3HIFA

The crystal structure of apo wild type cap at 3.6 a resolution.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
201
structure length
199
Chain Sequence
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of apo-CAP reveals that large conformational changes are necessary for DNA binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords Catabolite gene activator
total genus 51
structure length 199
sequence length 201
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hifA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hifA01
3IKVA 3GX4X 1G3TA 4L9JA 1KU3A 4XFIA 3NQOA 2FF4A 2XL9A 4LB6B 4BQAA 3M7GA 4EROA 1OYYA 3FHIB 4KU7A 3S2WA 4L0ZB 5L3FA 5I0UA 1LDKB 3QPHA 2DQRA 3EDPA 4M6YA 2IJLA 4U0VA 1YFHA 1J59A 4N9IA 5E16A 3RPUA 1LVAA 1ZZ6A 4F8AA 1NZCA 2D45A 2CO5A 2MHFA 2AS5F 3V7SA 4MTDA 2CV6A 5D6FA 2RC4A 1O57A 3N97A 2RV8A 1ZZ9A 3R0JA 5FDBA 3GUDA 1J3QA 2H27A 3W6KB 1ZRCA 1OI6A 4HX8A 1UCRA 3P9IA 4MEYF 1KU9A 4IRHA 3GFJA 1P6RA 4IEUA 4QM9A 3HTUA 3LQQA 2KIFA 2Z9OA 3TNQA 1V3FA 3U11A 1QPMA 2IXJA 1UHMA 3T8TA 1LRHA 2QCSB 4UXAA 2PMUA 3E5QA 4Z2YA 2EVXA 1USSA 2PG4A 2MD5A 2Z69A 2EFQA 3MQ0A 3SCFA 5L3DA 4AIHA 4GXOA 4HLYA 2LDUA 5DV5A 3WE2A 5FFXA 2MH2A 4JTOA 4I98B 3V4GA 4MHGA 1KQ9A 2MLKA 3DP7A 3F3XA 2O3FA 4KA4A 5K1YA 1O7LA 3W6JB 3HOTA 2QLZA 3RTRA 3TNPB 2XL7A 1QZZA 2XV4S 4AQ2A 4JBAA 2Y75A 2HTSA 2FBKA 1F1ZA 1S29A 2PA7A 4LMYA 2FMLA 4PDKA 1H1MA 2XKOA 2CG4A 1IUYA 3PFIA 4EJWA 5LEJA 1U3EM 2Z2SB 4X6RB 3SHRA 4CXFA 3R60A 1ZREA 1G3YA 5BPIA 3VOEA 1EP0A 1FSHA 3BPVA 1S7AA 3QP5A 2I45A 4LULA 5DYMA 4IHTA 3USSA 2EV5A 1CAXB 3QP6A 3WW4A 2QM3A 4LEJA 1R7JA 2UXXA 1I1GA 2UY9A 2QBYA 4LG0A 1WKMA 1ZGJA 5HDGA 4HVOA 3RIRA 5HLGA 3FE5A 2IW5A 5DCMA 4FT8A 4H7LA 2F5DA 4IEXA 5CVVA 1X8MA 4EGZA 3ZN0A 4XLNF 2DT5A 3K1MA 1XDSA 2OZJA 4GO1A 3F72A 3CUQA 3OTFA 3P9KA 4MEXF 1IAWA 4CHUA 5CJ9A 2LKPA 3JZVA 3E6MA 2XGXA 5FLXZ 2QQ9A 4UV8A 4CO8A 1BI1A 2K4JA 3QACA 2M45A 3L7WA 4R8HA 4EM2A 2A5YB 1JE8A 3U0ZA 4EJTA 1AWCA 3GXOA 1W7PD 3UKTA 4IF4A 4R1HA 1QXJA 4FAHA 3T0YA 4BYYA 1MKMA 3RKYA 2Q2EA 2D93A 1F9NA 4OU0A 3JTHA 2NNNA 5E20A 4K8FA 5CLSA 3F8BA 1DGWA 5BPXA 3CL1A 4UHTA 1PMIA 2EK5A 5FO5A 1J3RA 4IRIA 1Z05A 2ESHA 3WTYC 4EMSA 4L18B 1SFNA 5CVUA 1E2XA 2DFIA 4AIJA 1I1SA 2RDPA 4U0WA 3K1NA 1IN8A 1ZX5A 5JAXA 4FBFA 2L54A 3TDZC 4Q4ZF 4XEZA 3BJAA 1HXDA 3MEXA 4PZJA 3DQVC 2ISZA 2OQGA 3U1DA 3FFQA 3E3VA 4G9YA 1VTNC 1SD4A 3HTSB 3IWFA 3CLPA 2OBPA 4LUMA 3C1DA 1FPQA 3GFLA 2VT2A 2FNAA 2FA5A 3KLNA 1QGPA 1UIJA 4HW0A 1XMKA 2UXNA 5E8GA 4BIFA 1MJ9A 2EB7A 2V1XA 1FXZA 4UBGA 3CTAA 4QX5A 4ZU5A 3I7DA 5HS9A 1B59A 4Y15A 3M9AA 1G4DA 4OIOF 1CAXA 5J48A 3U10A 3SQNA 1LDDA 2CAVA 4D0PA 3FMQA 2P7CB 5J8FA 3MFKA 3KP3A 4Z82A 4LG0B 3BPZA 3M1EA 1IW7F 4L5JA 5LEKA 1ZLJA 1PDNC 1RIOH 1QBJA 1YLFA 1MDMB 4KFCA 3R0AA 1X8EA 2FBIA 3DL3A 5I93A 4IEZA 2VC0A 3JAMK 4HYEA 4MNUA 1YS7A 2HEOA 4IERA 4K2EA 4I0BA 1WLTA 2RNJA 2DTRA 4XETA 3O2PE 3HT1A 5LLQA 5KVRA 4A6EA 3QPTA 1WA4A 4QM8A 2XKPA 1P4XA 3GZ6A 2FQ3A 3ZMTA 1HW2A 4YIFA 4G7ZF 1R5GA 2RN7A 5D6EA 4IEWA 5JVTA 5I91A 4O5VA 3G73A 1OYWA 3I54A 4HF1A 3WTUC 4E70A 2GZWA 4HLTA 4M9ZA 4H0EA 1GHCA 4U0YA 2F5EA 1PM7A 4HVQA 1FZPB 2HZTA 5J3UA 4XFGA 4YARA 3G7DA 4YFKF 3FF5A 3H3UA 4AVCA 4RAZA 4HQEA 2VECA 1G3SA 3HQXA 4OLLA 4I09A 1HKTA 1FBSA 1R23A 2IC1A 3FZ3A 3QOPA 3TGNA 2OAZA 3F8FA 3RZZA 2ZMEA 1RUNA 4GULA 1SQ4A 5F6FA 2FQPA 4LLNA 1IXSB 2CQKA 4KIGA 1ZZCA 1GQHA 2ZBKA 3QAHA 3V8JA 2CAUA 1O4TA 1RGSA 4AVPA 4RGSA 4MQ9F 4WZCA 4A0ZA 2EA2A 1YS6A 1R00A 4UUVA 2GXGA 4BHBA 2ET1A 2PTMA 3FM3A 3TQNA 1HQCA 4KYWA 3BPXA 1ONVA 2EFWA 4HLXA 3H1MA 3CJXA 2A07F 4L9TA 4OFGA 2FOKA 4XFBA 4HOBA 3L9FA 4XFHA 4Y13A 1JXSA 5C6CA 2D40A 3BROA 3QU3A 2OZUA 3EYYA 2QENA 5LGNA 3HHHA 2PFWA 5BV6A 4MGZE 2C6YA 1DDNA 2IA1A 1EPZA 4HF0A 3HYIA 3EO6A 3IC7A 3HRMA 2MH9A 2BBYA 2EJRA 1K79A 4RGRA 4YNIA 3IRRA 1ZLKA 3ELNA 2ZKZA 1XGNA 1YG2A 2Z3YA 4XLPF 5D5XB 1K78A 3KMHA 2PYTA 4EVIA 1QY4A 5F64A 4OOIA 3SMHA 4I2OA 4PJYA 2L4AA 2OA4A 4LTAA 2KXLA 1SMYF 1ZNPA 1P4AA 4KMUX 3DF8A 4O3MA 3HRUA 1LJ9A 3ROUA 2FBHA 1VJ2A 1B6AA 2BNNA 5D8LB 5FD5A 4HVRA 1LEBA 1UHWA 4OIRF 5A2QZ 3CO2A 4WXCA 1P4WA 3LAGA 5KHIA 2IPQX 3EETA 4UXNA 1CF7A 4OMYA 1T0FA 3MYXA 2DBBA 4HN0A 5BY5A 4Q5SF 3UKVA 2F2EA 5L3EA 3F23A 5BMZA 4I3PA 4L0YB 5JR7B 1B9MA 4OMZA 1LNWA 1CAWB 3NSTA 4AVBA 1Z91A 3IRQA 5D4RA 4UVAA 4Q47A 2IA2A 3TOAA 4UBHA 2EFNA 5L3GA 2ADUA 5FB2A 2G9WA 2O8QA 3KLOA 4ENMA 4QGLA 4Q48A 1FP1D 3NJZA 5AVPA 3SXWA 4M71A 2EFOA 2Y0MA 2ISYA 2STTA 6PAXA 3BALA 1O3SA 3I0TA 2M30A 4AD9A 5LHHA 4B29A 4ON0A 2CSOA 1Y3TA 3IDBB 3ST7A 1NYWA 4BH9A 5D5WB 2VPVA 3NW4A 1W5TA 2JT1A 5CVIA 4RAYA 3FHZA 1YLLA 1WWXA 5J8CA 1G3WA 1DGRA 5HDKA 2K86A 4WF2A 1YW7A 4B8XA 4EJOA 4I01A 4BNCA 5HDNA 1O3TA 1HBXG 2CW0F 4DQ2A 1OD5A 2FSWA 5A2QK 1KQ0A 3VFZA 2V79A 3M70A 1BOAA 4RGUA 3RI4A 3ML6A 1TQIA 1J5YA 3J80K 1LDJA 4U7DA 1WRJA 5EEHA 1ZARA 2B0LA 2D1HA 2J5OA 1W7PA 3I59B 4HBNA 1QQIA 4R79A 4MGRA 2DPUA 3IBMA 3LQRA 5DUKA 4WXDA 3CLOA 3MAJA 4KN7X 3K9TA 1JHFA 3BJOA 3C18A 3FXUA 3SCHA 1E17A 1ZZ8A 3HOSA 1DZTA 3IWZA 4IVNA 1CF7B 4ZYDA 3ES4A 1FYKA 2IXIA 5LHGA 1XSVA 3MZHA 4LLGF 4QLCU 2ACJA 2BNMA 