3HJCA

Crystal structure of the carboxy-terminal domain of hsp90 from leishmania major, lmjf33.0312
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
405
structure length
387
Chain Sequence
b'HKPLWTRDPKDVTKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFPNKKRNNIKLYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPENLQQNKILKVIRKNIVKKCLEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLKDYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDFEDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLSTSPCILVTSEFGWSAHMEQIMRNQQYMMSKKTMELNPRHPIIKELRRRVGADNDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein 83-1
publication title Crystal Structure of the middle and carboxy-terminal domain of HSP90 from Leishmania major, LMJF33.0312
rcsb
source organism Leishmania major
molecule tags Chaperone
total genus 130
structure length 387
sequence length 405
ec nomenclature
pdb deposition date 2009-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3hjcA03
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3hjcA01
3.40.50.12450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hjcA02
2CGEA 3HJCA 3PRYA 2IOPA 1Y4SA 1HK7A 2IOQA 1USVA 3Q6NA 1Y4UA 2O1TA 3Q6MA 1Y6ZA 2O1UA 2CG9A 1USUA 2GQ0A 2O1VA 1SF8A 5FWKA 2O1WA
chains in the Genus database with same CATH superfamily
3BJZA 5M7EA 3OIFA 4FC7A 4FYYA 4TPKA 4BN4A 1E32A 3QT8A 1IOVA 3FDZA 4E17A 2XIJA 4L5AA 4CS8A 5DP2A 4R1UA 3FRIA 3B0PA 2O9JA 1XNQE 3V3TA 2G9QA 4J1TA 1O5HA 1YNSA 4QM6A 1XEXA 1MQ9A 3NRCA 2YASA 3EG9A 1T2AA 4QG7A 2J4FA 1OF1A 1KP2A 4DV1I 5ITZA 3BFJA 4P3NA 5LA6F 4ZKDA 3RUAA 2XQKA 2YXPX 3PLAE 4DEVA 3T1YI 3R0QA 4W7HA 3DBRB 4YJDA 4HB3A 2FDRA 3ZQ4A 1E2KA 2B30A 2O5RA 2XUOA 4CDAA 3ITKA 4NPAA 3SM9A 4WADA 3AEYA 5DWVA 2GBIA 4G0WA 5EMNA 1CZKA 1KKHA 1Q92A 2XQVA 5C7IO 4F4CA 1EP1B 3BB1A 2I7TA 3DC7A 1ZA2A 1OCCC 1VLMA 4CS7A 4RHYA 2PYZA 1IQUA 5FPQA 1TECE 1KDRA 3I72A 5CLFA 1LJLA 2BUCA 5E2BA 2BKVA 1N2EA 1JG1A 3KTFA 4PQGA 4C2TA 4IG4A 1U6JA 3QUQA 2X7XA 3UKJA 4XX0B 1JL3A 2B5OA 3W78A 4Q7EA 1EVYA 2WYOA 4NC9A 5ADWA 1JV2B 2XLEA 3SLGA 1E1LA 1VBKA 4PWZA 1DKUA 4C3EA 2A0BA 4Z1OA 2DR2A 3TLZA 6CHYA 1YA6A 4CM5A 3S90A 1CF2O 2CWWA 1OLXB 2QUKA 1DQNA 1RHMA 3UPTA 5I3CA 1HT1E 2EGHA 4CKXA 2JJ1D 3LHSA 5EXTA 3H8VA 1XL1A 2RHDA 4QQ8A 4QNRA 1ZNXA 1IZ8A 3KQUA 4J94A 1EBFA 1FDOA 3J81C 3AEQB 1JLSA 4NFHA 3HA5A 4XCQA 5L45A 5FEUA 4YB8A 5C0XE 3NTXA 2GYUA 1P3Y1 1QCYA 1V9SA 4CE6A 2QP3A 4TRRA 3DTTA 4GG1A 4QRHA 2IHNA 4DV7I 3P0IA 1YO6A 