3HIMA

The crystal structure of a bacterial regulatory protein in the tetr family from rhodococcus rha1 to 2.2a
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
190
Chain Sequence
TSKAAARIRAAAIEVFAAKGYGATTTREIAASLDMSPGAVYPHYKTKESLLYAISLEGHHSVLAAITAADFPDIAAPDRLMSTVTAYVTWHADNRASARVGQYELRSLSPEHFAIIADIRRSTTKVFTRIIEAGATAGDFHPFDIEAAALAITSLGIDVSRWFPSHTYSDPRIIAARYVELALRMVGCAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Bacterial Regulatory Protein in the tetR Family from Rhodococcus RHA1 to 2.2A
rcsb
source organism Rhodococcus jostii
molecule tags Transcription regulator
molecule keywords Probable transcriptional regulator
total genus 74
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3himA00
3BCGA 4ACIA 3BR3A 4AC0A 5D1RA 3HTHA 4M3BA 3LSJA 3BR5A 2JJ7A 2FQ4A 1U9NA 2ZOYA 2QIBA 3KZ9A 4GFLA 5IOYA 4W97A 3T6NA 2NX4A 5F1JA 1Z0XA 3HTIA 4MK6A 3HTAA 3CCYA 3PM1A 2TCTA 3ANGA 4GCTA 2HXIA 4I76A 2XPVA 2VKEA 3FK6A 2G7GA 1JTXA 3LSRA 2NS8A 5CW8A 3C07A 3VP5A 4D7NA 3V78A 4JYKA 3EGQA 3TP3A 1Z77A 3MNLA 4V2FA 3IH3A 2VKVA 4JNNA 3VVZA 1U9OA 3VVYA 3PPBA 3VPRA 4JKZA 3TP0A 2IEKA 2JK3A 3Q0VA 1T56A 3QPLA 2OERA 3QBMA 2RAEA 5FGLA 2NP5A 2I10A 2NP3A 2ZCNA 3G56A 3FIWA 3Q3SA 4D5CA 5K58A 3ZQFA 2TRTA 3C2BA 5FKKA 3LWJA 2XRLA 2HQ5A 2IBDA 3ON2A 1BJZA 3CRJA 4I6ZA 3BJBA 5FKLA 2XGDA 3O60A 3LOCA 3VW1A 3CDLA 4AF5A 2X6OA 2X9DA 2EH3A 3VW2A 1QVTA 3QQAA 2QTQA 2HKUA 4B1RA 2GFNA 3COLA 2ID3A 3HE0A 3DPJA 3F0CA 5FHPA 5GPCA 4HKUA 3JSJA 4X1EA 5DAJA 3BT9A 2ZB9A 5GP9A 5IP6A 3G1LA 4ICHA 2FD5A 2OF7A 3HTJA 5HBUA 2FBQA 3O8GA 3GEUA 2XPUA 2UXHA 5GPAA 3P9TA 2Y30A 2Y2ZA 3HGYA 2WGBA 2O7TA 3G7RA 4DW6A 3IH2A 2HYJA 2YVHA 4M3EA 2IU5A 4YZEA 1ZKGA 5F27A 3IH4A 2DG7A 2OPTA 2GUHA 1A6IA 2RASA 3BR6A 2ID6A 2F07A 3ZQGA 2DTZA 4ABZA 5F0CA 2PBXA 4GCKA 5J1RA 2QCOA 4KWAA 3DCFA 5AQCA 5FKNA 2G0EA 2UXUA 5HSZA 3BNIA 3KNWA 1ZK8A 3AQTA 2RHAA 5F04A 1UI6A 5K7FA 2PZ9A 3B81A 5IPAA 1JT0A 2W53A 2ZOZA 3LJLA 3SDGA 4CGRA 3NNRA 2G7LA 5FKOA 3QKXA 5EZHA 3G1MA 3VW0A 1JUPA 5H9TA 5J1YA 2QKOA 2XGCA 3AQSA 4D5FA 2XPWA 2HXOA 5EZGA 3ON4A 2WV1A 3Q0WA 1QPIA 2QOPA 3ANPA 4ME9A 3RD3A 4NELA 5CXIA 3VVXA 3LHQA 1VI0A 3BR2A 2WUIA 1JUMA 5D19A 5EYRA 4M3DA 3SFIA 1SGMA 4XK4A 2V57A 4MO7A 3BTJA 1UI5A 3G1OA 3BR0A 2Q24A 4D7MA 4V2GA 1QVUA 4L62A 