3HIMA

The crystal structure of a bacterial regulatory protein in the tetr family from rhodococcus rha1 to 2.2a
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
190
Chain Sequence
TSKAAARIRAAAIEVFAAKGYGATTTREIAASLDMSPGAVYPHYKTKESLLYAISLEGHHSVLAAITAADFPDIAAPDRLMSTVTAYVTWHADNRASARVGQYELRSLSPEHFAIIADIRRSTTKVFTRIIEAGATAGDFHPFDIEAAALAITSLGIDVSRWFPSHTYSDPRIIAARYVELALRMVGCAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Bacterial Regulatory Protein in the tetR Family from Rhodococcus RHA1 to 2.2A
rcsb
source organism Rhodococcus jostii
molecule tags Transcription regulator
molecule keywords Probable transcriptional regulator
total genus 74
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3himA00
4M3DA 2DTZA 3LJLA 3QPLA 3VIBA 3HE0A 2VPRA 3F1BA 3WHBA 3EUPA 2QKOA 3VVXA 4MO7A 5J1YA 2WGBA 3DPJA 4JYKA 2FX0A 3MNLA 5F0CA 5CXIA 3BR0A 5CW8A 2ZB9A 2O7TA 4AC6A 4NELA 3BQZA 2UXOA 3B81A 3BTCA 2XB5A 2D6YA 2IAIA 1QPIA 3BT9A 2WUIA 5F1JA 2G0EA 2ZCMA 3O8HA 3E7QA 3F0CA 4JL3A 2IBDA 5D18A 5F0HA 2Y30A 1QVUA 3C07A 5IP6A 4M3EA 3S5RA 3AQTA 3B6CA 5K7ZA 3QKXA 2TRTA 4I76A 2JJ7A 3BTLA 5GP9A 2X6OA 2VKEA 3LWJA 3LHQA 3NI7A 1JUPA 2Y2ZA 1QVTA 5FMPA 2ZCXA 1RKWA 2NS8A 4MXMA 3LSRA 3VUQA 2JK3A 2GFNA 5J3LA 5FKKA 2QOPA 2NP3A 4D5CA 2XPVA 2ZOYA 2QWTA 2HQ5A 3RH2A 2WV1A 4ACIA 5FHPA 4JNNA 3LSPA 3HTIA 5HAWA 4X1EA 4CGRA 4ABZA 5EFYA 5HSZA 4L62A 2QTQA 3NXCA 5F27A 3IH4A 1JUSA 3O8GA 2OI8A 2HKUA 4W97A 1JTYA 5J1RA 2XPWA 4V2GA 3ON2A 3NNRA 5AQCA 3SFIA 3VP5A 2FD5A 3FIWA 3BCGA 2HYTA 2ID3A 5HBUA 3RD3A 4GFLA 3CJDA 2GENA 4HKUA 4DW6A 2F07A 2XRLA 3NRGA 3IUVA 3FRQA 5D1RA 3VW1A 5FKLA 2RAEA 3ANGA 3BR5A 4I6ZA 2DG7A 5K7HA 2UXPA 3AQSA 4G12A 3TP3A 5FKNA 2YVHA 1ZKGA 3G1OA 5GPAA 2G7SA 2OF7A 3P9TA 2NS7A 5D19A 5C4YA 2X9DA 3GZIA 3HIMA 2ID6A 3KKCA 3Q0UA 1Z0XA 2I10A 3VVYA 2GBYA 1JUMA 3BR1A 3TP0A 5CXGA 5FKMA 3ZQGA 2V57A 3CDLA 3KNWA 3SDGA 1JTXA 3HGYA 1RPWA 2YVEA 4D7MA 2OPTA 4M3BA 2UXHA 4W1UA 3ZQFA 2ZCNA 1VI0A 4KWAA 1T33A 3KZ9A 5K7FA 4B3AA 3LSJA 3PPBA 2FQ4A 1A6IA 3Q0WA 5EZGA 2TCTA 1UI6A 3T6NA 3GEUA 3C2BA 5GPCA 4AUXA 1SGMA 2Q24A 1JT0A 3BHQA 3DEWA 1ZK8A 2XGEA 3VOXA 2RASA 3G1LA 3EGQA 3B6AA 3BQYA 3WHCA 3BR6A 3CWRA 1UI5A 4GCKA 4V2FA 2HXOA 3IH2A 3BJBA 3G7RA 3KKDA 3ZQLA 2IEKA 2PZ9A 2GUHA 3LOCA 5H9TA 4M3GA 