3HIFA

The crystal structure of apo wild type cap at 3.6 a resolution.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
199
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of apo-CAP reveals that large conformational changes are necessary for DNA binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 51
structure length 199
sequence length 201
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hifA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hifA01
4L2NA 1LDKB 4YIIA 4A5NA 4FT8A 1NXMA 1ON1A 1USTA 4A6EA 5DYMA 3KLOA 3DFGA 4F7ZA 5HLHA 4P96A 2X0LA 3G7DA 2COMA 1SQ4A 4QGMA 3RJPA 2WFPA 3I54A 1R00A 2B8MA 4LD5A 1FI2A 2GAUA 1WRJA 2HOEA 1XMAA 4ENNA 3TO6A 3H8UA 4MEYF 4LK0F 1IZ1A 3CUOA 1LJ9A 4Y15A 5DUIA 2P5LC 4KIBA 5FLXK 3RYPA 1ZGAA 3KP5A 1XSXA 1PP8F 3WU0A 3HOSA 3ZMUA 3PNAA 1ZRRA 1ZZBA 2NNYA 1J5YA 1AWCA 2A68F 3P9IA 2FNAA 2PMHA 4I0AA 3R60A 2GC3A 2Q2EA 2K27A 3R0AA 5J8FA 1X8EA 2KIUA 4MGKE 1OYYA 3KFWX 1MJ9A 3RYRA 2AS5F 3RZZA 3QPTA 3WW2A 3Q9VA 3I59A 4YNIA 4A12A 1CF7A 3LA7A 1TQPA 3LAPA 1TQIA 2FNPA 5DV5A 5HOOA 2XGXA 3F6VA 4I09A 4IHTA 4OINF 3WTSC 4EGZA 3GYDA 2QENA 2KIMA 5K5RA 5H6QA 3KSCA 2DO7A 4BHBA 4H7LA 2WTEA 5A2QK 2ZMEB 4OMZA 3FM5A 1T38A 1XDSA 1UD1A 4AVAA 4L5IA 3MQ0A 2PTMA 2XL7A 3COAC 1BOAA 3ST7A 4PZJA 3J80Z 3WW3A 2YX4A 4XSXF 4IXAA 2F2EA 3V7CA 2A61A 2CAVA 3TOBA 3FMSA 3D5LA 2J5PA 4UV9A 2PBIA 5CU1A 1H1IA 1F1ZA 2GA1A 3GYHX 4I3PA 4M9XA 4EJWA 1YUDA 4UV8A 3F72A 5JSOA 1UCRA 2MA3A 3KZYA 5K5QA 1FWZA 3L2HA 1XGSA 4M73A 4Q29A 2MPFA 2GXBA 4BH9A 1O3QA 4LA2A 2Q0AA 3NVCA 4BAYA 4KA4A 1ZARA 5FQ0A 4R1HA 1LB2A 3WODF 4QM8A 4NHJA 4L0YB 2HEOA 2F4PA 1IF1A 1JHHA 1TNTA 4G94A 4UBHA 4XF4A 1BJAA 1IW7F 4RGRA 1IRGA 2GQQA 2WWYA 1VJ2A 2ADUA 1RUOA 3R0JA 2FRHA 4Z2YA 4KMFA 4HQEA 2RV8A 1XSDA 4XF9A 2LKPA 4WXDA 3HTUA 3TOAA 5KHIA 3ETQA 5JR3A 2VQAA 5JHUA 4MGRA 1B9MA 3NQOA 4GXOA 5FLIA 4HF1A 2EAAA 4XFHA 4RAZA 4XFAA 2WV0A 1E2XA 2IRFG 1ZREA 2VC1A 5BPDA 4HVOA 3FMQA 2V6CA 2XV4S 5FFZA 2RNJA 4ZH4F 4Y13A 3ZPLA 3V7RA 4N9HA 3W6KB 1P4AA 4M6XA 1FYMA 4MNUA 4A0ZA 3T5XA 3ZN0A 2EFNA 3I58A 3QPHA 1EY2A 5D4RA 2VC0A 1O3TA 1BIBA 1D8JA 4N9IA 1RL3A 5J7MA 4B8XA 1BI1A 4ESJA 1ZZ6A 1U5TA 3MDPA 4J1WA 1OKRA 2XAFA 4MUVA 2V1XA 2R7DA 3C1DA 2PJPA 2M1BA 3NEUA 1O3SA 5FQ0B 3GUDA 4ZU4A 2UXNA 2RN7A 2L54A 1O7FA 4NQWA 2HQRA 3L00A 2M87A 2ESNA 1LNWA 5LBQA 3KP2A 1ONVA 1W5SA 2PG4A 3BCWA 3BPXA 3LZZA 2C6YA 1TBXA 4IHSA 3DXJF 4BNCA 1XE7A 5LHIA 3FXQA 5ICEA 2H94A 1IPJA 3GFMA 1FYLA 1GHCA 4HV5A 1SFXA 4OU0A 2D2WA 4KL1A 3DPLC 4KWJA 2XROA 3OOPA 3B73A 5CVRA 3CLPA 1ZN2A 4HX8A 1LRHA 3WGGA 4ZZLA 2E9QA 2QYOA 3TGNA 2H27A 3CTAA 4EJVA 1JXSA 1ON2A 2LF7A 5LGUA 4OFGA 4AVCA 3KLNA 1TQMA 5I91A 2K4BA 4AQ2A 3JSPA 4U0WA 2P7VB 4MTEA 5EEHA 3M3IA 1SD5A 3E6CC 3ZQ7A 1YQAA 4ORFA 2OQGA 2D93A 2BV6A 5JVTA 1XGOA 1QGPA 1R22A 4QM9A 1S3JA 3B02A 3REOA 1OYWA 5FB2A 1O3RA 3BB6A 2P6SA 3BJ6A 5JFRA 2Y0MA 4WK8F 3IL2A 3TDZC 5JSPA 2YPRA 2D45A 4RS8A 2GWRA 5IT9Z 4LA3A 2IJLA 4META 4XRFA 3HSFA 1F9NA 4CHUA 1O4TA 4KDPA 2H0VA 3IKVA 1KU7A 4GYGA 1VR3A 2OQRA 1L3JA 1FPQA 5KHGA 2A69F 5DCMB 4HW0A 2XASA 4MH0E 5AONA 2UXXA 3O6BB 1ZRCA 5D5XB 3U10A 3NKTA 5ILVA 3RPUA 1GXQA 1G3YA 4OIPF 3RKYA 2OPKA 1RGSA 2LSOA 1JHFA 3SFZA 2ZNYA 4HYEA 4Q47A 1I5ZA 4G6DA 1B1BA 4IRGA 2RKHA 5D6FA 1SMTA 4KUMA 5DEQA 4HN1A 5FPZA 2XUBA 2VBXA 4LLGF 4P9FA 1O7LA 2HGCA 3LFKA 5K5OA 4ETSA 5HDGA 3N97A 3MZYA 1SAXA 4BQAA 3L7WA 5CYVA 4I0BA 5FDBA 3PVBB 4X6QB 1XRUA 1V70A 1T0FA 4MX3A 5HS8A 2XL9A 2KRFA 2ZJ2A 5D5WB 1IN7A 1MKMA 2EA7A 3H7YA 4AQ6A 1S7AA 1CX4A 4QGLA 4WXHA 2J5OA 2Q1ZB 5KK1A 3J80K 2IPQX 4CDGA 1EPZA 1FBUA 1ZLJA 3FHIB 3W6JB 3ZDSA 2PA7A 1QZZA 2QQ9A 4P9UA 3MCZA 2HTJA 5CVVA 3EDPA 3I0TA 4ONUA 4A6DA 5I0UA 1RUNA 2UWMA 4AIHA 3JAMZ 3GWZA 2O6GE 5LEJA 1O5LA 3QRFF 3BZ6A 1CAWB 3V8JA 3KETA 5HLGA 1VP6A 3KMHA 1EYBA 1J7KA 3KP6A 4HX4A 3DF8A 4LB5A 4M71A 4ESFA 3MAJA 1I1GA 4KU8A 2NNNA 1SFNA 1Z1DA 4O3MA 1XCVA 2XLFA 1PDNC 3JTGA 1Q43A 3CLOA 3NRVA 2FQPA 3EBRA 5ILUA 1JUHA 2MD5A 1P92A 3TO9A 1ZX5A 4LLLA 5HDNA 4OMYA 5LGTA 4HQMA 5E1RA 5J8CA 3BJAA 4Q48A 1GQGA 1UIJA 2L4AA 1L3LA 4AIKA 4JBAA 2NRAC 1LVAA 1FZPB 2ZXJA 1TNSA 2BNNA 3S7IA 3BROA 1SMYF 4I02A 3U2RA 4M6YA 1UHMA 4B09A 3BP8A 2CG4A 3GFLA 2A6EF 5I8SA 4UVCA 4O9EA 4FX4A 1J2XA 2A6HF 2A07F 1HXDA 1W7PA 1FXZA 4A0YA 5I8TA 1R1UA 1K79A 4XETA 2R7FA 4JTOA 3F8NA 2EV5A 2EB7A 2MLKA 1UHWA 2H09A 4KMUX 4WBBA 4PIZA 2IP2A 4HOBA 5HI0A 4UNOA 2OAZA 1IN4A 1HSTA 1HQCA 5HVQC 2PAEA 3H1YA 5E8IA 4YIFA 2PN6A 1YS7A 1QPMA 1Y0UA 2JT1A 3K9TA 2HKOA 1Z6TA 3ULQB 5EZWA 5LGNA 4LJZF 1IRFA 1L0OC 1MJAA 2HWVA 2E7XA 2L01A 5HDKA 4HVRA 3E3VA 2FMLA 2DK8A 2Q8KA 1DGRA 3I53A 4Z07A 5FO5A 3MEXA 3F22A 1HW2A 3R4KA 2UY8A 4KICA 3RTRA 2P7CB 3WE2A 2FBIA 2Z2SB 4ZYHA 2VBYA 3FZVA 3RIRA 3T1BA 3IWZA 1NE4A 3JSOA 2GH2A 3NL1A 4P55A 4LUMA 3ES1A 5LHGA 4D7SA 1NHAA 1FBSA 4YFXF 3ZN1A 5DD8A 3VFZA 5D5VB 3F6OA 1MD0A 1EH7A 3HRSA 4WXCA 1Q3EA 4JVAA 2DQLA 1Y9QA 3EYYA 4HA8A 1T98A 2QUFA 2O1QA 2JSCA 3HSEA 4Q0SA 2IXIA 4XFCA 2OD5A 2E1NA 4HF0A 2PAKA 1ZRDA 4KN4X 3HUGA 4RGXA 4IEXA 4DNCA 4FBFA 4E2SA 4IEOA 3ABUA 3BDDA 4HLXA 1FYKA 2XAGA 4GO1A 2PQQA 2QM3A 6PAXA 3F8BA 