3RJPA 2K4BA 3TOBA 2H09A 5CADA 5K8SA 4CGZA 3EUHA 1RI7A 5K5RA 4S04A 4UNOA 2XRNA 4A12A 3ES1A 1I27A 2UY8A 5CYVA 3PVBB 5LHIA 3K2ZA 3F21A 3VHRA 5FD6A 1L0OC 3FX3A 5DCMB 4KWJA 2JTVA 2H6CA 1J1LA 3KFWX 3T8RA 2QYOA 1ZH5A 1BM9A 1HW5A 3DV8A 5BOXA 2GC1A 1YYVA 5T3NA 2Q0AA 1BBYA 2QVOA 5FLXK 4JTNA 5HOOA 1QWRA 1T38A 3CF6E 4WCGA 3NEUA 4XF0A 4MH0E 3MPBA 1S8NA 4QGNA 4Q0VA 2XAHA 4E2SA 2EV0A 1YW9A 2X0LA 1P2FA 3M8FA 5J6XA 2P5LC 3LAPA 4WXHA 1VP6A 3ZMZA 3GYDA 1IPKA 2L3DA 2R3SA 1I6XA 1KYZA 1ODDA 4XF3A 4PCQA 5E17F 2IXHA 3M8EA 5JI6A 2UZKA 1Q43A 2QQAA 3ZMDA 1KU2A 1GXPA 2F4PA 2JZYA 2C0ZA 4LLOA 4Z07A 1MJBA 1YHFA 1S7OA 3L00A 3BWGA 3OD0A 2XUBA 2OA2A 4L2NA 5BXXA 1H1IA 3LWCA 3RYPA 4ORFA 1H0MA 1RL3A 3SHFA 3BJ6A 3TO7A 4JQFA 2W24A 4KL1A 5H6RA 4KICA 5FLJA 2WV0A 1XB4A 1FC3A 1U8RA 1I5ZA 3D0JA 3WTXC 2PJPA 3G3ZA 5I0RA 2HKOA 4QWQA 2PN6A 1Y0UA 1QZYA 1KQ8A 1K78B 3KP6A 2UYAA 3HRTA 1F4KA 1EH6A 1J2XA 2IP2A 3I53A 4D7TA 4CDGA 2GIVA 3Q5FA 2E1CA 1IN4A 2RQPA 3RYRA 2PBIA 1U12A 4RB0A 3WTTC 3BCWA 4P5OA 3FXQA 1O3QA 4G8XA 4G6QA 4MQVA 2EA7A 1J9IA 1FYMA 5LBQA 1SAXA 2B5HA 1HW1A 3RDIA 3GVAA 4HA8A 2ZFWA 5I0TA 3WW2A 4D7SA 1XMAA 2F5CA 4ZU4A 1NE4A 2DO7A 2W57A 3WG9A 1W7PB 3ABUA 3I59A 4KNYA 2NNYA 2Y48A 4ENKA 4HQMA 2ZCWA 1R5HA 4P9GA 2YR2A 4LGWA 2ZNZA 5E1XA 3U2RA 3GYHX 5F1RA 1KYWA 4GCVA 3KP4A 5C8WA 3Q9SA 1CGPA 4JV4A 1T6SA 2FRHA 3P9CA 1GQGA 3ZP5A 5KHKA 3H92A 5JR3A 3ACLA 1B9NA 2Z33A 1KGSA 3MWMA 1SD7A 1XE7A 3CO6C 3EBRA 5I8SA 4XF4A 5DEQA 4KU8A 3KEOA 1STZA 4ASNA 3MCZA 2XIGA 1MJAA 4HSJA 3O14A 1ON1A 4HX7A 2MPFA 1WSUA 4IEPA 3LFKA 1L3LA 1OR7A 3V8LA 3GEZA 3OGJA 1A04A 3H3ZA 1ZGAA 3DPLC 3V8KA 3WTWC 1ULYA 2VC1A 3SCGA 4KMFA 1SFUA 2Y0OA 1FSEA 2HGCA 3DPTA 4A0XA 1G6NA 1T2KA 1YTYA 1DUXC 4LUKA 2K02A 3GFMA 2WC2A 3ECHA 2E9QA 4ZH4F 2R7FA 1DP7P 4EJVA 2L4MA 2X4HA 4CZZA 2B8MA 4MUVA 1SFXA 3NRVA 1IRFA 1YFWA 2GC2A 5LRRA 2M87A 1FWZA 2Q30A 2ATFA 4N9HA 1ZZ7A 3VEPA 1SMTA 4L9NA 5LGUA 1IN5A 2PFBA 3C3WA 4KN4X 4XRFA 2VBZA 2D5FA 4WK8F 5ICGA 5LGTA 2IXCA 5I0SA 4IESA 3KCCA 4BXUA 2P5VA 4MGYE 2XLGA 5JSRA 3ERED 1X82A 1XRUA 1BI0A 1BN5A 3WGIA 4MZUA 3FXRA 1U78A 1LB2A 2GXBA 1FY7A 1OMIA 1UPIA 1REPC 3LA2A 2W85A 1J7KA 4QXKA 2VODA 4BHCA 2QWWA 4ESFA 3E6CC 4KWLA 4LK0F 4RB1A 2B9UA 3HSRA 5L3BA 4X6QB 2DLLA 2P6SA 3LWFA 1O5LA 3GF2A 1BI2A 1C0WA 3SZTA 3WU0A 1T39A 3GW2A 3H7JA 5D1IA 1EV7A 2PMHA 1J58A 3KETA 1LKNA 5EEGA 1YFYA 1YFXA 4TLFA 2STWA 2H0VA 2PAKA 1FOKA 1XGOA 5DD8A 1Z9CA 5HI0A 1GXQA 2MBFA 3R4KA 4N0BA 1DZRA 3QU6A 2GC0A 4XFFA 3DXJF 4G94A 2GAUA 2D5HA 3F6VA 2WWYA 2KIUA 5ILSA 2CYYA 2DK8A 4HX4A 4HMZA 4U7BA 2GWRA 4A5NA 5AIPA 1IN6A 2HKXA 3NL1A 2P6TA 3JAMZ 3FJSA 1V4RA 1FBUA 1AOYA 1EYBA 4QGMA 2DQLA 4ZYGA 2DAOA 2GA2A 3WGGA 1UW8A 3GBFA 2E7WA 1Y9QA 2HFHA 2H6BA 3MZYA 2YX7A 3FMSA 1XCVA 1CAUB 1X7NA 4HN1A 2XROA 2P8TA 3O3KA 1ZG1A 3HT2A 4YYOA 4RS8A 3C3VA 1FBQA 2CGPA 2VBWA 1D5VA 2NRAC 4YFNF 2HDCA 1CX4A 3ISPA 4IPAA 1FP2A 5ED4A 3F8CA 2V1DA 2HR3A 1QO0D 1XN7A 1DPRA 3P7NA 1EH8A 4E2GA 4KIBA 2W25A 1SFEA 4XBFA 1D3YA 5D5UB 2K27A 5HS8A 4YFXF 4O9EA 3OOPA 3K0LA 1IF1A 3J81Z 1UB9A 2BGCA 2VXZA 3C7JA 2O03A 5BQTA 4EJUA 1RZ4A 3L2HA 1W5SA 2E7XA 3HSEA 2A3SA 4O6JA 2M8EA 5K5OA 3WTVC 4IEQA 1Z6RA 3OV8A 2O8XA 1BI3A 3HHGA 2GC3A 1TQMA 3LSTA 4E2QA 3KGLA 2HYFA 5CU1A 1IPJA 2FMYA 4EQQA 1IXRC 3F8MA 5I8TA 4J1WA 1KA8A 2DCTA 1U2WA 4BAYA 2LF7A 1CAVB 5FLHA 2RGVA 3TDUC 2HJIA 4GYGA 5E8IA 2MLGA 3E97A 1CAUA 1XGSA 5KHGA 1USTA 1K7AA 1R1TA 3KP5A 1TQPA 5JHUA 2VOPA 2Q1ZB 1XE8A 3KZYA 1SEFA 3E6DA 4JK1X 2JPCA 1J75A 2V1UA 2VN2A 2KIMA 2H94A 2A6HF 2V6CA 1FNNA 5E1ZB 5HLIA 1HSJA 3JSOA 2YU3A 3E5UA 2KJBA 4NQWA 4R52A 3S0MA 3ULQB 4ONUA 3K1PA 3PNAA 1D8KA 3BB6A 4LA2A 1NXMA 4FAGA 3DFGA 4KWKA 4B09A 1H9TA 3U9GA 4Y17A 4YRDA 3J81K 2KJCA 3KP2A 3FMRA 1KU7A 4WBBA 4EGYA 5BPDA 5FLIA 4EWDA 4JVAA 5ICEA 2FE3A 1IZ1A 2DI3A 2EAAA 2N7GA 3ABTA 3ELKA 3H50A 2MNGA 3CUQC 2ET7A 4IEVA 4MV2A 2PLYA 5AIQA 2XAQA 3KGZA 2IXKA 4Q0QA 3ZDSA 3HIFA 4OIQF 2V09A 3OCPA 4Q29A 3BP8A 2VT3A 3L2CA 1UD1A 4RD7A 1SD6A 4IHSA 1ZRFA 1RC6A 4MTEA 3DKWA 3ZPLA 4I0AA 4AQ6A 3PQJA 3B02A 2OQRA 1YQAA 4ENJA 4P9UA 4NB5A 3LAJA 1O3RA 2G7HA 3H7YA 1IN7A 2A61A 2K9ZA 5FQ0A 1W4MA 1R22A 1ZYRF 2KKOA 1MZBA 2HWVA 1XCBA 1DPUA 1XSXA 4HDUA 2CFXA 2MC3A 1B1BA 2UWMA 1J3PA 4EV0A 1YO5C 5FGMA 5DCFA 3FWEA 4S05A 3T5XA 4HV5A 3H1WA 3EQEA 5DD4A 4DNCA 1R1VA 2Q8KA 1HKQA 1CAVA 1TW2A 1NHAA 2E1NA 1WQ2A 2FEZA 2ZXJA 3F8NA 2L02A 5LRSA 2D2WA 1Q1HA 3AAFA 2Z5UA 1LR5A 2PHDA 1ZN2A 4NHJA 4A5MA 3H8UA 2UYBA 4XFAA 4ZZLA 2YX4A 1ZRRA 4KUMA 2ELHA 3GZ5A 3MDPA 2XLAA 1Z7UA 3I71A 3RYKA 3KEQA 4YG2F 3CEWA 2LNBA 3D0SA 2QDRA 4IXAA 3LA3A 3EYIA 1B4AA 4UVBA 3FZVA 1L3JA 1PP7U 2IXLA 1OYIA 5DUIA 4WWCA 3TO9A 5L3CA 2IA0A 2O1QA 4M6XA 4WVZA 1TNTA 4ETSA 3JTGA 4KT5C 1FT9A 3IDCB 5KHHA 2R7DA 1D8JA 2FNPA 2HOEA 3I5UA 2J5PA 2BYVE 4XSXF 2XLFA 1ZRDA 5EZWA 3BY6A 4PGHA 4META 2WTEA 4WX9A 4U88A 2PEXA 4CICA 5FPXA 5E1WA 1RUOA 1ZHFA 3WW1A 3Q9VA 5TJJA 5TRDA 1YWKA 3WGHA 4HSLA 2QUFA 4AXOA 4ENNA 1JUHA 1PUEE 5ICCA 4LA3A 3FM5A 3WU1B 4M73A 5FPZA 3SZPA 2JRTA 4ESBA 5CVJA 2GA1A 3I58A 4A2UA 4MGIE 4AVAA 2O0YA 3QRFF 1VR3A 2ZO4A 2HTJA 4XFCA 5HLHA 4IRGA 5HS7A 1UFMA 1H9GA 3OF1A 5BUVA 