3HIMA

The crystal structure of a bacterial regulatory protein in the tetr family from rhodococcus rha1 to 2.2a
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
190
Chain Sequence
TSKAAARIRAAAIEVFAAKGYGATTTREIAASLDMSPGAVYPHYKTKESLLYAISLEGHHSVLAAITAADFPDIAAPDRLMSTVTAYVTWHADNRASARVGQYELRSLSPEHFAIIADIRRSTTKVFTRIIEAGATAGDFHPFDIEAAALAITSLGIDVSRWFPSHTYSDPRIIAARYVELALRMVGCAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable transcriptional regulator
publication title The Crystal Structure of a Bacterial Regulatory Protein in the tetR Family from Rhodococcus RHA1 to 2.2A
rcsb
source organism Rhodococcus jostii
molecule tags Transcription regulator
total genus 74
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3himA00
3ANPA 3BTCA 4ABZA 3IH3A 4XK4A 3HIMA 5F0FA 3HGGA 1BJZA 3LSRA 3WHBA 2ZB9A 5HAWA 3B6CA 4ME9A 3ZQFA 5F08A 2XGEA 3F0CA 3FK7A 4D5FA 3O8GA 3O60A 3DEWA 2Y2ZA 2W53A 3PM1A 3QKXA 5F27A 4GFKA 2QWTA 5EYRA 2HXIA 4PXIA 3HTJA 2DG8A 1RKTA 4KWAA 2WGBA 5FKKA 2UXHA 4D7NA 3IH2A 4M3DA 5C4YA 1UI6A 3HE0A 5H9TA 2UXOA 1Z0XA 3NRGA 3RD3A 3G7RA 3CDLA 3WHCA 5J3LA 2QKOA 3BCGA 3GEUA 2F07A 2OI8A 1JUSA 1JTXA 4M3BA 5GPAA 3G1MA 1RPWA 4MXMA 3C2BA 1U9OA 2RASA 5FKLA 4JKZA 3Q3SA 2G0EA 3ZQIA 2ZOYA 3HGYA 4X1EA 2TCTA 4M3GA 2XPUA 3ON2A 3BT9A 5IPAA 3JSJA 3AQSA 1T56A 2GENA 3VUQA 4M3FA 5K7FA 5D18A 3LJLA 3NI7A 4NN1A 3DPJA 5DAJA 3BTLA 4B3AA 3KKDA 3CJDA 2ZCMA 3BR0A 4JNNA 1UI5A 3TP0A 3MNLA 2HXOA 4V2FA 3HTHA 2NX4A 1JUMA 4GFLA 5D1RA 3LSPA 4V2GA 3BQZA 1SGMA 3VIBA 4HKUA 2QOPA 2RAEA 2GBYA 3IUVA 2XPVA 5FKNA 5GPCA 2HYTA 2X6OA 3BR6A 3BHQA 3AQTA 3O8HA 2YVHA 3Q0VA 5FHPA 4L62A 3BTJA 3KNWA 4G12A 4AF5A 4D7MA 4MO7A 2IU5A 1QVUA 2YVEA 1JUPA 3PPBA 4D5CA 2ZCNA 1RKWA 3Q0WA 2OF7A 5HSZA 2XGDA 1ORKA 2RHAA 3BR1A 3LOCA 2UXIA 2QIBA 3QPSA 3QQAA 2IBDA 2FBQA 2G7LA 5F1JA 3BR5A 1Z77A 3ZQGA 3EUPA 4AC0A 2ZCXA 5EZGA 4B1RA 1ZK8A 3TP3A 3QBMA 3B81A 3LHQA 3DCFA 2DTZA 3FK6A 5F0HA 3V6GA 2D6YA 3VVZA 3VOKA 2Y30A 2EH3A 2PBXA 2OPTA 2G3BA 1JT6A 1T33A 2ID6A 3IH4A 3BR2A 4W1UA 2XRLA 3SFIA 2V57A 3HTAA 2UXPA 1A6IA 2VKEA 4GCLA 4CGRA 5CW8A 5J1UA 3G1OA 5CXGA 2XB5A 5D19A 4M3EA 2ZOZA 3ZQLA 3VW0A 5J1RA 3SDGA 2XGCA 5K7ZA 4ACIA 3QPLA 2QCOA 2WV1A 2FQ4A 2NS7A 3Q0UA 1VI0A 3NPIA 4DW6A 1JT0A 3VP5A 3NXCA 3BTIA 4ICHA 3VVYA 