1ZVFA 3IDCB 4DQ2A 1DZTA 1USSA 3V4GA 4HX7A 2D40A 2Z9OA 4XLNF 1YO5C 5I93A 3U1DA 3FHZA 2Y75A 1E17A 4NB5A 4UUVA 1B59A 1LKNA 5ILSA 2XKOA 5H6RA 5I0RA 4LG0A 1B9NA 3VODA 5BY5A 1U5TB 2XAJA 4EQQA 2BBYA 1S6LA 3LWCA 1BN5A 3SZTA 2V09A 4TLFA 5E1ZB 4G7HF 1TW2A 1FSHA 1J58A 2D5HA 4EWAA 4YSFA 5HS7A 4G7ZF 4HMZA 2O8XA 2D1VA 4LUKA 2ZKZA 4EJOA 2EFPA 5K1YA 4Q0PA 1RNLA 5KHJA 4LMYA 1O5UA 5JSRA 3IWFA 5BPIA 4HLYA 2VT3A 2FU4A 1HW5A 4LLNA 5HLIA 1ZNPA 4PCQA 2PYTA 3CJXA 4IF4A 1J75A 1XDUA 1LDJA 3DQVC 3HHHA 2VBZA 4KNYA 5I0TA 3KP3A 5I0SA 2VPVA 3RI4A 3EETA 4XLPF 4FX0A 3HSRA 3ACLA 4L9JA 3TNQA 1IN8A 2STTA 5CADA 2ETEA 3CO2A 3WGIA 1IN6A 2M30A 2XVCA 2I45A 1CAXB 3CJNA 1NYWA 3MZHA 5TRDA 4MZUA 1C0WA 2L3DA 2PEXA 4AVPA 4Z82A 4EWEA 2E7WA 3CF6E 1A04A 4PGGA 5L3DA 5CLSA 3EJKA 4HBNA 1RTVA 3KEQA 1OYIA 3FWEA 4RB2C 1WGPA 2FMYA 4G9YA 4Q5SF 2O3FA 2HYGD 2JTVA 5CVIA 3ABTA 4M74A 2V1DA 3FXUA 2DBBA 4A2UA 1S29A 4D0PA 1YFYA 2MNGA 3OCPA 1YFHA 2M8EA 3ROUA 2E1CA 2NAZA 5DUKA 3JAMK 1WA4A 2Q30A 1YYVA 1XGMA 5L3CA 3SCGA 2IW5A 2ELHA 3L09A 2V9VA 3VEPA 3WTWC 1KA8A 4O9GA 3FF5A 1IXRC 5F6FA 2KKOA 3PLQA 1X82A 4O6JA 3F8CA 3QP6A 5AIPA 3AAFA 4G7OF 3G3ZA 2GZWA 2F5EA 3C3VA 4R79A 5E1WA 3H3UA 1PMIA 3KGZA 1DUXC 4XFFA 1P6RA 2H6CA 4LK1F 3CO7C 3CL1A 3O14A 2FSWA 3VB2A 3IHUA 5D8LB 1B4AA 5DCFA 1YHFA 5FLHA 3WU1B 1P4WA 4KIGA 4HN0A 5H20A 3SQNA 2IXKA 4A5MA 1YLLA 3GVAA 2B5HA 1D3YA 4IEPA 4YFKF 3SCFA 1GXPA 2W25A 4LGWA 2D1HA 1YWKA 2OA4A 3ZMVA 3BY6A 1SFEA 3GFJA 3ZP5A 4D7TA 5E1XA 4KU7A 3OD0A 2QLZA 4OLLA 1WSUA 5I8YA 4UXAA 1H9GA 5ERIA 2ACJA 5EFUA 3ECHA 2EFQA 2IA2A 3LA3A 3WTUC 2Z33A 3DKWA 1I1SA 1ZGJA 5DCMA 1PP7U 2GA2A 3CUQA 1ZZCA 2VOOA 4XFGA 1S7OA 2F5DA 2G7HA 2JPBA 4HBLA 3HT1A 5ICFA 2UY9A 2CAUA 3FJSA 1Y3TA 4RB0A 3ELKA 2X4HA 3OTFA 4I98B 2RQPA 1H1MA 4KT5C 3EQEA 2IXCA 4EM2A 2C0ZA 2CWEA 3VHRA 2FBKA 3C3WA 2IVMA 1EH6A 2AXLA 3RPQA 3N4MA 1RZ4A 4IEQA 3SHFA 1UFMA 5JCTA 2VODA 3SCHA 3LA2A 4P9GA 1V4RA 2W84A 3KE2A 3J7AO 3LSTA 4WWCA 5J3UA 2DAOA 2L02A 3M9AA 1TTYA 1HBXG 4MEXF 1JE8A 1MZBA 3H92A 5D5UB 1G6NA 5A2QZ 1Z6RA 2PI0A 4QGNA 4UXNA 2QDRA 2EFOA 5F64A 1T39A 4X6RB 1FC3A 2VT2A 1LEBA 1BI3A 3TO7A 4GGGA 4ENMA 1KQ8A 2W85A 5JAXA 4KN7X 3BWGA 3KGLA 1FNNA 5BQTA 3GEZA 3E5QA 1P4XA 2FXAA 3T8RA 2CFXA 2YU3A 3IDBB 4L9VA 2QJVA 1GVJA 1I6XA 2DQRA 2JPCA 1CF7B 5TJJA 3H50A 5BXXA 3L2CA 1EV7A 2V1UA 4EVIA 2CGPA 4WF2A 4F8AA 4UVBA 4EV0A 4B29A 1UCXA 2Q0OA 3D0SA 2LDUA 2PAMA 1TLHB 4I01A 3E6MA 3UKVA 3M8FA 1R7JA 2XHKA 3U11A 2BEOA 4XBFA 3WE3A 1ULYA 3WTTC 3F23A 3C18A 2OBPA 3M8EA 3JZVA 3DV8A 3EHKA 1KYWA 1CAVB 1ZHFA 5J6XA 4QLCU 5T3NA 4R8HA 4ZU5A 2ZNZA 4YRDA 4AWXB 4GULA 1XE8A 1SD6A 4EJTA 2P17A 3GW2A 4M72A 3E6BA 5L3GA 3D82A 3JW4A 2RGVA 1J0RA 4KWLA 3IBMA 5FCCA 2YSRA 3I5UA 1U2WA 3F21A 4YARA 2Z99A 5BOXA 4EWDA 2DFIA 1FX7A 4XF0A 4HVQA 4GYIA 4KFCA 5KHKA 5AIQA 1Z7UA 2V79A 2EJRA 3CUQC 2ET1A 3Q5FA 1K78A 2BNOA 3M70A 2CSOA 2JZYA 1QBJA 3I4PA 3MWMA 4IEVA 2XAHA 2HZTA 2HDCA 5LRRA 1JGSA 3RKWA 2XAQA 2G9WA 4MGIE 3LAJA 1YG2A 4L5JA 5D8KB 1W7PB 2ET7A 2IXHA 5IT3A 3T8TA 1FT9A 1DPUA 1DZRA 1KGSA 2P5KA 4Q0QA 1YFXA 2W57A 4NVPA 4BYYA 1HKQA 3U9GA 1Z9CA 1KQ0A 4RD7A 3IRRA 2Z3YA 5LLQA 4RAYA 2EK5A 2HYFA 4FAHA 1U3EM 1V3FA 1HW1A 3ZMZA 3RDIA 4CZZA 5DD4A 4IESA 3WW4A 3E97A 5LEKA 1VTNC 2HJIA 1LEAA 1ZLKA 4ON0A 3PQJA 3DN7A 3I7DA 4KYWA 2QWWA 3FFQA 4BXUA 2MH9A 1WWXA 3ERED 4MGZE 2PFWA 2QQAA 1G3WA 1XMKA 2XLAA 1J3RA 5D6EA 1IXCA 2EFWA 4L18B 2NYXA 4YG2F 4UBGA 1G3TA 3H1MA 1I27A 1KU9A 3HRUA 1G3SA 4MV2A 3P7NA 5E18F 3V8KA 2GU9A 3GLXA 4WX9A 2IA1A 4ZYEA 2UYAA 2GC2A 2K02A 4BHPA 5CVJA 4LTAA 4H0EA 5J48A 1XCBA 1HSJA 1NZCA 4IVNA 3EQLF 2VE9A 2K0GA 3KP4A 3FM3A 2RVCA 2OU2A 4A0XA 1GQHA 4AD9A 4GCVA 3WTVC 1CAXA 2K7LA 4QXKA 2DCTA 1FBQA 4OIOF 3FX3A 2KIFA 4OOIA 2MHFA 3ZMDA 2STWA 1UW8A 2Z69A 1LDDA 4PDKA 3GZ6A 1R1VA 1IN5A 2LF8A 4K8FA 3RNSA 1DGWA 1LR5A 1TW3A 4IRHA 3ML6A 1K78B 2Y48A 2HTSA 3SZPA 3VOEA 1YFUA 1XN7A 2B9UA 2K9ZA 4KWKA 4IEWA 3GZ5A 1OR7A 5FGMA 3EYIA 4XFIA 4TV7A 4CO8A 1PM7A 3TNPB 2A5YB 3D0JA 1T2KA 3HTSB 2FQ3A 4HSJA 3F3XA 2FA5A 3SXWA 1BI0A 3FXRA 4U0VA 1ZH5A 4RGUA 2BYVE 1H0MA 5FPXA 1T6SA 3IC7A 2RC4A 3M7GA 2DI3A 1QO0D 3QACA 1OMIA 2CO5A 2PHDA 3UKTA 3H7JA 4LLOA 1OD5A 1D8KA 1Q5OA 1BC8C 1D5VA 1CGPA 5HS9A 3KP7A 4LEJA 1REPC 2F5CA 3BU7A 1STZA 2TDXA 2MC3A 5E16A 1EP0A 3QAHA 2D5FA 5DDGA 4OIQF 4I7HA 1ZZ8A 3OGJA 3QU3A 3P9KA 4EJUA 1J3PA 2O61A 2XRNA 1R23A 2HR3A 4PJYA 1YIOA 1K6OA 2XKPA 4MGYE 1ZG5A 2OZUA 1P2FA 2M45A 4XF3A 1QXJA 3LQQA 2VECA 4YFNF 4EM0B 4JK1X 2A3SA 2ZBKA 4LFUA 1SEFA 3E5XA 1PUEE 1B6AA 1ZRFA 4ESBA 3K2ZA 3PQKA 1KQ9A 2L4MA 3BALA 3BPZA 1KU3A 4MQVA 3HYIA 3QU6A 1BIAA 4E2GA 4IEYA 2BNMA 1U78A 3P9CA 1FLIA 4E70A 3I71A 2ZKLA 2OZ6A 3IRQA 4RB3C 3R61A 3SHRA 5ICGA 1BC7C 4Q0VA 4PIYA 5FLXZ 4HZFA 1WLTA 5K8SA 3S0MA 1YS6A 4JV4A 3I59B 2FOKA 2HFHA 5FFXA 1QWRA 2P6TA 4U0YA 2ISYA 2K86A 4EM1A 3LQRA 3SXYA 1IAWA 1Q1HA 3LWFA 4G8XA 1R36A 4EGYA 1YFWA 1J59A 2VXZA 1NE6A 1O57A 3H9AA 1XGNA 1ODDA 3HIFA 2ZCWA 3IKTA 3LOIA 3U0ZA 3HRMA 3CUQB 1UIKA 2DK5A 3KCCA 4FHTA 1QXRA 2GC0A 3H3ZA 2Z5UA 3G73A 4XF1A 3K1MA 5KVRA 1QZYA 5KBFA 5JR7B 4PGHA 1MGTA 1KYZA 1S8NA 2HKXA 3C7JA 5BV6A 2H6BA 