3T1BA 3KSCA 3L09A 4P55A 3SXYA 3F22A 4G6DA 1P92A 3BU7A 2OPKA 2ZNYA 3ECOA 1O5UA 1YUDA 1MDMA 2QJVA 4DINB 4PIYA 3I4PA 4M72A 2XAFA 4IJAA 4LD5A 1T98A 4ZZDA 2VBYA 4HBLA 1LEAA 1JHHA 1IRGA 2FU4A 4KIFA 3DEUA 3CJNA 4ZU7A 5FFZA 2DW4A 1TW3A 1BJAA 1K6OA 3IL2A 4A6DA 4LJZF 1GVJA 2Q4SA 2AXLA 5E1RA 2QVSB 3EJKA 2EWNA 4G7OF 1S3JA 1CAWA 4QMAA 4M74A 4HDVA 2XHKA 3HUGA 4MGKE 2OZ6A 2TDXA 4TV7A 5ERIA 4FX4A 2EV6A 4HZFA 2GU9A 1XSDA 4EWEA 1UIKA 2L01A 5KK1A 3J80Z 1TNSA 2BE5F 2VE9A 2G7UA 2HS5A 3WW3A 5JCTA 1JGSA 4LLLA 5BS6A 2BNOA 1NE6A 1ON2A 2VBXA 5I8YA 4HF2A 1LQ1A 3B73A 2W84A 4ZYEA 1XD7A 2VE8A 5H20A 4PIZA 3RNSA 4EM0B 1OFNA 4ESJA 2LF8A 2QZ8A 1UCXA 4GGGA 4RB2C 2XVCA 3KZZA 3H1YA 2ESNA 2JSCA 4ZYHA 3H9AA 1HSTA 1TQ5A 5CVRA 3LOIA 4HV6A 4OINF 4F7ZA 5D4SA 4L5IA 1ZG5A 3E5XA 2DU9A 2GQQA 1QXRA 3M3IA 1X3UA 4LB5A 3UKNA 2M1BA 3LZZA 2F5FA 5IT3A 4OIPF 4Q0UA 4P9FA 5ILVA 3CDHA 3TO6A 3E6BA 5KHJA 2HYGD 2IVMA 2QQBA 4J1XA 3N4MA 2P4WA 1O7FA 4XSZF 2M5WA 3ZMUA 1FLIA 1BIBA 5FQ0B 2NS0A 1FI2A 3NKTA 5K5QA 2O61A 1R58A 5J7MA 5ILUA 1XGMA 2Q0OA 1R1UA 4G7HF 3GO5A 3KP7A 4AIKA 2A69F 4EM1A 3ZMSA 5HVQC 2JPBA 3GFIA 2FXAA 3LA7A 2WFPA 2KRFA 2PI0A 5IT9Z 2GH2A 2RVCA 1J0RA 3KE2A 2VONA 4HAMA 3EQLF 3DN7A 2LSOA 2ZMEB 1TLHB 2PHLA 5H6QA 4EWAA 4GYIA 5D5VB 4I7HA 2A6EF 3S7IA 2PQQA 2CWEA 3V7RA 2MA3A 4Q0PA 1YFUA 2OD5A 1Q3EA 4MX3A 1RNLA 1TTYA 3EHKA 5FCCA 3ZMVA 2IT0A 3REOA 5KBFA 2ETHA 1WI9A 3WODF 4XF9A 2NYXA 1U6GA 2COMA 2A68F 3IIAA 3JSPA 2VQAA 1SD5A 3GLXA 3IKTA 3WE3A 2YSRA 5DDGA 3O6BB 4RGXA 4PGGA 3R6SA 4RB3C 3D5LA 2PAMA 5JSOA 1XDUA 1BC7C 4IEOA 2VOOA 1ZG3A 4A0YA 3D82A 1Z1DA 3R61A 2K0GA 3BZ6A 2HQNA 1EH7A 4FHTA 4L11A 4O9GA 3CUQB 1U5TA 3ZQ7A 3HRSA 3JW4A 4Q0SA 1MD0A 4IETA 2ZJ2A 4M9XA 2P17A 1WGPA 4UV9A 1ZVFA 3WTSC 5AONA 2O6GE 2XAGA 2P7VB 4L9VA 3RKXA 1ZZBA 5D8KB 4UVCA 2DPDA 3CUOA 3BOQA 4BHPA 3ETQA 1OPCA 3RPQA 1Z6TA 2XASA 1V70A 2PAEA 2IRFG 4LFUA 2OU2A 5JFRA 2EA4A 3COAC 4YIIA 2BEOA 2QNKA 5E18F 2K7LA 1RTVA 1BC8C 1R36A 1QNTA 3IHUA 4CYDA 2QBYB 3PQKA 1EY2A 5JSPA 2EFPA 1ZAOA 3SFZA 3VODA 1U5TB 4XF1A 3HSFA 2NAZA 3V7CA 2XAJA 1Q5OA 1FX7A 1FYLA 3BDDA 2DK5A 2HQRA 4NVPA 2OYZA 3WTZA 5IT9K 3GWZA 4IEYA 2P5KA 3RKWA 4KDPA 1TBXA 2ZKLA 4I02A 2BV6A 4P96A 4FX0A 1F5TA 1HKSA 1PP8F 4AWXB 3S7EA 3PLQA 3F6OA 3VB2A 3K69A 2Z99A 4LK1F 4PIXA 3I64A 3J7AO 3NVCA 3ZN1A 1IXCA 3CO7C 3TKYA 2YPRA 1S6LA 1MGTA 2D1VA 4YSFA 4M9SA 1YW8A 2RKHA 5ICFA 1BIAA 1OKRA 1YIOA 2ETEA 2PQ8A 1U5TC 2V9VA 5EFUA
chains in the Genus database with same CATH superfamily
5EV7A 1HB2A 1JGGA 4BZ4A 2QSGX 2DTYA 1N1YA 3MW4A 4EROA 2JK3A 3FKJA 3S2WA 4LLFA 3NV4A 1X1BA 2EZIA 2WQZC 2MFZA 2A71A 4GH4B 2DQRA 4RS5B 2IJLA 4E7HA 4J01A 1LVAA 3JBG2 1ZZ6A 2CL2A 2AS5F 1IDZA 4QQPA 3ZYRA 2GXAA 4QPOA 2RC4A 3N7JA 4QSHA 3ZSLA 2L0KA 2VNOA 4GH4A 1OLTA 3OYNA 5FDBA 1J3QA 4X8NA 5FZCA 3OS1A 3F95A 3T1MA 3BQZA 1P6RA 4Z8BA 3ESWB 2VULA 2KHMA 2DWRA 2P81A 1F36A 2C5DA 3VL9A 1UKGA 1IOAA 1SC7A 1LGCA 4QQ2A 3AX4A 4ZXEA 3NMBA 2VKEA 2PG4A 2MD5A 2EFQA 5IVFA 3GTOJ 3SCFA 3JR9A 5L3DA 2NS7A 4GXOA 2KDZA 3OYMA 3OYWA 3WE2A 5FFXA 4I98B 3V4GA 1KQ9A 2MLKA 3DP7A 4KA4A 3W6JB 3HOTA 3HOBA 3RTRA 1AL23 1K5MA 5CFDB 2E1MC 1UZCA 3CJTB 4FTEA 4CDUA 5T55A 2XV4S 3ZFGC 1FIPA 3MIHA 2OUJA 1F1ZA 5G05L 4LMYA 5JZGB 3H9JA 3UNGC 4PDKA 1H1MA 3DKXA 3KHCA 3LSRA 2XKOA 1FX5A 3WF2A 5ABJB 2Z2SB 5LEJA 1U3EM 3SHRA 4CXFA 4CP1A 3R60A 3DEMA 5BPIA 3VOEA 1EP0A 2XONA 1FSHA 3QP5A 3VZLA 2I45A 2GIZA 4HG2A 2C26A 5JLXA 2EV5A 1CAXB 4BK4A 3QP6A 1XPXA 3WW4A 4UW6A 2QM3A 2UXXA 2D3SA 2JE7A 4C2UA 2XWBB 4XXPA 2DCYA 5LBFA 5FZ0A 4P9IA 1ZGJA 4QU1A 5B66C 2P1BA 4L92A 2OZJA 2XOMA 3CUQA 1D2SA 3KVAA 1PMHX 2JENA 2VNGA 2M2EA 3OTFA 2RAEA 2ZSHB 5IYDJ 1ENQA 5GPAA 4OQ9A 5F6KA 4CYCB 5FLXZ 3EXUA 4XCBA 4QPIA 4C3JJ 1WCSA 2A5YB 3LSJA 4RHV3 1W7PD 5CIRA 1JZ3A 1QXJA 4R1HA 1FATA 1OURA 3OYWB 3T0YA 4BYYA 3JRFA 2LR8A 1VAKA 4J19A 3RKYA 3D8CA 2VZTA 2NNNA 3WP6A 5CLSA 1MNMC 1UN1A 2FCUA 1DZQA 2UU8A 1Z3YA 3CL1A 1W90A 2YXSA 3BLYA 4IRIA 1Y7BA 1Z05A 3WTYC 2PLV3 4AEKA 1SFNA 2HEYF 3U78A 2OPWA 5JOYA 3GCXA 4AIJA 3IH2A 4LE3A 2ARCA 1FV3A 5JAXA 3TDZC 4BS9A 2OIIA 3MEXA 5HODA 2DUQA 2RDNA 3MF9A 3TN92 3JRIA 1UQXA 3TMOA 1X2NA 5LB6A 2JRMA 2LRDA 1YRNB 1X19A 1G8WA 2LFBA 2X9DA 4UBGA 3CTAA 3VBFB 4GB31 2JG9C 3I7DA 2L9RA 1B59A 5HS9A 5J48A 3SQNA 2HWF3 2CU7A 1RMU2 1YQ6A 5J8FA 1BJZA 3ZQIA 4FP3A 5LEKA 1ZLJA 4N4NB 3OUHA 2VKHA 4KFCA 3R0AA 5B4XA 3ZQLA 2YPDA 4IEZA 3DGTA 4K2EA 4I0BA 3IAQA 1GZ9A 1H1AA 5FKNA 3MFAA 4NRPA 3DCQA 3USUA 3CMAI 4A6EA 4QQLA 4B4CA 2Y6FA 1SBFA 5CQEA 3HR9A 4C9YA 4N8MA 2DYCA 2J1UA 3SQOA 3ZMTA 2DTZA 5L9RA 1HW2A 2JMWA 4IE5A 2FDJA 1R5GA 3J26N 4C1XA 4AYBN 5JVTA 4M3DA 2AO9A 2NXNB 4E70A 4A3ZA 3I9V2 4HVQA 4XKBA 1WMXA 3RQ4A 1HF0A 1V0AA 4RAZA 4BDVB 1JOJA 2LRPA 3NAPC 3PTYA 2JA5J 4Z2WA 1S0BA 3NO8A 4I09A 1HKTA 4GJZA 3FZ3A 4JRLA 5L73A 4FE4A 2BY3A 3EPZA 2VXRA 5DXDA 2OAZA 3F8FA 5IFPA 1ALYA 1JYTA 3F2ZA 1SQ4A 2C4XA 4IQPA 3RZDJ 1YRZA 3VKOA 3ORJA 2CV0A 2YGMA 4NAOA 1ZZCA 1LKXA 3O5SA 4HKOA 3OS2A 4YLZA 4DZJA 4BY7J 1JT6A 1JYNA 3IT8A 2B39A 3ZXAC 4CTEA 3ZFEC 5FPUA 3ZMNA 1O4TA 2C9KA 1RGSA 3ZSEA 1CX1A 4AI1A 3QD6A 3WF4A 2EA2A 1XNDA 1YS6A 1R00A 4UUVA 2GXGA 