2DG7A 5EFYA 2TRTA 3LSJA 1QVTA 5IOZA 4GCTA 2GFNA 2PZ9A 3RH2A 2IEKA 5IP6A 5F0CA 5FMPA 2X9DA 4MK6A 1QPIA 2FJ1A 3FIWA 3FRQA 3NNRA 3KKCA 3P9TA 3VW2A 3BQYA 5EZHA 2JJ7A 3BJBA 2Q24A 3CWRA 2NP5A 4JYKA 3MVPA 2XPWA 5FGLA 2GUHA 3S5RA 4UDSA 4JL3A 3GZIA 2NP3A 2IAIA 3VW1A 2QTQA 3G1LA 3ON4A 5AQCA 2ID3A 3COLA 3V78A 2NS8A 4AC6A 5J1YA 4GCKA 2JK3A 3PASA 4I6ZA 2HKUA 5GP9A 2REKA 3B6AA 2VKVA 5F04A 4W97A 3LWJA 2G7SA 3VVXA 2G7GA 2HYJA 2Y31A 3G56A 3BRUA 3E7QA 3BNIA 3T6NA 1ZKGA 3BR3A 5K58A 5FKOA 5IOYA 4NELA 4YZEA 3VPRA 4AUXA 4I76A 2UXUA 3CCYA 2OERA 5FKMA 2FX0A 2VPRA 3ANGA 5CXIA 3ZQHA 3C07A 3VOXA 2O7OA 3CRJA 2FD5A 3EGQA 3KZ9A 5K7HA 2XDNA 2HQ5A 2O7TA 2I10A 3HTIA 2WUIA 1JTYA 1U9NA 5HBUA 3F1BA
chains in the Genus database with same CATH superfamily
3ANPA 3BTCA 4ABZA 3IH3A 4XK4A 3HIMA 5F0FA 3HGGA 1BJZA 3LSRA 3WHBA 2ZB9A 5HAWA 3B6CA 4ME9A 3ZQFA 5F08A 2XGEA 3F0CA 3FK7A 4D5FA 3O8GA 3O60A 3DEWA 2Y2ZA 2W53A 3PM1A 3QKXA 5F27A 4GFKA 2QWTA 5EYRA 2HXIA 4PXIA 3HTJA 2DG8A 1RKTA 4KWAA 2WGBA 2FJI1 5FKKA 2UXHA 4D7NA 3IH2A 4M3DA 5C4YA 1UI6A 3HE0A 5H9TA 2UXOA 1Z0XA 3NRGA 3RD3A 3G7RA 3CDLA 3WHCA 5J3LA 2QKOA 3BCGA 3GEUA 2F07A 2OI8A 1JUSA 1JTXA 4M3BA 5GPAA 3G1MA 1RPWA 4MXMA 3C2BA 1U9OA 3K8PC 2RASA 5FKLA 4JKZA 3Q3SA 2G0EA 3ZQIA 2ZOYA 3HGYA 4X1EA 2TCTA 4M3GA 2XPUA 3ON2A 3BT9A 5IPAA 3JSJA 3AQSA 1T56A 2GENA 3VUQA 4M3FA 5K7FA 5D18A 3LJLA 3NI7A 2R7RA 2B3WA 4NN1A 3DPJA 5DAJA 3BTLA 4B3AA 3KKDA 3CJDA 2ZCMA 3BR0A 4JNNA 1UI5A 3TP0A 3MNLA 2HXOA 4V2FA 2R7VA 3HTHA 4WIBA 2NX4A 1JUMA 4GFLA 5D1RA 2PFVA 3LSPA 4V2GA 3BQZA 1SGMA 3VIBA 4HKUA 2QOPA 2ZY9A 2RAEA 2GBYA 3IUVA 2XPVA 5FKNA 5GPCA 4IRVA 2HYTA 2X6OA 3BR6A 3BHQA 3AQTA 3O8HA 2YVHA 3Q0VA 5FHPA 4L62A 3BTJA 3KNWA 4G12A 4AF5A 4D7MA 4MO7A 2IU5A 1QVUA 2R7XA 2YVEA 1JUPA 3PPBA 4D5CA 2ZCNA 1RKWA 2R7UA 3Q0WA 2OF7A 5HSZA 2XGDA 1ORKA 3FHNA 2RHAA 3BR1A 3LOCA 2UXIA 2QIBA 3DU5A 3QPSA 3QQAA 2IBDA 2FBQA 2G7LA 5F1JA 3BR5A 1Z77A 3ZQGA 3EUPA 4AC0A 2ZCXA 5CQGA 5EZGA 4B1RA 1ZK8A 2R7QA 3TP3A 3QBMA 3B81A 3LHQA 3DCFA 2DTZA 3FK6A 4U9LA 5F0HA 4U9NA 2R7TA 3V6GA 2D6YA 3VVZA 3VOKA 2Y30A 2EH3A 4OD5A 2PBXA 2OPTA 2G3BA 1JT6A 1T33A 2B1EA 2ID6A 3IH4A 2R7OA 3BR2A 4W1UA 2XRLA 3SWHA 3SFIA 2V57A 3HTAA 2YVXA 2UXPA 1A6IA 2VKEA 4GCLA 4CGRA 3DU6A 5CW8A 5J1UA 3G1OA 5CXGA 2XB5A 5D19A 4M3EA 