1MABB 3ECAA 1Q0PA 1SY7A 4WKPA 2VPPA 1XIVA 2IHBA 1A7UA 1CIVA 3MWKA 4CHTA 1C02A 2QZPA 4ZOLF 3AUSA 5K3CA 3H8SA 4PHFA 2IOPA 4Z9YA 1Z8HA 2C8JA 1KQ3A 2PZKA 2I2DA 4RELA 4YAFA 4QDUA 2QE7D 1BQEA 5F7OA 4BV8A 3D2BA 4H35A 2CUZA 5BQFA 4UM9B 2NUBA 4JLMA 3ZU4A 4JT8A 3ZW8A 3T41A 4E0BA 1I4LD 2EWWA 3TRKA 2D8AA 3JTMA 1C80A 5LZ7A 4HYMA 2CL6X 4BNWA 1JQJC 4MQ6A 3JRXA 1E2NA 3ILVA 5I8PA 4F7DA 5LWHA 3ROGA 2O8CB 1V1JA 5UKDA 2ZSHA 3VDXA 3IVGA 3S7TA 2X0DA 1PL7A 2CSXA 1L7EA 2XIQA 2FEWB 3BWCA 4AN1A 5EIHA 5LQRA 3LC0A 1Z0EA 2D13A 1U3DA 4DF3A 1T6BY 1MIOA 4DLRA 2GTIA 4X62I 3RS3A 2J5XA 2OCXA 2XXAB 8MHTA 3B0UX 3OEEA 5IWAE 1N2BA 4NEQA 1E7QA 4L9WA 2TMVP 1U1CA 3X1DA 4JD5A 4OI0A 3RT1A 3EBLA 1HTBA 2ZE5A 1E6WA 5JT1A 4DR4B 4I3FA 5LDGA 2DKFA 4M8LA 5CD9A 4PZAA 2O8FB 1HL7A 4G78A 2RH9B 3Q6IA 4C3BA 2JBWA 1GNLA 5LMNE 4JBIA 2C37B 2O7RA 4LY9A 3BD9A 2GTHA 5DTMA 3LBIA 3PXBA 2GWWA 2WM2A 2Q3JA 4ZI7B 3STVA 3DBRA 4KLAA 4YI5A 2H4HA 5IT9Q 3UMBA 4YL0A 5EY5B 4J8PA 3WWOA 1XZIA 2QIOA 4BE4A 2JCBA 1RAGA 4LC0A 4FHEA 1ANKA 2NXJA 3G2PA 1ZVVA 4AG5A 2CFCA 3QPDA 5BSHA 1E4YA 4MVJA 3CSSA 2ATVA 4WZBB 1TMGE 3WZLA 1ZIOA 4MR9B 3LS1A 5DLPA 1M54A 3ASUA 3CR8A 3L1HA 4HEHA 5KTKA 1GCUA 2UXCB 1NP3A 1GQQA 2XLDA 3DYIA 2WU8A 1A76A 2HA5A 1RBMA 2R86A 2VF4X 4XX0A 1UXKA 4LZOA 1B1AA 4WOJA 2QRLA 5CDYA 4D97A 3O82A 4D4GA 4YJ3F 3IEMA 4MJ7A 2D5BA 2PRZA 3NP7A 1J97A 2NIPA 3OX3A 3IMFA 4WNCA 1IATA 2PPVA 4GPEA 1DQRA 4O5OA 1VI2A 2ZZKA 4UAVA 5K09A 2BFPA 3OEYA 1W1IA 1N34B 1OLXA 1TT5B 1M2JA 2ZRPA 1ORJA 4M49A 4XLTA 1WLYA 4DIOA 3I05A 4LNUA 3T3NA 3WGTA 4A6XA 3DMTA 4ZU1X 3E3AA 1A0BA 2E82A 2IPOA 1I5OA 1N7JA 1M1UA 3AEQA 2P6OA 2AR0A 4F38A 2MYUA 5IKXA 3UKDA 2ZR0A 3NH9A 4I1IA 2ASVA 1MABA 3NYJA 1EU1A 1W4LA 1IBMB 2A3NA 3W9BA 4ZVIA 2AFHB 2UYYA 2OV3A 1W25A 1CC1S 2X7HA 3KEMA 2GRUA 2WAAA 4LYFA 3QX8A 4QL3A 1FSGA 2HFKA 4ZC1A 3CF6R 4M0MA 1O6CA 3LHKA 3DB1A 4TGLA 4KQJA 5ICCA 2JRLA 1J99A 2P6NA 2FZGA 4B6PA 3P8ZA 2BOVA 3U4MA 1EXNA 2XUAA 1XF9A 2XV1A 5A2QQ 5C34B 3FGOA 4DBLE 1E6UA 4TTJA 4CFYA 1CUSA 3HXPA 2VRCD 2QUAA 2ZIVB 1QS0B 4B6GA 3CT6A 4U2DA 4MWGA 3M9XA 4ME6A 3IIEA 4FI3F 3ZY3A 4O8CA 2ZZNA 4JEAA 3MGAA 1WS6A 2HMSA 4RTSA 1XQXA 4GKJB 3QLVC 3C3WA 2QGZA 4OQFA 1CJVC 4OQDA 4WDQA 5C8YB 3JYNA 3IERA 2F1IA 2O8CA 3A10A 3BICA 3N2IA 4BDTA 3FHLA 3PZBA 4DU7A 2R44A 5GJVC 4NQZA 4PFJA 5ALKA 1WMAA 4PS1A 1YNOA 2XL6A 4F1JA 1TIBA 4PG8A 1I5NA 4Q01A 3VISA 1RJ9B 1YOBA 2Z6VA 4XTCS 4YN3A 2QI9C 1E7MA 3NUGA 5JASA 3NTQA 2PXHA 1T10A 4K3VA 4Q4LA 3E9CA 1DUIA 1KI1A 1EZ4A 2WJ4A 1NR5A 1E77A 3ZCPA 4TYPA 