3S15J 2ET1A 2VKVA 1MNEA 4KYWA 3BPXA 3WDYA 3HOUJ 5FO8B 3H1MA 1S9HA 4COWA 1W2UA 3CJXA 3JRCA 3CC7I 2FOKA 2P3IA 5EG0B 4XFBA 3L9JT 4NIDA 1GQPA 4Y1UA 1X1CA 2R061 3RQIA 1RJ7A 2OZUA 2QENA 2XGDA 4MGZE 1R4NB 2IA1A 1HDKA 3QYBA 1D0GA 3ZSJA 2EJRA 1K79A 1OPOA 5A6QA 1ACIA 3HOVJ 5FR3A 5FZ1A 2GN3A 2I10A 3ELNA 4ZTJA 3KYDB 2JG9B 3VBFC 1G86A 1K78A 4JP0A 1PVC2 2PYTA 2VVEA 3QH6A 3SNMA 5F64A 3U1XA 4RS5A 3SMHA 1IS4A 2RMU1 4AVTA 1SMYF 3KS7A 3AFHA 3DBLB 1GYKA 3HRUA 1RKWA 3ZSKA 1I3HA 4LJHA 2FBHA 2RR11 1JZ7A 1VJ2A 2WNUC 2EAKA 5D8LB 4HVRA 4NN0A 2BVMA 3ZFFC 3WUCA 4B1LA 2WNVA 3VDXA 3EETA 4OMYA 4QKDA 3MYXA 5APAA 2DBBA 4HN0A 5BY5A 5L3EA 3HBKA 4BACA 2KRCA 1N25A 4E7KA 4N90A 4YZ3A 1PO12 1CAWB 2HXOA 5EHDA 1OOPA 3ZYPA 2IA2A 3O0WA 1WA6X 4ASMB 2ADUA 3NWTA 2JWPA 4A45A 1H8AC 2W1UA 3SXWA 4S2GA 1LFBA 3WG2A 1FV2A 3M4OJ 2ISYA 2STTA 2CQNA 3I0TA 4I3GA 5LHHA 2IS4A 1ITYA 4JC1A 3Q0VA 3IDBB 4FFHA 4HKWA 2JT1A 1YLLA 4D0QA 2RE9A 3PVOA 5J8CA 1G3WA 4WF2A 4NC8A 2XF6A 4EJOA 4LBQD 4E7LA 3HGGA 3D1NI 1CJPA 1O3TA 2LY2A 2RR12 1HBXG 1OA4A 2BZDA 2A6WA 4DQ2A 1A36A 2QZ3A 2K5CA 3CJIC 1KQ0A 2GMEA 3ML6A 1J5YA 1OLME 1UMIA 5M5XJ 1LDJA 3RG0A 1WRJA 3A2KA 1NCQB 1ZARA 1QQIA 3VB9A 5CISA 1UXZA 4KBZA 1W2OA 5DUKA 1FOYA 3WDXA 5CNAA 2QCOA 2NVTJ 5A1FA 5A33A 1NKGA 4HL0A 1ND2C 4YGEA 3VL8A 4ZYDA 1OCRH 2O14A 2YV8A 2ZGOA 2L7KA 2R16A 1XSVA 1POV0 4LLGF 3CC2I 4DB5A 2BNMA 4RR3C 4ZPIA 2W9XA 1W6PA 2H09A 5K8SA 4XL9A 3NARA 5K5RA 1MMNA 5IP6A 4UNOA 4A12A 1TZOA 3WG4A 1P7JA 3PVBB 2WA3A 2YS9A 5FZFA 5GADJ 4PBPA 4M6VA 4Y5SA 4QB1A 4XUOA 2HLEA 4UY8I 5E3OA 2JTVA 4FOQA 1J1LA 1ZH5A 3POYA 1KQRA 3AFGA 4AEJA 3A0BC 5BOXA 4R9AA 3CDZB 4XKCA 2GC1A 1I6HJ 2HVSA 1T38A 4UUTA 1N1VA 3MPBA 2PLV2 4Q0VA 3TB0A 4O65A 1YW9A 1OR7C 4M00A 5A32B 2VUDA 5J6XA 2WZEA 4XRSG 2P5LC 2R49A 3PL8A 2L3DA 2M0CA 2R3SA 3S3NA 4PCQA 3ZXEA 3CCMI 4JHTA 1CN1A 3GJAA 5DAWA 3I2FA 4DRRA 4FPLA 1KU2A 4PDWB 4COYA 2RM21 3B3QE 1YHFA 2DJNA 4OULA 1FTTA 1S7OA 1E57A 1I5PA 1DYKA 2BVBA 3I8TA 4PLOA 1NG0A 2PMZN 3LWCA 2FZ1A 2RS32 2XJRA 3G2BA 4ORFA 3SHFA 3TO7A 1GP6A 3PM1A 2PHRA 1U9NA 4MADA 4G4FA 1XB4A 2MEV2 5FPLA 2WSVA 2PJPA 1HRV1 1PO21 2HKOA 4QWQA 1LOAA 2DUPA 4CP9A 5FP4A 2E36A 4BE0A 2UYAA 3ZIXA 1SACA 2IP2A 3K75B 4D7TA 2VJJA 3RZKA 1DU3D 2TRTA 5LWBA 2PBIA 1F5FA 2ZGQA 4RB0A 5FUPA 2LREA 2QQVA 1YQ5A 1RVF2 1JN2P 2Y31A 4FPHA 2XVLA 1J9IA 4X1EA 3SJMA 3C7HA 1FYMA 5DZGA 3WP5A 3B9IA 1HW1A 4DOUA 4XN0A 3NJVA 2ARAA 4D7SA 1XMAA 5EJCA 2DO7A 3K3NA 2W57A 3KEYA 4GWIA 4CSWA 1QIQA 5T54A 4BL0B 4KNYA 2NNYA 2VQUA 1GU3A 1WBFA 4PCRA 4OAYA 1GP5A 3K70D 2YG0A 1P7IA 4PDWA 5FZ6A 4Q4W2 1WW6A 3GCWA 3GNEA 1UMZA 5E1XA 3WF0A 4JGZC 1DYOA 1AYM1 1D1CA 1KYWA 5F1RA 3WDVA 4GCVA 1W0OA 3B69A 3M3EA 1CGPA 5FMOS 1U9OA 4GWMA 4XUQA 1GQGA 2DA6A 2VE1A 4AEDB 3ZXGA 1PK6A 3L2WA 3MWMA 1SD7A 2E26A 1DGWX 1OXCA 2EALA 5DZEA 2VBDA 1XYNA 1E0EA 3MCZA 3M3QA 1S0EA 2E71A 1ON1A 3OR2C 4HX7A 2MPFA 2XJUA 3U14A 1OR7A 4RYDA 3OY9A 2ZX1A 5CZKA 1FNZA 4FOVA 1ZGAA 1Q8PA 3DPLC 3WTWC 2VZSA 4AQTA 2NMOA 3BTJA 1QMJA 5DUWA 4KMFA 5J4YA 2Y0OA 2HGCA 1COV3 1G6NA 2DODA 1T2KA 1R1A3 2JDPA 2K02A 2KIQA 3GFMA 2WC2A 4ZH4F 1MACA 1DP7P 2GM4A 3PIPF 1TZLA 5FP7A 2F48A 4IOCF 1OQDA 1YFWA 5JXGA 2M87A 1RUH2 4IW3A 4U2AA 1SMTA 3C3WA 2VH9A 2ELKA 4GZ9A 5LASA 1TMF3 4E7ZA 5ICGA 1W36C 2CH0A 3RZLA 3ZKYA 3ZFGB 1UYYA 2JN6A 3GTPJ 1HLVA 4K1ZA 4DZPA 2P5VA 1BW6A 5JSRA 2X29A 3VHOA 1BR4A 1LB2A 3B00A 2CNAA 5GPCA 1AXKA 1NLRA 3H5RA 2VUCA 5ACA1 1WH7A 3S1NJ 1UPIA 4QWNA 1REPC 3CJQB 5FKOA 5JXHA 1X4OA 3WQ1A 4ZDLA 3J9SA 4M3GA 4AIDA 1NG7A 1BEV1 1W6QB 2XJVA 2ID6A 3DKYA 3NKGA 4XVHA 4LITA 3BR3A 3H7JA 2VC9A 5J1UA 2VR4A 3B7MA 1FOKA 2ZEZA 1XGOA 3DECA 4QHOA 5DD8A 3AYAA 4R4XA 3BU0A 2A3YA 1DZRA 3PUAA 3RVHA 4Q4V1 2SLIA 3K4JA 4W97A 1TT5B 2GAUA 4CXWA 4HANA 2KIUA 1M4WA 2CYYA 4HMZA 1RUH1 2V72A 4QDRA 2E5NA 2GWRA 4A5NA 1ZBA3 1F5JA 4BWOA 1RETA 2XG3A 3NL1A 3JAMZ 1ETKA 4D7YA 1V4RA 1DGWY 4E4DX 4DY3A 3U4XA 2E5ZA 1EYBA 2DQLA 1MNDA 3LDBA 2GA2A 1VBD2 1IG7A 3AYCA 2HFHA 2H6BA 2VQCA 3FMSA 3FISA 1GNZA 5DG2A 2P3YA 2WO3A 4SLIA 3P5JA 2VBWA 1D5VA 2NRAC 5M3MJ 2HDCA 1CX4A 3ISPA 2Y8KA 3F8CA 1XN7A 3VBSA 3P7NA 1UZZA 3TP0A 4AF9A 2GOMA 3AKQA 3ZQHA 1D0YA 5A3WA 4D5FA 2RS13 2DMUA 4EQVA 2CWSA 1A78A 4OYUA 1HJFA 5LCWL 5BQTA 5FIXA 3L2HA 2GP3A 2E7XA 2RJKA 1G9BA 2A3SA 3WTVC 4IEQA 3HNMA 2O8XA 3HHGA 3BG6A 2CGNA 5C3EJ 1BBT2 2A5ZA 4WM7A 5ANQA 4LK6A 4E2QA 5JLWA 1IPJA 2VZOA 4N53C 1ULDA 5BYNA 1IXRC 2W3JA 1VBC2 5FYTA 4KG8A 2BTVC 3AJZA 1WD4A 3VDDB 2I8DA 5IUQA 1GMMA 3LSKA 3E7LA 5IY5H 4DUXA 5JLVA 3J8F3 1SLCA 1N47A 2BOLA 1ND3C 2I2SA 4GYGA 1D5YA 1AUYA 5BNNC 1NLQA 3LKJA 5KHGA 3VSLA 1R1TA 3KP5A 1GBGA 1TQPA 5JHUA 4CA9A 2Q1ZB 3WR0A 4PSXA 3KZYA 1SEFA 1ULCA 1J75A 1VI0A 2Q8DA 2H94A 2A6HF 3S16J 5FP3A 5E1ZB 3OYHA 1JXNA 3H3LA 2YU3A 4BQ4A 5GZFA 2LC2A 3ATGA 4NQWA 5A32A 1GOHA 3LIHA 5FUIA 5F6LB 3PUQA 4ITVA 2A5WA 1J84A 4B09A 1H9TA 4DMIA 4WBBA 5BPDA 4FTHA 1F35A 1NA1A 4EWDA 3U21A 2FE3A 2ECCA 1OD3A 2I5UA 1NUKA 3ELKA 3SKVA 1V9U1 3CUQC 2HWD1 1LTEA 2XAQA 1JTYA 4OIQF 3OCPA 4Q29A 3BP8A 4E4HA 2D6LX 2LBFA 1VBC1 4UAPA 4XIKA 1XMXA 4PQQA 3PQJA 1YQAA 1SCRA 4OUSA 3AL5A 4NB5A 4PJ0C 1NAEA 1O3RA 1H89C 5L7OA 