2ZOZA 3ZQLA 3VW0A 4DVYP 5J1RA 3SDGA 2XGCA 5K7ZA 4ACIA 3NS4A 3QPLA 2QCOA 2WV1A 2FQ4A 2NS7A 3Q0UA 1VI0A 3NPIA 4DW6A 1JT0A 3VP5A 3NXCA 4OD4A 3BTIA 4ICHA 3VVYA 2DG7A 5EFYA 2TRTA 3LSJA 1QVTA 5IOZA 4GCTA 2GFNA 2PZ9A 2R7WA 3RH2A 2IEKA 5IP6A 5F0CA 5FMPA 2X9DA 4MK6A 1QPIA 2FJ1A 3FIWA 3FRQA 3NNRA 2R7SA 3KKCA 3P9TA 3BQYA 3VW2A 5EZHA 2JJ7A 3BJBA 2Q24A 3CWRA 2NP5A 4C2MA 4JYKA 3MVPA 2XPWA 5FGLA 2GUHA 3S5RA 4UDSA 4JL3A 3GZIA 2NP3A 2IAIA 3VW1A 2QTQA 3G1LA 3ON4A 5AQCA 2ID3A 3COLA 3V78A 2NS8A 4AC6A 5J1YA 4GCKA 2JK3A 3PASA 4I6ZA 2HKUA 5GP9A 2REKA 3B6AA 2VKVA 5F04A 4W97A 3LWJA 2G7SA 3VVXA 2G7GA 2HYJA 2Y31A 3G56A 3BRUA 3VTIA 3E7QA 3BNIA 3T6NA 1ZKGA 3BR3A 5K58A 5FKOA 5IOYA 4NELA 4YZEA 3VPRA 4AUXA 4I76A 2UXUA 3CCYA 2OERA 2A2FX 5FKMA 2FX0A 2VPRA 3ANGA 5CXIA 3ZQHA 3C07A 3VOXA 2O7OA 3CRJA 2FD5A 3EGQA 3KZ9A 5K7HA 3KYLA 2XDNA 2HQ5A 2O7TA 2I10A 3HTIA 2WUIA 1JTYA 1U9NA 5HBUA 3F1BA
chains in the Genus database with same CATH topology
3ANPA 3BTCA 4ABZA 3IH3A 4XK4A 3HIMA 5F0FA 3HGGA 1BJZA 3LSRA 3WHBA 2ZB9A 5HAWA 3B6CA 4ME9A 3ZQFA 5F08A 2XGEA 3F0CA 3FK7A 4D5FA 3O8GA 3O60A 3DEWA 2Y2ZA 2W53A 3PM1A 3QKXA 5F27A 4GFKA 2QWTA 5EYRA 2HXIA 4PXIA 3HTJA 2DG8A 1RKTA 4KWAA 2WGBA 5FKKA 2UXHA 4D7NA 3IH2A 4M3DA 5C4YA 1UI6A 3HE0A 5H9TA 2UXOA 1Z0XA 3NRGA 3RD3A 3G7RA 3CDLA 3WHCA 5J3LA 2QKOA 3BCGA 3GEUA 2F07A 2OI8A 1JUSA 1JTXA 4M3BA 5GPAA 3G1MA 1RPWA 4MXMA 3C2BA 1U9OA 2RASA 5FKLA 4JKZA 3Q3SA 2G0EA 3ZQIA 2ZOYA 3HGYA 4X1EA 2TCTA 4M3GA 2XPUA 3ON2A 3BT9A 5IPAA 3JSJA 3AQSA 1T56A 2GENA 3VUQA 4M3FA 5K7FA 5D18A 3LJLA 3NI7A 4NN1A 3DPJA 5DAJA 3BTLA 4B3AA 3KKDA 3CJDA 2ZCMA 3BR0A 4JNNA 1UI5A 3TP0A 3MNLA 2HXOA 4V2FA 3HTHA 2NX4A 1JUMA 4GFLA 5D1RA 3LSPA 4V2GA 3BQZA 1SGMA 3VIBA 4HKUA 2QOPA 2RAEA 2GBYA 3IUVA 2XPVA 5FKNA 5GPCA 2HYTA 2X6OA 3BR6A 3BHQA 3AQTA 3O8HA 2YVHA 3Q0VA 5FHPA 4L62A 3BTJA 3KNWA 4G12A 4AF5A 4D7MA 4MO7A 2IU5A 1QVUA 2YVEA 1JUPA 3PPBA 4D5CA 2ZCNA 1RKWA 3Q0WA 2OF7A 5HSZA 2XGDA 1ORKA 2RHAA 3BR1A 3LOCA 2UXIA 2QIBA 3QPSA 3QQAA 2IBDA 2FBQA 2G7LA 5F1JA 3BR5A 1Z77A 3ZQGA 3EUPA 4AC0A 2ZCXA 5EZGA 4B1RA 1ZK8A 3TP3A 3QBMA 3B81A 3LHQA 3DCFA 2DTZA 3FK6A 5F0HA 3V6GA 2D6YA 3VVZA 3VOKA 2Y30A 2EH3A 2PBXA 2OPTA 2G3BA 1JT6A 1T33A 2ID6A 3IH4A 3BR2A 4W1UA 2XRLA 3SFIA 2V57A 3HTAA 2UXPA 1A6IA 2VKEA 4GCLA 