4Y17A 3ZMSA 4IPAA 4BHCA 4HF2A 3F8FA 2UZKA 4HV6A 2YX7A 5L3FA 3K1NA 3CEWA 4PIXA 4U7DA 2EVXA 2DU9A 4G6QA 2FE3A 2OZJA 2P8TA 2CV6A 1ZG1A 2B0LA 2QVSB 1FY7A 1RI7A 2K4JA 3HRTA 1CAVA 5FLJA 2EA4A 3MPBA 2QQBA 3WTXC 4EMSA 3KEOA 1DPRA 4O5VA 5EEGA 3BPVA 4IETA 1UB9A 2VBWA 5AVPA 3ISPA 3F8MA 3MFKA 2FF4A 1ZYRF 1RIOH 1TQ5A 2DW4A 4LG0B 1J1LA 4CYDA 2OA2A 1BM9A 4HAMA 2WC2A 4CGZA 4L11A 2CQKA 3GXOA 3R6SA 3WG9A 2FBHA 5L3EA 1IUYA 4M9ZA 2ZO4A 3K1PA 1J3QA 2P5VA 2GIVA 2RDPA 2JRTA 5D1IA 1X7NA 1AOYA 1CAWA 4ENJA 3GX4X 4YYOA 3QP5A 1X3UA 2QVOA 1EH8A 1IPKA 1CAUA 3H1WA 1U5TC 3SMHA 4IJAA 1UPIA 3NJZA 1R58A 1G4DA 1XB4A 1KU2A 3PFIA 1OPCA 2GC1A 3EO6A 4S05A 3KZZA 2HQNA 1HKTA 2VN2A 4L9TA 4HLTA 1U8RA 2EV0A 5L3BA 4QMAA 1RC6A 2GXGA 3GO5A 2XIGA 4RB1A 3FMRA 4UHTA 4S04A 2N7GA 3DEUA 4AIJA 5FD5A 1WI9A 1FOKA 3HHGA 2ZFWA 5C8WA 2DT5A 4U88A 4IEUA 2O03A 1QY4A 4AXOA 3IIAA 4XEZA 3FE5A 1QQIA 2LNBA 3J81K 5BS6A 3V7SA 3WW1A 2MLGA 2G7UA 1SD4A 4UVAA 1ZZ7A 1YW7A 4P5OA 1Z91A 4EROA 3EUHA 3UKNA 4MHGA 4E2QA 3WTYC 2CW0F 1R5HA 2EV6A 4N0BA 4FAGA 1W5TA 4M9SA 1FP2A 1IXSB 4J1XA 1ZAOA 1SD7A 1W4MA 1LQ1A 3DL3A 4HDUA 3S2WA 2ETHA 2QBYA 2XLGA 2HS5A 5C6CA 3K69A 3S7EA 1R1TA 3HT2A 1CAUB 2QCSB 2PQ8A 1F4KA 3WGHA 4LB6B 1F5TA 3JTHA 1DP7P 4ASNA 1H9TA 2P4WA 1FSEA 4WCGA 3NSTA 4OIRF 3ELNA 4MTDA 1YW9A 2CYYA 5ED4A 5D4SA 1WKMA 5E20A 2BGCA 1U12A 4LULA 2R3SA 3GFIA 3GF2A 2EA2A 4JQFA 1XD7A 2Q4SA 3BJOA 4KIFA 3LAGA 3CDHA 3M1EA 4DINB 5LHHA 2PMUA 2NS0A 3NW4A 3QOPA 3K0LA 5KHHA 1YTYA 2QZ8A 1YLFA 1R5GA 1ZZ9A 3L9FA 1QNTA 3WTZA 4IERA 2O0YA 4R52A 2IA0A 3GBFA 2PLYA 5F1RA 1J9IA 1DDNA 2M5WA 4JTNA 1YW8A 4QWQA 1BI2A 3TQNA 3V8LA 1MJBA 1U6GA 4ENKA 2IC1A 3J81Z 5IT9K 3ZMTA 3Q9SA 2O8QA 2VONA 2IXJA 3RYKA 1OI6A 2W24A 2ATFA 4MQ9F 2QBYB 3O2PE 5CVUA 2MH2A 4HDVA 5BMZA 2Y0OA 1SFUA 4QX5A 4ZZDA 2BE5F 2DPUA 2DPDA 4XSZF 4ZYGA 2DTRA 4Q4ZF 5BPXA 2UYBA 3E5UA 3USSA 2OYZA 3O3KA 5CJ9A 4BIFA 4CICA 3MYXA 2KJBA 3ES4A 2MBFA 3CO6C 2ISZA 3OV8A 2VE8A 3DP7A 4AVBA 1FP1D 3E6DA 3TDUC 1XSVA 4WVZA 2PFBA 3DPTA 1ZG3A 5BUVA 4XFBA 4WZCA 1MDMB 2QNKA 2PHLA 2ZMEA 3TKYA 4Q0UA 1WQ2A 2DLLA 4I2OA 3ECOA 1X8MA 4IEZA 1K7AA 5JI6A 2VOPA 2FEZA 5ICCA 4U7BA 1MDMA 4HSLA 4ZYDA 3HQXA 2IT0A 4L0ZB 2ESHA 4ZU7A 2EWNA 3OF1A 3T0YA 4RGSA 2F5FA 1BBYA 4CXFA 5LRSA 1OFNA 5FD6A 4K2EA 4IRIA 1Z05A 3HOTA 2IXLA 1W7PD 3I64A 2KXLA 3BOQA 5E17F 1HKSA 4L9NA 2YR2A 3FZ3A 3RKXA 2KJCA 5E8GA
chains in the Genus database with same CATH superfamily
4L2NA 2OX0A 1NXMA 3KLSA 4NIAA 4GALA 3T4HB 2WAFA 2RMU3 3UNGC 1WCDJ 1Z3XA 5M5XJ 3WVJA 3ZQGA 2VUMJ 5F2WA 2B8MA 2V73A 3WUDA 1ND3C 2ZTNA 3CIHA 2B9VA 1Z7S3 5IVFA 4YGDA 3TO6A 4MEYF 1RC9A 1IZ1A 3CUOA 9ANTA 4IHWA 1LU2A 3WDTA 4DJAA 4QHBA 4YWAA 2O9LA 1XSXA 5F0FA 2R7ZJ 2R072 4AAXA 3PNAA 1ZRRA 3BU0A 2V5YA 3BG3A 2NNYA 3VHNA 1QGLA 2VAUA 1OCCH 1GLNA 4RS5A 4E7SA 4RQPC 3R60A 4RM2A 4Q4V1 5J8FA 1NLSA 1X8EA 4AVVA 2QTWB 2AXTC 5EXOA 1XYPA 4FTSA 1QA6A 2BTVC 3O1VA 2P3JA 4A12A 3K3OA 1W6OB 4A3ZA 2RVAA 2FNPA 3I3MA 2CV0A 2A05A 3E1F1 3HN1A 2XGXA 4I09A 4IHTA 3WTSC 2QENA 4WVMA 1IG0A 4OI4A 2DO7A 3AKZA 4BHBA 2WTEA 3G2BA 1OUXA 5GZCA 5IJRA 3O1TA 1BOBA 5CAZA 2KL4A 2LLKA 3JRGA 4BACA 3J80Z 3T1MA 1NXD1 5DAVA 2XB5A 4Q4Y1 4XSXF 4MO7A 1WW7A 2GDFA 1YQ8A 4Q4W3 3POFA 3GYHX 4A3CJ 1WFXA 4PDWB 2P6HA 4EJWA 1YUDA 3PUSA 4UV8A 1UJ8A 3F72A 3NAUA 3L1PA 1AXZA 2MA3A 4DEQA 1XGSA 4J6GA 3JREA 1XNTA 2H1KA 5T55A 4F83A 2GXBA 5EJCA 3KYCB 2Q0AA 1OXCA 1Y1VJ 4KA4A 1ZARA 1OOPC 2WINB 1POGA 5JZGC 3POWA 4FPKA 4QQLA 1IF1A 2CUEA 4W97A 4OUEA 3FXJA 1C8M3 2WWSA 4NAOA 2GQQA 2DFCA 1RUOA 2ZGQA 1IRZA 2V9PA 1XSDA 4WXDA 4D7NA 1N75A 1JW6A 3VBHB 2QZ2A 1CPNA 2DURA 2L7FP 4LR4A 2IGOA 1E2XA 4L97A 1ZREA 3ZDVA 2VC1A 2VOWA 3FMQA 5FFZA 3V7RA 2RE9A 1C3HA 4M6XA 4EE2A 4JKLA 3AMPA 3T5XA 3JBG2 3I58A 1SCRA 2VC0A 1O3TA 2Y6GA 5J7MA 2H8RA 4B8XA 1X2NA 3O0VA 1U5TA 5A7PA 1EKEA 3MDPA 1PO22 3THPA 5HCAA 5A1AA 3TEDA 5C3SA 4MUVA 1UY0A 2PXJA 1LGCA 5LA2A 3NEUA 4XKBA 1O3SA 4RLFA 2XVLA 5C5TA 4K1ZA 1F35A 1AR92 2EBIA 3I3LA 3MKZA 2L54A 1ND2C 4NQWA 3NJVA 3KQRA 4AEDA 1QOSA 3JBG3 1ONVA 1W5SA 4YW5A 2JKBA 2ZB9A 3VBOA 5JIAA 1OOPB 3ZFGA 2YV8A 4AL9A 1FNZA 1XE7A 5C9AB 2RS32 2BY0A 5FYCA 1RR7A 2M34A 2D2WA 3SEPA 3UYJA 5GLUA 1CJDA 4KL1A 4KWJA 3NV2A 5CVRA 1X4OA 2RREA 3IAPA 1MS4A 4QIWN 3OD4A 5DDJ1 1MBFA 1K5MB 4HOOA 3WGGA 3ZGKA 2L9LA 1DFQA 1TE1B 4EJVA 1W04A 1JXSA 5JMCA 4ZC3A 2Y6HA 3OS1A 4QX7A 4TZDA 2WQZC 1IS5A 4LOTA 2JDMA 3PURA 3M3IA 1SD5A 5GTHC 3E6CC 2WIIB 4ORFA 4PK4A 2WAOA 2BV6A 1ASJ2 4YVSC 3ZPYA 1LJ7A 1OYWA 3BODA 1TMF3 2ZA9A 3ZXFA 5JFRA 1RUI2 3TDZC 2E26A 2GWRA 4JX0A 3MZ8A 5IT9Z 2IJLA 4HKLA 3QYFA 3QPLA 1F9NA 3ZYRA 3ASIA 3D5RC 3IKVA 3DF0A 4GYGA 1FPQA 5FZ9A 2VZOA 2A69F 4IHYA 2XASA 3PHMA 5FYSA 3RWKX 3U10A 5ILVA 2HPMA 3QH7A 1GXQA 2DCYA 4OIPF 5JOWA 3S1RJ 4XN0A 3O0XA 1BZWA 1RGSA 2LSOA 2EIBA 4IRGA 2RKHA 3OYNA 2ZJCA 1HQWA 3PDQA 4HN1A 3EUKL 3K2AA 5LCWL 1S0FA 4HRIA 2CV2A 2C4XA 5HDGA 3ONQA 1A31A 1UMHA 3N97A 5B1BH 1BEV1 3L7WA 5CYVA 1AKHB 4I0BA 3EUAA 2XONA 5FDBA 3PVBB 4X6QB 1V70A 2JE9A 2P4EA 4XIDA 2OVUA 2JDUA 5JDBA 1ACIA 1MKMA 1F43A 2EA7A 2D5VA 4AQ6A 3JD73 1KRIA 4E6KG 3PUHA 4AQTA 4GWNA 3LFUA 3BG7A 3B94A 