3FK6A 5F08A 4GCTA 2VKVA 1U9OA 5IPAA 1ORKA 5EYRA 1T56A 3IH3A 3PASA 2PBXA 2XDNA 2XPUA 3VPRA 4NN1A 3BNIA 3VOKA 5DAJA 2G3BA 3DCFA 3Q0VA 1JT6A 3MVPA 5F04A 3HGGA 5K58A 2IU5A 3QPSA 3HTAA 2UXIA 3VW0A 3CCYA 3NPIA 4AC0A 2W53A 5FGLA 3ZQIA 4JKZA 4M3FA 2UXUA 5F0FA 2DG8A 2REKA 3BRUA 3ANPA 4GFKA 4YZEA 2QCOA 2ZOZA 3VVZA 2G7LA 2QIBA 1BJZA 2EH3A 2HXIA 3V78A 2NP5A 5IOYA 2G7GA 4B1RA 1U9NA 3HTJA 2O7OA 4ME9A 5J1UA 1Z77A 4D7NA 2Y31A 3QQAA 3FK7A 3PM1A 3COLA 2OERA 4MK6A 2XGDA 4ICHA 3V6GA 2RHAA 3JSJA 4XK4A 2FJ1A 3CRJA 3BR3A 3BTIA 5EZHA 3Q3SA 3ON4A 4UDSA 1RKTA 2FBQA 4GCLA 3VW2A 2NX4A 3O60A 3BTJA 3BR2A 5IOZA 2HYJA 2XGCA 3G56A 4AF5A 4PXIA 3ZQHA 3QBMA 4D5FA 3HTHA 3G1MA 5FKOA
chains in the Genus database with same CATH superfamily
4M3DA 2DTZA 3LJLA 3QPLA 3VIBA 2R7SA 3HE0A 4U9NA 2VPRA 3F1BA 3WHBA 3EUPA 2QKOA 3VVXA 4MO7A 5J1YA 2WGBA 3DPJA 4JYKA 2FX0A 3MNLA 5F0CA 5CXIA 3BR0A 5CW8A 2ZB9A 2O7TA 3K8PC 4AC6A 2R7VA 4NELA 3BQZA 2UXOA 3B81A 3BTCA 2XB5A 2D6YA 2IAIA 1QPIA 3BT9A 5CQGA 2WUIA 3NS4A 5F1JA 2G0EA 2ZCMA 3O8HA 3E7QA 3F0CA 4JL3A 2IBDA 5D18A 5F0HA 2Y30A 1QVUA 3C07A 5IP6A 4M3EA 3S5RA 2R7QA 3AQTA 3B6CA 5K7ZA 3QKXA 2TRTA 4I76A 2JJ7A 3BTLA 5GP9A 2X6OA 2VKEA 3LWJA 2R7UA 3LHQA 3NI7A 1JUPA 2Y2ZA 1QVTA 5FMPA 2ZCXA 4OD5A 1RKWA 2NS8A 4MXMA 3LSRA 3VUQA 2JK3A 2YVXA 2GFNA 5J3LA 5FKKA 2QOPA 3VTIA 2NP3A 4D5CA 2XPVA 2ZOYA 2FJI1 2QWTA 2HQ5A 2R7RA 3RH2A 2WV1A 4ACIA 5FHPA 4JNNA 3LSPA 3HTIA 5HAWA 4X1EA 4CGRA 4ABZA 5EFYA 5HSZA 4L62A 2QTQA 3NXCA 5F27A 3IH4A 2R7XA 1JUSA 3O8GA 2OI8A 2HKUA 4W97A 1JTYA 5J1RA 2XPWA 4V2GA 3DU5A 3ON2A 3NNRA 5AQCA 3SFIA 3VP5A 2FD5A 3FIWA 3BCGA 2HYTA 2ID3A 5HBUA 3RD3A 4GFLA 3CJDA 2GENA 4HKUA 4DW6A 2R7OA 2F07A 2B3WA 2XRLA 3NRGA 3IUVA 3FRQA 5D1RA 3VW1A 5FKLA 2RAEA 3ANGA 3BR5A 4I6ZA 2DG7A 5K7HA 2UXPA 3AQSA 4G12A 3TP3A 5FKNA 2YVHA 1ZKGA 3G1OA 5GPAA 2G7SA 2OF7A 3P9TA 2NS7A 5D19A 5C4YA 2X9DA 3GZIA 3HIMA 2R7TA 2ID6A 3KKCA 3Q0UA 1Z0XA 2I10A 3VVYA 2GBYA 1JUMA 3BR1A 3TP0A 5CXGA 5FKMA 3ZQGA 2V57A 3CDLA 3KNWA 3SDGA 1JTXA 3HGYA 2R7WA 1RPWA 2YVEA 4D7MA 2OPTA 4C2MA 4M3BA 2UXHA 4W1UA 3ZQFA 2ZCNA 1VI0A 4KWAA 1T33A 3KZ9A 5K7FA 4B3AA 3LSJA 3PPBA 2FQ4A 1A6IA 3Q0WA 4IRVA 5EZGA 2TCTA 1UI6A 3T6NA 3GEUA 3C2BA 5GPCA 4AUXA 4WIBA 1SGMA 2Q24A 1JT0A 3BHQA 3DEWA 1ZK8A 2XGEA 3VOXA 2RASA 3G1LA 