2C9CA 3HSKA 4RQAA 5JCJD 2Y8EA 3FLAA 5J2TF 3TM5A 1IH8A 1BDHA 1MX0A 4ZT3A 3IHLA 2P61A 4GEHA 3TTWA 5EESA 3SC6A 5JQGB 3IUMA 3MPUA 3EZFA 2PO2B 2C3PA 4TN1A 3T7RA 1IWBB 1JKMA 4H16A 1BXZA 3GZTB 1TU3A 4IICA 1U6HA 3LYHA 2C37A 1IRIA 1QAMA 4P3OA 4F04A 1GV0A 4UREA 1H1DA 4UVIA 5IDVA 1Y82A 2XB2A 5DMHA 4ZI7A 1ULTA 1UT8A 3V5NA 1LZLA 4J0QA 4DJTA 3NANA 2ZSAA 5AC5A 3AILA 4R83A 3WIEA 2DB3A 2H7XA 1DOAA 4EG1A 4E5MA 1UM8A 1R37A 1Z6GA 4MR9A 4CT0A 4BN0A 4D45A 3N9IA 3KDPA 2J3KA 3UANA 9ABPA 4AYTA 2P4SA 4DR2I 1K7EB 5BYKA 2Y2VA 4H60A 1CR6A 3B89A 1YI1A 4CKCB 2PUCA 5E2AA 1KAOA 4AG3A 1J2UA 3L84A 3KDSE 3FLMA 2AN5A 1GA1A 1ESMA 5J9FA 4DLAA 4MW9A 2HD4A 4F21A 3I45A 4PAMA 4TROA 4BDSA 4RIIA 1T0BA 4MPRA 4PANA 3C85A 5T6MA 4R3WA 1RRGA 1DAEA 4K6OA 1BDIA 2ZXFA 3RF3A 1T6YA 1TT5A 5EKSA 1UK7A 2O1XA 4Q7JB 5EHGA 3EXEB 2GHIA 2BMWA 1G7RA 3FPFA 3CO5A 2ETVA 5CK4A 5E7JA 5AXCA 4P86A 3ORHA 1OMOA 4JTAB 1AUEA 2AUTA 3HYRA 4UNSA 3KKBA 2X5KO 4WINA 1V8BA 2FZCA 2Z4SA 3FIJA 2VNIA 1SHTX 4PHHA 1IZ7A 4CF7A 2ZUEA 1JNXX 1DJMA 1J22A 3ABSB 2LE0A 1KJZA 2I03A 1HBJA 3FYUC 4DDTA 3H4VA 1QHIA 1T1EA 4QGGA 4W5OA 4BPMA 3ITNA 1BIFA 4WI1A 2ID8A 1DXYA 3AFHA 3QSGA 1MNDA 3BT7A 3PQ5A 4L9RA 3SYRA 2HSJA 3SOPA 4BNJA 2CVQA 1XD9A 1E1QA 2HA2A 3E0QA 1N36I 4TXNA 1LFDB 5LP6B 1HNWB 2YJGA 5KINB 3AI2A 5JMWA 4BQPA 1YB7A 2G9VA 2R8PA 4JQZA 1QS0A 3MWFA 4KLZA 1ZR4A 1E2HA 5KI6A 5CGQB 5AC4A 4OFBA 3QNMA 5CAEA 4DAEA 1WZNA 2AMJA 1YBFA 4G67A 4RKYA 4IJUA 2VBIA 3LQKA 3UWPA 1DKMA 1TVEA 4L72A 4DLBA 4HFNA 3FXAA 4NCJA 4URXR 2FWJA 3QE4A 3S40A 1IPEA 2ZYSA 4NAVA 1T91A 2AI2A 1RYNA 4XQCA 5KNDA 3CW8X 2CL0X 4QUHA 1L5MA 3L8EA 1RM4A 2VHXA 4PO9A 2BGMA 4YRAA 3I73A 4IXWA 5BSGA 3SYMA 3EYAA 1DJNA 1O95C 3TSOA 1RJ9A 4YDHB 4BWGA 4NAUA 5DU2A 4RDHA 4NYJQ 4U3JB 2FEAA 2R2AA 3L07A 1NYRA 5IWCA 1PHPA 4RPFA 1VSQA 3BZUA 4UEOA 1JDVA 2P2CA 4Z99A 4RTOA 3OQOA 4YCAA 4PXAA 4EQ6A 2Z95A 2WQZA 1D0XA 3DKRA 3K30A 1EZ1A 3ZTYA 5JQGA 2QENA 1JEEA 1LEHA 1NNEA 2RCYA 2A5YB 3L7IA 4DPTA 1ZX1A 1VIYA 4Q37A 1MHPA 1K7SN 1YE3A 1BFDA 5ALPA 3WWZA 4EHKA 2VHEA 1LPSA 3GM1A 4BKQA 2QM7A 3QFSA 4IQ0A 1R6AA 1PGJA 3PS9A 4B7AA 1Q1QA 5LWQA 4PFOA 1DAHA 5D2CA 4L0DA 4UT4A 4CUZA 1ZVQA 4Y67A 1W5EA 3U0VA 3K5PA 4L6CA 4OD5A 1Q5PA 3KLNA 5F98A 1SVNA 4JJ7A 1XJ0A 2XUDA 1RHUA 1GCAA 1B0ZA 3IUSA 3GEBA 2XLOA 2WVOA 1WY5A 1TKBA 2JZNA 2ZT6A 2QT9A 2YCLA 2PH3A 4FGWA 3T1NA 1YR9A 4LYHA 4H1VA 5F77A 1K05A 4DZTA 2V6JA 1U0HC 2D1FA 4CKCA 1B6TA 1XMIA 4FFLA 5JE8A 1QRTA 5KHOC 3UBTA 4GT1A 2FDXA 1G6HA 1F06A 4D9IA 3P0EA 1J2JA 3U3DA 3GJSA 4NK4A 4L1KA 