2E71A 4JAAA 2PA7A 5FR3A 3POBA 1QZZA 4P9UA 3MCZA 4ISRA 5E88A 5CVVA 1ZR4A 1EUTA 2YUEA 4PI0A 1OJLA 5BNNC 2QZ3A 1W28A 3GWZA 1JXNA 1OT5A 4BY1J 1VP6A 1IS4A 2Y2ZA 4XBNA 1OKQA 4YVSB 4ZXEA 3HVDA 1W2UA 3PMSA 1R49A 2HYXA 1PGL1 4UT5A 4O3MA 1XCVA 1PDNC 2AO9A 1R4MB 1V9U3 2VXJA 1XNAA 3OEAA 1TMF1 1QJX3 3QH6A 4KG8A 4W4ZA 3EBRA 1MS8A 1OF3A 2ILMA 2BFUL 2WB1N 1W9SA 5HV4A 4DBQA 3CJTB 5HDNA 4OMYA 4B3XA 3VKMA 2IS2A 4XBLA 2YHJA 1FZPB 3AMHA 2ZXJA 3BOWA 1UX6A 1WMXA 2IFRA 2WZ8A 3AP9A 1JZ8A 3BP8A 2CG4A 3VBSB 4ZTJA 4ET7A 4UVCA 4YZ1A 2G9ZA 1QJY1 1EV12 1YJ9I 3OYDA 3CZUA 2J1EA 5F3IA 3HZJA 1VQ5I 4ABZA 4FASD 1FXZA 2W7NA 4Q5OA 4JTOA 4CDWB 4V1PA 2HWE2 3C2UA 3JRFA 1J83A 1RETA 1IN4A 1XNCA 4NPRA 3H1YA 1TT5B 2D3SA 3VD5A 1H9WA 4JQRA 5FK7A 1DBNA 3LSJA 1JYTA 4HPQA 2WZR3 3K9TA 5GKAC 1EJ9A 2COBA 4XLEA 4RR3A 2XJRA 2J1RA 1L0OC 1MJAA 2VOVA 2L01A 4FI9A 2W5FA 4HVRA 2DK8A 1G9BA 4JC1A 4FPYA 4Z07A 5J40A 4KICA 3WE2A 3WT3A 2Z2SB 2VZ1A 5LBCA 2JG8C 4P9XA 3U37A 3JSOA 4P55A 3ES1A 4MLOA 3RJ2X 3F6OA 4WXCA 1Q3EA 4RFT0 5H9PA 3WF3A 5A3MA 4HA8A 5F0CA 3K77A 2DUPA 2WS93 2JSCA 2FDHA 3GMEA 4Q0SA 2IXIA 4BXFA 3K4MA 2P81A 3H8RA 4JDOA 5KAIC 4Q8LA 3K2OA 4RGXA 4IEXA 4FBFA 4E2SA 1COV1 2ME6A 3ABUA 4GO1A 4D0QA 2PQQA 1JS9A 2P34A 2QM3A 5FZHA 1USSA 1QMJA 2JJ7A 4HX7A 5CFDC 5HLTA 2BW3A 1A35A 1B35B 1YO5C 2Y75A 2H0BA 3OYKA 1LKNA 3AM2A 5H6RA 1C28A 2ENRA 4A4AA 5I0RA 4M3FA 3MI8A 4WVWA 4HG6B 1PK6A 4DXTA 5KXDA 3FBMA 3LWCA 1MACA 2DF7A 5E1ZB 4TLFA 2K2SA 5CB7A 4LHSA 2D5HA 3HPNA 1BMV2 5HS7A 3AJYA 4COWA 2EFPA 3WCRA 2YROA 4Q0PA 1G7YA 1ZQ3P 4H2AA 1O5UA 3SNMA 3KT1A 5AC92 5BPIA 4W50A 4HLYA 2VT3A 3WR0A 3BTYA 1ALYA 4ZYAA 3H0DA 4PCQA 3CJXA 1J75A 3WP4A 3DQVC 1UU6A 1FOD1 3ZXAC 5EJZB 2L9SA 3OY8B 1IN8A 1MBJA 3THTA 1QOOA 3WGIA 1JYXA 2YMZA 3CJNA 2W91A 2W46A 4RGAA 4TN7A 4FPCA 4XORA 2ZSHB 2J1SA 2L3DA 4Z82A 4BK4A 1UOJA 1UWWA 2QKMB 2JIJA 4QKNA 2VUJA 3O1SA 3AVSA 3T2PA 4HBNA 1IQAA 4D6RA 1R9TJ 4JHTA 4Q5SF 5CYYA 2O3FA 2XPJA 1QHGA 5CVIA 3N35A 1X1PA 3BR5A 4NN0A 2DBBA 5H9RA 1YFYA 5KHDA 3DKXA 2BVBA 5CG8A 4FOYA 2M8EA 3PFYA 1F2NA 1HQNA 3MKLA 5ACA2 1WA4A 3H8XA 1TME1 3JD71 5L3CA 2A1XA 2DA7A 1UKGA 3VEPA 1G9AA 4BDZA 4A3IJ 1CZSA 3VBHA 3DGTA 3CP8A 1X82A 4AI3A 4M00A 3WG1A 5AIPA 3ZSKA 2SLIA 1ETKA 3PIOF 1SLAA 4CCOA 1AYM2 1B8IB 3KGZA 3L9JT 1PIV1 1P6RA 2H6CA 3CO7C 1T6BX 3CL1A 1UAIA 2EH3A 2JWTA 1DU0A 4YGCA 3SEZA 3SQNA 4A5MA 3D3AA 1YLLA 3GVAA 2LYCA 1U0AA 2J1TA 5LA0A 4XLHA 4YFKF 3HMYA 4JGZC 4JRLA 3IM0A 3PUBA 2W25A 4E7HA 1Y6IA 3FHNA 4UY8I 2WYFA 3DPRB 2VTFA 3I2JA 2E7TA 3ZMVA 3VHOA 3ZP5A 4D7TA 1N25A 1W5CC 5KAFC 3ZR8X 1K3IA 1S7EA 4EQVA 3HOUJ 2MG4A 3I55I 2SBAA 2DFFA 4PDWA 1I1SA 2ZXWH 3MIHA 1PP7U 2GA2A 4X1EA 4XFGA 1UG2A 3Q0VA 4IV1C 3HT1A 1DQUA 4FQGA 2A73B 2BV4A 1AR91 2CAUA 1HIXA 1PHMA 2X4HA 3HOYJ 4CA9A 1IGNA 2BWCA 1X50A 1ETYA 1QVTA 1W3XA 3C3WA 2HWB2 4R4XA 2E31A 1ZBE3 2AXLA 3EPZA 3SHFA 3HB9A 3PNTA 3SCHA 4XLFA 2W84A 2HWE1 1VLNA 5J3UA 3VL9A 1TTYA 1LOGA 4MEXF 1MZBA 5D5UB 2VQCA 1PK6B 2FD5A 3C2BA 2JKXA 1Z6RA 4XKCA 4JP0A 1FC3A 5A3NA 4R9CA 4A7ZA 4GGGA 3NWKA 1KQ8A 2HWF2 2ZS6B 2CDOA 4PF1A 5JAXA 2VLAA 5CKNA 3AVRA 4Y20A 1Y8RB 3BCAA 5HBAA 3GEZA 1O4ZA 1BBT3 1X19A 4MXVA 1H8VA 2GH8A 3NNMA 4E27A 2BOJA 4L9VA 1GVJA 1G86A 5IP7J 3HBKA 2JPCA 1W6OA 1HRV3 1DP3A 5DABA 3WD5A 4CYCB 3A0NA 2XSJC 4XOPA 4F8AA 4EV0A 3M07A 2JVHA 1UCXA 3D0SA 5JLVA 2PAMA 4NE9A 3E6MA 1OC1A 3VYUB 3U11A 4XBFA 1FAYA 4FQZA 2ZX3A 3M8EA 4Z8BA 3EHKA 2XXZA 4DW6A 4NROA 1KYWA 1CAVB 3N05A 5B66C 1NCQC 1IUFA 1W2OA 3ZFGC 4HKWA 3BTCA 3PSIA 4R9BA 3GZTB 2VQLA 4QLCU 4R8HA 4YRDA 3MUZ1 2JQ7A 1QNWA 1SLLA 2P17A 2LVSA 2PJRA 3JCIA 2WT2A 4C8DA 3LSHA 5ACA3 1J0RA 4BEHB 4C91A 5FCCA 3I5UA 4YARA 2XGEA 2F6BA 5FYHA 4EYUA 1AL23 4EWDA 2ZEXA 2UURA 3DCQA 3RQ0A 4ZKTB 1W8WA 3WNMA 4AE2A 2BJSA 5FP4A 2XAUA 3Q5FA 2E60A 2NM1A 1K78A 3IH2A 2XMLA 1L7RA 2JZYA 3J7HA 2C1FA 3MBWA 4KGQA 2XWJB 2HDCA 5LRRA 3OS0A 2R7EB 3RKWA 3POYA 5T54A 3HJEA 2G9WA 3L2RA 1XQNA 3SDGA 3H3VK 5D8KB 1HB2A 1SACA 2ET7A 2VJJA 2V4JC 2JVGA 4NC8A 5IT3A 3T8TA 4XKWA 1UZVA 1MSFC 3FBIB 2P5KA 4BLJA 3ZKUA 3BKZA 1NA1C 1TT0A 2LMDA 1IG7A 5FAXA 3H9JA 4BYYA 3U9GA 1Z9CA 2FCUA 3IMNA 5LFAA 4RAYA 3LD8A 1PK6C 3S6PA 4FAHA 2W87A 4Z2AA 2DVFA 4QWNA 2HJIA 4N53A 4BM8A 3I7DA 2AUYA 3WXPA 4PJNA 2L9RA 1DQ4A 4ZY9A 4A7KA 1G3WA 1AL22 3H8OA 4QX0A 3ZIWA 1US3A 1AF9A 3V65A 2XSDC 5D6EA 5JZGA 1A78A 2NOGA 3ZR6A 4LO7A 1KU9A 1G3SA 4RAFA 3G1MA 5E18F 1H2KA 3NJXA 2OW4A 3LSPA 1XJAA 2BP6A 1CIYA 4YM3A 1YQ2A 1ETQA 1MBEA 1HSJA 3GLLA 1NTCA 1X9PA 4IVNA 1NCQB 2HWC3 4AVSA 2C5DA 2A6VA 2K0GA 2VQGA 4A0XA 4ARXA 1OH3A 3ETPA 3AB0A 3IUOA 4QTRA 5J09A 1FBQA 2DV9A 1OPOA 3FX3A 4A3KJ 1UW8A 5E6HA 4OHYA 1RUJ1 2DCZA 1YRNB 4OZXA 5FXVA 4FCYA 1V55H 3TB0A 2HI3A 1S2KA 1R1VA 2XR4A 1QF3A 4QDSA 4K8FA 2E1MB 1DGWA 5IY5H 4A3MJ 3ME2A 2K9ZA 3GZ5A 5FGMA 3CC4I 1VMFA 2DBNA 4CO8A 3G6EI 4YFZA 4U36A 3GZUC 1YC61 2Q1MA 3TEXA 1F5FA 2EIGA 3U4XA 3FXRA 2VBDA 2ZGNA 3OR2C 1UU5A 2W3JA 3GHMA 1G9FA 4Y1ZA 1OKOA 3BR6A 1OMIA 1E57A 2VL4A 2TRTA 2VUDA 3H7JA 1OD5A 1Q5OA 1O4YA 3ZSJA 3ZIXA 3BG5A 1UXZA 2VU9A 3KZIC 2WN3A 1NG0A 2Y6LA 1A34A 3KP7A 4AEDB 4UAPA 1A36A 2OTLI 2QDNA 4ZONA 2D5FA 2CW7A 