1RKTA 3BQYA 2UXPA 1RPWA 1ORKA 2VPRA 3BRUA 2ZCXA 5HAWA 4M3FA 3S5RA 3QPSA 4W1UA 1JTYA 3V6GA 5EFYA 2OI8A 2NS7A 4M3GA 4G12A 5FKMA 2QWTA 3FK7A 3MVPA 4MXMA 3BTIA 2GENA 3RH2A 2DG8A 2Y31A 4UDSA 3KKCA 3NRGA 4GFKA 3IUVA 4JL3A 5IOZA 2REKA 5F0FA 3F1BA 3VOKA 3ZQLA 3NXCA 4PXIA 4GCLA 2G7SA 1JT6A 3B6CA 2ZCMA 2G3BA 3BHQA 3PASA 4B3AA 5F08A 1RKWA 3B6AA 2FX0A 3BTCA 3BR1A 2GBYA 4AC6A 3BQZA 3WHBA 3KKDA 3GZIA 3WHCA 3NI7A 3VOXA 3ZQIA 3NPIA 1JUSA 3FRQA 3DEWA 4NN1A 5J1UA 3Q0UA 2IAIA 2UXOA 2XGEA 2O7OA 5D18A 2YVEA 5J3LA 5F0HA 3HGGA 5C4YA 3CWRA 2FJ1A 2D6YA 1T33A 2XB5A 2XDNA 5K7HA 4AUXA 3ZQHA 5K7ZA 3E7QA 3VUQA 5CXGA 3BTLA 3O8HA 3CJDA 3EUPA 5FMPA 3LSPA 3HIMA 2HYTA 3VIBA 2UXIA
chains in the Genus database with same CATH superfamily
3BCGA 4ACIA 3BR3A 4AC0A 5D1RA 5CQGA 3HTHA 4M3BA 3LSJA 3BR5A 2JJ7A 2FQ4A 1U9NA 2ZOYA 2QIBA 3KZ9A 4GFLA 5IOYA 2PFVA 4W97A 4U9NA 3T6NA 2NX4A 5F1JA 1Z0XA 3DU6A 3HTIA 4MK6A 3HTAA 3CCYA 3PM1A 4OD4A 2TCTA 3ANGA 4GCTA 2HXIA 4I76A 2XPVA 2VKEA 3FK6A 2G7GA 1JTXA 3LSRA 2NS8A 5CW8A 3C07A 3VP5A 4D7NA 3V78A 4JYKA 4C2MA 3EGQA 3TP3A 1Z77A 3MNLA 4V2FA 3IH3A 4JNNA 2VKVA 3VVZA 4OD5A 4U9LA 1U9OA 3DU5A 3VVYA 3PPBA 3VPRA 4JKZA 3TP0A 2IEKA 2JK3A 3Q0VA 1T56A 3QPLA 2OERA 3QBMA 2RAEA 5FGLA 2NP5A 2I10A 2NP3A 2ZCNA 3G56A 3FIWA 3Q3SA 4D5CA 5K58A 3ZQFA 2TRTA 3C2BA 2R7UA 5FKKA 3LWJA 2XRLA 2HQ5A 2IBDA 3ON2A 3NS4A 1BJZA 3CRJA 4I6ZA 3BJBA 5FKLA 2XGDA 3O60A 3LOCA 3VW1A 3CDLA 4AF5A 2X6OA 2X9DA 2EH3A 3VW2A 1QVTA 3QQAA 2QTQA 2HKUA 4B1RA 2GFNA 3COLA 2ID3A 3HE0A 3DPJA 3F0CA 5FHPA 5GPCA 4HKUA 3JSJA 4X1EA 5DAJA 3BT9A 2ZB9A 5GP9A 5IP6A 3G1LA 4ICHA 2R7VA 2FD5A 2OF7A 3HTJA 5HBUA 2FBQA 3O8GA 3GEUA 2XPUA 2UXHA 2ZY9A 5GPAA 2B1EA 3P9TA 2R7QA 2Y30A 2Y2ZA 3FHNA 2R7OA 3HGYA 4IRVA 2WGBA 2O7TA 3G7RA 4DW6A 3IH2A 2HYJA 2YVHA 4M3EA 2IU5A 4YZEA 1ZKGA 5F27A 3KYLA 3IH4A 2DG7A 2OPTA 2R7XA 2GUHA 1A6IA 2RASA 3BR6A 2ID6A 2F07A 3ZQGA 2DTZA 4ABZA 5F0CA 2PBXA 4GCKA 5J1RA 4DVYP 2QCOA 4KWAA 3DCFA 5AQCA 5FKNA 2G0EA 2UXUA 5HSZA 3BNIA 3KNWA 1ZK8A 3AQTA 2RHAA 5F04A 1UI6A 5K7FA 2PZ9A 3B81A 5IPAA 1JT0A 2W53A 2ZOZA 3LJLA 3SDGA 4CGRA 3NNRA 2G7LA 5FKOA 2B3WA 3QKXA 5EZHA 3G1MA 3VW0A 1JUPA 5H9TA 2R7TA 3VTIA 5J1YA 2QKOA 2XGCA 3AQSA 4D5FA 2XPWA 2HXOA 5EZGA 3ON4A 2WV1A 3Q0WA 1QPIA 2QOPA 3ANPA 4ME9A 3RD3A 2A2FX 4NELA 