3KF3A 2A61A 1A6IA 2OCCH 5FQ0A 4PFPA 5FXVA 3QYEA 3VZKA 3HKZA 1DPUA 1XSXA 5FYVA 3OUJA 3K77A 1R091 1QJX1 1U0JA 4HDUA 2JJ6A 1XTAA 1SZBA 1XSQA 4M3EA 1YO5C 2A6ZA 3N9PA 1QH6A 2H8RA 4JX5A 4EE2A 1BBT3 5A3LA 1SLTA 2VASA 4HV5A 3H1WA 1RB8G 5DD4A 4HRIA 3R05A 1ZBA1 1N3QA 3KIOA 4AGVA 1PYVA 1VBD1 1NHAA 1LHWA 3JRDA 1WQ2A 4JRAA 5LRSA 1GUUA 1RKTA 1X33A 3OIOA 1LR5A 1V55H 4XKVA 2AQFA 2ID3A 4NPMA 4XFAA 2VOWA 3B6AA 4X0GA 2VCMA 3FUQA 4IV3A 3HGYA 4KUMA 3AMMA 5LZ6A 2BVLA 4BCUA 3GZ5A 1GOGA 2XLAA 2VCCA 4JQTA 4FPKA 4HPKA 1K3IA 4YG2F 3CEWA 3NNFA 3WNNA 1IS6A 1JTXA 3OPWA 2LBFB 2IGOA 4BISA 4MG2A 1R6RA 1S0FA 2D97A 4LHSA 5DUIA 1XJAA 3WDUA 5L3CA 2IA0A 4CE8A 4M6XA 3VBOA 1GKBA 3SC7X 1RR7A 3JTGA 4KT5C 1W99A 2PLV1 3IDCB 1D8JA 4LO7A 4XBLA 4N43A 2BYVE 4BLIA 1AR81 1QJX2 3HEFA 1NOVA 2CMPA 2OJED 2WV1A 3M7AA 3WW1A 5TJJA 5K0UA 1WW7A 3OYBA 1FOD1 2W2IA 4AXOA 2COBA 4ES9A 4CP9B 1PUEE 1AR61 1QOTA 4W50A 3WU1B 5FRMA 1JW6A 1P9QC 4EN7B 5GAGJ 2WB1A 1OF4A 4A3EJ 1UOJA 5CVJA 3HBLA 5C3PA 1V6KA 1A6CA 4AVAA 3R4DB 4MIMA 3ZQGA 4Y3OA 3T2TA 1YCIA 2HTJA 2D44A 4IRGA 3K6GA 5FYBA 1R082 2JA8J 4Y26A 5BUVA 3T1BA 3KSCA 3L09A 4P55A 2ZX2A 1COV1 3MMYB 2OPKA 2ZNYA 4F93B 1YUDA 4DINB 2IGKA 2HWC1 3I2HA 1PHMA 3GMEA 1URXA 3KYCB 3HNBM 5A7PA 4HBLA 5FZ4A 1SLLA 1JHHA 4K21A 2W92A 2HWE1 2WZR2 1T33A 4NJ4A 4N7UA 4A3CJ 3CJNA 1QJFA 4ZU7A 2P34A 1TW3A 2WS92 2RVAA 1RHI1 1K6OA 1WJAA 3IL2A 3I55I 5T5LA 2LG4A 3S17J 4QDQA 4A6DA 4N43B 4LJZF 1MBHA 1I9RA 4PLMA 2EWNA 2K9NA 3ZYHA 2TDXA 5FWJA 2FCTA 4TV7A 2R073 1YE9A 1R083 1IG3A 3I2IA 2ZGPA 4EWEA 3VPRA 3J80Z 5IP7J 1LE8B 1MZ6A 3L2RA 1ZBE2 5C7GA 2EXJA 1MS1A 3I3MA 1QQP3 2X6YA 3LSPA 1HKDA 2DFCA 3KCYA 1W8NA 1NE6A 3POFA 3KLSA 3B73A 1LFPA 1XD7A 1N3PA 2D6OX 2VE8A 3TYJA 1R081 3RNSA 5C8CA 1NCRA 2R30A 1MMSA 1RUG1 5FO7B 3KZZA 1I1EA 3WVJA 4HSRA 5FZMA 4YW3A 4YELA 1HSTA 5CVRA 5K7HA 5FZ3A 2AC1A 5FFOC 3ZDVA 4UB8C 1WJDA 2FUG2 3AMHA 1RXGA 2WAQA 3DLAA 3UKNA 4DGWB 2F5FA 1HCRA 3PTRB 5ILVA 3TO6A 3E6BA 2HYGD 3TWIA 2IVMA 2VTXJ 4V2GA 2JECA 2WL1A 2YC4A 5IW0A 2P4WA 1U5YA 5EP9A 1US2A 4O7XA 5FV3A 5C33A 1AYN3 5ILUA 2D98A 1XGMA 4A4AA 4G7HF 3GO5A 1XS9A 2JPBA 2EQRA 2KRFA 2PI0A 5IT9Z 2GH2A 2RVCA 4XM3A 1TVGA 2HEWF 4XLEA 4AYBA 3KE2A 1JUIA 4HAMA 3EQLF 1SMVA 1VQ7I 2W1QA 5BNOC 5KNLA 1OCTC 1W6OB 5H6QA 4EWAA 4GYIA 5E8AA 2DVFA 3V7RA 4GMP3 2ZX4A 1RNLA 1MS4A 2OTLI 1VQKI 1TTYA 2WLPA 4BE2A 5KAFC 1ENSA 1FOD3 2IT0A 2ETHA 3NAPA 5B4NA 4AG4A 1PIV2 5IVBA 5JVVA 1QJU1 2A3WA 1SD5A 1MBEA 4EZ4A 2YSRA 3WP3A 3ZN4A 1RUE1 2CHHA 4A42A 5DAPA 5DDGA 4XJWA 5C4WA 2ZHNA 3MICA 2G0EA 5K7PA 3J7HA 5M5WJ 3VDCA 5JSOA 1XDUA 4IEOA 3IH3A 3LQCA 4NAMA 1SVMA 2WSUA 2LROA 1Z1DA 5HCFA 2H1KA 1OF3A 1RXFA 3BZ6A 2HQNA 4FHTA 1MQTB 4L11A 3CUQB 1U5TA 2TUNA 4Q0SA 4IETA 2P17A 4XZUG 3AM2A 3MIFA 2GNBA 2XAGA 4H4KC 3D6EA 2P7VB 5DAVA 5CKNA 3I3LA 2JJ7A 3CUOA 1VMHA 3W9AA 4LO4B 3BOQA 5HV4A 2B46X 1Z6TA 2W87A 4A3XA 3HXLA 1YJ9I 4WVWA 4AGGA 3KHBA 1WCQA 1DQ5A 4LFUA 3ZQFA 3WUDA 2LY1A 5JFRA 5FZOB 3COAC 4ZDPA 4NIAA 2QNKA 4Y5Z0 5I0DA 1IJWC 3Q8AA 4UF0B 1V6NA 3RSNA 1REFA 4D7NA 1R36A 1EY2A 3ZSMA 4NWWA 5JSPA 4LXLA 3FXOA 3SFZA 1U5TB 3ZQQA 4XF1A 4FCYA 1HLCA 1Q5OA 2JUGA 1SHWB 3WLUA 5IYYA 3B5LB 3POSA 1GOFA 4NVPA 3WTZA 3GWZA 2P5KA 1W5CC 4Q4X3 3WDTA 5CG9A 1WJBA 1W05A 3KZIC 1MR5A 3CDLA 1K4TA 1IG0A 1V9U3 1F9KA 3I64A 1SFYA 4BQ5A 1C1LA 3ZN1A 3ILFA 3CO7C 2WADA 3TKYA 4P9XA 3OOXA 1YW8A 5ICFA 2QSFX 3ETPA 1U5TC 3TEWA 5CAZA 2X6OA 3IKVA 3MPPG 3GX4X 1OT5A 2WNEA 4XFIA 3NQOA 2EIGA 5EYYA 4BQAA 3M7GA 4KU7A 1VIWB 2HH9A 1IV6A 3FLRA 5GLVA 4L0ZB 5I0UA 1LDKB 3QPHA 5DPNA 2DU1A 2W08A 2XJPA 3VBUC 3PUFA 4F8AA 2EPFA 2D45A 4B47A 1PX3A 3V7SA 4YIRX 4MTDA 2WQ4A 3UNPA 3I2OA 3BUCA 1NXD1 4CDUB 5FKBA 2E31A 3GUDA 1OKQA 2OUMA 3HPHA 3NNGA 5B2GB 5DUVA 3WQ0A 1RUD3 4HX8A 2Y33A 4LE4A 2FDKA 3BR5A 4IRHA 3UGGA 3O1TA 2Y9ZA 1ULFA 2O9LA 2LS6A 1Y1VJ 1IS5A 4QKFA 2CS3A 2Z9OA 1V3FA 2XB6C 2ZPXA 4ZS3A 3BR0A 2IXJA 2O0OA 2YHJA 1UHMA 3T8TA 2QCSB 4UXAA 2R7SA 1ODMA 3OBAA 2PMUA 3E5QA 4Z2YA 1QJY1 2Q8CA 3T2QA 5F7UA 4AIHA 3S3MA 4HLYA 2LDUA 2OS2A 3AXEA 2MH2A 1QJU2 1M06G 3F3XA 2O3FA 4W1UA 5CBLA 2XL7A 4H14A 1RUC1 1TMF2 1QZZA 2BXYA 1Z21A 1DG6A 5A6XA 2HTSA 2WAQN 3LPGA 2IS1A 1S29A 4A6OA 3C7EA 4OI0A 3ZXFA 1AF9A 1LOFA 1H2KA 1G9DA 4HPKB 3PFIA 4P9LA 2FZ2A 3K48A 2E60A 3BCAA 2GLOA 3H9QA 3ZCOA 1K83J 4IXLA 2WNUB 3GTGJ 5FBZA 1V5FA 4LULA 4IHTA 3VYUB 4CCKA 3X29B 2ZA9A 3WNLA 3HPGA 1POQA 4JGZB 1FEXA 3ALQA 1R7JA 5A7OA 2QBYA 4UFMA 4LG0A 2BW3A 3OYIA 2L7MP 4IHYA 4RQPA 1VBB1 3RIRA 1TL8A 1PGL2 4FT8A 4IEXA 5CVVA 1X8MA 2WO2A 1HA8A 4DUWA 1VAVA 3OYCA 4FOWA 2J1AA 4EATA 3JXSA 4M4RA 1E3OC 3VHNA 3F72A 2ZABA 3T2PA 3LOCA 3CKHA 4CDQC 4CHUA 5A3PA 3E0JB 3TOJA 2C24A 2QE3A 2LKPA 3JZVA 3E6MA 4UT5A 1V6OA 1JT0A 4JHZA 2QQ9A 1PZ8A 2K4JA 1KXGA 1OUXA 1OUSA 3LEMA 5IPAA 5C3RA 5DZFA 1JZ5A 1JE8A 4J6GA 3U0ZA 1US3A 1AWCA 1EAH1 4A7ZA 3UKTA 4FAHA 4QPQA 1O4ZA 2ZGNA 2R5ZA 3R4SA 1ZBA2 2YU1A 4E6KG 2CUEA 3RGBA 4B4PA 2O8KA 4OU0A 1UY4A 1MVQA 2Q8EA 5IVVA 3OPZA 3L1PA 5BPXA 2BJSA 1EKEA 5FO5A 1J3RA 1QVTA 4EMSA 1EAH3 3A0NA 5CVUA 2P0WA 1R9TJ 1I1SA 2RDPA 1TEIA 2L54A 4XEZA 3RQ0A 3BJAA 1HXDA 5C9AC 2N8GA 5FKLA 2OQGA 3FFQA 1S0JA 3E3VA 