1ZZ8A 1UMQA 4KI5M 2HWE3 3QU3A 1UYXA 4PUSA 4LOCA 1FPN3 1K6OA 2XKPA 2W2IA 2OZUA 1P2FA 1ULEA 2DVAA 2OV7A 5DUVA 1AR81 3ZSEA 1XU1A 3VN4A 1VE0A 1H6XA 4GB33 1NCQA 2VECA 1B35C 2ZACA 2CJJA 2ZBKA 1HQLA 4XRMA 4LFUA 1W6NB 4LBQB 2K9MA 1GLHA 4XM3A 1ULPA 5F5IA 1R6RA 4B4PA 1VBA3 1KQ9A 3BR3A 2RV9A 3PJQA 3WU2C 4ZDLA 3QU6A 2JA6J 3VDDB 1FLIA 3RQIA 2CV1A 1ZKGA 3I71A 3UJOA 1T2XA 4B43A 5FJKA 2FBEA 4II2A 2CGNA 4OAYA 4DS0A 3WF2A 4BBRJ 3SHRA 1BC7C 4IEJA 4ZS2A 2EIJH 5T5JA 2XPUA 5K8SA 3I59B 5A7OA 2ZBJA 4W1UA 2B63J 2ISYA 1GZWB 4BS9A 2K86A 1NUKA 4CP1A 3QPSA 4XNFA 1T33A 4OMDA 4C9YA 1HOMA 3LWFA 2GNMA 1R36A 2WA0A 3S8PA 1DG6A 3CCMI 1PGL2 1W2NA 4GWJA 1NE6A 4JOMA 2CWMA 3AX4A 4LQRA 1EF4A 1QJU2 4G9SB 5JVGF 1YO8A 3I2OA 2CNAA 1RUF1 3LOIA 4D6SA 1YJNI 3U0ZA 3DTEA 2CMPA 3MMYB 2DK5A 3H3ZA 3E0JB 3ASNH 2VVEA 5KBFA 4P1WA 4Y4YA 5JR7B 4OULA 2P3IA 1KYZA 2HKXA 1RPWA 1RUD1 1RXGA 3T2QA 4D3WA 2R1DA 3K1NA 3V0AB 5J96B 3IH3A 3JD72 2QKLB 3GALA 2EVXA 1ENHA 4P9IA 3FISA 2OZJA 4W65A 4LT5A 1JZ3A 2P8TA 1ZG1A 2ZX4A 2QVSB 3LIHA 4YLZA 3RMXA 1RI7A 4TYSA 2L9VA 3T2OA 1LGBA 3V56A 4O5VA 5EEGA 1JMUB 4QKFA 2RR11 4IETA 2VBWA 5CNAA 2XHNA 5AVPA 4RA0A 3QODA 3VDDC 1RITA 2DW4A 3RI9A 2HVRA 2JEMA 1D1AA 2WC2A 2WAQN 1C1FA 2V26A 4YM2A 3D5SC 1VBB2 2K85A 1ERDA 4M9ZA 1J3QA 4CCEA 4NMIA 3G71I 1E5IA 4D69A 1QH6A 1AOYA 2W94A 4YYOA 3GX4X 4AFDA 2F4IA 4M4PA 3QP5A 3WDWA 1EH8A 1CAUA 3H1WA 5JXJA 2JDPA 3MV11 2Y9ZA 3WQBA 1R58A 4XJUA 1BW6A 4OI2A 2VTXJ 1YXWA 4E7KA 2GC1A 4CXWA 3AYAA 2ZGOA 4A42A 1CESA 3PSFA 2CQQA 2VN2A 1RUI3 4HLTA 2X6XA 1U8RA 2EV0A 1LHWA 4BY7J 2ELJA 2L7KA 3IAM2 1ZRIA 4RB1A 1KONA 1UY3A 4FE7A 2N7GA 1D4M1 1OUSA 1JKPC 4UF0A 5EGOB 2ARAA 4XHBA 2XJTA 4IEUA 1Z0HA 1QY4A 4AI8A 3GHNA 3HOXJ 3A23A 2VBPA 1H2MA 3WW1A 1W6QA 1DGWY 5FY1A 3CCUI 2A6XA 2YGMA 1Z91A 4EROA 3VDBA 2ZMNA 3SJMA 3OY8A 1K42A 2GNTA 1XSQA 2XOMA 4M9SA 4LKFA 3AL0B 2D7FA 1RIRA 4IV1A 1QKQA 4YIRX 4O65A 3TN92 3WHTA 1NK2P 2DDBA 1F4KA 1B35A 2CU5A 4LB6B 1F5TA 4CDXB 2EINH 1JU3A 5SV5A 1YX3A 4Y7NJ 2GMMA 1JH5A 2TNFA 1GNHA 1WKMA 5E20A 4BQ1A 3GF2A 4JGZA 1XD7A 2WWUA 2BZTA 2Q4SA 2CYFA 4KBZA 3LAGA 1SDWA 2X10A 3AL6A 1MNDA 2MC4A 3B3QE 3H5RA 4IE6A 2JICA 4NIHA 3K0LA 3WF1A 2VZTA 3L9FA 4NAMA 3MIDA 3PJRA 4CVUA 2IA0A 3OMYA 1J9IA 1GV2A 3SH4A 1W36D 1MJBA 2GP3A 1VRH1 3IKWA 1OOPA 3M3CA 3ZFGB 2NVYJ 1OI6A 2W24A 1LOAA 4MQ9F 2QBYB 3U07A 3EB7A 4GZ9A 4K3UA 1US2A 5FZ3A 4P02B 1YI9A 1JUMA 2BHYA 1HF0A 1MEC2 3K3NA 4NIDA 2JB4A 2BE5F 3S32A 3AZXA 3T0AA 5T5OA 1ULGA 4XSZF 1QJX2 2GMEA 3VKOA 4Q4ZF 2NS8A 3O1OA 3E5UA 5D2AA 3NARA 4UI9L 3MF6A 2MBFA 1JTZX 3MIGA 2GXAA 1F31A 3OGSA 2KLOA 2PMZN 2HWD1 4BQ4A 4FE4A 4IX7A 5BUVA 5IYYA 1WJCA 1FOD2 1JYNA 1MDMB 2YGLA 3LSIA 1OD3A 3BT9A 3ABLH 3TKYA 5EDNA 1SC7A 4I2OA 5EYXA 2G0EA 4IEZA 2HZDA 3CCQI 4A3XA 3OB8A 4QX1A 5FK8A 5FREA 2FEZA 3DWLE 1N1SA 5F7UA 2JMWA 1MDMA 4HSLA 3HQXA 4Y24A 3B5LB 4IOAF 2IT0A 1AX2A 4RGSA 3KX2A 2FDGA 1JT6A 3HKZA 4KMQA 3ZXEA 2DODA 2C26A 2DVBA 4M6VA 3HOTA 2IXLA 1XMXA 3BVCA 1GV5A 5E17F 2AYHA 1PZ7A 4YIIA 4A5NA 5C7GA 1UOFA 5JLXA 2YPJA 3ZN6A 1ZBE2 4H3WA 3DFGA 3ZYHA 3RS6A 3G1OA 2ADDA 1ND3B 3RJPA 2WFPA 4LD5A 1FI2A 4AGVA 2GAUA 3J7MA 3CLQA 2R7VA 2ZJQF 2P6CA 4LK7A 4XONA 3U14A 4ENNA 2JG9B 1W8FA 3H8UA 1DLLA 2PHWA 3MFAA 5FFOC 2DMQA 4D6QA 1ZM1A 4K7JA 1IS3A 1LJ9A 5JPNB 4J25A 2VNOA 4Y15A 5DUIA 3PTYA 4KIBA 3RYPA 3BR2A 2WL1A 3RZDJ 5CKTA 1BR1A 1WH7A 3ZSLA 3WU0A 3ZMUA 3OSFA 2P1BA 1D1CA 1MNMC 2A68F 2HOSA 4BQ3A 2FNAA 2PJRB 1BJZA 1AR82 5FUPA 1A8DA 3WY6A 2KIUA 3KFWX 1U9NA 3RYRA 1GNZA 2D98A 2AS5F 3UL2A 3RZZA 1MEC3 1TMF2 2K3FA 4XZUG 2F4MB 3WW2A 3WF4A 3I59A 1ULCA 2WLQA 4YNIA 2ZABA 4NPLA 2P2KA 2A3XA 3F6VA 4CA0A 1AYM3 3M7AA 5K5RA 5H6QA 3KSCA 2W1SA 1SLIA 5A2QK 2ZMEB 5F3EA 4L5IA 2WNVB 3MQ0A 2PTMA 5FZ0A 3LPGA 2XL7A 3COAC 5C3EJ 2VULA 5J37A 3ST7A 2QQ8A 4CCKA 5FWEA 1X1CA 5L19A 3WW3A 4DYRA 5DUWA 2CW8A 2JUCA 1TWHJ 5AFEA 2A61A 3RJRA 1JZ4A 4AHXA 2Y0SA 3FMSA 4XVHA 3O1PA 4UV9A 3MLLA 1K5JA 1F1ZA 2FCVA 2TBVA 3WX5A 4OHWA 4Y1XA 2D6MA 1NQJA 4RS5C 5JWPA 3DEMA 2K46A 1FWZA 4EEFG 3BCBA 3MPPG 3L2HA 2VB6A 4LJHA 3HAGA 3KZ4C 4BE2A 1UNBA 2L0KA 3CMAI 3A21A 3LPFA 5FJHA 4BH9A 2R6QA 1O3QA 3WDYA 4NR1A 5FYMA 3W3CA 4Z1VA 1UZWA 4BISA 1SDDB 4R1HA 1GFF2 1LB2A 1G8XA 3M3YJ 1RKTA 4QM8A 3TN93 2G4IA 4NHJA 4PF5A 5A6YA 3JRHA 4D8MA 4HNVA 3BN6A 1YRNA 1LNSA 2V4AA 3KCYA 3TEYA 1IW7F 4RGRA 5IK7A 2DTWA 1HJFA 4RR3B 2WAEA 3GJBA 1PO23 4XF9A 2LKPA 3TOAA 1S1AA 2LTNA 4Q4V2 1X4PA 4OI1A 2X1EA 4MGRA 3NQOA 3M1HA 1X58A 4XFAA 3OGGA 2IRFG 4XBQA 1MH3A 2HU9A 4URAA 5BPDA 4CCLA 4ZH4F 4N9HA 4B8EA 1P4AA 2H1LA 4AM3A 5LASA 1ZYBA 3ZN0A 3QPHA 2BVVA 1BIBA 3ZYBA 1RL3A 1GV9A 1ZZ6A 2NMOA 2E53A 4BWOA 4D7MA 3DECA 5CFCB 1OKRA 3MLKA 2VBBA 5BNNA 2VNVA 1U5XA 1GU3A 3C1DA 2M1BA 3K48A 3B9CA 3GUDA 3MIBA 1GZCA 2RHPA 3USUA 4ZU4A 1HB1A 2HBUA 2ZEWA 3K70C 3L00A 4C0HA 2ESNA 3A0BC 2W47A 1RKWA 2D6OX 3R05A 2VQ0A 5LBQA 1DHKB 3KP2A 1WMFA 1WUVA 1AU7A 1D0ZA 1NY71 5C3PA 4JKKA 3C2HA 4BNCA 4G12A 1LKXA 5ICEA 3GFMA 3LSRA 5TGTA 1GHCA 1SFXA 2CSGA 1JKRC 4OU0A 1ODNA 3DPLC 2XROA 2JE7A 3VBFB 2AEZA 2W1WA 3OOPA 3B73A 2R061 3CLPA 3HKZN 3LNQA 5C70A 2VKVA 4ZZLA 5K7ZA 2QYOA 4MOAA 3TGNA 2H27A 