1ZOSA 3ZJ5A 3LS2A 1J09A 2GZ3A 4M0EA 5I7UA 1U1EA 2IYSA 2W5UA 1FZTA 3S7ZA 4RV5A 1UMCB 1F3LA 1W0KD 1SGWA 2WSMA 3EZ7A 1NW9B 3U7EB 5AQEA 2IEZA 3DEYX 3MTGA 4MWCA 2GAJA 4WXYB 4MV4A 3BDVA 2ZBUA 3P2YA 2FR1A 3A6KA 3STTA 3IRVA 1RE1A 4HGNA 4OX9E 1Q0LA 2DSTA 3HC7A 4EHLA 1RQRA 3MUOA 1Y3CE 3G2HA 1C0KA 5TC4A 4Q9LA 2PO0A 4ZQCB 2QP4A 2QORA 1R9JA 4V0SA 4PCVA 3KSUA 3WDSA 2XITA 4E5PA 3MPOA 3OWXA 1K9SA 1MMGA 4LFCE 3RUFA 1KSFX 2OQIA 1KKMA 2HJWA 1BHO1 2R00C 5CDSA 5EZ6B 1F48A 1YE5A 1XROA 5LP6A 1W52X 4USMA 3SOZA 3AJDA 1A5SB 5IAGA 3VNQA 2R7VA 3QMWA 2W71A 2W7TA 1WN0A 1TM2A 1OVGA 3ESDA 4W9RA 3D8RA 2FZWA 4KGZA 2C2ZA 3G0CA 5F5XA 2FZ4A 1RTTA 3K4QA 1Z0GA 3V3KA 3B9PA 4G97A 3I4FA 1AKWA 1W7AA 3CH6A 4FBGA 2DHCA 4RH3A 3V4RA 3WB2A 1V95A 4JXXA 1XNRI 4AZSA 1RU3A 3OTOI 2XNHA 1SCQA 1YAUO 4YJWA 5DCYA 1TJYA 3USZA 4MNDA 1K98A 1Y1SA 4LF4E 5KEIA 4YJFA 4IV8A 3ESBA 4QHSA 5C7OO 5BV0A 4ARZB 4L8GA 4EECA 2P4QA 4A6EA 1TEZA 5BUZA 1TMOA 4DIEA 4Y3UA 2C03A 1SG0A 2P3LA 1QWSA 3VVLA 1LDEA 2EAUA 1P4RA 2ZTUA 5BSFA 3LNMB 1RCUA 2OENG 4KN6A 1QZ3A 3RU3A 5IBRA 1RWNA 3Q72A 3H4MA 5DXAA 1LVGA 3T9EA 2FEXA 3RIYA 4TT8A 1XLTC 1RI4A 1Y1LA 1I7SB 4EUKB 3KYDB 4V1CB 1KMHB 3WRXC 4HDRA 1LI4A 3NMKA 1FUYB 2L2QA 4I9UA 1NUPA 2FG6C 5G3YA 1X2EA 4JCCA 3K9FC 2OY0A 3PUYA 1GTG1 3MC1A 1KR5A 1KE2A 3EF0A 4GX5A 3BFPA 1TM4E 2JJ1A 2ZAOA 5EKXA 2ZTLA 4LOLA 3FFTA 2OZKA 3G1UA 3TZEA 3UPDA 4PPGA 4B7CA 1R6XA 2V5VA 2P9ZA 3JW8A 2B9VA 5JHGB 1H5UA 1SXHA 2BR2B 2FQYA 1BS2A 2Q46A 5GIOE 4PEVA 4NF2A 1V39A 3D8NA 1CLUA 4OO1B 1BO6A 4U2CA 3TB6A 3B3AA 2HT1A 3L8IA 1NBHA 3FYCA 2GN0A 2VDRB 1IQRA 3O92A 3UMHA 4K05A 4DLXA 1R64A 3CG0A 3V7FA 3Q9NA 2Y93A 1C8VB 5LU9A 3KNZA 4FHCA 4JUFA 5J47A 4TV9F 3BZBA 1ZS9A 3KOXA 4OMUA 3H9JA 2QE7A 1NFNA 4YCCA 2O3RA 3QEOA 1TJ4A 4U7GA 1LC0A 5CFZA 3HBLA 1ULBA 4C7JA 3SY8A 2PFGA 2AG5A 3OU7A 3IC5A 4JOBA 4XOUA 4RBNA 2P11A 2FMFA 1VG9B 4KDRA 2EW8A 4PYIA 1ZGJA 2NNLD 5JDIC 4DLPA 1AK9A 1UMCA 5KOJB 3R5HA 4HVCA 1V8DA 4ZI2A 1QQ6A 2BZ1A 2JVIA 3ZGOA 3HU2A 1SU4A 2X58A 3CZRA 4JEIA 3VQTA 1HE1C 1NVUQ 2Y66A 3SN6A 5CLLA 4OCZA 2UV8A 2R7RA 3O1IC 2EPOA 3E7PA 2QTVA 1ZIDA 2BMEA 4JP2A 5ALWA 3RNLA 3T3PB 1I2AA 4RQTA 3UJNA 2AK2A 2A4MA 3RJMA 5ICFA 5A0TA 3SBOA 3QKRB 3LDGA 5HSGA 1JSLA 3O4JA 4MI1A 1IUKA 4KW7A 3ELDA 4E2XA 1ZCBA 3ZE0B 4D0SA 4LCGA 5CHEA 16PKA 1ZN8A 3T94A 4KNWA 3KD3A 1T01A 3RBAA 1F3OA 2AHRA 4R3UC 1W88B 4IDFA 1H9AA 5CIYA 4BB6A 3C5WP 2YBDA 1HETA 2C8LA 1CJKC 1CUDA 4ZV9A 2BVNA 1WB4A 4IUBS 2I9PA 2I6QA 3K4PA 2VH5R 3CV3A 1IU9A 1T5IA 4JTCB 1E84A 2ZUCA 2RBKA 2PX0A 