3ZFEB 1VTNC 5FZBA 4XJ9A 1PGW2 3IWFA 1CQ9A 1A3KA 1LU1A 2W4SA 1MBKA 1MW7A 2VT2A 3INAA 2WB1N 1QDOA 5GKAC 1QGPA 4HW0A 4A93J 2DMTA 2ZZJA 2JB4A 1Y39A 1VALA 4ZU5A 2XPWA 4IX7A 3M9AA 2NN8A 2GMPA 2CAVA 4D0PA 1CVNA 2K9MA 2P7CB 1FOD2 2DUOA 1PDNC 4AFAA 3IIIA 2J7MA 2DURA 1PZ9A 2KRHA 3G4SI 1W9YA 2F4OB 2FBIA 4YGCA 1V54H 5I93A 5F2SA 4HYEA 2R5ZB 1W39A 4MNUA 4IERA 1NCRB 2NMNA 3HT1A 1R092 4QT6A 3UK9A 5LLQA 3A23A 3K4NA 3WG3A 1JODA 2XKPA 3GZ6A 2FQ3A 2W52A 2G9FA 3MIGA 3P3PA 5EJ3A 4YIFA 3QOEA 1EA3A 4ISQA 5D6EA 3PNVA 1RUJ2 2E1OA 2Z79A 4IE4A 2H1LA 2DA1A 3G73A 2XQRA 1GDTA 1ZA7A 4AVZA 2GZWA 4H0EA 2JB8A 1DP3A 1FZPB 3K4LA 3APBA 2JVHA 4XFGA 2VMHA 4F91B 1QJZA 2V5YA 3GZNB 3G7DA 4YFKF 3VBUA 3FF5A 2VY0A 4AVCA 2GBYA 4U87A 4BBSJ 4XJ8A 4N4OB 3J7AY 2X1CA 3HQXA 3OYFA 4OLLA 1KDMA 5HCBA 2L9SA 2RJ2A 4F3QA 1R23A 2IC1A 1JYXA 4C90A 3RZZA 5F6FA 4LLNA 4RAFA 1VBB2 1VLNA 3POEA 3MBWA 2ZBKA 2X85A 2IVIB 3QAHA 3CCRI 2XWJB 5GZEA 5FREA 3HNYM 4MQ9F 4M3CF 3TW7A 1JYCA 5LFAA 3FM3A 1RUG2 3I97A 4D8MA 1LAJA 3JRBA 4NPRA 2EFWA 1ENRA 2Y34A 4FQ4A 2HQAA 4TLGA 2VZQA 4OFGA 4HOBA 5GTIC 3L9FA 4XRMA 3BROA 2F4IA 3NJXA 4Q4Y1 1DQ4A 3VBOC 1CZVA 2JDAA 1X2MA 1BVP1 3C7OA 4BEHB 1GVDA 4EN8B 3HBZA 1SDDB 3FBNB 5F0FA 3H8RA 1VBA2 1UYZA 2PN5A 3N7LA 3OBZA 3JQXA 4YNIA 1W0TA 2FX0A 2YFZA 1XGNA 3ZOBA 1D4VB 2Z3YA 4AVVA 1X3ZB 5D5XB 2OF7A 3KMHA 4EVIA 3WF1A 4IOAF 1QY4A 3T2OA 4OOIA 1XBFA 2HWB3 4PJYA 2QTWB 2OA4A 1MS0A 2E7TA 4UF0A 3WNOA 1BL0A 5FMOL 1VBE3 5FZ8A 4K1YA 4A7YA 4NC7A 2PJRA 1AVBA 4O3MA 2ZJRF 1YI7A 1HB4A 1WW5A 5DAXA 1YJWI 1OQEA 5HNHA 3UESA 1UHWA 4OIRF 5A2QZ 3CO2A 2O7OA 2XAUA 5F32A 5KHIA 2D6KA 1YQ8A 2VL8A 5C8CC 4N43C 4ABZA 3BPSA 1T0FA 2ORZA 1SEUA 4BXFA 3GM8A 3BGAA 1STMA 2AREA 2F2EA 1Q8SA 3DXUA 5F27A 5JR7B 1LODA 4BQXA 4OMZA 3T09A 1LNWA 4YM3A 1Z91A 4RGKA 2X10A 3SH4A 5H9RA 1HRV2 1PO22 3NWSA 2NPIA 4MHRA 3KLOA 4ENMA 1FP1D 2J42A 1RUJ1 2LTNA 2R7RA 3A22A 2VW0A 1D1BA 6PAXA 1RRJA 3RRDA 4B29A 1Q56A 2CSOA 2BHZA 2L9NA 2VUMJ 3VKMA 1NYWA 4BH9A 5D5WB 5DQ0A 2VPVA 2K9SA 3NW4A 5F5AA 5JMOA 3HG9A 1WWXA 2K86A 3K4KA 4B8XA 2V4JC 3OGRA 2CW0F 3O0XA 3M4FA 3VZJA 1VFCA 1W8FA 1MEC1 1ZA4A 4W6XA 2FSWA 2P3KA 4LIUA 1BOAA 4XLHA 4RGUA 3OYLA 3K4MA 1TQIA 1PK6B 2D3RA 3USUB 4LBOA 4QX7A 1RESA 1Y1WJ 2D1HA 4EEFG 1W7PA 3I59B 2WN2A 4MGRA 4A3GJ 5FZHA 1JJ6C 1VB4A 3LQRA 1QEXA 2DV9A 3MAJA 3QYFA 3K9TA 1JHFA 3C18A 1VNDA 3DLLF 3SCHA 1E17A 1GLHA 4K40A 1DZTA 1DU6A 1JZ6A 4G6TB 4BPZA 5EWSA 1JOBA 3IZOA 5FP8A 2IXIA 2L2OA 1FMVA 3RJPA 4Y20A 2EBIA 3TOBA 2GH8A 4CGZA 3Q8BA 1RI7A 4BA6A 4S04A 2XRNA 3JBG3 3ES1A 1TWHJ 2UY8A 1XNAA 3RKQA 2JG8B 3F21A 1YX3A 5FD6A 5FZLA 4M0NA 5TSWA 4E8CA 1L0OC 2KQRA 3HOWJ 2WAOA 2KZGA 3FX3A 4BXXJ 2V7FA 3MI8A 2ENRA 2ZACA 1ULEA 1HC8A 3QCWA 1HW5A 4LNVA 4MFDA 5FRNA 3C2HA 2BERA 4AM3A 5FY7A 5DG1A 2NZ9A 1YYVA 3WCRA 1UU4A 2Q0AA 5KXDA 2Y0SA 1BBYA 2DFEA 2QVOA 1XU2A 2VNRA 4JTNA 3IPVA 4RM3A 2QEXI 4XF0A 1QVUA 4Y4RA 3DF0A 5AFEA 4HOOA 4CU9A 4P08A 3VBRC 1S8NA 3QPLA 4HK9A 5ACA3 4E2SA 2X0LA 1DDLA 2R93J 3M8FA 3OYJA 1NY72 2WNUA 3ZMZA 1IPKA 3O0VA 1RUI1 1I6XA 1W6NB 4URTA 1JHNA 4XF3A 4NUBA 5E17F 3I2DA 5FOBB 3S2DJ 2EF6A 2JSPA 2CWMA 3V56A 1MJBA 3RZMA 2RG4A 1L7LA 3L00A 4G9SB 3OD0A 3D5RC 3S1RJ 1JTZX 4L2NA 2OA2A 5BXXA 1H0MA 2W39A 4CCJA 2LTPA 3BKZA 2CW7A 1RUE3 2ZGRA 1ORKA 3IAS2 1TT0A 3DKQA 1U8RA 2VU9A 3WTXC 4NIHA 2PN6A 1Y0UA 4S2DA 4YZ1A 4N7IA 1KQ8A 1J83A 1K78B 5DABA 4Q8LA 1CZSA 1VQNI 1OISA 3HEIA 4MSVA 5L36A 1A5JA 1Q8QA 3N7MA 4CDGA 1TC3C 1RITA 2RQPA 3RYRA 1S0CA 5JIUA 3CU7A 4KGGA 5FYZA 1U12A 3CDIA 3WTTC 4P5OA 4G8XA 1T6GC 1N75A 4AR2A 4MQVA 1CPNA 2R063 3BOPA 4AE2A 1RUD1 2B5HA 4CU7A 5LBEA 1V5EA 5J36A 5I0TA 3BR1A 2WWUA 3U4SA 4P5HA 3S6PA 4D5CA 4DXSA 2IGNA 3VBSB 4E7JA 4MXWB 3OYAA 2Y48A 2RQQA 4K6BA 3RMYA 5KXEA 2ZCWA 1XSRA 5FY4A 5CQGA 2YR2A 1TG7A 4BBRJ 3UYJA 1OLQA 4ISRA 1D4M1 1D7PM 3O8HA 3LF7A 1T6SA 3ZYJB 2FRHA 1BCXA 5EJZB 1Q1VA 3GCMA 3ZP5A 2DVAA 3A7QA 5KHKA 2JDYA 3ACLA 4BQ2A 2Z33A 1KGSA 1XE7A 5I8SA 1OVPA 4XF4A 1WCMJ 2FJ1A 1KONA 3WP4A 3KEOA 2MYSA 2PMZA 3TW6A 3RZOJ 3PJRA 4CUCA 1APLC 3H0OA 3K2OA 4IEPA 3LFKA 2JDZA 3WD5A 3FXLA 4QB2A 2FD8A 3C8XA 1C1FA 1HV1A 1PO13 3V8LA 4LBKA 3GEZA 3KV9A 1A04A 5F5IA 1OOPB 1QNWA 4FCAA 4P02B 2ZXQA 3H3ZA 2J1TA 1X50A 1K5MB 3V8KA 5E3NA 4XDPA 3SCGA 4PJJA 2MEV3 3WXPA 3O1UA 1FSEA 5B1AH 3DPTA 1E5SA 5GLUA 2EIJH 1YTYA 1DUXC 2VQLA 3ZPYA 1UY3A 4MFEA 3ZYFA 5A33B 4EJVA 2L4MA 4JQRA 4QPGB 2B8MA 3ACGA 3NRVA 1G9FA 4HXCA 3T4HB 3I3EA 3H8OA 5A7NA 4FVVA 4EN6B 4I30A 2JUCA 5CKQA 4AI2A 1W6PB 3ZOIA 2Q30A 3K4DA 1RUF3 1M1EB 1W8UA 1BQPA 5AC92 2IVJA 1IN5A 2PFBA 4KN4X 3MUY1 3POWA 2D5FA 1IUFA 1F4HA 2QZ2A 1WLDA 2R4GA 3W58A 1RC9A 5CYYA 3PIGA 3KCCA 4BXUA 4MGYE 4AWDA 2XLGA 1BMV1 3WGIA 1JYWA 2R7TA 4NHYA 3FXRA 2DDAA 2D43A 2X6WA 1HXS3 1UZYA 2GXBA 3ECQA 4AQSA 3OJBA 5SV5A 2M4KA 2QQNA 1J7KA 2VODA 4D6RA 2QWWA 4ESFA 3ACHA 3E6CC 4KWLA 4LK0F 1L7QA 2B9UA 3HSRA 5L3BA 1R1A1 2OQ7A 1O5LA 3ZLIA 3GF2A 1WUVA 5LA0A 4HG6B 2P4EA 3ERMA 3SZTA 5JZGC 4XTMA 1JZ8A 1J58A 1LKNA 2W1WA 1YFXA 4TLFA 2KD7A 2STWA 2H0VA 4LHNA 1Z9CA 2ZMEC 5HI0A 2E1MB 1GXQA 2MBFA 3R4KA 3FFZA 3QU6A 3HKZN 2I74A 1LOFC 4YW2A 3WCSA 1W6MB 2OT7A 1VQ5I 1C8NA 