5CXIA 3VVXA 3LHQA 1VI0A 2YVXA 3BR2A 2WUIA 1JUMA 5D19A 5EYRA 4M3DA 3SFIA 1SGMA 4XK4A 2V57A 4MO7A 3BTJA 1UI5A 4WIBA 3G1OA 3SWHA 3BR0A 2Q24A 4D7MA 4V2GA 1QVUA 4L62A 1RKTA 3BQYA 2UXPA 1RPWA 1ORKA 2VPRA 3BRUA 2ZCXA 5HAWA 4M3FA 3S5RA 3QPSA 4W1UA 1JTYA 3V6GA 5EFYA 2OI8A 2NS7A 4M3GA 4G12A 3K8PC 5FKMA 2QWTA 3FK7A 3MVPA 4MXMA 3BTIA 2R7RA 2GENA 3RH2A 2DG8A 2Y31A 4UDSA 3KKCA 3NRGA 4GFKA 3IUVA 4JL3A 5IOZA 2REKA 5F0FA 3F1BA 3VOKA 3ZQLA 3NXCA 4PXIA 4GCLA 2G7SA 2R7SA 1JT6A 3B6CA 2ZCMA 2G3BA 3BHQA 3PASA 4B3AA 5F08A 1RKWA 3B6AA 2FX0A 3BTCA 3BR1A 2GBYA 4AC6A 3BQZA 3WHBA 3KKDA 3GZIA 3WHCA 3NI7A 3VOXA 3ZQIA 3NPIA 1JUSA 3FRQA 3DEWA 4NN1A 5J1UA 3Q0UA 2IAIA 2UXOA 2XGEA 2O7OA 5D18A 2YVEA 5J3LA 5F0HA 3HGGA 5C4YA 3CWRA 2FJ1A 2D6YA 1T33A 2XB5A 2XDNA 5K7HA 4AUXA 3ZQHA 5K7ZA 3E7QA 3VUQA 2FJI1 5CXGA 3BTLA 3O8HA 3CJDA 3EUPA 5FMPA 2R7WA 3HIMA 3LSPA 2HYTA 3VIBA 2UXIA
chains in the Genus database with same CATH topology
3BCGA 4ACIA 3BR3A 4AC0A 5D1RA 3HTHA 4M3BA 3LSJA 3BR5A 2JJ7A 2FQ4A 1U9NA 2ZOYA 2QIBA 3KZ9A 4GFLA 5IOYA 4W97A 3T6NA 2NX4A 5F1JA 1Z0XA 3HTIA 4MK6A 3HTAA 3CCYA 3PM1A 2TCTA 3ANGA 4GCTA 2HXIA 4I76A 2XPVA 2VKEA 3FK6A 2G7GA 1JTXA 3LSRA 2NS8A 5CW8A 3C07A 3VP5A 4D7NA 3V78A 4JYKA 3EGQA 3TP3A 1Z77A 3MNLA 4V2FA 3IH3A 2VKVA 4JNNA 3VVZA 1U9OA 3VVYA 3PPBA 3VPRA 4JKZA 3TP0A 2IEKA 2JK3A 3Q0VA 1T56A 3QPLA 2OERA 3QBMA 2RAEA 5FGLA 2NP5A 2I10A 2NP3A 2ZCNA 3G56A 3FIWA 3Q3SA 4D5CA 5K58A 3ZQFA 2TRTA 3C2BA 5FKKA 3LWJA 2XRLA 2HQ5A 2IBDA 3ON2A 1BJZA 3CRJA 4I6ZA 3BJBA 5FKLA 2XGDA 3O60A 3LOCA 3VW1A 3CDLA 4AF5A 2X6OA 2X9DA 2EH3A 3VW2A 1QVTA 3QQAA 2QTQA 2HKUA 4B1RA 2GFNA 3COLA 2ID3A 3HE0A 3DPJA 3F0CA 5FHPA 5GPCA 4HKUA 3JSJA 4X1EA 5DAJA 3BT9A 2ZB9A 5GP9A 5IP6A 3G1LA 4ICHA 2FD5A 2OF7A 3HTJA 5HBUA 2FBQA 3O8GA 3GEUA 2XPUA 2UXHA 5GPAA 3P9TA 2Y30A 2Y2ZA 3HGYA 2WGBA 2O7TA 3G7RA 4DW6A 3IH2A 2HYJA 2YVHA 4M3EA 2IU5A 4YZEA 1ZKGA 5F27A 3IH4A 2DG7A 2OPTA 2GUHA 1A6IA 2RASA 3BR6A 2ID6A 2F07A 3ZQGA 2DTZA 4ABZA 5F0CA 2PBXA 4GCKA 5J1RA 2QCOA 4KWAA 3DCFA 5AQCA 5FKNA 2G0EA 2UXUA 5HSZA 3BNIA 3KNWA 1ZK8A 3AQTA 2RHAA 5F04A 1UI6A 5K7FA 2PZ9A 3B81A 5IPAA 1JT0A 2W53A 2ZOZA 3LJLA 3SDGA 4CGRA 3NNRA 2G7LA 5FKOA 3QKXA 5EZHA 3G1MA 3VW0A 1JUPA 5H9TA 5J1YA 2QKOA 2XGCA 3AQSA 4D5FA 2XPWA 2HXOA 5EZGA 3ON4A 2WV1A 