3AM5A 1U2DA 4MV5A 2VJPA 4C0HA 4TZTA 1HSOA 3FB1A 1VPVA 3UV7A 1XWIA 5TMPA 2QBYB 3FTDA 1XXLA 1RHQA 2H4ZA 1WABA 2VESA 4E7ZA 4K03A 3M85D 4GBED 3NPMA 4HLUA 2VASA 1ZHOA 3LLKA 1WUJS 3VU3A 4DG9A 2CMDA 4Y9UA 2VNKA 5JRDS 1CRQA 2X9NA 3TVYA 1OTXA 5LJIA 2DFNA 1QHYA 2AW5A 1BN7A 1G2QA 2J5BA 4ARZA 2AR7A 1OQCA 5BQPA 2GX6A 4J7AA 4MS3A 1ZWLA 5JAUA 1IUOA 4RD9A 1B41A 3PQ6A 1ZUWA 1J4AA 5IS2A 4ZO7A 5EMHA 1VOTA 4M83A 3QE2A 3W5SA 1GGKA 1XP8A 3UJ7A 2A5DA 2NZWA 3IKLA 1GSOA 3IUNA 2EP7A 2W2MA 1E3SA 3M7IA 2DI3A 1RXUA 3ES9A 4EUKA 3KYDA 4V1CA 1XHKA 4DDVA 3CUVA 3CUTA 1WMSA 3K5HA 1Z47A 4ZGWA 1NNUA 2UVQA 3S68A 3CCCA 1ZR2A 4RD6A 5FULA 4F1KA 3NWJA 3DHVA 2IRWA 1XVUA 2F3UA 4YCNA 1V4BA 4MW2A 3RG8A 3RQIA 4XUCA 4KE7A 1QYXA 3AG1C 4C29A 4OGFA 1D2HA 4ESEA 5AM4A 2HMZA 1KI9A 1CYEA 4UVDA 1RI3A 2BR2A 3ZU2A 5T4FA 1TJ3A 1Z17A 1XNQI 4RA6B 1DFGA 4BVFA 3PC7A 2C78A 3NBFA 4LW8A 3JQ7B 1R4NB 4WKNA 1Z0KA 2J0EA 1CB7A 2VJOA 3GA0A 2BI7A 5JP7A 2YINC 5DNDA 4XB2A 1DXOA 1AKVA 3OJEA 2NMVA 4C7BA 1NYTA 1RFLA 3FAKA 2XOXA 2ZIUB 4JI5E 1E96A 3WSVA 4G8DA 2UDPA 2RGUA 2WABA 4TSRA 1ZL0A 3FPKA 2YTZA 1IBSA 4BKUA 3ZJVA 2VRCA 2WJIA 4P58A 4O6VA 5B64A 3SVLA 5JOQA 3IXMA 4INJA 1T1SA 1PDVA 2IUUA 4MYUA 1RRVA 5B1SA 5ENDA 2YYZA 1ENZA 5DOVA 4HX5A 4DM3A 2KYHA 2I65A 2J9WA 5KOJA 1X7YB 2YFYA 3Q8WA 4PCUA 5DNCA 2YWBA 4F5WA 1BZ4A 4HQKA 3R6TA 4O2LA 4UM8B 3T1TA 4CF5A 1TZ2A 4EO7A 4FMPA 5C0XC 2Q3EA 2XTMA 4LYJA 3F2IA 1IBKE 5DTJA 4KYVA 3CNLA 3RS0A 3UTCA 4J0FA 3JAMQ 1IN7A 1S5PA 3H3JA 3PQ3A 2R7WA 3K0BA 3TVDA 3KBBA 4TLAA 4U5EE 1MMDA 4YO7A 1Z56C 3E7FA 5A4FS 1ADYA 1N1DA 3QKRA 3HYCA 4FFPA 1EVLA 1V26A 3FW1A 4B81A 1N3IA 5JCJA 4OYRA 5HYVA 2Q5IA 4M9UA 4EB0A 3HCPA 3CRRA 2XT6A 3OF3A 4HS4A 2QSZA 3ANXA 4RWEA 3A7EA 4RDIA 4GLLA 4MP8A 4JI2B 2L42A 3ST7A 3Q7QA 1WHTA 1YR3A 1GYQA 3W1WA 1OCEA 2D54A 2FE1A 3M83A 3GP8A 2ODWA 3AQ4A 3CF4G 4M0LA 2FPIB 2BR5A 4RPKA 4O4HF 4K9SA 4KR9A 4G0UA 4LFBB 1L7DA 1P5HA 2D5CA 5THXA 2XNJA 2GLTA 2GM9A 3I5UA 3FVRA 1KYXA 1WLSA 1NY5A 3FKSD 5GM1A 4N6NA 1KR2A 2XT9A 4LOMA 4TLMB 2XCSB 2W6JD 1DJOA 2PL1A 3ROQA 1UIRA 1YS2X 3ROZA 1C7FA 4L22A 2QPAA 1TJ5A 3CZ6A 5CDUA 2R6ZA 4P22A 2HPVA 1T43A 4WCFC 4HAVA 3BWBA 2BHSA 4O2AF 1IBLB 5F4BA 1LX6A 2B99A 2I8LA 4RAOA 4LLCA 1MENA 3GLKA 1KZ1A 2H1CA 3C8MA 4HF7A 4NHOA 4XKJA 3W06A 4BC1A 3EQ9A 4B4DA 3OEHD 4O4JF 1I6MA 4CTKA 4J16C 4CTNA 1HDIA 4NPHA 4AF6A 3HXKA 2FQ1A 2WNRA 2I29A 1G9SA 1UDAA 5A04A 4BNXA 2QG9A 2ICAA 1YARO 4UDVA 2WUWE 2OP0A 3IOCA 5F5HA 1R10A 4PC3A 4X63A 3G8BA 4BAUA 1ZK3A 1Z0ZA 1Q0SA 1N2SA 5K01A 2JFFA 1SC9A 