3CTAA 1RUH1 1GUUA 3KLNA 1TQMA 4HETA 2R0QC 5J98B 5E79C 4FXKB 3JSPA 4K20A 4AZZA 5F39A 2A3WA 3VZKA 2QCOA 3ZQ7A 2VM9A 3VKNA 1R22A 4ZHNA 2QQJA 3B02A 4XE9A 1FOYA 1AYN1 1JHNA 3BB6A 3I4MJ 1AR63 2P6SA 2DJNA 4QKDA 3Q8EA 5JZGB 2XRLA 3U21A 3IL2A 3DEEA 5JSPA 2YPRA 2D45A 4RS8A 4ZPIA 1ND2A 4DIQA 4XRFA 4LO4B 2JDHA 1N3QA 3GZEA 4XQDA 4AEMA 3S2DJ 2VMGA 1MBHA 4KDPA 4PFOA 3UT0A 2HWD2 4CXYA 2WY8Q 1KU7A 2OQRA 4XKVA 1L3JA 5KHGA 5DCMB 4FPOB 3JRAA 3DU5A 2G1MA 3O6BB 3POEA 1QQP2 5FKLA 1WJ5A 1AX0A 2QA4I 1JHFA 3MW2A 2ZNYA 4X0GA 1L7LA 2HLEA 1LHUA 3SKVA 4KUMA 4QB6A 3KF3A 1UY1A 1PVXA 4P9FA 1O7LA 4YFWA 4ETSA 1YI7A 2YB7A 4W8JA 4DOZA 4BQAA 4UFIA 3C7FA 1V5FA 2W52A 2Z4FA 1C8M2 2ZJ2A 1IN7A 3HDDA 1QJY2 1JYIA 2X8KA 2KZVA 1HRI1 1BK0A 4ZS3A 1S7AA 1OURA 4UFJA 3MFCA 5KK1A 3VYRB 2JG8A 2IPQX 1MZ5A 3FHIB 5FYZA 3MN2A 5E3LA 4EJRA 1PX4A 5FPBA 1Q56A 2R7OA 1FPN2 3P6BA 3EDPA 1R5ID 3RCOA 3SEQA 4ONUA 1RUNA 2X51A 5GP9A 2R4GA 4AIHA 4JDMA 2O6GE 4LO8A 3QRFF 3BTAA 3KETA 5HLGA 4LIVA 1W3VA 2MEV2 5HNFA 2DA3A 1XG1A 3KMHA 2L9NA 1UG0A 1PJRA 4ASLA 4FFHA 1FV3A 4QDRA 1UAAA 4M71A 1T8IA 4IGPA 1JUPA 2NNNA 3N9OA 3KIOA 1WCKA 2XLFA 3LOCA 4K8RB 2WBMA 3JTGA 3LDRA 4ITVA 1G2HA 2P3YA 5IVCA 4XR6A 4FP2A 2FQPA 3AP7A 5D8AB 5FYVA 1EA3A 1YNAA 1C1LA 1ZX5A 2Y60A 4LLLA 1KDMA 3WQ7A 4FPLA 5E1RA 1GQGA 4RR3C 3WV6A 1ND3A 1FX5A 2R5ZB 2VC9A 3BOPA 3OBZA 1NA1A 4MGSA 2BNNA 4F52A 2ZXHA 1SMYF 2BBVA 2L2OA 3WOGA 2F48A 3NQHA 3GFLA 3FXKA 5I8SA 4O9EA 4FX4A 1IKPA 2HVSA 1J2XA 5FMDA 2V7FA 3GJAA 5J3LA 2A6HF 2A07F 1XNKA 1VMHA 4CU8A 1VBA1 1HXDA 4A0YA 1R1UA 4XETA 2R7FA 3FXLA 3T09A 3OS2A 3S17J 4HSRA 5BNGA 4JRAA 4JQTA 3RZMA 2EXKA 4EATA 1UHWA 4WM8B 3T08A 5HI0A 4I76A 5FZLA 4BK5A 4B3NA 2VJ4A 3LOBA 5HXVA 2ERFA 1W6MB 1YS7A 2RNGA 1Y0UA 2JA5J 2IGNA 3ULQB 1KJRA 5LGNA 4A93J 3OEBA 4LE3A 4LJZF 1OLME 1R1ZA 2B7YA 3CJIA 1DZQA 4N53C 2WA3A 3P5JA 3VKFC 1AL0G 2IVIB 1PMHX 4QXCA 5IT6A 2YFUA 5FO5A 3MEXA 3F22A 1HW2A 1X1AA 3RTRA 2P7CB 1SG3A 4AU7A 2FBIA 2VBYA 1W90A 2E51A 3FZVA 1UKRA 1RB8G 5C3QA 4KG0A 5BYNA 1CQTA 2E5NA 3IWZA 4IV3A 1NE4A 1EAH3 3NL1A 4HPKB 4XAAA 2YBSA 4BE0A 5JHFA 2Q8CA 5FKBA 1GVDA 2RM21 1W6QB 2DQLA 3EMRA 4DZJA 3EYYA 1T98A 4P9WA 2E1NA 4GWMA 1WJBA 3ATGA 1RUH3 4KN4X 3D5OA 4YRVA 4DNCA 2JECA 1OVSA 4IEOA 3K4ZA 5GZEA 3ABZA 4HLXA 3JRDA 1FYKA 2CL2A 3VHPA 1VRBA 1ZVFA 3F8BA 3IDCB 3DBRB 3V4GA 4GFBA 2J7MA 5JPMB 1YOVB 3M1CA 2ELKA 4XLNF 5I93A 3FHZA 1E17A 5IAVA 4CSWA 3NNFA 1B59A 2ARCA 5ILSA 4A3JJ 4LG0A 1KS4A 3VODA 2XAJA 5ANQA 2BBYA 4JGYB 1S6LA 3IV5A 1X3ZB 4XMYA 3DXUA 2V09A 3WNPA 3O1RA 1FSHA 1STMA 3D6EA 4YSFA 2VCAA 1OLTA 3V64A 3A0HC 1V6IA 2EXIA 1K5MA 2D1VA 4LUKA 1LAJA 2DTYA 1PGW2 5I0DA 1RNLA 1KEXA 5KHJA 3K4NA 1UY2A 3IWFA 3IAS2 2V9KA 4NC7A 4YM1A 3W5NA 5IW0A 4LLNA 1ZTRA 2PYTA 2K9SA 2VQTA 3N7KA 2DTZA 1W0TA 3S5AA 1OCPA 1LDJA 2W82A 1VFCA 1H4HA 5A33A 2VPVA 3RI4A 3EETA 3OPZA 4KQ7A 5JI7A 3HSRA 4IGOA 1WI3A 2STTA 3CU7A 3OYGA 3CO2A 1VQ6I 5FZDA 4A3DJ 5FPUA 1TWGJ 4Y4RA 1T6GC 4QHZA 1PX3A 4MZUA 3M3EA 5IVYA 4QAWA 4AVPA 1VMJA 1G9DA 3BPSA 1HKDA 2W1UA 1Z7S1 2WQ4A 2QQUA 4PGGA 3UR3C 5K9YA 4A3GJ 4CRQA 5L3DA 5CLSA 3TP0A 3EJKA 3FWEA 2FMYA 2RR12 3ABKH 5H9QA 1DQ6A 2V1DA 2RS11 3FXUA 1S29A 2QQLA 2KRCA 4HONA 1WJEA 3J8F3 2OXBA 3DLLF 5DUKA 3FHAA 2BXZA 4HNTA 4II3A 1WKYA 4YVWB 2Q30A 4UW4A 1XGMA 5IVEA 2IW5A 4B1RA 1NOVA 3WTWC 5FZGA 5FIXA 4GAZA 3ZFFB 5F6FA 2KKOA 3PLQA 1U5YA 2OUHA 2WT0A 5A80A 3F8CA 1TEIA 4G7OF 2R7UA 2DWRA 2X5IC 3ALQA 2WBKA 2F5EA 4R79A 5E1WA 1UHSA 3H3UA 2RDQA 4MG2A 3VDDA 4LK1F 3NV1A 2FSWA 4BKXA 3VB2A 5D8LB 1B4AA 3HPHA 3WU1B 1P4WA 2BBAA 2IXKA 4XOTA 1JHJA 1VBE1 1D3YA 5FROA 2R0HA 3JQXA 4C2UA 4IEPA 1W2TA 3QCWA 1D4M2 3JBG1 1YCIA 1N1YA 1OA2A 5CKQA 4GMP3 1YWKA 2KT0A 4UB6C 4YVSA 2ECBA 3VD9A 2QLZA 1E3PA 1WSUA 1WCSA 5I8YA 2LOOA 3ON7A 3SLIA 5EFUA 3ECHA 2EFQA 3LA3A 3WTUC 4OHVA 3DKWA 1GWLA 2A3YA 5DCMA 5FYIA 4KJZA 5C9AC 1KXGA 1S7OA 2EZLA 2F5DA 2JPBA 1VBD3 1I5PA 1Z7S2 2UY9A 3FJSA 3H5NA 3OTFA 2ZAHA 4PCRA 2X29A 4LBQD 2C0ZA 2FBKA 1REFA 2M9HA 2B46X 4H14A 3N4MA 4FXGB 1VBA2 2R5ZA 1DGRN 2CGOA 4IEQA 2VO5A 1UFMA 4CEYB 5JCTA 3KE2A 3FKJA 3J7AO 3LSTA 3AMNA 5E3NA 1Y1WJ 3H92A 1G6NA 2ID4A 2ZGPA 5A2QZ 2QDRA 5F64A 3NAPC 4WVMB 1XYNA 1T39A 4BDYA 1HV1A 3DKQA 4QX2A 3TO7A 2O7OA 3LEGA 3OY9A 4UFLA 4KN7X 4FFFA 5FOJB 4Y5TA 4Y26A 1FTZA 5L7OC 3E5QA 1P4XA 1JOPA 1I39A 2FXAA 3BC8A 1COV2 5FUNA 1I6XA 1CF7B 4DY5A 3AKRA 4DEVA 3H50A 4BB3A 3L2CA 1WJAA 3OBRA 4W6YA 1J09A 2CGPA 5L73A 2HEVF 1G9CA 2LDUA 4I01A 1GQPA 5LWBA 1WLCA 3M8FA 3OYBA 3UKGA 3HQUA 4QSHA 3WE3A 1ULYA 5FZBA 3JZVA 3DV8A 4D7YA 5DDJ3 1NKGA 1ZHFA 1W99A 3T3YA 3GF6A 1R1A2 1QXPA 1EAH1 2DCKA 1VQPI 4QPWA 2M2EA 2ZNZA 1AZDA 4XIKA 4B4CA 2WO1A 3GW2A 1K4TA 2RJLA 4XC9A 4PSXA 4IGQA 3OUIA 4M4RA 3KHBA 1Z78A 2E1OA 2Q8OA 5LD2C 5DUUA 3J8F2 3IZOA 1F5JA 2PELA 1UOBA 2N8GA 2IEKA 2YDEA 1W36C 3MIFA 2BGPA 4C1WA 4BGDA 4IW3A 5IP9J 2E33A 5AIQA 5IYBJ 1Z7UA 1E0EA 3D4KA 5FP3A 1R083 3M70A 1QHDA 1BXHA 3UJQA 1QBJA 3I4PA 3MWMA 4IEVA 2HZTA 4KGGA 3LAJA 4F92B 4BQ2A 3MHZA 1HDKA 1F36A 3VD4A 2IXHA 2JA8J 5L7OB 4Q4X3 4QHOA 1PZ8A 1PUFA 4ZJZA 2M0MA 1KGSA 2BGOA 4AFCA 1D4VB 1YFXA 2W57A 2AHQA 4NVPA 4CZCA 4BUPA 