4CGRA 5CW8A 5J1UA 3G1OA 5CXGA 2XB5A 5D19A 4M3EA 2ZOZA 3ZQLA 3VW0A 5J1RA 3SDGA 2XGCA 5K7ZA 4ACIA 3QPLA 2QCOA 2WV1A 2FQ4A 2NS7A 3Q0UA 1VI0A 3NPIA 4DW6A 1JT0A 3VP5A 3NXCA 3BTIA 4ICHA 3VVYA 2DG7A 5EFYA 2TRTA 3LSJA 1QVTA 5IOZA 4GCTA 2GFNA 2PZ9A 3RH2A 2IEKA 5IP6A 5F0CA 5FMPA 2X9DA 4MK6A 1QPIA 2FJ1A 3FIWA 3FRQA 3NNRA 3KKCA 3P9TA 3VW2A 3BQYA 5EZHA 2JJ7A 3BJBA 2Q24A 3CWRA 2NP5A 4JYKA 3MVPA 2XPWA 5FGLA 2GUHA 3S5RA 4UDSA 4JL3A 3GZIA 2NP3A 2IAIA 3VW1A 2QTQA 3G1LA 3ON4A 5AQCA 2ID3A 3COLA 3V78A 2NS8A 4AC6A 5J1YA 4GCKA 2JK3A 3PASA 4I6ZA 2HKUA 5GP9A 2REKA 3B6AA 2VKVA 5F04A 4W97A 3LWJA 2G7SA 3VVXA 2G7GA 2HYJA 2Y31A 3G56A 3BRUA 3E7QA 3BNIA 3T6NA 1ZKGA 3BR3A 5K58A 5FKOA 5IOYA 4NELA 4YZEA 3VPRA 4AUXA 4I76A 2UXUA 3CCYA 2OERA 5FKMA 2FX0A 2VPRA 3ANGA 5CXIA 3ZQHA 3C07A 3VOXA 2O7OA 3CRJA 2FD5A 3EGQA 3KZ9A 5K7HA 2XDNA 2HQ5A 2O7TA 2I10A 3HTIA 2WUIA 1JTYA 1U9NA 5HBUA 3F1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ANP A;  3BTC A;  4ABZ A;  3IH3 A;  4XK4 A;  3HIM A;  5F0F A;  3HGG A;  1BJZ A;  3LSR A;  3WHB A;  2ZB9 A;  5HAW A;  3B6C A;  4ME9 A;  3ZQF A;  5F08 A;  2XGE A;  3F0C A;  3FK7 A;  4D5F A;  3O8G A;  3O60 A;  3DEW A;  2Y2Z A;  2W53 A;  3PM1 A;  3QKX A;  5F27 A;  4GFK A;  2QWT A;  5EYR A;  2HXI A;  4PXI A;  3HTJ A;  2DG8 A;  1RKT A;  4KWA A;  2WGB A;  5FKK A;  2UXH A;  4D7N A;  3IH2 A;  4M3D A;  5C4Y A;  1UI6 A;  3HE0 A;  5H9T A;  2UXO A;  1Z0X A;  3NRG A;  3RD3 A;  3G7R A;  3CDL A;  3WHC A;  5J3L A;  2QKO A;  3BCG A;  3GEU A;  2F07 A;  2OI8 A;  1JUS A;  1JTX A;  4M3B A;  5GPA A;  3G1M A;  1RPW A;  4MXM A;  3C2B A;  1U9O A;  2RAS A;  5FKL A;  4JKZ A;  3Q3S A;  2G0E A;  3ZQI A;  2ZOY A;  3HGY A;  4X1E A;  2TCT A;  4M3G A;  2XPU A;  3ON2 A;  3BT9 A;  5IPA A;  3JSJ A;  3AQS A;  1T56 A;  2GEN A;  3VUQ A;  4M3F A;  5K7F A;  5D18 A;  3LJL A;  3NI7 A;  4NN1 A;  3DPJ A;  5DAJ A;  3BTL A;  4B3A A;  3KKD A;  3CJD A;  2ZCM A;  3BR0 A;  4JNN A;  1UI5 A;  3TP0 A;  3MNL A;  2HXO A;  4V2F A;  3HTH A;  2NX4 A;  1JUM A;  4GFL A;  5D1R A;  3LSP A;  4V2G A;  3BQZ A;  1SGM A;  3VIB A;  4HKU A;  2QOP A;  2RAE A;  2GBY A;  3IUV A;  2XPV A;  5FKN A;  5GPC A;  2HYT A;  2X6O A;  3BR6 A;  3BHQ A;  3AQT A;  3O8H A;  2YVH A;  3Q0V A;  5FHP A;  4L62 A;  3BTJ A;  3KNW A;  