3PHJA 2VI5A 3BK7A 1FMJA 1ST6A 4X3PA 1B14A 1E5LA 1RRMA 2G5GX 2WE7A 4R3NA 2RGNA 2W45A 1G2OA 3R8CA 4RA6A 1PFYA 5DB4A 5BT9A 3GFSA 2VUTA 2FG7C 3AFNA 4YT5A 1O5IA 2JD2A 1KI3A 4XR9A 1R4NA 2GJ8A 4YWHA 4B82A 2HIMA 3UATA 3PNSA 4AXXA 3JY6A 3S81A 3LQYA 5LMNI 4LGVA 1XRQA 5EP2A 3K7EA 4B7UA 3W8RA 3NAGA 4DKXA 2DXIA 4YIKA 3DKVA 1GRNA 5MN5A 5K51A 1M2GA 4XCVA 3GMSA 1DCTA 5FWNA 2LCHA 3PUXA 3OT4A 3NNSA 3TIXB 4Y0VA 3B53X 2DB4A 3OI7A 2TYSB 5IPFA 3PT5A 1F8XA 1Z82A 1KA9H 4V0NA 2FKNA 3L8YA 5DM1A 4N3OA 3WIDA 4NV0A 1K1EA 5E8RA 4JVOA 4A15A 4D9FA 5CTJA 4WUVA 4OH1A 2JT2A 4AJ9A 5LQNA 2ZVPX 3E3MA 5A71A 1E0KA 5DNLA 3OZCA 5J23A 1OAOC 4G0MA 3QLEA 4G0ZA 3FY4A 4MV9A 4OK3A 2EIKC 3KKLA 2XAUA 3LQ4A 3MUNA 1H8HD 3BEHA 1FXUA 2E4AA 5HIAA 3E3NA 1RLOA 2XD9A 4DUZB 4BO1A 3NIDB 4ULWA 4OAQA 1VPEA 3TD6A 3H1AA 2QVZX 3DCIA 3ZZUA 2ZITA 3LT1A 4AB1A 4H6VA 1XXEA 2XRHA 1IB0A 3NIGB 4XM2A 4HFRA 4NYMQ 4EIWA 2GVDC 2C95A 2ZG6A 3KTDA 1C3XA 1EI1A 1WU7A 2Y1FA 4R81A 1PWHA 4KFSA 3R3JA 2EDAA 1Y9AA 3CC8A 2V55B 4XTKA 2CGEA 1ZRMA 1K7YA 2J3DA 4XE5A 2LKCA 4LXYA 4HZUB 4IZHA 1X1RA 4DBLC 3ZHQA 1E7WA 4BNFA 1P77A 1UBTS 1K0FA 1M5TA 2UUAE 1CDOA 1CZRA 2F8LA 5BN3B 4P9NA 4OLBA 1GZ3A 2SHKA 4KX5A 1EGQA 2FPIA 3DZBA 3F1LA 2P9TA 2ZJFA 4DDKA 2C9BA 4TRMA 4UPEA 1Y1RA 4JT9A 5C46F 2BZ0A 1FMLA 4X8LA 4OK5A 4B2YA 2HREA 2FMXA 1WM1A 3R7DA 2VCEA 3EVCA 4B17A 4EHFA 1TLLA 5CVUA 3FCAA 2FFQA 2FPMA 3KVVA 1F7UA 4CCYB 3ZHXA 1J0CA 3MT7A 1QLEC 4Y2SA 3UYLA 4FFOA 3W4KA 1KF0A 1ZSNA 1XWFA 2F1JA 1MDFA 2D00A 4BO4A 2WDPA 2EEZA 2LUOA 4DNOA 4Q4HB 3RB8A 3B7PA 4KO3S 1I2BA 2GRJA 1N5MA 2BLNA 4PZZA 4IDDA 5FNVF 3AHFA 1MP0A 2C97A 3HCFA 2A6HF 1L3BA 2ESRA 2P78A 3LK7A 2ZM5A 4C6TB 1VYHA 2G1KA 2BFCB 1G9XA 2YJ5A 1DQYA 1QZXA 1XMOE 3ITFA 3SHTA 4RIGA 1YBAA 4YMWA 2HMYB 1JH8A 1DAPA 5KWJA 2PQMA 5DQZA 5F1YA 1IN1A 1XLWA 2RH8A 5JNSA 1A77A 4ZANA 1W0KA 3AX6A 3OE5A 1R5BA 3GK3A 1LPAB 1S16A 1XCJA 1Y3AA 1FNDA 1DV2A 4BJ1A 4IOLA 1RYYA 2A68F 4FW8A 1R66A 1MZVA 3BXHA 5CBPB 3VUFA 3C24A 1AB6A 4IOMA 2CG9A 4DA8A 4BB9A 5EXEA 1Z0DA 2I6GA 5KTRA 2CCJA 2QQ5A 1EDEA 5E4FA 5CLHA 4ER0A 1AZSC 4OIRF 3S99A 2DYKA 3OP4A 3E6AA 5G0WA 1NIPA 4H3SA 2JAPA 3EIOA 1E3IA 5FI3A 3FTNA 2CWDA 2H7OA 5I7HA 2O5CA 1BKSB 1U7PA 1QQ3A 4PZLA 5DO9A 5C3UA 1WPQA 1M2VA 2BTEA 4D4LA 1RWKA 3LCRA 1JE0A 3ETGA 1RZVA 3QIAA 2IF0A 5KNLA 3P9QA 2WUDA 1U0FA 3ETJA 5KVQA 2EARA 1TM3E 2GCOB 1SZDA 2C2GA 4HNTA 2G5CA 2PR2A 3D6UA 3VPXA 5DH9A 5KQRA 4KQ1A 5J59A 3RKOF 2F59A 4KUHA 2OZLB 3EULA 4BZZA 5CDGA 2RK3A 5T3WA 3FUUA 3CLUC 3JQBA 4CV3A 3PHLA 2WBLC 1T5SA 