3EGQA 3B6AA 3BQYA 3WHCA 3BR6A 3CWRA 2ZY9A 1UI5A 4GCKA 4V2FA 2HXOA 3IH2A 3BJBA 3G7RA 3KKDA 3ZQLA 2IEKA 2PZ9A 2GUHA 3LOCA 5H9TA 4M3GA 3FK6A 5F08A 4GCTA 2VKVA 1U9OA 5IPAA 1ORKA 5EYRA 1T56A 3IH3A 3PASA 2PBXA 2XDNA 2XPUA 3VPRA 4NN1A 3BNIA 3VOKA 5DAJA 2G3BA 3DCFA 3Q0VA 1JT6A 3MVPA 5F04A 3HGGA 5K58A 2IU5A 3QPSA 3HTAA 2UXIA 3VW0A 4OD4A 3CCYA 2PFVA 3NPIA 4AC0A 2W53A 5FGLA 3ZQIA 4JKZA 4M3FA 2UXUA 5F0FA 2DG8A 2REKA 3BRUA 3ANPA 4GFKA 4YZEA 2QCOA 2ZOZA 3VVZA 2G7LA 2QIBA 3KYLA 1BJZA 2EH3A 2HXIA 3V78A 2NP5A 5IOYA 2G7GA 4B1RA 1U9NA 3HTJA 2O7OA 4ME9A 5J1UA 1Z77A 4D7NA 2Y31A 3QQAA 3FK7A 3PM1A 3COLA 2OERA 4MK6A 2XGDA 4ICHA 3V6GA 2RHAA 3JSJA 4XK4A 2FJ1A 3CRJA 3FHNA 3BR3A 3BTIA 2B1EA 5EZHA 3Q3SA 3ON4A 4UDSA 4U9LA 1RKTA 2FBQA 4GCLA 3VW2A 2NX4A 3O60A 3BTJA 3BR2A 5IOZA 2HYJA 2XGCA 3G56A 4AF5A 4PXIA 3ZQHA 3QBMA 4D5FA 3HTHA 3G1MA 5FKOA 4DVYP 3DU6A 3SWHA 2A2FX
chains in the Genus database with same CATH topology
4M3DA 2DTZA 3LJLA 3QPLA 3VIBA 3HE0A 2VPRA 3F1BA 3WHBA 3EUPA 2QKOA 3VVXA 4MO7A 5J1YA 2WGBA 3DPJA 4JYKA 2FX0A 3MNLA 5F0CA 5CXIA 3BR0A 5CW8A 2ZB9A 2O7TA 4AC6A 4NELA 3BQZA 2UXOA 3B81A 3BTCA 2XB5A 2D6YA 2IAIA 1QPIA 3BT9A 2WUIA 5F1JA 2G0EA 2ZCMA 3O8HA 3E7QA 3F0CA 4JL3A 2IBDA 5D18A 5F0HA 2Y30A 1QVUA 3C07A 5IP6A 4M3EA 3S5RA 3AQTA 3B6CA 5K7ZA 3QKXA 2TRTA 4I76A 2JJ7A 3BTLA 5GP9A 2X6OA 2VKEA 3LWJA 3LHQA 3NI7A 1JUPA 2Y2ZA 1QVTA 5FMPA 2ZCXA 1RKWA 2NS8A 4MXMA 3LSRA 3VUQA 2JK3A 2GFNA 5J3LA 5FKKA 2QOPA 2NP3A 4D5CA 2XPVA 2ZOYA 2QWTA 2HQ5A 3RH2A 2WV1A 4ACIA 5FHPA 4JNNA 3LSPA 3HTIA 5HAWA 4X1EA 4CGRA 4ABZA 5EFYA 5HSZA 4L62A 2QTQA 3NXCA 5F27A 3IH4A 1JUSA 3O8GA 2OI8A 2HKUA 4W97A 1JTYA 5J1RA 2XPWA 4V2GA 3ON2A 3NNRA 5AQCA 3SFIA 3VP5A 2FD5A 3FIWA 3BCGA 2HYTA 2ID3A 5HBUA 3RD3A 4GFLA 3CJDA 2GENA 4HKUA 4DW6A 2F07A 2XRLA 3NRGA 3IUVA 3FRQA 5D1RA 3VW1A 5FKLA 2RAEA 3ANGA 3BR5A 4I6ZA 2DG7A 5K7HA 2UXPA 3AQSA 4G12A 3TP3A 5FKNA 2YVHA 1ZKGA 3G1OA 5GPAA 2G7SA 2OF7A 3P9TA 2NS7A 5D19A 5C4YA 2X9DA 3GZIA 3HIMA 2ID6A 3KKCA 3Q0UA 1Z0XA 2I10A 3VVYA 2GBYA 1JUMA 3BR1A 3TP0A 5CXGA 5FKMA 3ZQGA 2V57A 3CDLA 3KNWA 3SDGA 1JTXA 3HGYA 1RPWA 2YVEA 4D7MA 2OPTA 4M3BA 2UXHA 4W1UA 3ZQFA 2ZCNA 1VI0A 4KWAA 1T33A 3KZ9A 5K7FA 4B3AA 3LSJA 3PPBA 2FQ4A 1A6IA 3Q0WA 5EZGA 2TCTA 1UI6A 3T6NA 3GEUA 3C2BA 5GPCA 4AUXA 