3Q0WA 1QPIA 2QOPA 3ANPA 4ME9A 3RD3A 4NELA 5CXIA 3VVXA 3LHQA 1VI0A 3BR2A 2WUIA 1JUMA 5D19A 5EYRA 4M3DA 3SFIA 1SGMA 4XK4A 2V57A 4MO7A 3BTJA 1UI5A 3G1OA 3BR0A 2Q24A 4D7MA 4V2GA 1QVUA 4L62A 1RKTA 3BQYA 2UXPA 1RPWA 1ORKA 2VPRA 3BRUA 2ZCXA 5HAWA 4M3FA 3S5RA 3QPSA 4W1UA 1JTYA 3V6GA 5EFYA 2OI8A 2NS7A 4M3GA 4G12A 5FKMA 2QWTA 3FK7A 3MVPA 4MXMA 3BTIA 2GENA 3RH2A 2DG8A 2Y31A 4UDSA 3KKCA 3NRGA 4GFKA 3IUVA 4JL3A 5IOZA 2REKA 5F0FA 3F1BA 3VOKA 3ZQLA 3NXCA 4PXIA 4GCLA 2G7SA 1JT6A 3B6CA 2ZCMA 2G3BA 3BHQA 3PASA 4B3AA 5F08A 1RKWA 3B6AA 2FX0A 3BTCA 3BR1A 2GBYA 4AC6A 3BQZA 3WHBA 3KKDA 3GZIA 3WHCA 3NI7A 3VOXA 3ZQIA 3NPIA 1JUSA 3FRQA 3DEWA 4NN1A 5J1UA 3Q0UA 2IAIA 2UXOA 2XGEA 2O7OA 5D18A 2YVEA 5J3LA 5F0HA 3HGGA 5C4YA 3CWRA 2FJ1A 2D6YA 1T33A 2XB5A 2XDNA 5K7HA 4AUXA 3ZQHA 5K7ZA 3E7QA 3VUQA 5CXGA 3BTLA 3O8HA 3CJDA 3EUPA 5FMPA 3LSPA 3HIMA 2HYTA 3VIBA 2UXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCG A;  4ACI A;  3BR3 A;  4AC0 A;  5D1R A;  3HTH A;  4M3B A;  3LSJ A;  3BR5 A;  2JJ7 A;  2FQ4 A;  1U9N A;  2ZOY A;  2QIB A;  3KZ9 A;  4GFL A;  5IOY A;  4W97 A;  3T6N A;  2NX4 A;  5F1J A;  1Z0X A;  3HTI A;  4MK6 A;  3HTA A;  3CCY A;  3PM1 A;  2TCT A;  3ANG A;  4GCT A;  2HXI A;  4I76 A;  2XPV A;  2VKE A;  3FK6 A;  2G7G A;  1JTX A;  3LSR A;  2NS8 A;  5CW8 A;  3C07 A;  3VP5 A;  4D7N A;  3V78 A;  4JYK A;  3EGQ A;  3TP3 A;  1Z77 A;  3MNL A;  4V2F A;  3IH3 A;  2VKV A;  4JNN A;  3VVZ A;  1U9O A;  3VVY A;  3PPB A;  3VPR A;  4JKZ A;  3TP0 A;  2IEK A;  2JK3 A;  3Q0V A;  1T56 A;  3QPL A;  2OER A;  3QBM A;  2RAE A;  5FGL A;  2NP5 A;  2I10 A;  2NP3 A;  2ZCN A;  3G56 A;  3FIW A;  3Q3S A;  4D5C A;  5K58 A;  3ZQF A;  2TRT A;  3C2B A;  5FKK A;  3LWJ A;  2XRL A;  2HQ5 A;  2IBD A;  3ON2 A;  1BJZ A;  3CRJ A;  4I6Z A;  3BJB A;  5FKL A;  2XGD A;  3O60 A;  3LOC A;  3VW1 A;  3CDL A;  4AF5 A;  2X6O A;  2X9D A;  2EH3 A;  3VW2 A;  1QVT A;  3QQA A;  2QTQ A;  2HKU A;  4B1R A;  2GFN A;  3COL A;  2ID3 A;  3HE0 A;  3DPJ A;  3F0C A;  5FHP A;  5GPC A;  4HKU A;  3JSJ A;  4X1E A;  5DAJ A;  3BT9 A;  2ZB9 A;  5GP9 A;  5IP6 A;  3G1L A;  4ICH A;  2FD5 A;  2OF7 A;  3HTJ A;  5HBU A;  2FBQ A;  3O8G A;  3GEU A;  2XPU A;  2UXH A;  5GPA A;  3P9T A;  2Y30 A;  2Y2Z A;  3HGY A;  2WGB A;  2O7T A;  3G7R