4GJZA 4IQPA 3IRRA 2W00A 1JZ7A 2NS7A 2BOLA 5CFDA 2TCTA 3ZMZA 1I6HJ 1PMJX 4CZZA 5DD4A 4IESA 5IUQA 5LB6A 3ZPOA 1K6YA 1ZLKA 1FJLA 3PQJA 3DN7A 4XDPA 3BYWA 4KYWA 3N36A 1ENRA 2MH9A 4MGZE 1TWCJ 2J22A 2PFWA 2QQAA 3FK6A 1J3RA 5HODA 1IOAA 1S0CA 3TW6A 3HL2A 2EFWA 2VMFA 1RR8C 4L18B 3NWTA 2WJSA 1TC3C 4LPLA 4PFPA 1G3TA 1A6QA 1P9QC 3HRUA 3HOWJ 3LEKA 3P3NA 5C33A 4MADA 3V8KA 2WFF1 3GLXA 4EZHA 2UYAA 5KWRA 1MMAA 4BHPA 5ABJA 1RVF1 5CVJA 4LTAA 4H0EA 1QRYA 3LB9A 1W8UA 4MGQA 1K61A 1WMDA 3KP4A 2P3KA 1Y4WA 2OU2A 1GQHA 2JUGA 4GCVA 3WTVC 1CAXA 5FY5A 1UX7A 5AC93 2DCTA 4OIOF 3ZR5A 1HJGA 1R093 1BMV1 2STWA 1LDDA 1MW7A 3GZ6A 2NZ9A 2F17A 1D5YA 1JBCA 3IMMA 1W1WE 2R32A 3RNSA 5GM0A 4O61A 5C5UA 1TW3A 3ML6A 3VZNA 2VXRA 3MW3A 2VI6A 4N8MA 2B9UA 1ZBA2 2ARXA 3AFHA 3TNPB 2W1QA 2JG8B 2FA5A 4TXWA 4U0VA 2BYVE 2WDBA 4CUCA 1H0MA 5FPXA 5ANNA 4FFGA 1T6SA 3MV01 4QU2A 3VBOB 3M7GA 3RFRA 3DLAA 3HG9A 3F95A 3BZCA 1UYZA 1VAKA 3FUOA 2CO5A 3CDLA 4PDWC 4Q4X1 2PHDA 1VQNI 4LMFA 2RJ2A 3ZYGA 5M3FJ 1C5HA 1KDKA 4LKSA 5HS9A 4L9BA 2VUAA 3LSMA 2F5CA 1REPC 3BU7A 4LEJA 5BNPA 2WUHA 3C7OA 3CJQB 5E16A 5FZ7A 1EP0A 2HQ5A 2JG9C 4OI0A 5DDGA 4HXCA 4I7HA 3ITQA 5C4JJ 1J3PA 1OFSA 2O61A 1R23A 3CCLI 4JKMA 2V1NA 4HG2A 2HWB1 2KHMA 1PNFA 4MGYE 4KWUA 2GLOA 2QQKA 4QXBA 3ENRA 1XOYA 1VBE3 2R042 4XF3A 4B1LA 1XBFA 2QQPA 3X29B 1POV3 4JK1X 2DA2A 1YE9A 2NVUB 1HB4A 5DAWA 4NO4A 1B6AA 4E8CA 3VBHC 2CWSA 4ESBA 3PQKA 1KFXL 4FETA 1RMU3 3Q9OA 1KU3A 4MQVA 3VWBA 3W2AA 5B4NA 1UZYA 3SQOA 4E70A 2ZKLA 1FYUA 4CH7A 3LQCA 5GZFA 1AR72 5A1FA 5E89A 3M2MA 3R61A 2ZMEC 4PIYA 1A3KA 4M3DA 4Q2FA 3W59A 4JV4A 2ZC2A 4IV3B 2W92A 5FFXA 3OUJA 3ZXGA 1UF2C 2P6TA 1UYYA 3VBOC 3LQRA 2B4KA 1WPKA 3TN91 3O5SA 1JJ6C 4K1YA 1S0GA 1YFWA 1FIAA 3GCMA 2BDRA 3H9AA 4IL7A 5EG0B 2BY2A 3CBNA 1ODDA 2JE8A 3LMMA 4Y5Z0 1COV3 2ZCWA 4CYCA 2AH2A 1FMD2 2LW8A 2A6TA 3CUQB 3G4SI 5GJ6A 3KCCA 2DUQA 1VBE2 4NRMA 3IIIA 4XF1A 4ISQA 5KVRA 2HYJA 5EIYB 1VBC3 4XXAA 4UW6A 5GZGA 3C7JA 4DXZA 2XPWA 1V6MA 3HNMA 5IVJA 4IPAA 1O8PA 2R0FA 3F8FA 3RZKA 5SV8A 4EN8B 1AKHA 5F5AA 1HXS2 3ZQHA 2FE3A 4N43B 4HSTA 3A01A 3FDYA 2D6NA 3QLQA 1ETVA 1RUC2 2E19A 2ARBA 4YEJA 1X1BA 1WGXA 2B39A 4BQXA 2NMNA 3HRTA 1CAVA 5FLJA 2EA4A 3WTXC 3ZOBA 1DPRA 2QQWA 3ISPA 1RIOH 1ZYRF 1TQ5A 1YQ5A 1J1LA 1CR7A 2OA2A 4AEDC 1BM9A 4BQYA 2BY1A 5BNOB 1Z21A 2ZJPF 5L9RA 2IGKA 5J4YA 4L11A 2CQKA 3WZ1A 3WG9A 2FBHA 2EZHA 1IUYA 2ZO4A 2J1VA 2RDPA 2RDNA 1EV11 5D1IA 2LH9A 1NLQA 1IV6A 4A6SA 1QJZA 4XQWA 4JDNA 5E3OA 3SEEA 3VKLA 1U5TC 3SMHA 1QU0A 4IJAA 1UPIA 2YYOA 1KFUL 1MS5A 4UFMA 1XB4A 1KU2A 1W0NA 3WP6A 3PFIA 1JTXA 1KS5A 1R092 3EO6A 3KZZA 1UU4A 1R1A1 3V0AA 4L9TA 4XPVA 3H0OA 3CCVI 2WT1A 2XIGA 4LE4A 4A6OA 4GH4C 1M06G 3RZOJ 3DEUA 1KQRA 4AIJA 3Q8FA 1QJU1 2PHXA 4ARYA 1LULA 3HHGA 1JZ5A 4P5YA 3AKQA 4U88A 4NUBA 4A41A 2JIGA 3FE5A 3OIPA 2LNBA 5BS6A 4N4NB 5EEAA 3V7SA 2EQRA 5LA9A 4CP0A 3GTKJ 2G7UA 4UVAA 4P5OA 2ES3A 2ZZJA 2PX9A 2CW0F 1R5HA 2FOWA 2GOXB 1YIFA 4HFSA 3HNYM 1N78A 3SDBA 1EAH2 3GBWA 4DNYA 4EN7B 1SD7A 1W4MA 3NRUA 4QPOA 3LCPA 1K4SA 1N3OA 5FZ1A 3DCFA 4FTHA 3POIA 5DTDA 4YW3A 5C6CA 3ZFEC 4P9JA 2PQ8A 3OOUA 5IHRA 1IRXA 1R64A 2K5CA 3KB5A 3RQ4A 1PVC3 1ZK8A 4IE7A 3RSJA 3HQRA 3ELNA 1R091 2CYYA 5D4SA 3GCWA 4KITB 2R3SA 1Y43B 3UGHA 2IVJA 1ETOA 1U5IA 4LIUA 1D2QA 3OYLA 1ODMA 5FYBA 3BJOA 3CDIA 3OYEA 4KIFA 3IAQA 4LHLA 1GZWA 4DINB 1TL8A 3K4LA 2NS0A 3QOPA 2KMUA 3ZCOA 3P1IA 4FISA 2QZ8A 5FZFA 3FLTA 3A02A 1JT0A 2Q1FA 5G04L 4DFSA 3WTZA 4HPKA 4DMIA 4IERA 2O0YA 1GWMA 3VBSC 4AR2A 2YS9A 2AREA 4QB1A 3ZM8A 2E2JJ 2DVGA 1BI2A 5FOBB 3TQNA 2C6SA 2YPDA 2XBO3 3JUUA 4ENKA 1SLBA 4MYEA 2O8QA 2VONA 5A33B 2XJUA 3PO3J 5CVUA 2VPLA 2MH2A 4PJ0C 5DAPA 1V6OA 4RQPA 1E3OC 3RZLA 4AHZA 4BQ5A 1LHNA 2DA6A 3ZXLA 4AAPA 1IO2A 2DPUA 3WNKA 5KR7A 2DPDA 4CCJA 5BPXA 2UYBA 1AYM1 3IPVA 1VBB1 4UW3A 3AKPA 2WNUA 4CICA 4N7UA 4BIFA 2DT6A 2LRDA 2KJBA 3CO6C 1OQDA 2ISZA 1DP0A 3ZFEB 2ZHMA 4Y33A 2WABA 3V0BB 3DP7A 3N9NA 3S1NJ 1EV13 2VZ3A 1LHVA 2E34A 3E6DA 3TDUC 3AP6A 2WNUB 4BE1A 5IOZA 1UZCA 4XFBA 3WNLA 3AMQA 2QNKA 5FBZA 3UGGA 1WQ2A 3R4DB 3ECOA 2J42A 1GP5A 3MUY1 4XACA 1L7QA 4YZ4A 4ZYDA 1A6IA 4HT1T 2LKSA 1XX5A 1PIV2 4L0ZB 2ZX0A 2C9AA 3OF1A 2ZGMA 2F5FA 5LRSA 1OFNA 1IV8A 4ZXKA 3SITA 3PL0A 1FMD1 5K0UB 4LORA 1HC8A 3RZJA 3I64A 2A5WA 4DOUA 2JJ6A 3UESA 1B72A 2KM2A 2YR2A 4RSUA 5DUXA 1OCTC 1QVUA 2K40A 1ON1A 2XQRA 5LW9A 3WF0A 4DXSA 4P96A 2X0LA 1QHHD 4NQWB 1B72B 4QGMA 1R00A 1YITI 5FZ8A 1W9TA 2HOEA 4YVWC 1XMAA 5EHDA 2EZIA 2J1AA 1JU4A 3FC0A 5A7WA 4XLCA 2UUZA 1SANA 2P5LC 5DM7F 5FLXK 3WLUA 3GCXA 4IE0A 4C90A 3S3MA 3HOSA 1IKQA 2Y38A 2VL8A 2EIEA 2ORZA 2CH0A 1OR7C 2RAEA 2J1UA 1AWCA 5A3LA 5TSWA 3J26N 2PMHA 3A7QA 4IO9F 2GC3A 2K27A 3R0AA 3U75A 1OYYA 1N47A 1QJX1 4UUTA 4NHMA 2Y64A 1MJ9A 3OYCA 3H35A 1OPMA 5A3UA 4B4RA 3AG1H 5DQ0A 3AP4A 2O8OA 2VOTA 5DV5A 4N53B 5HOOA 5IATA 2DU0A 3GYDA 2NVQJ 1MVEA 3K4JA 1BEV3 4H7LA 4LXLA 3PUAA 4OMZA 1HRV1 1T38A 1UD1A 4AVAA 2ZX1A 4LITA 2C24A 2DJIA 5GAHJ 1BOAA 4PZJA 2EAKA 2WO7A 3Q8CA 2R5YA 2AC1A 4IXAA 3V7CA 1VNDA 2CAVA 3F0CA 3RVHA 3DYOA 3PTRB 3D5LA 2J5PA 5CU1A 1ETWA 2GA1A 2RDSA 4DUVA 5FZCA 1RUD3 5C8CA 3USUB 4I3PA 5EZHA 