1SGMA 2Q24A 1JT0A 3BHQA 3DEWA 1ZK8A 2XGEA 3VOXA 2RASA 3G1LA 3EGQA 3B6AA 3BQYA 3WHCA 3BR6A 3CWRA 1UI5A 4GCKA 4V2FA 2HXOA 3IH2A 3BJBA 3G7RA 3KKDA 3ZQLA 2IEKA 2PZ9A 2GUHA 3LOCA 5H9TA 4M3GA 3FK6A 5F08A 4GCTA 2VKVA 1U9OA 5IPAA 1ORKA 5EYRA 1T56A 3IH3A 3PASA 2PBXA 2XDNA 2XPUA 3VPRA 4NN1A 3BNIA 3VOKA 5DAJA 2G3BA 3DCFA 3Q0VA 1JT6A 3MVPA 5F04A 3HGGA 5K58A 2IU5A 3QPSA 3HTAA 2UXIA 3VW0A 3CCYA 3NPIA 4AC0A 2W53A 5FGLA 3ZQIA 4JKZA 4M3FA 2UXUA 5F0FA 2DG8A 2REKA 3BRUA 3ANPA 4GFKA 4YZEA 2QCOA 2ZOZA 3VVZA 2G7LA 2QIBA 1BJZA 2EH3A 2HXIA 3V78A 2NP5A 5IOYA 2G7GA 4B1RA 1U9NA 3HTJA 2O7OA 4ME9A 5J1UA 1Z77A 4D7NA 2Y31A 3QQAA 3FK7A 3PM1A 3COLA 2OERA 4MK6A 2XGDA 4ICHA 3V6GA 2RHAA 3JSJA 4XK4A 2FJ1A 3CRJA 3BR3A 3BTIA 5EZHA 3Q3SA 3ON4A 4UDSA 1RKTA 2FBQA 4GCLA 3VW2A 2NX4A 3O60A 3BTJA 3BR2A 5IOZA 2HYJA 2XGCA 3G56A 4AF5A 4PXIA 3ZQHA 3QBMA 4D5FA 3HTHA 3G1MA 5FKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3D A;  2DTZ A;  3LJL A;  3QPL A;  3VIB A;  3HE0 A;  2VPR A;  3F1B A;  3WHB A;  3EUP A;  2QKO A;  3VVX A;  4MO7 A;  5J1Y A;  2WGB A;  3DPJ A;  4JYK A;  2FX0 A;  3MNL A;  5F0C A;  5CXI A;  3BR0 A;  5CW8 A;  2ZB9 A;  2O7T A;  4AC6 A;  4NEL A;  3BQZ A;  2UXO A;  3B81 A;  3BTC A;  2XB5 A;  2D6Y A;  2IAI A;  1QPI A;  3BT9 A;  2WUI A;  5F1J A;  2G0E A;  2ZCM A;  3O8H A;  3E7Q A;  3F0C A;  4JL3 A;  2IBD A;  5D18 A;  5F0H A;  2Y30 A;  1QVU A;  3C07 A;  5IP6 A;  4M3E A;  3S5R A;  3AQT A;  3B6C A;  5K7Z A;  3QKX A;  2TRT A;  4I76 A;  2JJ7 A;  3BTL A;  5GP9 A;  2X6O A;  2VKE A;  3LWJ A;  3LHQ A;  3NI7 A;  1JUP A;  2Y2Z A;  1QVT A;  5FMP A;  2ZCX A;  1RKW A;  2NS8 A;  4MXM A;  3LSR A;  3VUQ A;  2JK3 A;  2GFN A;  5J3L A;  5FKK A;  2QOP A;  2NP3 A;  4D5C A;  2XPV A;  2ZOY A;  2QWT A;  2HQ5 A;  3RH2 A;  2WV1 A;  4ACI A;  5FHP A;  4JNN A;  3LSP A;  3HTI A;  5HAW A;  4X1E A;  4CGR A;  4ABZ A;  5EFY A;  5HSZ A;  4L62 A;  2QTQ A;  3NXC A;  5F27 A;  3IH4 A;  1JUS A;  3O8G A;  2OI8 A;  2HKU A;  4W97 A;  1JTY A;  5J1R A;  2XPW A;  4V2G A;  3ON2 A;  3NNR A;  5AQC A;  3SFI A;  3VP5 A;  2FD5 A;  3FIW A;  3BCG A;  2HYT A;  2ID3 A;  5HBU A;  3RD3 A;  4GFL A;  3CJD A;  2GEN A;  4HKU A;  4DW6 A;  2F07 A;  2XRL A;  3NRG A;  3IUV A;  3FRQ A;  5D1R A;  3VW1 A;  5FKL A;  2RAE A;  3ANG