4G12 A;  4AF5 A;  4D7M A;  4MO7 A;  2IU5 A;  1QVU A;  2YVE A;  1JUP A;  3PPB A;  4D5C A;  2ZCN A;  1RKW A;  3Q0W A;  2OF7 A;  5HSZ A;  2XGD A;  1ORK A;  2RHA A;  3BR1 A;  3LOC A;  2UXI A;  2QIB A;  3QPS A;  3QQA A;  2IBD A;  2FBQ A;  2G7L A;  5F1J A;  3BR5 A;  1Z77 A;  3ZQG A;  3EUP A;  4AC0 A;  2ZCX A;  5EZG A;  4B1R A;  1ZK8 A;  3TP3 A;  3QBM A;  3B81 A;  3LHQ A;  3DCF A;  2DTZ A;  3FK6 A;  5F0H A;  3V6G A;  2D6Y A;  3VVZ A;  3VOK A;  2Y30 A;  2EH3 A;  2PBX A;  2OPT A;  2G3B A;  1JT6 A;  1T33 A;  2ID6 A;  3IH4 A;  3BR2 A;  4W1U A;  2XRL A;  3SFI A;  2V57 A;  3HTA A;  2UXP A;  1A6I A;  2VKE A;  4GCL A;  4CGR A;  5CW8 A;  5J1U A;  3G1O A;  5CXG A;  2XB5 A;  5D19 A;  4M3E A;  2ZOZ A;  3ZQL A;  3VW0 A;  5J1R A;  3SDG A;  2XGC A;  5K7Z A;  4ACI A;  3QPL A;  2QCO A;  2WV1 A;  2FQ4 A;  2NS7 A;  3Q0U A;  1VI0 A;  3NPI A;  4DW6 A;  1JT0 A;  3VP5 A;  3NXC A;  3BTI A;  4ICH A;  3VVY A;  2DG7 A;  5EFY A;  2TRT A;  3LSJ A;  1QVT A;  5IOZ A;  4GCT A;  2GFN A;  2PZ9 A;  3RH2 A;  2IEK A;  5IP6 A;  5F0C A;  5FMP A;  2X9D A;  4MK6 A;  1QPI A;  2FJ1 A;  3FIW A;  3FRQ A;  3NNR A;  3KKC A;  3P9T A;  3VW2 A;  3BQY A;  5EZH A;  2JJ7 A;  3BJB A;  2Q24 A;  3CWR A;  2NP5 A;  4JYK A;  3MVP A;  2XPW A;  5FGL A;  2GUH A;  3S5R A;  4UDS A;  4JL3 A;  3GZI A;  2NP3 A;  2IAI A;  3VW1 A;  2QTQ A;  3G1L A;  3ON4 A;  5AQC A;  2ID3 A;  3COL A;  3V78 A;  2NS8 A;  4AC6 A;  5J1Y A;  4GCK A;  2JK3 A;  3PAS A;  4I6Z A;  2HKU A;  5GP9 A;  2REK A;  3B6A A;  2VKV A;  5F04 A;  4W97 A;  3LWJ A;  2G7S A;  3VVX A;  2G7G A;  2HYJ A;  2Y31 A;  3G56 A;  3BRU A;  3E7Q A;  3BNI A;  3T6N A;  1ZKG A;  3BR3 A;  5K58 A;  5FKO A;  5IOY A;  4NEL A;  4YZE A;  3VPR A;  4AUX A;  4I76 A;  2UXU A;  3CCY A;  2OER A;  5FKM A;  2FX0 A;  2VPR A;  3ANG A;  5CXI A;  3ZQH A;  3C07 A;  3VOX A;  2O7O A;  3CRJ A;  2FD5 A;  3EGQ A;  3KZ9 A;  5K7H A;  2XDN A;  2HQ5 A;  2O7T A;  2I10 A;  3HTI A;  2WUI A;  1JTY A;  1U9N A;  5HBU A;  3F1B A; 
#chains in the Genus database with same CATH topology