A;  4DW6 A;  3IH2 A;  2HYJ A;  2YVH A;  4M3E A;  2IU5 A;  4YZE A;  1ZKG A;  5F27 A;  3IH4 A;  2DG7 A;  2OPT A;  2GUH A;  1A6I A;  2RAS A;  3BR6 A;  2ID6 A;  2F07 A;  3ZQG A;  2DTZ A;  4ABZ A;  5F0C A;  2PBX A;  4GCK A;  5J1R A;  2QCO A;  4KWA A;  3DCF A;  5AQC A;  5FKN A;  2G0E A;  2UXU A;  5HSZ A;  3BNI A;  3KNW A;  1ZK8 A;  3AQT A;  2RHA A;  5F04 A;  1UI6 A;  5K7F A;  2PZ9 A;  3B81 A;  5IPA A;  1JT0 A;  2W53 A;  2ZOZ A;  3LJL A;  3SDG A;  4CGR A;  3NNR A;  2G7L A;  5FKO A;  3QKX A;  5EZH A;  3G1M A;  3VW0 A;  1JUP A;  5H9T A;  5J1Y A;  2QKO A;  2XGC A;  3AQS A;  4D5F A;  2XPW A;  2HXO A;  5EZG A;  3ON4 A;  2WV1 A;  3Q0W A;  1QPI A;  2QOP A;  3ANP A;  4ME9 A;  3RD3 A;  4NEL A;  5CXI A;  3VVX A;  3LHQ A;  1VI0 A;  3BR2 A;  2WUI A;  1JUM A;  5D19 A;  5EYR A;  4M3D A;  3SFI A;  1SGM A;  4XK4 A;  2V57 A;  4MO7 A;  3BTJ A;  1UI5 A;  3G1O A;  3BR0 A;  2Q24 A;  4D7M A;  4V2G A;  1QVU A;  4L62 A;  1RKT A;  3BQY A;  2UXP A;  1RPW A;  1ORK A;  2VPR A;  3BRU A;  2ZCX A;  5HAW A;  4M3F A;  3S5R A;  3QPS A;  4W1U A;  1JTY A;  3V6G A;  5EFY A;  2OI8 A;  2NS7 A;  4M3G A;  4G12 A;  5FKM A;  2QWT A;  3FK7 A;  3MVP A;  4MXM A;  3BTI A;  2GEN A;  3RH2 A;  2DG8 A;  2Y31 A;  4UDS A;  3KKC A;  3NRG A;  4GFK A;  3IUV A;  4JL3 A;  5IOZ A;  2REK A;  5F0F A;  3F1B A;  3VOK A;  3ZQL A;  3NXC A;  4PXI A;  4GCL A;  2G7S A;  1JT6 A;  3B6C A;  2ZCM A;  2G3B A;  3BHQ A;  3PAS A;  4B3A A;  5F08 A;  1RKW A;  3B6A A;  2FX0 A;  3BTC A;  3BR1 A;  2GBY A;  4AC6 A;  3BQZ A;  3WHB A;  3KKD A;  3GZI A;  3WHC A;  3NI7 A;  3VOX A;  3ZQI A;  3NPI A;  1JUS A;  3FRQ A;  3DEW A;  4NN1 A;  5J1U A;  3Q0U A;  2IAI A;  2UXO A;  2XGE A;  2O7O A;  5D18 A;  2YVE A;  5J3L A;  5F0H A;  3HGG A;  5C4Y A;  3CWR A;  2FJ1 A;  2D6Y A;  1T33 A;  2XB5 A;  2XDN A;  5K7H A;  4AUX A;  3ZQH A;  5K7Z A;  3E7Q A;  3VUQ A;  5CXG A;  3BTL A;  3O8H A;  3CJD A;  3EUP A;  5FMP A;  3LSP A;  3HIM A;  2HYT A;  3VIB A;  2UXI A; 
#chains in the Genus database with same CATH topology