A;  3BR5 A;  4I6Z A;  2DG7 A;  5K7H A;  2UXP A;  3AQS A;  4G12 A;  3TP3 A;  5FKN A;  2YVH A;  1ZKG A;  3G1O A;  5GPA A;  2G7S A;  2OF7 A;  3P9T A;  2NS7 A;  5D19 A;  5C4Y A;  2X9D A;  3GZI A;  3HIM A;  2ID6 A;  3KKC A;  3Q0U A;  1Z0X A;  2I10 A;  3VVY A;  2GBY A;  1JUM A;  3BR1 A;  3TP0 A;  5CXG A;  5FKM A;  3ZQG A;  2V57 A;  3CDL A;  3KNW A;  3SDG A;  1JTX A;  3HGY A;  1RPW A;  2YVE A;  4D7M A;  2OPT A;  4M3B A;  2UXH A;  4W1U A;  3ZQF A;  2ZCN A;  1VI0 A;  4KWA A;  1T33 A;  3KZ9 A;  5K7F A;  4B3A A;  3LSJ A;  3PPB A;  2FQ4 A;  1A6I A;  3Q0W A;  5EZG A;  2TCT A;  1UI6 A;  3T6N A;  3GEU A;  3C2B A;  5GPC A;  4AUX A;  1SGM A;  2Q24 A;  1JT0 A;  3BHQ A;  3DEW A;  1ZK8 A;  2XGE A;  3VOX A;  2RAS A;  3G1L A;  3EGQ A;  3B6A A;  3BQY A;  3WHC A;  3BR6 A;  3CWR A;  1UI5 A;  4GCK A;  4V2F A;  2HXO A;  3IH2 A;  3BJB A;  3G7R A;  3KKD A;  3ZQL A;  2IEK A;  2PZ9 A;  2GUH A;  3LOC A;  5H9T A;  4M3G A;  3FK6 A;  5F08 A;  4GCT A;  2VKV A;  1U9O A;  5IPA A;  1ORK A;  5EYR A;  1T56 A;  3IH3 A;  3PAS A;  2PBX A;  2XDN A;  2XPU A;  3VPR A;  4NN1 A;  3BNI A;  3VOK A;  5DAJ A;  2G3B A;  3DCF A;  3Q0V A;  1JT6 A;  3MVP A;  5F04 A;  3HGG A;  5K58 A;  2IU5 A;  3QPS A;  3HTA A;  2UXI A;  3VW0 A;  3CCY A;  3NPI A;  4AC0 A;  2W53 A;  5FGL A;  3ZQI A;  4JKZ A;  4M3F A;  2UXU A;  5F0F A;  2DG8 A;  2REK A;  3BRU A;  3ANP A;  4GFK A;  4YZE A;  2QCO A;  2ZOZ A;  3VVZ A;  2G7L A;  2QIB A;  1BJZ A;  2EH3 A;  2HXI A;  3V78 A;  2NP5 A;  5IOY A;  2G7G A;  4B1R A;  1U9N A;  3HTJ A;  2O7O A;  4ME9 A;  5J1U A;  1Z77 A;  4D7N A;  2Y31 A;  3QQA A;  3FK7 A;  3PM1 A;  3COL A;  2OER A;  4MK6 A;  2XGD A;  4ICH A;  3V6G A;  2RHA A;  3JSJ A;  4XK4 A;  2FJ1 A;  3CRJ A;  3BR3 A;  3BTI A;  5EZH A;  3Q3S A;  3ON4 A;  4UDS A;  1RKT A;  2FBQ A;  4GCL A;  3VW2 A;  2NX4 A;  3O60 A;  3BTJ A;  3BR2 A;  5IOZ A;  2HYJ A;  2XGC A;  3G56 A;  4AF5 A;  4PXI A;  3ZQH A;  3QBM A;  4D5F A;  3HTH A;  3G1M A;  5FKO A; 
#chains in the Genus database with same CATH topology