 3ANP A;  3BTC A;  4ABZ A;  3IH3 A;  4XK4 A;  3HIM A;  5F0F A;  3HGG A;  1BJZ A;  3LSR A;  3WHB A;  2ZB9 A;  5HAW A;  3B6C A;  4ME9 A;  3ZQF A;  5F08 A;  2XGE A;  3F0C A;  3FK7 A;  4D5F A;  3O8G A;  3O60 A;  3DEW A;  2Y2Z A;  2W53 A;  3PM1 A;  3QKX A;  5F27 A;  4GFK A;  2QWT A;  5EYR A;  2HXI A;  4PXI A;  3HTJ A;  2DG8 A;  1RKT A;  4KWA A;  2WGB A;  2FJI 1;  5FKK A;  2UXH A;  4D7N A;  3IH2 A;  4M3D A;  5C4Y A;  1UI6 A;  3HE0 A;  5H9T A;  2UXO A;  1Z0X A;  3NRG A;  3RD3 A;  3G7R A;  3CDL A;  3WHC A;  5J3L A;  2QKO A;  3BCG A;  3GEU A;  2F07 A;  2OI8 A;  1JUS A;  1JTX A;  4M3B A;  5GPA A;  3G1M A;  1RPW A;  4MXM A;  3C2B A;  1U9O A;  3K8P C;  2RAS A;  5FKL A;  4JKZ A;  3Q3S A;  2G0E A;  3ZQI A;  2ZOY A;  3HGY A;  4X1E A;  2TCT A;  4M3G A;  2XPU A;  3ON2 A;  3BT9 A;  5IPA A;  3JSJ A;  3AQS A;  1T56 A;  2GEN A;  3VUQ A;  4M3F A;  5K7F A;  5D18 A;  3LJL A;  3NI7 A;  2R7R A;  2B3W A;  4NN1 A;  3DPJ A;  5DAJ A;  3BTL A;  4B3A A;  3KKD A;  3CJD A;  2ZCM A;  3BR0 A;  4JNN A;  1UI5 A;  3TP0 A;  3MNL A;  2HXO A;  4V2F A;  2R7V A;  3HTH A;  4WIB A;  2NX4 A;  1JUM A;  4GFL A;  5D1R A;  2PFV A;  3LSP A;  4V2G A;  3BQZ A;  1SGM A;  3VIB A;  4HKU A;  2QOP A;  2ZY9 A;  2RAE A;  2GBY A;  3IUV A;  2XPV A;  5FKN A;  5GPC A;  4IRV A;  2HYT A;  2X6O A;  3BR6 A;  3BHQ A;  3AQT A;  3O8H A;  2YVH A;  3Q0V A;  5FHP A;  4L62 A;  3BTJ A;  3KNW A;  4G12 A;  4AF5 A;  4D7M A;  4MO7 A;  2IU5 A;  1QVU A;  2R7X A;  2YVE A;  1JUP A;  3PPB A;  4D5C A;  2ZCN A;  1RKW A;  2R7U A;  3Q0W A;  2OF7 A;  5HSZ A;  2XGD A;  1ORK A;  3FHN A;  2RHA A;  3BR1 A;  3LOC A;  2UXI A;  2QIB A;  3DU5 A;  3QPS A;  3QQA A;  2IBD A;  2FBQ A;  2G7L A;  5F1J A;  3BR5 A;  1Z77 A;  3ZQG A;  3EUP A;  4AC0 A;  2ZCX A;  5CQG A;  5EZG A;  4B1R A;  1ZK8 A;  2R7Q A;  3TP3 A;  3QBM A;  3B81 A;  3LHQ A;  3DCF A;  2DTZ A;  3FK6 A;  4U9L A;  5F0H A;  4U9N A;  2R7T A;  3V6G A;  2D6Y A;  3VVZ A;  3VOK A;  2Y30 A;  2EH3 A;  4OD5 A;  2PBX A;  2OPT A;  2G3B A;  1JT6 A;  1T33 A;  2B1E A;  2ID6 A;  3IH4 A;  2R7O A;  3BR2 A;  4W1U A;  2XRL A;  3SWH A;  3SFI A;  2V57 A;  3HTA A;  2YVX A;  2UXP A;  1A6I A;  2VKE A;  4GCL A;  4CGR A;  3DU6 A;  5CW8 A;  5J1U A;  3G1O A;  5CXG A;  2XB5 A;  5D19 A;  4M3E A;  2ZOZ A;  3ZQL A;  3VW0 A;  4DVY P;  5J1R A;  3SDG A;  2XGC A;  5K7Z A;  4ACI A;  3NS4 A;  3QPL A;  2QCO A;  2WV1 A;  2FQ4 A;  2NS7 A;  3Q0U A;  1VI0 A;  3NPI A;  4DW6 A;  1JT0 A;  3VP5 A;  3NXC A;  4OD4 A;  3BTI A;  4ICH A;  