 3BCG A;  4ACI A;  3BR3 A;  4AC0 A;  5D1R A;  5CQG A;  3HTH A;  4M3B A;  3LSJ A;  3BR5 A;  2JJ7 A;  2FQ4 A;  1U9N A;  2ZOY A;  2QIB A;  3KZ9 A;  4GFL A;  5IOY A;  2PFV A;  4W97 A;  4U9N A;  3T6N A;  2NX4 A;  5F1J A;  1Z0X A;  3DU6 A;  3HTI A;  4MK6 A;  3HTA A;  3CCY A;  3PM1 A;  4OD4 A;  2TCT A;  3ANG A;  4GCT A;  2HXI A;  4I76 A;  2XPV A;  2VKE A;  3FK6 A;  2G7G A;  1JTX A;  3LSR A;  2NS8 A;  5CW8 A;  3C07 A;  3VP5 A;  4D7N A;  3V78 A;  4JYK A;  4C2M A;  3EGQ A;  3TP3 A;  1Z77 A;  3MNL A;  4V2F A;  3IH3 A;  4JNN A;  2VKV A;  3VVZ A;  4OD5 A;  4U9L A;  1U9O A;  3DU5 A;  3VVY A;  3PPB A;  3VPR A;  4JKZ A;  3TP0 A;  2IEK A;  2JK3 A;  3Q0V A;  1T56 A;  3QPL A;  2OER A;  3QBM A;  2RAE A;  5FGL A;  2NP5 A;  2I10 A;  2NP3 A;  2ZCN A;  3G56 A;  3FIW A;  3Q3S A;  4D5C A;  5K58 A;  3ZQF A;  2TRT A;  3C2B A;  2R7U A;  5FKK A;  3LWJ A;  2XRL A;  2HQ5 A;  2IBD A;  3ON2 A;  3NS4 A;  1BJZ A;  3CRJ A;  4I6Z A;  3BJB A;  5FKL A;  2XGD A;  3O60 A;  3LOC A;  3VW1 A;  3CDL A;  4AF5 A;  2X6O A;  2X9D A;  2EH3 A;  3VW2 A;  1QVT A;  3QQA A;  2QTQ A;  2HKU A;  4B1R A;  2GFN A;  3COL A;  2ID3 A;  3HE0 A;  3DPJ A;  3F0C A;  5FHP A;  5GPC A;  4HKU A;  3JSJ A;  4X1E A;  5DAJ A;  3BT9 A;  2ZB9 A;  5GP9 A;  5IP6 A;  3G1L A;  4ICH A;  2R7V A;  2FD5 A;  2OF7 A;  3HTJ A;  5HBU A;  2FBQ A;  3O8G A;  3GEU A;  2XPU A;  2UXH A;  2ZY9 A;  5GPA A;  2B1E A;  3P9T A;  2R7Q A;  2Y30 A;  2Y2Z A;  3FHN A;  2R7O A;  3HGY A;  4IRV A;  2WGB A;  2O7T A;  3G7R A;  4DW6 A;  3IH2 A;  2HYJ A;  2YVH A;  4M3E A;  2IU5 A;  4YZE A;  1ZKG A;  5F27 A;  3KYL A;  3IH4 A;  2DG7 A;  2OPT A;  2R7X A;  2GUH A;  1A6I A;  2RAS A;  3BR6 A;  2ID6 A;  2F07 A;  3ZQG A;  2DTZ A;  4ABZ A;  5F0C A;  2PBX A;  4GCK A;  5J1R A;  4DVY P;  2QCO A;  4KWA A;  3DCF A;  5AQC A;  5FKN A;  2G0E A;  2UXU A;  5HSZ A;  3BNI A;  3KNW A;  1ZK8 A;  3AQT A;  2RHA A;  5F04 A;  1UI6 A;  5K7F A;  2PZ9 A;  3B81 A;  5IPA A;  1JT0 A;  2W53 A;  2ZOZ A;  3LJL A;  3SDG A;  4CGR A;  3NNR A;  2G7L A;  5FKO A;  2B3W A;  3QKX A;  5EZH A;  3G1M A;  3VW0 A;  1JUP A;  5H9T A;  2R7T A;  3VTI A;  5J1Y A;  2QKO A;  2XGC A;  3AQS A;  4D5F A;  2XPW A;  2HXO A;  5EZG A;  3ON4 A;  2WV1 A;  3Q0W A;  1QPI A;  2QOP A;  3ANP A;  4ME9 A;  3RD3 A;  2A2F X;  4NEL A;  5CXI A;  3VVX A;  3LHQ A;  1VI0 A;  2YVX A;  3BR2 A;  2WUI A;  1JUM A;  5D19 A;  5EYR A;  4M3D A;  3SFI A;  1SGM A;  4XK4 A;  2V57 A;  4MO7 A;  3BTJ A;  1UI5 A;  4WIB A;  3G1O A;  3SWH A;  3BR0 A;  2Q24 