 4M3D A;  2DTZ A;  3LJL A;  3QPL A;  3VIB A;  2R7S A;  3HE0 A;  4U9N A;  2VPR A;  3F1B A;  3WHB A;  3EUP A;  2QKO A;  3VVX A;  4MO7 A;  5J1Y A;  2WGB A;  3DPJ A;  4JYK A;  2FX0 A;  3MNL A;  5F0C A;  5CXI A;  3BR0 A;  5CW8 A;  2ZB9 A;  2O7T A;  3K8P C;  4AC6 A;  2R7V A;  4NEL A;  3BQZ A;  2UXO A;  3B81 A;  3BTC A;  2XB5 A;  2D6Y A;  2IAI A;  1QPI A;  3BT9 A;  5CQG A;  2WUI A;  3NS4 A;  5F1J A;  2G0E A;  2ZCM A;  3O8H A;  3E7Q A;  3F0C A;  4JL3 A;  2IBD A;  5D18 A;  5F0H A;  2Y30 A;  1QVU A;  3C07 A;  5IP6 A;  4M3E A;  3S5R A;  2R7Q A;  3AQT A;  3B6C A;  5K7Z A;  3QKX A;  2TRT A;  4I76 A;  2JJ7 A;  3BTL A;  5GP9 A;  2X6O A;  2VKE A;  3LWJ A;  2R7U A;  3LHQ A;  3NI7 A;  1JUP A;  2Y2Z A;  1QVT A;  5FMP A;  2ZCX A;  4OD5 A;  1RKW A;  2NS8 A;  4MXM A;  3LSR A;  3VUQ A;  2JK3 A;  2YVX A;  2GFN A;  5J3L A;  5FKK A;  2QOP A;  3VTI A;  2NP3 A;  4D5C A;  2XPV A;  2ZOY A;  2FJI 1;  2QWT A;  2HQ5 A;  2R7R A;  3RH2 A;  2WV1 A;  4ACI A;  5FHP A;  4JNN A;  3LSP A;  3HTI A;  5HAW A;  4X1E A;  4CGR A;  4ABZ A;  5EFY A;  5HSZ A;  4L62 A;  2QTQ A;  3NXC A;  5F27 A;  3IH4 A;  2R7X A;  1JUS A;  3O8G A;  2OI8 A;  2HKU A;  4W97 A;  1JTY A;  5J1R A;  2XPW A;  4V2G A;  3DU5 A;  3ON2 A;  3NNR A;  5AQC A;  3SFI A;  3VP5 A;  2FD5 A;  3FIW A;  3BCG A;  2HYT A;  2ID3 A;  5HBU A;  3RD3 A;  4GFL A;  3CJD A;  2GEN A;  4HKU A;  4DW6 A;  2R7O A;  2F07 A;  2B3W A;  2XRL A;  3NRG A;  3IUV A;  3FRQ A;  5D1R A;  3VW1 A;  5FKL A;  2RAE A;  3ANG A;  3BR5 A;  4I6Z A;  2DG7 A;  5K7H A;  2UXP A;  3AQS A;  4G12 A;  3TP3 A;  5FKN A;  2YVH A;  1ZKG A;  3G1O A;  5GPA A;  2G7S A;  2OF7 A;  3P9T A;  2NS7 A;  5D19 A;  5C4Y A;  2X9D A;  3GZI A;  3HIM A;  2R7T A;  2ID6 A;  3KKC A;  3Q0U A;  1Z0X A;  2I10 A;  3VVY A;  2GBY A;  1JUM A;  3BR1 A;  3TP0 A;  5CXG A;  5FKM A;  3ZQG A;  2V57 A;  3CDL A;  3KNW A;  3SDG A;  1JTX A;  3HGY A;  2R7W A;  1RPW A;  2YVE A;  4D7M A;  2OPT A;  4C2M A;  4M3B A;  2UXH A;  4W1U A;  3ZQF A;  2ZCN A;  1VI0 A;  4KWA A;  1T33 A;  3KZ9 A;  5K7F A;  4B3A A;  3LSJ A;  3PPB A;  2FQ4 A;  1A6I A;  3Q0W A;  4IRV A;  5EZG A;  2TCT A;  1UI6 A;  3T6N A;  3GEU A;  3C2B A;  5GPC A;  4AUX A;  4WIB A;  1SGM A;  2Q24 A;  1JT0 A;  3BHQ A;  3DEW A;  1ZK8 A;  2XGE A;  3VOX A;  2RAS A;  3G1L A;  3EGQ A;  3B6A A;  3BQY A;  3WHC A;  3BR6 A;  3CWR A;  2ZY9 A;  1UI5 A;  4GCK A;  4V2F A;  2HXO A;  3IH2 A;  3BJB A;  3G7R A;  3KKD A;  3ZQL A;  2IEK A;  2PZ9 A;  2GUH A;  3LOC A;  5H9T A;  4M3G A;  3FK6 