A 4R8HA 2FBIA 5EGOB 2N7GA 3M2MA 3J8F2 1B59A 2CWMA 2GDFA 3MN2A 4NHLA 3ZFGA 4OQ8A 1A78A 3GFIA 4CU6A 3QOEA 3GZNB 1XN7A 1BW5A 1DGRA 3NAUA 2RS11 2K4BA 4MEXF 1CESA 4NRMA 4KT5C 3DEMA 1ACIA 5JR2A 5FAXA 4GWIA 1XSRA 4EWAA 2AGSA 2PLV1 4WM7A 3DXJF 2CWEA 1RNLA 3QAHA 3KCYA 2VLAA 5FD5A 2Q8CA 4K3UA 4BEHA 5ABJA 2DYCA 2OQGA 3V8LA 2W2IA 2QQWA 4JTOA 3WG2A 4XHXA 4QXKA 1DGLA 4GQ7A 1V00A 1RUH1 3NJYA 2A71A 3JRCA 3LF7A 1UZ0A 2O9LA 2EALA 5C9AB 3JB4C 2BWAA 3DTIA 2HYGD 1YW8A 4FI9A 4V2WA 1NXD1 2YHJA 3DPRA 1GV5A 1JU4A 1WLWA 2JIGA 4BXXJ 3R61A 4A0YA 2I74A 4DBQA 1YW7A 2K4JA 4ITVA 1R5ID 3KT4A 1HKTA 4IV3B 4CCMA 4FP3A 2YFUA 2R5ZB 4V1PA 2CUFA 4XM3A 2DU0A 1WJDA 4I7HA 1ETWA 3R05A 1PP8F 3OYWB 4QDQA 2H27A 3IZOA 4N43C 1MH3A 4J6GA 4AEMA 3ZFGC 1VBE3 3D4KA 2E1NA 5B4XA 5DAXA 1AX0A 4MHGA 1N1TA 3WHBA 4IHVA 4OHXA 2A70A 4AI2A 2K9SA 4TSVA 4MXVA 3JD71 2JA5J 3W5MA 1AR71 4XYXA 1TMF3 5JUVA 4ES9A 1IC8A 3FXUA 3M3YJ 2EV6A 3PFYA 1C28A 2D6MA 2DCKA 2FZ2A 2HWC3 1EPWA 5HBAA 4KWKA 2GN3A 2IXJA 2BJSA 1Z67A 2GA2A 3KS7A 1KQ8A 2DLLA 4H7MA 1XMAA 2XGDA 1A8DA 4EJTA 3BG7A 2RS13 1LAJA 2FNAA 3KV4A 4M3EA 3O1OA 2CSOA 2KRFA 2VUAA 4XJWA 3PIGA 1RUE2 3HVDA 2GC1A 4XJAA 2IA2A 1SDDB 3QU3A 3CF5F 2VMCA 3C7FA 3C7JA 1LPQA 5C9AA 1PO23 4QQOA 4NQWA 5I8YA 2E36A 1W99A 3S16J 1O91A 4UOJA 1Z7S1 1MZFA 5GLUA 3IWFA 2WNUB 1Q43A 1BOBA 2MH9A 2ZJPF 1ST8A 4IE7A 2HQNA 2R072 2EH3A 4B4QA 3ZFGB 1HRV2 3L2YA 4JX4A 2STWA 4NUBA 3OUIA 3FXLA 4ASMB 2VZRA 3K4KA 2R5ZA 1RUH3 1JTYA 3JCUC 2WT0A 1ZYRF 2DVGA 5E18F 1RYYA 2ZBKA 3K4DA 4IE6A 3WTXC 2XPWA 4LO4B 3E7LA 2XL9A 1VAKA 1A31A 2GC2A 3BJAA 2K86A 4WZCA 4K20A 3BZ6A 2OX0A 1W6NB 4HVRA 1R4NB 1YEWA 2OU2A 5J36A 4JQRA 3TN91 2IRFG 5EG0A 2DA3A 1IZ1A 3HT2A 2Q2EA 5KR7A 5FBJA 1S29A 2DPDA 5F8PA 3WVJA 1FMD3 3HTUA 5HS7A 5FZ7A 4FSJA 4P9WA 2CDOA 1A6QA 4FT8A 4HNUA 1VMJA 3FLPA 4B1LA 5LCWL 4QHOA 1GSLA 2R5YB 5IK7A 1UPIA 3J81Z 4BZ4A 3QCWA 3DV8A 2Q8OA 2VB6A 3PVNA 2FOKA 1WMXA 2E2IJ 2MEV1 3IKWA 4L99A 1CZVA 1QJY1 2R061 4XJ8A 3KHBA 4RGGA 1OYYA 2CFXA 3LB9A 2GC3A 1FOXA 3P5JA 1FPN2 2MC3A 3SCGA 4UW5A 2RG4A 2DURA 3OOUA 2QYOA 4XQFA 1HB3A 5C4WC 2R1BA 2HBTA 1RUC3 1N1VA 2E34A 5A2QZ 3EYPA 1SVLA 3N9LA 4N4NB 3OL3A 3VZMA 3BWGA 1JBCA 4W97A 