A;  4D7M A;  4V2G A;  1QVU A;  4L62 A;  1RKT A;  3BQY A;  2UXP A;  1RPW A;  1ORK A;  2VPR A;  3BRU A;  2ZCX A;  5HAW A;  4M3F A;  3S5R A;  3QPS A;  4W1U A;  1JTY A;  3V6G A;  5EFY A;  2OI8 A;  2NS7 A;  4M3G A;  4G12 A;  3K8P C;  5FKM A;  2QWT A;  3FK7 A;  3MVP A;  4MXM A;  3BTI A;  2R7R A;  2GEN A;  3RH2 A;  2DG8 A;  2Y31 A;  4UDS A;  3KKC A;  3NRG A;  4GFK A;  3IUV A;  4JL3 A;  5IOZ A;  2REK A;  5F0F A;  3F1B A;  3VOK A;  3ZQL A;  3NXC A;  4PXI A;  4GCL A;  2G7S A;  2R7S A;  1JT6 A;  3B6C A;  2ZCM A;  2G3B A;  3BHQ A;  3PAS A;  4B3A A;  5F08 A;  1RKW A;  3B6A A;  2FX0 A;  3BTC A;  3BR1 A;  2GBY A;  4AC6 A;  3BQZ A;  3WHB A;  3KKD A;  3GZI A;  3WHC A;  3NI7 A;  3VOX A;  3ZQI A;  3NPI A;  1JUS A;  3FRQ A;  3DEW A;  4NN1 A;  5J1U A;  3Q0U A;  2IAI A;  2UXO A;  2XGE A;  2O7O A;  5D18 A;  2YVE A;  5J3L A;  5F0H A;  3HGG A;  5C4Y A;  3CWR A;  2FJ1 A;  2D6Y A;  1T33 A;  2XB5 A;  2XDN A;  5K7H A;  4AUX A;  3ZQH A;  5K7Z A;  3E7Q A;  3VUQ A;  2FJI 1;  5CXG A;  3BTL A;  3O8H A;  3CJD A;  3EUP A;  5FMP A;  2R7W A;  3HIM A;  3LSP A;  2HYT A;  3VIB A;  2UXI A; 
#chains in the Genus database with same CATH homology
 3BCG A;  4ACI A;  3BR3 A;  4AC0 A;  5D1R A;  3HTH A;  4M3B A;  3LSJ A;  3BR5 A;  2JJ7 A;  2FQ4 A;  1U9N A;  2ZOY A;  2QIB A;  3KZ9 A;  4GFL A;  5IOY A;  4W97 A;  3T6N A;  2NX4 A;  5F1J A;  1Z0X A;  3HTI A;  4MK6 A;  3HTA A;  3CCY A;  3PM1 A;  2TCT A;  3ANG A;  4GCT A;  2HXI A;  4I76 A;  2XPV A;  2VKE A;  3FK6 A;  2G7G A;  1JTX A;  3LSR A;  2NS8 A;  5CW8 A;  3C07 A;  3VP5 A;  4D7N A;  3V78 A;  4JYK A;  3EGQ A;  3TP3 A;  1Z77 A;  3MNL A;  4V2F A;  3IH3 A;  2VKV A;  4JNN A;  3VVZ A;  1U9O A;  3VVY A;  3PPB A;  3VPR A;  4JKZ A;  3TP0 A;  2IEK A;  2JK3 A;  3Q0V A;  1T56 A;  3QPL A;  2OER A;  3QBM A;  2RAE A;  5FGL A;  2NP5 A;  2I10 A;  2NP3 A;  2ZCN A;  3G56 A;  3FIW A;  3Q3S A;  4D5C A;  5K58 A;  3ZQF A;  2TRT A;  3C2B A;  5FKK A;  3LWJ A;  2XRL A;  2HQ5 A;  2IBD A;  3ON2 A;  1BJZ A;  3CRJ A;  4I6Z A;  3BJB A;  5FKL A;  2XGD A;  3O60 A;  3LOC A;  3VW1 A;  3CDL A;  4AF5 A;  2X6O A;  2X9D A;  2EH3 A;  3VW2 A;  1QVT A;  3QQA A;  2QTQ A;  2HKU A;  4B1R A;  2GFN A;  3COL A;  2ID3 A;  3HE0 A;  3DPJ A;  3F0C A;  5FHP A;  5GPC A;  4HKU A;  