3TD7A 2XMCA 3PC3A 2JFHA 1DAKA 1ONNA 3MYYA 2ORIA 4IO1A 3BSFA 3R8XA 5B2FA 3UJPA 4AKGA 3SE7A 2Y67A 1O57A 2C88A 2XTZA 2YV3A 2Q00A 1L4BA 4MKFA 3NHMA 1F8YA 4ESVA 1IWOA 5KYKA 2NVWA 1MIHA 1E9VA 1G8MA 3S2EA 3K1TA 1K8XB 5DT9A 4NLLA 3OFVA 1YS7A 4P83A 4WVLA 2ZRCA 3KQSA 2QNRA 2R7SA 3FUWA 3AYZB 4GF5A 3WKAA 4COOA 4CF4A 3MINA 3N0WA 2O50A 3W9SA 4HZUA 3JYQA 2PLNA 5KJFA 2QV0A 3RROA 4BMYA 1CY8A 3KEQA 3L8JA 3IUBA 4C3VA 1HE4A 3H9CA 1ZXLA 4W9MC 2G0TA 2H2IA 2J3QA 3OM8A 2C5BA 4YROA 2Z09A 3FMOB 3X1OA 2CC2A 4H7EA 4A10A 3U1KA 3JQQA 3ASNC 1LKXA 2WVGA 1MNAA 3SLRA 2HX1A 1AG9A 2A5LA 2CDCA 2FPPB 3FMSA 4TTVA 5AVKA 2W2NA 5AMXA 5CA1F 4HLDA 1GPJA 2LWIA 4H6PA 1PSWA 4OXIA 3OQPA 1KI2A 4FMBB 4RXMA 4WN3A 4DR7B 5IDQA 4CCYA 5TARA 4YS6A 4EYGA 4XIFA 4U5CE 2N0SA 5ALJA 2QU7A 4J0DA 4XAQA 1QO7A 1MO5A 2QE9A 1MJHA 5K4GA 4Q4HA 4B4VA 4TQAA 4WZAE 1NT2A 2EQBA 3UAGA 3HN2A 1WASA 2H9YA 5J4LA 4QDLA 5CPBA 3T3MB 3CKKA 1CKEA 1C0PA 1X8KA 4N3CA 2PMKA 4LMRA 1VI7A 4MTCA 2BM9A 3M0EA 4UQPA 2BFCA 1SVMA 3H4IA 1PE0A 4M9QA 3E9MA 1XBTA 4PG7A 1SBYA 3R5JA 4LJAA 3ZE6A 2PNZA 2C94A 3C15C 2XUGA 2JAOA 5EAIA 5M04A 2H8AA 1EFDN 3EC7A 3QVYA 4G4IA 5JZ9A 1MRNA 2VPQA 1IOLA 4JDUA 4MZDA 3HFSA 1GKKA 3DL4A 1KL7A 1TFKB 3SS9X 3UNGC 1BFKA 3DE5X 1IZYA 3IPRA 3VZBA 3HJBA 3BGDA 5CBKA 4X1KB 2WVJA 1DIGA 1PW5A 4A03A 3GXBA 5CBPA 3T52A 4YV7A 2WSIA 1EWKA 4XUDA 4FXPA 4XLNF 2EBUA 4PLFA 1HLDA 2J3JA 4LQ4A 1T6XA 4J7YA 1IM5A 4DV2E 4GOKA 1U7ZA 2F1HA 3E4CA 1ZC3A 1CY4A 1P6XA 4ZICA 1Q2XA 2HF8A 1PGPA 3E2MA 4KAJA 2D7JA 3BSSA 4TYMA 2G1UA 5IN4A 4HB4A 5HIKA 1TJNA 2PKEA 1XQ6A 4E30A 1YTLA 3IQDB 1RYEA 3DUWA 2LP4A 1N8NA 4V2IA 1SU8A 1UZNA 3WGKA 1IMJA 4ZZ3A 5D3MB 4A9AA 5KREA 3GGSA 3BAZA 4FEYA 3IHWA 1QPZA 1X70A 3MTDA 1XYVA 2GCOA 3C1UA 2NUTB 2B0CA 4W1QA 1WQ3A 3GEIA 1CDEA 2LCFA 3FCUB 4IX1A 4JOQA 4MGEA 4BE7B 4F7WA 2P5UA 3PXCX 5FLEX 5KSYA 1DRVA 1RWWA 4AO6A 2QHXA 2OZLA 4AURA 1AF7A 1NYLA 3O3CA 2X13A 2CLHB 3FFBA 1LPNA 1MW9X 5JC8A 3HRIA 1NXSA 3H4LA 1D6TA 1N33E 4CIXA 4QDZA 2X5JO 3CX4A 3A0UA 2CDBA 2DWPA 2Z57A 4W5NA 3DMDA 3G13A 3QGMA 1GDDA 3FYDA 4JLJA 4I5FA 2G3YA 3KB1A 4JJEA 5ALZA 2AX4A 2KW3C 3Q87B 4FVTA 5IF9A 3RS2A 4Z9XA 4E14A 1DFHA 4LY6A 5JISA 1HDOA 1UFKA 5JYEA 2QJTA 1NMSA 5T67A 1YB4A 3Q7EA 3ESYA 1TYEB 3TE6A 4WX2B 1PR9A 2G67A 3L06A 3UMKA 3ASZA 3K32A 2LZ0A 4QA9A 4AMVA 4NBSA 5A1TA 4ZAFA 2UUHA 1MU5A 2A30A 4UNRA 5HM6A 2PGIA 1R4AA 2GERA 2WNSA 3VNVA 1TIKA 3PDWA 3NPAA 4F3RA 5DEIA 3A6GA 4DLSA 3VU9B 4URUR 4BGDA 3BCSA 3ENWA 4KK3A 5H1YA 3WLRA 3G23A 3U8PA 3MYFA 2FPGB 2Y2UA 5LBIA 5BW5A 