A;  5F08 A;  4GCT A;  2VKV A;  1U9O A;  5IPA A;  1ORK A;  5EYR A;  1T56 A;  3IH3 A;  3PAS A;  2PBX A;  2XDN A;  2XPU A;  3VPR A;  4NN1 A;  3BNI A;  3VOK A;  5DAJ A;  2G3B A;  3DCF A;  3Q0V A;  1JT6 A;  3MVP A;  5F04 A;  3HGG A;  5K58 A;  2IU5 A;  3QPS A;  3HTA A;  2UXI A;  3VW0 A;  4OD4 A;  3CCY A;  2PFV A;  3NPI A;  4AC0 A;  2W53 A;  5FGL A;  3ZQI A;  4JKZ A;  4M3F A;  2UXU A;  5F0F A;  2DG8 A;  2REK A;  3BRU A;  3ANP A;  4GFK A;  4YZE A;  2QCO A;  2ZOZ A;  3VVZ A;  2G7L A;  2QIB A;  3KYL A;  1BJZ A;  2EH3 A;  2HXI A;  3V78 A;  2NP5 A;  5IOY A;  2G7G A;  4B1R A;  1U9N A;  3HTJ A;  2O7O A;  4ME9 A;  5J1U A;  1Z77 A;  4D7N A;  2Y31 A;  3QQA A;  3FK7 A;  3PM1 A;  3COL A;  2OER A;  4MK6 A;  2XGD A;  4ICH A;  3V6G A;  2RHA A;  3JSJ A;  4XK4 A;  2FJ1 A;  3CRJ A;  3FHN A;  3BR3 A;  3BTI A;  2B1E A;  5EZH A;  3Q3S A;  3ON4 A;  4UDS A;  4U9L A;  1RKT A;  2FBQ A;  4GCL A;  3VW2 A;  2NX4 A;  3O60 A;  3BTJ A;  3BR2 A;  5IOZ A;  2HYJ A;  2XGC A;  3G56 A;  4AF5 A;  4PXI A;  3ZQH A;  3QBM A;  4D5F A;  3HTH A;  3G1M A;  5FKO A;  4DVY P;  3DU6 A;  3SWH A;  2A2F X; 
#chains in the Genus database with same CATH homology
 4M3D A;  2DTZ A;  3LJL A;  3QPL A;  3VIB A;  3HE0 A;  2VPR A;  3F1B A;  3WHB A;  3EUP A;  2QKO A;  3VVX A;  4MO7 A;  5J1Y A;  2WGB A;  3DPJ A;  4JYK A;  2FX0 A;  3MNL A;  5F0C A;  5CXI A;  3BR0 A;  5CW8 A;  2ZB9 A;  2O7T A;  4AC6 A;  4NEL A;  3BQZ A;  2UXO A;  3B81 A;  3BTC A;  2XB5 A;  2D6Y A;  2IAI A;  1QPI A;  3BT9 A;  2WUI A;  5F1J A;  2G0E A;  2ZCM A;  3O8H A;  3E7Q A;  3F0C A;  4JL3 A;  2IBD A;  5D18 A;  5F0H A;  2Y30 A;  1QVU A;  3C07 A;  5IP6 A;  4M3E A;  3S5R A;  3AQT A;  3B6C A;  5K7Z A;  3QKX A;  2TRT A;  4I76 A;  2JJ7 A;  3BTL A;  5GP9 A;  2X6O A;  2VKE A;  3LWJ A;  3LHQ A;  3NI7 A;  1JUP A;  2Y2Z A;  1QVT A;  5FMP A;  2ZCX A;  1RKW A;  2NS8 A;  4MXM A;  3LSR A;  3VUQ A;  2JK3 A;  2GFN A;  5J3L A;  5FKK A;  2QOP A;  2NP3 A;  4D5C A;  2XPV A;  2ZOY A;  2QWT A;  2HQ5 A;  3RH2 A;  2WV1 A;  4ACI A;  5FHP A;  4JNN A;  3LSP A;  3HTI A;  5HAW A;  4X1E A;  4CGR A;  4ABZ A;  5EFY A;  5HSZ A;  4L62 A;  2QTQ A;  3NXC A;  5F27 A;  3IH4 A;  1JUS A;  3O8G A;  2OI8 A;  2HKU A;  4W97 A;  1JTY A;  5J1R A;  2XPW A;  4V2G A;  3ON2 A;  