3IMMA 5GTIC 2YSRA 4WVWA 4ZYEA 1UYYA 2HEWF 4OINF 1W36C 2LY2A 3X2QH 1Z9CA 1NH3A 1QH7A 1SLTA 4J1WA 2WJSA 3BCBA 2XLFA 2E6VA 3K70D 1KYZA 4RAZA 2CV1A 2PJPA 4KQ7A 2PFWA 3VZJA 1QQIA 1DGRN 3I2DA 3KE2A 1W28A 1LU1A 2IPQX 3C3WA 4KIFA 1AYN1 2JDPA 1OISA 1VQOI 4J1XA 5H9QA 2A5YB 4MNUA 4BEHB 4KNYA 5H9RA 1IN4A 3ZM8A 1OQYA 1K78B 4DYCA 3S0MA 2XUEA 1HCRA 1E3OC 1HW1A 4QX1A 3WTVC 2RHPA 4A45A 5FLHA 5E3MA 4BB3A 1IHMA 1MDMB 1XYPA 1K5MC 1R58A 4EN8B 2QCOA 4LBKA 1ZM1A 3R0RA 2UXNA 4P55A 5EEHA 3DXUA 4P00B 2HWF1 2RR12 3LOBA 1ON1A 2FUG2 2G7HA 1H1IA 5FP8A 2FE3A 5A3LA 2YC4A 4IQPA 2XAGA 5K7PA 5EJ3A 4IL7A 1W9YA 1R4MB 3DF8A 4ORFA 3KF3A 5DAWA 1QEXA 1YS6A 5AVAA 3GHMA 3DTKA 5A7QA 4BOWA 1DGWX 2R7OA 3WW4A 2UWAA 3IDEA 1OF4A 4META 1S0IA 1UMIA 2JKBA 5BNOC 4IE0A 2D97A 3HTSB 2CDPA 4HDVA 4Q1PA 2DJIA 4IXAA 5E1ZB 4QM9A 1CX1A 5BNQA 2DVAA 2P2KA 3JCIA 1EF4A 4MX3A 4AR2A 3HJEA 2DA6A 3FUOA 3Q5FA 2X8KA 4O3MA 2HWF3 2D6LX 3GCWA 5FP3A 2P5VA 3Q9VA 4EJOA 4BJ0A 5HLTA 4DUVA 5IVJA 4QB2A 4QPWA 3DYPA 1GP5A 2VXDA 5FKOA 4B44A 2BU9A 5F6LB 3SHRA 4B3XA 4MHRA 3TDZC 1RRJA 1W39A 2B9VA 1CF7A 2LF8A 1VMFA 2COMA 4DRVA 4IEQA 5KC6A 4WXCA 1PP7U 1OI6A 2A68F 1UWWA 4LBQD 4Y5Z0 3A4UA 1G2HA 3KV9A 4BK4A 2XR4A 3GZ5A 4CTEA 1TWCJ 3QPLA 4LBMA 3HOYJ 3REOA 3GYHX 5BNNC 1BI0A 2D45A 4M0NA 3MDPA 2E51A 1EH6A 4PGGA 2XLAA 4PSXA 1W5TA 4BQNA 1H2NA 1I1SA 2MD0A 4A41A 2X5IB 3B9CA 5JXJA 1P4AA 5IT9K 2VQAA 3HOXJ 4U0YA 1VBD1 4UUSB 5JLXA 2ID6A 5J4VA 3M3IA 3Q0WA 4NHXA 3OSFA 1JYNA 1CGPA 1JTXA 3UL2A 5E8IA 1R091 3EQEA 4PJNA 1AR92 3DPLC 5BPXA 3ZQIA 3ZSJA 3VSLA 3W3CA 3NV1A 4RD7A 2BERA 1C57A 1R083 2HYFA 5D5UB 2D40A 1FSEA 5TISC 4I2OA 3FKJA 2CV0A 2HQRA 1YQAA 1IXRC 3HC7A 3FJSA 3RPQA 1BI3A 4YFXF 1BC8C 3W6VA 4NC7A 1OQ1A 4XC9A 3CC4I 1O3SA 1STMA 1NT0A 1IZ3A 4FTSA 1V6NA 4ZH4F 3RI9A 3F0CA 5DUVA 4U7DA 5FB2A 4RL7A 1WLDA 3POSA 3HGGA 3UKNA 1X2NA 3M1EA 2FMLA 2L3DA 3EO6A 3AZXA 2D6OX 4QX3A 6PAXA 3VGIA 4Q27A 4LEJA 2E7QA 2VVEA 3HBZA 2JX9A 3QOPA 2VODA 3VZKA 4AHZA 4K40A 5DD4A 3S2HJ 4F8AA 2ELHA 4Y1ZA 4E7SA 1MS3A 5E1XA 1FWZA 4YVSC 4OLLA 5CVVA 3PSIA 3WNXA 3O1UA 4K21A 2QWWA 2PQQA 4YVWA 2O8QA 1WJBA 1OCCH 4BDYA 4WM7B 5DDJ3 5BNOB 2WT1A 2EJRA 2IUWA 3KYDB 2MPFA 2Y33A 5HNFA