2WWYA 3B94A 3BG7A 5A7SA 2QQPA 4N53B 1NQJA 2DCJA 4XCAA 5AIPA 1IN6A 3S57A 2ERFA 2P6TA 4IKFA 5IP9J 2E2HJ 1R1ZA 1CD3G 4CEWA 1AOYA 4YGDA 4QGMA 5E6HA 3A0HC 1UW8A 3GBFA 5FZ7A 1XCVA 2MD0A 1CAUB 1UOBA 5J40A 4ASLA 5JOWA 2EH3A 2NS8A 1JYVA 1ZG1A 3PIOF 1HQLA 4E27A 1H30A 4RS8A 3C3VA 1FBQA 3IH4A 1QHDA 2Y9YA 1TWAJ 1FP2A 1AYM2 2HYKA 4XHXA 5ABJC 2DA3A 1QO0D 2E7AA 4KNCA 5SV8A 2W25A 1BEV2 4XBFA 4CEWB 3RS6A 2K27A 2WDBA 3UKGA 4YFXF 3OOPA 4R9DA 3KT1A 4EJRA 4CPBD 3FLPA 2AH2A 2MC4A 1QOOA 3JB8A 1QU0A 5GM0A 1YOVB 1AR83 4CVUA 4BB3A 5LBCA 2QQOA 4RBOA 3HSEA 4BJTA 1V6JA 5G04L 1Z6RA 4P1WA 3OV8A 4FFGA 1MH3A 1XX5A 2HWD2 5EGOA 2HYXA 2GC3A 1TQMA 2MW8A 2LKXA 4UW5A 4EQQA 2X51A 3PU8A 2VQGA 3WF3A 5IOYA 3VKNA 5BNNB 4ZONA 3LEGA 2DCTA 1U2WA 5T5OA 4BAYA 2XC7A 2HOAA 1QXPA 4F3JA 4QQHA 2LW8A 3H3VK 5HCAA 2RGVA 4Q4X1 4HSTA 3TL4X 5FJ8J 4XILA 1XNBA 1CAUA 1XGSA 3I2JA 1K7AA 2BQPA 5BNPA 5BNNA 2O5RA 2VOPA 1V6MA 1V5GA 3DPRA 3E1F1 2JPCA 4AI9A 2DCEA 2VN2A 1CESA 2XF5A 2V6CA 1FNNA 1FPN3 2WZPP 1W6NA 5HLIA 3BIWE 3JSOA 4FXKB 2WAFA 3S0MA 1WMDA 3ULQB 1HN0A 4P00B 4ONUA 3PNAA 3BB6A 4FAGA 5M0TA 4UUSB 4GD4A 4Y33A 4Y17A 4YRDA 2XSDC 2XVGA 3O7OA 4JVAA 2B7YA 2DI3A 1Y0NA 2N7GA 1DIWA 3ABTA 2ET7A 2YMZA 5GLTA 4MV2A 2PLYA 1YC61 5AIQA 3AKSA 1UG0A 5DDJ1 3BG5A 2IXKA 3ZDSA 2V09A 2P5BA 1T56A 2X1EA 3L2CA 1MZEA 1SD6A 2UUZA 1ZRFA 3DKWA 5IYCJ 2G1MA 4HFSA 2K2SA 2ZAAA 2VOXA 1NQDA 3THTA 4AU7A 3WT3A 3B93A 3U07A 4ARXA 3WOGA 3CBNA 4OHZA 4INDA 1ZGWA 1LEMA 2V5DA 3MFCA 1AR82 2ZXIA 2MC3A 1ETOA 3D4KA 4CDWC 4XIOA 2Q8OA 2NYYA 4A3IJ 4ATEA 3L2VA 3LSDA 4F92B 1X1PA 3DTIA 2VNVA 5DCFA 3FWEA 3HC7A 4S05A 3T5XA 3EQEA 2Z4FA 1R1VA 4UFLA 1VQ4I 1TW2A 2FEZA 2L02A 3AYDA 1W8ZA 3AAFA 2PHDA 4LMFA 1ZN2A 4NHJA 2W91A 3H8UA 3M8LA 2BRTA 3EB7A 4LQRA 3G1MA 3OBRA 2QQLA 4BK5A 1W8WA 2WR9A 2QQMA 3IDAA 3RYKA 2DFHA 3D0SA 2QDRA 3VBHB 4IXAA 2B4KA 3EYIA 4UVBA 2D7FA 1FJLA 1BR2A 1ZRIA 4XABA 1AZDA 3TO9A 4B43A 2O1QA 2CQ7A 1TME2 3MUZ1 2RMU3 4ETSA 1OBNA 3VYSB 4DEVA 1FT9A 1RHI2 5KHHA 4D94A 4YG0A 2Y38A 5J1XA 3OOUA 1JKOC 5CFCB 4XSXF 5C3QA 1E3PA 1BBT1 1LFUP 3UJOA 4WX9A 4W8JA 4YVWB 4CICA 1OCOH 2E35A 2HVRA 3Q9VA 1UY0A 5TRDA 4WM8A 5M3FJ 3DEWA 1XNCA 2VZPA 1VQOI 4XE9A 4S2HA 5FZEA 1PM4A 5ICCA 2F6BA 3KCXA 1PZ7A 2AEZA 3M07A 5DM7F 3AP9A 2JRTA 4ESBA 4B48A 1LEDA 2GA1A 2R062 1KDKA 5H9QA 3A0KA 3QRFF 2JICA 1VR3A 4LKSA 1WZ2A 3H0DA 3QWLA 4QHZA 1W1WE 2QQIA 1SFKA 1MS5A 4Q1PA 4G6DA 4WM8B 2ZBJA 3DUIA 1MDMA 3PIJA 2ADDA 4PIYA 2EXHA 3HUGB 1IO2A 2BBAA 3NNLA 4JOMA 1XXNA 2L7ZA 4IJAA 4LD5A 1T98A 4RM2A 4ZZDA 4PUSA 4XN3A 3HD8B 3IP4B 1GZTA 2FU4A 4AI0A 4KIFA 3DEUA 4IQJA 1IS3A 5FXWA 2VKDA 1RVF1 5FFZA 4E4ZA 3C2BA 4A3KJ 2ZHKA 1OQ1A 5A7WB 2ZMNA 3ZRGA 1SLIA 4L99A 2QUOA 4CP2A 2A7AA 3FIWA 3A1YA 2AXLA 2YY1A 4B3XA 1S3JA 3V64A 4QMAA 2XHKA 3HUGA 4MGKE 3LCPA 3POIA 2OZ6A 1WD3A 4FX4A 5EDNA 1POGA 2Y6LA 1NCQC 2NVQJ 1UIKA 5KK1A 2BE5F 3JB4C 4Y1XA 2PMWB 3WW3A 3I3QA 3SEQA 2BNOA 1BXHA 4HF2A 1NY71 3BC8A 4ZYEA 5H20A 3VZNA 1OFNA 1VBC3 4ESJA 3ABKH 4GGGA 4RB2C 1W6OA 3QQAA 2DDBA 3H1YA 3W21A 4N53A 2ESNA 3CP8A 3A4CA 4ZYHA 4A3FJ 3FLTA 3H9AA 4OINF 5LA9A 9ANTA 2VOTA 1ONAA 2DT7B 2GQQA 3ZXSA 4LB5A 3JBG1 3D5OA 1UWWA 1GR3A 5FY1A 2XJTA 5IT3A 4OIPF 3TBIA 2CDPA 2Z5WA 4ZY9A 3SEPA 3AMPA 1O7FA 1FLIA 1BIBA 2VW2A 5FQ0B 4XQ4A 4Y22A 3SZGA 3I4NJ 3ZR8X 2RS12 1R58A 2WRAA 1IQAA 5F04A 1MMGA 3ZMSA 5HVQC 3GFIA 2FXAA 3LA7A 4MGSA 1DBNA 2WA0A 1J0RA 4FPYA 4NNJA 4HETA 1LGBA 1UZWA 5JMCA 4ZZ5A 1ETWA 3V42A 3OGVA 1H4GA 5D5VB 3K10A 3E1SA 2RMU2 2WFF3 4AUXA 2WINB 2CWEA 2OD5A 1EUTA 4XOTA 4OZOA 1W2NA 1NA1C 3EHKA 4QXHA 3RFRA 2XBO3 3K4AA 5JVGF 3WODF 3AVSA 2YFUA 5LA1A 2NYXA 2COMA 3SDGA 2WNVC 2JIGA 3JSPA 3GLXA 2WWSA 2BOIA 3AZXA 3HZJA 4QX3A 3PDQA 4WV8A 3LEIA 4XC9A 2NVXJ 2ZXWH 3LSGA 2M7AA 4PGGA 3R6SA 4NO4A 4WZFA 1YXWA 3QODA 3L2QA 4FXGB 2HBTA 3W59A 2Y6KA 3UJQA 2R0QC 5KCMA 1ZG3A 3ASIA 3D82A 1PUFA 3IAM2 4JGYC 2K0GA 1EH7A 1E5HA 3VYTB 2A1XA 1LHOA 2FCVA 3ZQ7A 5FP9A 1PNFA 2JKXA 3VBOB 3JW4A 3R0RA 1COV2 1EUUA 4UV9A 1ZVFA 4C8DA 1OFSA 2MABA 5A6YA 5D8KB 4UVCA 3H36A 4UOJA 1OA2A 1Z0XA 3RPQA 5EGOB 4XONA 1PGL1 2A75A 1LOEA 1BR1A 2WFF1 5ANNA 4Y7NJ 5DAQA 4YIIA 2ICWG 1SFPA 2BEOA 1RIRA 5E18F 1BYHA 2Y0IA 1BC8C 1YIJI 1RINA 4CYDA 1GICA 2J22A 2EFPA 1ZAOA 4V2VA 4Y20B 5FLVA 5FYUA 2M34A 1W2TA 3V7CA 5F8PA 1E5RA 4AOCA 1IKPA 4RDUA 3P1IA 1UU6A 4Y5TA 4QXCA 1WKYA 4FETA 2VIXA 2ARXA 4FPFA 4JGYB 4IEYA 3MW2A 4KDPA 1TBXA 4I02A 1IKQA 4P96A 4M01A 1HKSA 2NVUB 4AWXB 3S7EA 3O1RA 2Z99A 3J7AO 2ZEXA 1JYIA 2YPRA 2RJLA 2AZ5A 2RKHA 2G9ZA 1BIAA 1YIOA 2PQ8A 2V9VA 2NP0A 4CRQA 1IQDC 1G3TA 4JKKA 4XUPA 4L9JA 4W65A 1LECA 2FF4A 3WNPA 3SH5A 1QDCA 2VGDA 1UF2C 1OYYA 3FHIB 4CZSA 1SDWA 2DMPA 5F3GA 2E32A 2W7NA 1J59A 4QX1A 3RPUA 2V26A 4PT6A 1NZCA 2A6XA 5JXJA 4MVTA 5IVJA 2CO5A 1D1AA 2MHFA 5IK7A 3GDBA 1H2MA 3IKWA 3NNJA 3N97A 1RUD2 2RV8A 4GB33 4CDQA 4IDZA 2R5YB 1HX6A 3ZM8A 2CY6A 1UPSA 2HDWA 1ZZ9A 3W6KB 4TWTA 1ZRCA 2O8OA 2F17A 1KFXL 1TNRA 3P9IA 3AKRA 1KU9A 1VQ6I 4DNYA 1W03A 1SG3A 1OC1A 4QM9A 2BDRA 3AMNA 2LUWA 2BY1A 2KIFA 3TNQA 3AFKA 3U11A 1QPMA 4OUEA 3ABZA 2UWBA 1LRHA 3RZJA 4BIOA 2EVXA 1USSA 4OCTA 5DUUA 2Z69A 3MQ0A 3OYGA 5DTDA 3LL7A 