3NNR A;  5AQC A;  3SFI A;  3VP5 A;  2FD5 A;  3FIW A;  3BCG A;  2HYT A;  2ID3 A;  5HBU A;  3RD3 A;  4GFL A;  3CJD A;  2GEN A;  4HKU A;  4DW6 A;  2F07 A;  2XRL A;  3NRG A;  3IUV A;  3FRQ A;  5D1R A;  3VW1 A;  5FKL A;  2RAE A;  3ANG A;  3BR5 A;  4I6Z A;  2DG7 A;  5K7H A;  2UXP A;  3AQS A;  4G12 A;  3TP3 A;  5FKN A;  2YVH A;  1ZKG A;  3G1O A;  5GPA A;  2G7S A;  2OF7 A;  3P9T A;  2NS7 A;  5D19 A;  5C4Y A;  2X9D A;  3GZI A;  3HIM A;  2ID6 A;  3KKC A;  3Q0U A;  1Z0X A;  2I10 A;  3VVY A;  2GBY A;  1JUM A;  3BR1 A;  3TP0 A;  5CXG A;  5FKM A;  3ZQG A;  2V57 A;  3CDL A;  3KNW A;  3SDG A;  1JTX A;  3HGY A;  1RPW A;  2YVE A;  4D7M A;  2OPT A;  4M3B A;  2UXH A;  4W1U A;  3ZQF A;  2ZCN A;  1VI0 A;  4KWA A;  1T33 A;  3KZ9 A;  5K7F A;  4B3A A;  3LSJ A;  3PPB A;  2FQ4 A;  1A6I A;  3Q0W A;  5EZG A;  2TCT A;  1UI6 A;  3T6N A;  3GEU A;  3C2B A;  5GPC A;  4AUX A;  1SGM A;  2Q24 A;  1JT0 A;  3BHQ A;  3DEW A;  1ZK8 A;  2XGE A;  3VOX A;  2RAS A;  3G1L A;  3EGQ A;  3B6A A;  3BQY A;  3WHC A;  3BR6 A;  3CWR A;  1UI5 A;  4GCK A;  4V2F A;  2HXO A;  3IH2 A;  3BJB A;  3G7R A;  3KKD A;  3ZQL A;  2IEK A;  2PZ9 A;  2GUH A;  3LOC A;  5H9T A;  4M3G A;  3FK6 A;  5F08 A;  4GCT A;  2VKV A;  1U9O A;  5IPA A;  1ORK A;  5EYR A;  1T56 A;  3IH3 A;  3PAS A;  2PBX A;  2XDN A;  2XPU A;  3VPR A;  4NN1 A;  3BNI A;  3VOK A;  5DAJ A;  2G3B A;  3DCF A;  3Q0V A;  1JT6 A;  3MVP A;  5F04 A;  3HGG A;  5K58 A;  2IU5 A;  3QPS A;  3HTA A;  2UXI A;  3VW0 A;  3CCY A;  3NPI A;  4AC0 A;  2W53 A;  5FGL A;  3ZQI A;  4JKZ A;  4M3F A;  2UXU A;  5F0F A;  2DG8 A;  2REK A;  3BRU A;  3ANP A;  4GFK A;  4YZE A;  2QCO A;  2ZOZ A;  3VVZ A;  2G7L A;  2QIB A;  1BJZ A;  2EH3 A;  2HXI A;  3V78 A;  2NP5 A;  5IOY A;  2G7G A;  4B1R A;  1U9N A;  3HTJ A;  2O7O A;  4ME9 A;  5J1U A;  1Z77 A;  4D7N A;  2Y31 A;  3QQA A;  3FK7 A;  3PM1 A;  3COL A;  2OER A;  4MK6 A;  2XGD A;  4ICH A;  3V6G A;  2RHA A;  3JSJ A;  4XK4 A;  2FJ1 A;  3CRJ A;  3BR3 A;  3BTI A;  5EZH A;  3Q3S A;  3ON4 A;  4UDS A;  1RKT A;  2FBQ A;  4GCL A;  3VW2 A;  2NX4 A;  3O60 A;  3BTJ A;  3BR2 A;  5IOZ A;  2HYJ A;  2XGC A;  3G56 A;  4AF5 A;  4PXI A;  3ZQH A;  3QBM A;  4D5F A;  3HTH A;  3G1M A;  5FKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...