3JSJ A;  4X1E A;  5DAJ A;  3BT9 A;  2ZB9 A;  5GP9 A;  5IP6 A;  3G1L A;  4ICH A;  2FD5 A;  2OF7 A;  3HTJ A;  5HBU A;  2FBQ A;  3O8G A;  3GEU A;  2XPU A;  2UXH A;  5GPA A;  3P9T A;  2Y30 A;  2Y2Z A;  3HGY A;  2WGB A;  2O7T A;  3G7R A;  4DW6 A;  3IH2 A;  2HYJ A;  2YVH A;  4M3E A;  2IU5 A;  4YZE A;  1ZKG A;  5F27 A;  3IH4 A;  2DG7 A;  2OPT A;  2GUH A;  1A6I A;  2RAS A;  3BR6 A;  2ID6 A;  2F07 A;  3ZQG A;  2DTZ A;  4ABZ A;  5F0C A;  2PBX A;  4GCK A;  5J1R A;  2QCO A;  4KWA A;  3DCF A;  5AQC A;  5FKN A;  2G0E A;  2UXU A;  5HSZ A;  3BNI A;  3KNW A;  1ZK8 A;  3AQT A;  2RHA A;  5F04 A;  1UI6 A;  5K7F A;  2PZ9 A;  3B81 A;  5IPA A;  1JT0 A;  2W53 A;  2ZOZ A;  3LJL A;  3SDG A;  4CGR A;  3NNR A;  2G7L A;  5FKO A;  3QKX A;  5EZH A;  3G1M A;  3VW0 A;  1JUP A;  5H9T A;  5J1Y A;  2QKO A;  2XGC A;  3AQS A;  4D5F A;  2XPW A;  2HXO A;  5EZG A;  3ON4 A;  2WV1 A;  3Q0W A;  1QPI A;  2QOP A;  3ANP A;  4ME9 A;  3RD3 A;  4NEL A;  5CXI A;  3VVX A;  3LHQ A;  1VI0 A;  3BR2 A;  2WUI A;  1JUM A;  5D19 A;  5EYR A;  4M3D A;  3SFI A;  1SGM A;  4XK4 A;  2V57 A;  4MO7 A;  3BTJ A;  1UI5 A;  3G1O A;  3BR0 A;  2Q24 A;  4D7M A;  4V2G A;  1QVU A;  4L62 A;  1RKT A;  3BQY A;  2UXP A;  1RPW A;  1ORK A;  2VPR A;  3BRU A;  2ZCX A;  5HAW A;  4M3F A;  3S5R A;  3QPS A;  4W1U A;  1JTY A;  3V6G A;  5EFY A;  2OI8 A;  2NS7 A;  4M3G A;  4G12 A;  5FKM A;  2QWT A;  3FK7 A;  3MVP A;  4MXM A;  3BTI A;  2GEN A;  3RH2 A;  2DG8 A;  2Y31 A;  4UDS A;  3KKC A;  3NRG A;  4GFK A;  3IUV A;  4JL3 A;  5IOZ A;  2REK A;  5F0F A;  3F1B A;  3VOK A;  3ZQL A;  3NXC A;  4PXI A;  4GCL A;  2G7S A;  1JT6 A;  3B6C A;  2ZCM A;  2G3B A;  3BHQ A;  3PAS A;  4B3A A;  5F08 A;  1RKW A;  3B6A A;  2FX0 A;  3BTC A;  3BR1 A;  2GBY A;  4AC6 A;  3BQZ A;  3WHB A;  3KKD A;  3GZI A;  3WHC A;  3NI7 A;  3VOX A;  3ZQI A;  3NPI A;  1JUS A;  3FRQ A;  3DEW A;  4NN1 A;  5J1U A;  3Q0U A;  2IAI A;  2UXO A;  2XGE A;  2O7O A;  5D18 A;  2YVE A;  5J3L A;  5F0H A;  3HGG A;  5C4Y A;  3CWR A;  2FJ1 A;  2D6Y A;  1T33 A;  2XB5 A;  2XDN A;  5K7H A;  4AUX A;  3ZQH A;  5K7Z A;  3E7Q A;  3VUQ A;  5CXG A;  3BTL A;  3O8H A;  3CJD A;  3EUP A;  5FMP A;  3LSP A;  3HIM A;  2HYT A;  3VIB A;  2UXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...