1ND2B 1OVSA 5DV5A 1I3AA 2QLZA 2VPRA 3VWBA 4RSUA 1W9WA 3ZKUA 1NG6A 1LU2A 4AQ2A 4M3FA 4JBAA 2YROA 2FMLA 2OXBA 3WZ1A 1IUYA 4ZXKA 5JUVA 3DU5A 4AFDA 2EIDA 3CCVI 4XURA 2BPA2 3BPVA 1S7AA 1IGOA 5LW9A 3FHNA 4OAZA 2DTWA 1YO8A 1PGW1 4LEJA 1I1GA 2UY9A 2CDOA 3W2WA 3BTZA 1JU4A 2UWAA 1AHSA 4HVOA 2DDUA 3FE5A 2IW5A 5DCMA 2F5DA 3SEZA 3THDA 4EGZA 1FPN1 3GXUA 3LNQA 3K1MA 1XDSA 2QSHX 1UX7A 1K61A 1Y9GA 3WNMA 3P9KA 4MEXF 1IAWA 5CJ9A 2Q2EB 2VPLA 4PJNA 4MHUA 5C4WB 1Z7LA 1REDA 2XGXA 1QOSA 1Z7S3 5H9SA 1AXZA 4UV8A 4CO8A 1BI1A 4S0HB 4BEHA 3QACA 4H55A 1CQTA 2M45A 3OG2A 3ZIWA 4CDXA 3AP5A 3B9CA 2ZX0A 2HWB2 5FKCA 2Q2EA 1C8M1 1F9NA 3GTLJ 3P6BA 3JTHA 3CMMA 4XMYA 2R042 4LOCA 1DGWA 1HB1A 1U5ZA 5FY8A 2K3FA 4RS5C 3CMEI 2JKBA 4UHTA 1PMIA 2EK5A 2CQXA 3BIEA 4L18B 4HK8A 1CR7A 2VQHA 3KWVA 1A8DA 4YPJA 4JAAA 5T52A 1VQLI 1H6XA 3I3DA 3K1NA 1IN8A 4C91A 3H0GJ 1ZX5A 4FBFA 4I76A 4Q4ZF 2ISZA 2EXKA 1ETQA 4G9YA 4K3UA 1Y4WA 3HTSB 4SBVA 4URAA 1IRXA 3CLPA 2OBPA 5A7WA 5LBBA 3C1DA 5F9TA 4L0PA 1FPQA 1K4SA 5F5QA 2FNAA 3FHQA 3KT7A 2FA5A 1FPN2 1UIJA 5K4LA 5E8GA 4JDOA 4BLJA 3UGFA 1MJ9A 2EB7A 2IZWA 2Z1DA 4QX5A 2DCZA 3K2AA 2VMIA 3ZFGA 1JJ8C 1G4DA 5DMYA 1CAXA 2V6EA 4R4ZA 2I07B 1GZWA 1CJDA 1LDDA 3V0AB 3ABLH 1Y8QB 3FMQA 4CCNA 3KP3A 3WV6A 3M1EA 1IW7F 4XQFA 4NRQA 2XXZA 1RIOH 3WQ7A 3GZTB 1MDMB 1EAH2 1FMD2 4NPLA 5F0CA 3BTIA 3PL0A 3JAMK 1T8IA 4TZDA 1YS7A 2HEOA 1S2EA 2M8GX 4LT5A 2RNJA 3VBSC 1H9PA 4XETA 5C8CB 3O2PE 1D0XA 5KVRA 3AP6A 1XNTA 5FMBA 3QPTA 1WA4A 1UZVA 2RS33 4QM8A 5JI9A 5KC6A 1GZWB 1P4XA 4IV1C 3PNYA 4NC6A 1HXS2 5C70A 2DFFA 3W2AA 1H8TA 4IEWA 1K5JA 5L7OB 4CEYC 1OYWA 5EEAA 3I54A 1H0BA 4HF1A 4TXWA 3WTUC 4H7MA 4HLTA 1GHCA 4U0YA 2YBKA 1GWMA 1K42A 1O4XA 2P6HA 5J3UA 5HBAA 3MV11 5FYYA 4YARA 3V0BA 3VN4A 2W95A 3H3UA 3F9KA 3ZPOA 5LY2A 1H8TC 4CCEA 4M3BA 3AG3H 3J4UH 1FBSA 4YG3A 3QOPA 2Q1MA 1AL0G 3LDRA 2ZJQF 4XXAA 4FQZA 2OUHA 2FQPA 5EJ1B 2GNDA 3OEBA 1IXSB 5J98B 1W0PA 2CQKA 4AI8A 1TME1 1S5LC 3S30A 4BUPA 3I3BA 1GQHA 4JX6A 2VCBA 2DVBA 4XOGA 4FOYA 4AVPA 4RGSA 5CFDA 2CW8A 4YM0A 5T5JA 1HQCA 2BOJA 1D0ZA 1ONVA 3MGUA 4HLXA 2E51A 3ABMH 4X8PA 2A07F 2HWB1 1GNHA 1FOWA 3AC0A 4OZXA 1QA6A 2D40A 3QU3A 4OHYA 3EYYA 2QKDA 4CUGA 1HB3A 1WZXA 2XH6A 2PFWA 2BHYA 2C6YA 1DDNA 1VRH2 2OVUA 5A3UA 2FDHA 4LO5B 4HF0A 3IC7A 3GGLA 2K9QA 1QH7A 4COUA 2MH9A 2FDGA 2BBYA 4RGRA 2WBMA 5EPAA 5F3IA 2BW3B 1DU0A 1WWYA 5DM6F 1ST8A 1W28A 1ZLKA 5BNPC 3FXJA 1N1SA 2ZKZA 2QBXA 1AL22 1YG2A 4XLPF 2XJSA 1XPWA 2ZMLA 1RUJ3 3ASOH 3IM0A 2EIEA 4I2OA 2CTVA 2L4AA 3BI3A 2JE8A 3WSOA 4LTAA 2KXLA 2AXTC 3ILNA 2DT6A 5HPOA 3ACFA 4AW7A 3HDDA 2VZRA 4B1MA 4CEWC 5IATA 1B6AA 3H42B 5FD5A 1LENA 3O8GA 3M1CA 3AVRA 3LAGA 4RFT0 2NLRA 1GLNA 3QBQA 2Y2ZA 1PK6C 2GOXB 2AGSA 1Z78A 4GJYA 4Q5SF 3UKVA 1KFUL 4QAWA 1AR73 4I3PA 2ZSIB 1CZTA 1B9MA 3KPHA 2ZX3A 5B1BH 1NTCA 4LBQB 3POGA 3NSTA 3IRQA 3CZ6A 4UVAA 3AJYA 2BVVA 3TOAA 4UBHA 3GALA 1UO9A 2EFNA 4CYCA 1OA3A 2VMCA 1GP4A 3M3CA 2G9WA 1ZR2A 1ZBE3 2VW1A 4QGLA 2YZ4A 1W8OA 4M71A 1UELB 5IAXA 2EFOA 2Y0MA 4LBMA 5JPNB 1O3SA 4AD9A 2VMFA 5GZCA 3SH3A 1W8TA 1TNFA 4PQ9A 1PVEA 4GMP0 1PIV3 5CVIA 2RR13 3HAGA 3FHZA 4RGGA 3W20A 3RWNA 1DGRA 2WO1A 5HDKA 3BVCA 4I01A 3N9QA 2F4LA 4BNCA 5HDNA 2J1VA 1ETXA 3F0CA 2Z42A 3DTKA 1MQTC 1Z7S2 2R7XA 4YVWC 4NHMA 2KP6A 3TN93 1ZKGA 2JD9A 5A2QK 3IN9A 1VB2A 1YI9A 3N9OA 4BJ5C 4P9YA 2V79A 3VV1A 3A01A 3RI4A 3J80K 2ECBA 4PJMA 2W47A 2Q1FA 5LD2C 5EEHA 2B0LA 4HBNA 1WJ5A 2A6YA 2DPUA 2XGEA 5J1RA 2WT0A 3IBMA 3SEEA 3MIBA 2FD5A 4WXDA 2CU5A 4KN7X 2VJ4A 3BJOA 4LBQA 5FMCA 3FXUA 2HOSA 1ZZ8A 3NRUA 4MXWA 3HOSA 2ME0A 1JUSA 4PSWA 1CF7B 4D6SA 1FYKA 1ZR4A 1IRZA 5LHGA 1TWGJ 3MZHA 1YHQI 4QLCU 2ACJA 3AMQA 3SYTA 3EUHA 4Y24A 2ELJA 1DF0A 1LOCA 2VOKA 1SBDA 2VL4A 2W5FA 2E33A 1EF4A 2ORXA 5CYVA 3O1MA 3MKZA 5LHIA 3K2ZA 4A6SA 2WS91 2MEV1 3VHRA 1AR72 3FXMA 1RUF1 2CRGA 4LBLA 4KWJA 2BFUL 4YW1A 2H6CA 4GAZA 2ZJCA 3T8RA 2QYOA 4IHVA 1BM9A 2NM1A 3PNTA 4ZHNA 3TEYA 3DV8A 3LOBA 4YEJA 2NOJB 5FXXA 3NV3A 4V2WA 2JG8A 2PHFA 4FPOB 2ZFUA 2FDIA 5HOOA 1ULPA 1QWRA 3CF6E 4WCGA 3NEUA 3I56I 1SLAA 5K7FA 1YYNA 4A41A 3OR1C 4A69C 2P2KA 3C2GA 2R7EB 4QGNA 2XAHA 4A44A 2EV0A 1ASJ3 3WHBA 4FE7A 4BQQA 3NAPB 1HN1A 3LAPA 4WXHA 1KJRA 4BOWA 1G8XA 2IXHA 4FO9A 2M0MA 5E88A 5JI6A 3CCQI 1Q43A 3MN2A 4B1RA 2QQAA 3ZMDA 1B09A 1AR62 1GXPA 2F4PA 2JZYA 2C0ZA 4LLOA 4Z07A 3KZ4C 4ZKTB 2E7QA 4KQ7A 4LKEA 2XUBA 3M3YJ 3ZMOA 5J3LA 1RL3A 2WN3A 1A35A 4YWAA 4YVSC 2BP6A 2W68A 3MW3A 2XDVA 4KL1A 5FLJA 2WV0A 3RZGA 4XLCA 3D0JA 5I0RA 1DQ6A 1SVOA 1DCSA 1ND3A 3HRTA 1F4KA 3PUIA 1EH6A 5JHFA 3VBUB 4F52A 2FBEA 1ASJ2 1J2XA 3VLBB 3I53A 5CG8A 2E1CA 2DOFA 4WVMB 2WZR3 5IFTA 4BGDA 3FXQA 1R5ID 3CF5F 1ULGA 3MVPA 4YVSB 3I4IA 5IVYA 3IUOA 1QZEA 3P5BA 4HA8A 4FPEA 3WW2A 1HRI2 2F5CA 4C3IJ 3FBMA 5HCHA 4A3MJ 3ABUA 4NQWB 4ENKA 4KISA 2DOAA 4HQMA 3IAPA 2E2IJ 1R5HA 5CFDC 4CA0A 4P9GA 2Y60A 2BFUS 4JDMA 4P9JA 3WHTA 1G9CA 1UMHA 1LOBA 1ZBE1 2ZGUA 2WY8Q 2OPTA 4GALA 3U2RA 2P3JA 1LNSA 4XLFA 4YVSA 2HQ5A 1X58A 3KP4A 5C8WA 4V19K 4OMCA 3Q9SA 2KR2A 2V9PA 4JDNA 5HNFA 3P9CA 2K3PA 4B7EA 3K7AJ 1B9NA 3RMXA 1AYN1 4PK4A 3CO6C 5E3LA 1MIJA 3AL0C 3CMYA 1R64A 2HWC3 1ND3B 4YFWA 4ASNA 3ZFFA