3VVY A;  2DG7 A;  5EFY A;  2TRT A;  3LSJ A;  1QVT A;  5IOZ A;  4GCT A;  2GFN A;  2PZ9 A;  2R7W A;  3RH2 A;  2IEK A;  5IP6 A;  5F0C A;  5FMP A;  2X9D A;  4MK6 A;  1QPI A;  2FJ1 A;  3FIW A;  3FRQ A;  3NNR A;  2R7S A;  3KKC A;  3P9T A;  3BQY A;  3VW2 A;  5EZH A;  2JJ7 A;  3BJB A;  2Q24 A;  3CWR A;  2NP5 A;  4C2M A;  4JYK A;  3MVP A;  2XPW A;  5FGL A;  2GUH A;  3S5R A;  4UDS A;  4JL3 A;  3GZI A;  2NP3 A;  2IAI A;  3VW1 A;  2QTQ A;  3G1L A;  3ON4 A;  5AQC A;  2ID3 A;  3COL A;  3V78 A;  2NS8 A;  4AC6 A;  5J1Y A;  4GCK A;  2JK3 A;  3PAS A;  4I6Z A;  2HKU A;  5GP9 A;  2REK A;  3B6A A;  2VKV A;  5F04 A;  4W97 A;  3LWJ A;  2G7S A;  3VVX A;  2G7G A;  2HYJ A;  2Y31 A;  3G56 A;  3BRU A;  3VTI A;  3E7Q A;  3BNI A;  3T6N A;  1ZKG A;  3BR3 A;  5K58 A;  5FKO A;  5IOY A;  4NEL A;  4YZE A;  3VPR A;  4AUX A;  4I76 A;  2UXU A;  3CCY A;  2OER A;  2A2F X;  5FKM A;  2FX0 A;  2VPR A;  3ANG A;  5CXI A;  3ZQH A;  3C07 A;  3VOX A;  2O7O A;  3CRJ A;  2FD5 A;  3EGQ A;  3KZ9 A;  5K7H A;  3KYL A;  2XDN A;  2HQ5 A;  2O7T A;  2I10 A;  3HTI A;  2WUI A;  1JTY A;  1U9N A;  5HBU A;  3F1B A; 
#chains in the Genus database with same CATH homology
 3ANP A;  3BTC A;  4ABZ A;  3IH3 A;  4XK4 A;  3HIM A;  5F0F A;  3HGG A;  1BJZ A;  3LSR A;  3WHB A;  2ZB9 A;  5HAW A;  3B6C A;  4ME9 A;  3ZQF A;  5F08 A;  2XGE A;  3F0C A;  3FK7 A;  4D5F A;  3O8G A;  3O60 A;  3DEW A;  2Y2Z A;  2W53 A;  3PM1 A;  3QKX A;  5F27 A;  4GFK A;  2QWT A;  5EYR A;  2HXI A;  4PXI A;  3HTJ A;  2DG8 A;  1RKT A;  4KWA A;  2WGB A;  5FKK A;  2UXH A;  4D7N A;  3IH2 A;  4M3D A;  5C4Y A;  1UI6 A;  3HE0 A;  5H9T A;  2UXO A;  1Z0X A;  3NRG A;  3RD3 A;  3G7R A;  3CDL A;  3WHC A;  5J3L A;  2QKO A;  3BCG A;  3GEU A;  2F07 A;  2OI8 A;  1JUS A;  1JTX A;  4M3B A;  5GPA A;  3G1M A;  1RPW A;  4MXM A;  3C2B A;  1U9O A;  2RAS A;  5FKL A;  4JKZ A;  3Q3S A;  2G0E A;  3ZQI A;  2ZOY A;  3HGY A;  4X1E A;  2TCT A;  4M3G A;  2XPU A;  3ON2 A;  3BT9 A;  5IPA A;  3JSJ A;  3AQS A;  1T56 A;  2GEN A;  3VUQ A;  4M3F A;  5K7F A;  5D18 A;  3LJL A;  3NI7 A;  4NN1 A;  3DPJ A;  5DAJ A;  3BTL A;  4B3A A;  3KKD A;  3CJD A;  2ZCM A;  3BR0 A;  4JNN A;  1UI5 A;  3TP0 A;  3MNL A;  2HXO A;  4V2F A;  3HTH A;  2NX4 A;  1JUM A;  4GFL A;  5D1R A;  3LSP