4M9XA 3VPRA 1VBC1 5EG0A 2XJQA 5JSOA 2DMNA 5K7PA 1UCRA 3BIEA 1BCXA 1H4GA 1VBD1 1NQDA 1BLZA 2AENA 2DDUA 1JJ8C 4AFMA 3PJYA 4OVEA 4LA2A 5IFTA 3NVCA 4BAYA 5FJ8J 2K3PA 5FZEA 3HOVJ 5FQ0A 5FUIA 4QQPA 2XDVA 1TZLA 2HEOA 4WV8A 2Z42A 2VMCA 4AOCA 4XF4A 1WBLA 1BJAA 2DFHA 1OCOH 2ADUA 3R0JA 2FRHA 1NT0A 4KMFA 3I8TA 1PIV3 4HQEA 1NH3A 4LKEA 4BOWA 3M3QA 3HTUA 5DM6F 5KHIA 1DCSA 3ETQA 5JR3A 2VQAA 4YW2A 5JHUA 1WD4A 1B9MA 4HF1A 1CZVA 2HXOA 4PLMA 2EAAA 4XFHA 1S2BA 4RAZA 2VMEA 1HDPA 4HVOA 2XV4S 2RNJA 5IOYA 3W6KB 3J7ZI 4KBBA 1FYMA 4MNUA 4A0ZA 1I1EA 2EFNA 4G4FA 2YBKA 1EY2A 4LBLA 4N9IA 2ZGTA 1BI1A 2QQOA 3I9V2 1JZ6A 3ZXKA 1SVOA 1OLQA 1RYYA 4XYXA 4B4QA 2X6OA 2V1XA 5FQ0B 2UXNA 3EXUA 3IH4A 2Y69H 3EUHC 2R7SA 3KF5A 3VDAA 1LNWA 1NCRC 2PG4A 1IDYA 1O8SA 2W08A 2VNGA 3BPXA 3LZZA 2C6YA 2E36A 3DXJF 2WSUA 4Y52J 1S72I 1QIQA 1BK1A 4N4OB 5LHIA 4CDXA 2ZZQA 1IPJA 2I07B 1FYLA 4HV5A 2HEWF 2I8DA 1W0PA 1S0IA 1ZN2A 1RESA 3O8GA 5ERLA 4HX8A 3ECQA 5FRNA 4B1MA 2QGUA 5FZIA 4DB5A 3PUQA 2WRAA 2Y0IA 4XQ4A 2LF7A 4OFGA 4AVCA 4OYUA 1RUC3 2HYKA 4XL9A 3A0KA 5I91A 2K4BA 3N7LA 2GMPA 3RG0A 4U0WA 2XVGA 2P7VB 3F2ZA 4I99C 5F08A 1YQAA 3JRIA 2X09A 4XCAA 3CD6I 1ACCA 5JVTA 1XGOA 1QGPA 4AHYA 4QM9A 3CNAA 3REOA 5HPOA 3SH3A 5FB2A 1O3RA 1CZTA 1VBC2 4TTGA 2Q8DA 1DGRM 3TP3A 2C9KA 3BJ6A 2Y0MA 4WK8F 2XF6A 4FPEA 4AVTA 3MGUA 4XUTA 1AR83 4LA3A 2R7XA 4META 3TEZA 1FPN1 2CFOA 4ZDPA 2NOJB 3N9PA 2WFF3 4HW0A 1FMWA 4MH0E 2A7AA 5AONA 5EQUA 2W9XA 1V54H 3L2YA 5D5XB 3NKTA 1S9HA 4MXWB 4HL0A 1OA3A 4QX3A 2OPKA 2FJ1A 3RRDA 1I3QJ 1IS6A 4HYEA 1I5ZA 4G6DA 1B1BA 5M5WJ 5D6FA 1SMTA 5HNHA 5FPZA 2XUBA 4LLGF 4Q1PA 1P7JA 4Q4V3 3W2VA 4CP9B 5GLVA 3WG2A 2LG4A 1UYPA 3B6CA 1RMU2 2JD4A 1XRUA 3L2QA 5FKCA 1T0FA 4DBRA 4MX3A 1NCRB 2XL9A 2KRFA 5D5WB 3O7OA 3AXDA 3H7YA 3WHUA 2WZR1 2LY2A 2GN7A 3I3QA 1LU1A 2WYSA 4QGLA 3HC7A 2J5OA 2E5ZA 4WXHA 2IGMA 4G6TB 3J80K 3NV3A 4BQWA 4CDGA 1EPZA 1FBUA 1ZLJA 3OBTA 4COUA 3GTOJ 5JOXA 3ZXJA 3P5BA 3ZDSA 2YU9J 2WO2A 1ULFA 2QQ9A 1CJPA 1S0BA 5C3OA 2P0WA 3PMEA 2W4SA 2ZPXA 3B00A 3I0TA 4Y1YA 4A6DA 5I0UA 1LOEA 3S3NA 2UWMA 1PM4A 2XQXA 1YRZA 5LEJA 4CCMA 4X8NA 3V8JA 2VKHA 1YYNA 2AQEA 3VBFC 4CPBD 3LKJA 1SAUA 1VRH2 1EYBA 1BR4A 1ZBE1 4AWDA 2YBPA 5FZAA 1A5JA 3AZYA 3ASOH 3KP6A 3I2GA 3DF8A 4LB5A 4A44A 3URFA 1H88C 3MAJA 1XE0A 1YEWA 4KU8A 1SFNA 1Z1DA 4M3GA 4J01A 1LOBA 1NAEA 3POGA 5E3MA 3K4AA 4XJ8A 1VBD2 4NRPA 2OKXA 5ILUA 1JUHA 1S55A 5T5LA 1P92A 4ITCA 3HN3A 5LBBA 3A22A 3TO9A 3AG2H 3OOXA 1W06A 1MS9A 3IB3A 3BJAA 4Q48A 2DVDA 1UIJA 2G9GA 4CE8A 3VV1A 4YG6A 4JBAA 2NRAC 4N7IA 1Y8QB 3ZN4A 1RMU1 1D4M3 4M6YA 3ZFFC 4B09A 4QPIB 1W8ZA 1V9U1 3TWIA 5D21A 4QB2A 2A6EF 2OC6A 3AKSA 5CPRB 4S2FA 2XGCA 4CEWC 3OSDA 3OWTA 1LFUP 5GADJ 3HWJA 1WJFA 3ZVXA 5K7HA 4NHXA 5A7NA 1W7PA 5I8TA 2WY7Q 3BG6A 1K79A 1UPSA 2Z5WA 4ATEA 3APBA 3F8NA 2EV5A 4IHXA 2MLKA 2H09A 4PIZA 2IP2A 4UNOA 5F3CA 1HRI2 1HQCA 1HCRA 1ONAA 1Z0XA 4YIFA 4E4ZA 1QPMA 5FZ4A 4ANJA 1TME3 2JT1A 3ZYPA 1Z6TA 1TP4A 5EZWA 1IRFA 3CP2A 1HB3A 2P5BA 3NO8A 1LFBA 2Q8KA 4R9DA 2E7AA 5FY9A 5B3SH 1ENQA 3R4KA 3MIEA 1W6PB 5K0UA 2QQNA 4UFKA 1MMDA 2WWJA 2FQ4A 3RIRA 3T1BA 1FV2A 2GH2A 3AP5A 2D3RA 2UWAA 1NHAA 5FXWA 3KM5A 3ZN1A 5EYYA 5DD8A 4N90A 5D5VB 3HRSA 1MD0A 2ZHKA 4ATFA 2G19A 1XXNA 2ZAAA 4JVAA 4H4KC 3TMOA 2QUFA 3NWSA 5B4XA 1G8WA 5ABJB 3HSEA 1LENA 1IC8A 4C3HJ 4XFCA 2OD5A 1POQA 2RS52 4HF0A 2PMZA 2PAKA 3ZKYA 2E2HJ 2I5UA 3I3BA 2K9LA 3HUGA 4Q1RA 3LEIA 1OLMA 1EPWA 3BDDA 2VKEA 2YUSA 2VD7A 2HWC2 6PAXA 4OUSA 4DQ2A 5CA6A 3IDAA 3U4SA 2QKDA 4L8QA 2D40A 4COZA 1SFKA 5A3OA 3U1DA 1BQPA 5DXDA 4XMIA 4V2GA 4WM7C 2XKOA 2M4GA 1UO9A 1QJEA 1YIJI 1IDZA 1U5TB 4EQQA 1LOFC 3AXEA 4E7JA 1VAMA 5FP8A 1TW2A 4A3EJ 3JRBA 1Y7BA 1J58A 4EWAA 2DA1A 2W95A 4XILA 3BG9A 4G7ZF 2WNVC 2O8XA 2ZKZA 3N7JA 4EJOA 5K1YA 1X33A 1YJKA 1RUF3 4XHXA 4LMYA 5GPCA 3VZLA 4DXRA 4UF0B 2IXSA 2VPRA 2NQYA 3VUOA 2EIMH 1ZNPA 1UXXX 3ACIA 4CDWC 2PMWB 2M3AA 2MABA 5F04A 2BUKA 3HHHA 3LF7A 4NWVA 3KP3A 5I0SA 4DPNA 4AI9A 4MGTA 3S5QA 4DZGA 1OA4A 3R0RA 4XLPF 4QQOA 1WLWA 2R93J 3D1NI 3ACLA 4L9JA 1BJQA 1I3HA 3TNQA 3M3OA 2E1MC 3ZN6B 1IN6A 2XVCA 3Q3SA 4IE4A 1C0WA 2PEXA 1D2SA 4EWEA 1FOWA 2E7WA 3KV4A 4AQSA 1LPQA 2FDJA 2VR4A 4LBKA 1VB2A 1RTVA 3ZQIA 1TZOA 1C8M1 4RB2C 3ZMNA 2HYGD 3K70D 4QD2A 4OUMA 4A2UA 4D0PA 1WMEA 1Y9GA 2ZJRF 1YFHA 3GBGA 4BL0B 1GICA 1REEA 4YZ5A 3ROUA 2E1CA 2JA2A 2NAZA 3FBNB 5F3GA 1ZA7A 2BU9A 1YYVA 3I2DA 4Y20B 4OWRB 3L09A 3KVAA 3C7GA 3TOJA 3GXUA 4Y1UA 4O9GA 3FF5A 4BMBA 2WZEA 4O6JA 1W9YA 3QP6A 3TBDA 3G3ZA 2GZWA 1PMIA 1DUXC 4XFFA 5EF6A 2VCCA 2MSYA 3BR0A 1RHI1 4FOVA 3O14A 4GDFA 2X53S 2ZHLA 3K4CA 5FLHA 1HX6A 1GBGA 3K4BA 2B5HA 3WDVA 2V5DA 4FPJA 3VBUB 3ZQFA 4BJ5C 1ITYA 1U0JA 1PVC1 2EXHA 3SCFA 1P7IA 2JSPA 4DZPA 4MVTA 1GXPA 2XJPA 5HCHA 4LGWA 2D1HA 3WG7H 4OCTA 2JWPA 2OA4A 4LBJA 3N7MA 3AL0C 2ZGSA 2R7RA 1K83J 2LBFA 4OLLA 3ZOIA 1H9GA 4JGYC 4V2WA 2Z33A 3RWNA 2KQRA 5CQEA 1ZGJA 1VBB3 2R062 4QPIC 4DO0A 3CUQA 3ZMOA 1ZZCA 2JDAA 2VOOA 5J1UA 1RUE2 4HBLA 5IP6A 3LSEA 5ICFA 3ELKA 1H1MA 4YG0A 4EM2A 2CWEA 2R071 3VHRA 3NNJA 1D0YA 1VAVA 4C30A 4Q4Y2 2IVMA 4CEYC 1GZTA 1EH6A 1RXFA 3HBZA 1RZ4A 4P08A 4CUAA 3B9IA 5CG9A