A;  4V2G A;  3BQZ A;  1SGM A;  3VIB A;  4HKU A;  2QOP A;  2RAE A;  2GBY A;  3IUV A;  2XPV A;  5FKN A;  5GPC A;  2HYT A;  2X6O A;  3BR6 A;  3BHQ A;  3AQT A;  3O8H A;  2YVH A;  3Q0V A;  5FHP A;  4L62 A;  3BTJ A;  3KNW A;  4G12 A;  4AF5 A;  4D7M A;  4MO7 A;  2IU5 A;  1QVU A;  2YVE A;  1JUP A;  3PPB A;  4D5C A;  2ZCN A;  1RKW A;  3Q0W A;  2OF7 A;  5HSZ A;  2XGD A;  1ORK A;  2RHA A;  3BR1 A;  3LOC A;  2UXI A;  2QIB A;  3QPS A;  3QQA A;  2IBD A;  2FBQ A;  2G7L A;  5F1J A;  3BR5 A;  1Z77 A;  3ZQG A;  3EUP A;  4AC0 A;  2ZCX A;  5EZG A;  4B1R A;  1ZK8 A;  3TP3 A;  3QBM A;  3B81 A;  3LHQ A;  3DCF A;  2DTZ A;  3FK6 A;  5F0H A;  3V6G A;  2D6Y A;  3VVZ A;  3VOK A;  2Y30 A;  2EH3 A;  2PBX A;  2OPT A;  2G3B A;  1JT6 A;  1T33 A;  2ID6 A;  3IH4 A;  3BR2 A;  4W1U A;  2XRL A;  3SFI A;  2V57 A;  3HTA A;  2UXP A;  1A6I A;  2VKE A;  4GCL A;  4CGR A;  5CW8 A;  5J1U A;  3G1O A;  5CXG A;  2XB5 A;  5D19 A;  4M3E A;  2ZOZ A;  3ZQL A;  3VW0 A;  5J1R A;  3SDG A;  2XGC A;  5K7Z A;  4ACI A;  3QPL A;  2QCO A;  2WV1 A;  2FQ4 A;  2NS7 A;  3Q0U A;  1VI0 A;  3NPI A;  4DW6 A;  1JT0 A;  3VP5 A;  3NXC A;  3BTI A;  4ICH A;  3VVY A;  2DG7 A;  5EFY A;  2TRT A;  3LSJ A;  1QVT A;  5IOZ A;  4GCT A;  2GFN A;  2PZ9 A;  3RH2 A;  2IEK A;  5IP6 A;  5F0C A;  5FMP A;  2X9D A;  4MK6 A;  1QPI A;  2FJ1 A;  3FIW A;  3FRQ A;  3NNR A;  3KKC A;  3P9T A;  3VW2 A;  3BQY A;  5EZH A;  2JJ7 A;  3BJB A;  2Q24 A;  3CWR A;  2NP5 A;  4JYK A;  3MVP A;  2XPW A;  5FGL A;  2GUH A;  3S5R A;  4UDS A;  4JL3 A;  3GZI A;  2NP3 A;  2IAI A;  3VW1 A;  2QTQ A;  3G1L A;  3ON4 A;  5AQC A;  2ID3 A;  3COL A;  3V78 A;  2NS8 A;  4AC6 A;  5J1Y A;  4GCK A;  2JK3 A;  3PAS A;  4I6Z A;  2HKU A;  5GP9 A;  2REK A;  3B6A A;  2VKV A;  5F04 A;  4W97 A;  3LWJ A;  2G7S A;  3VVX A;  2G7G A;  2HYJ A;  2Y31 A;  3G56 A;  3BRU A;  3E7Q A;  3BNI A;  3T6N A;  1ZKG A;  3BR3 A;  5K58 A;  5FKO A;  5IOY A;  4NEL A;  4YZE A;  3VPR A;  4AUX A;  4I76 A;  2UXU A;  3CCY A;  2OER A;  5FKM A;  2FX0 A;  2VPR A;  3ANG A;  5CXI A;  3ZQH A;  3C07 A;  3VOX A;  2O7O A;  3CRJ A;  2FD5 A;  3EGQ A;  3KZ9 A;  5K7H A;  2XDN A;  2HQ5 A;  2O7T A;  2I10 A;  3HTI A;  2WUI A;  1JTY A;  1U9N A;  5HBU A;  3F1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...