3ZOZA 4OX9I 3PXXA 4P52A 2I7CA 1Y3IA 4Y1FA 4EF6A 2G8NA 4RHFA 2OBXA 5FFFA 2Z1DA 1WEKA 3K0CA 3I34X 4AF7A 3CEXA 1F5NA 1DP4A 2CV1A 2FPPA 4DMUB 4K9OA 3KWLA 7MHTA 1U11A 3BGWA 2HJGA 4CUKA 3I2JA 1T9CA 5SZIA 1VPWA 1QQBA 3LHDA 4CMKA 2IY8A 3ZVMA 5HG0A 5AM1A 1HR0E 4XFDA 3KXDA 3QUSA 2NV0A 1CDZA 1HURA 2GAOA 3LZ6A 4LFCI 2VFAA 4PRXA 2QUHA 2CHGA 4H54A 1NW4A 3V8QA 4DWJA 4OO1D 3EWIA 3TOSA 3IQIX 2GDZA 5DS5A 1YBHA 3DQPA 3HYTA 2FMIA 2ZBEA 3DUFB 2RJ3A 2DKOA 1N75A 2BEUB 1SKYE 1Z0TA 3Q7LA 3HADA 3LC2O 1U5AA 1FSSA 3LHFA 4F2DA 1Y5NA 3W4IA 3KSMA 2NLOA 4CWAA 3C5HA 3TTXA 3S9OA 4JP8A 4BPRA 4DXWA 1AO0A 3TN7A 1U7WA 5JSYA 1BA2A 3VR3D 1H6GA 5IKMA 4R5MA 4UTVA 5B6PA 5T3TA 1WCYA 1KH1A 2KPOA 2IEYA 3H99A 3R75A 4GI1A 5H9VA 4MKHA 3KJXA 3AL0C 2JFOA 5I4BA 1KJJA 3OZIA 7YASA 2ZS8A 3QXXA 3OA0A 3UQZA 1VBFA 4C20A 3DONA 1GZ4A 4LF4I 3DCNA 2ZRMA 3HYSA 2D62A 5BV1A 4Y9DA 4KH0A 2OLJA 3O74A 1E3EA 2Q3HA 3GYGA 4GMKA 4NX2A 4EVIA 3EPVA 4RETA 2Q3LA 4HN9A 4CMHA 2B8NA 4UAGA 4X1KA 3D6MA 2Q49A 4L73A 4G5XA 5DGXA 3Q2IA 4HJRA 3THXB 1DU4A 3GOHA 1WR8A 5T3UA 2VTDA 4NE7A 3FPHA 4ER5A 4H59A 2ZRLA 5G1NA 1S2OA 1MC1A 3W8IA 1WF6A 1KPIA 4U0KA 2IYLD 5JZBA 1YT5A 2XXAA 4BA1B 2CCGA 3L1VA 3OCCA 1ODLA 2N9UA 3UVEA 3ZY6A 3PUKA 4TMVA 2XMQA 4FB5A 3THSA 4H08A 1DEHA 3FF4A 3K6SB 3DQZA 1I1OA 3OAAD 1G21E 4MIOA 1IHXA 1JPNA 5DYYA 4J4TA 3V42A 1SB8A 3R4VA 4GH5A 5D84A 1U1DA 1JA9A 5CVTA 1IAQA 1P4JA 3AHDA 5ELMA 1U6KA 3P0FA 1V25A 1E3QA 5LKAA 1FOEB 2O8FA 1SZPA 2NUTA 5JFOA 4G6ZA 5M5BA 2V54A 1VRWA 1V6SA 1FWLA 1T9DA 1MKYA 3AZQA 2ZR8A 4GC9A 3SF8B 3FCOA 1E0AA 3MT0A 3TR5A 3FKSA 1RHJA 3D3KA 3W6NA 3MMPA 1XU7A 2W6JA 2QS9A 1Q95A 4QOFA 1NWHA 1ISHA 2VBCA 3L92A 2XBLA 1L4YA 4LBZA 3B8EA 2ACVA 2G28A 5TS2A 5E8JA 1O9GA 1NULA 4RVFA 4RF3A 4GYYA 4EYSA 5I9LA 4WZBA 2QYTA 2XBMA 2VNAA 5YASA 3I9JA 3N0XA 4ZALA 5KWSA 1HO3A 4FCWA 1UWLA 1CVIA 3NTVA 3NYRA 5HR5A 4KYUA 2WAOA 4F8JA 821PA 2DY1A 4C30A 1FMFA 1CS0B 1Q7BA 3OEHA 2I9KA 1Z0CA 3TZCA 2IOFA 3QLUA 2XGGA 5F9HA 1ORTA 4GX0A 3K6RA 3N8KA 4JW1A 1WCXA 1TDJA 2B37A 3A37A 3M82A 1PT7A 1AA6A 2ZYAA 4AL0A 4ZO6A 1WNTA 2FPGA 1VXOA 3KD2A 4DWWA 4R2XA 4E12A 1PNRA 3SS7X 4II2A 1Z07A 3TDKA 2CJPA 3SICE 3A9RA 1NC3A 3GEEA 2R8RA 1R0KA 1MH1A 1Z23A 1NKTA 4Z0TA 4PG4A 1LKZA 3SIPA 5MHTA 3TAXA 4Q02A 1Z39A 4DCMA 4DUYE 3IOMA 1ZQ9A 2JH3A 1K8YB 3REQB 1E6EA 1KTVA 3ABZA 3I6ZA 4V0ME 2AH5A 4XEHA 2PX4A 3HVHA 1IE3A 3AJEA 3CPJB 1FC0A 3GRPA 3IJ5A 3AFGA 3DUFA 3G8CA 2AFHA 1WSDA 2BEUA 4ZZ2A 3QA3E 4FDLA 4MV0A 4Z86A 1RS0A 2GYYA 1QRAA 3PHHA 3DFMA 4DVZA 1GCGA 4TLEA 1GPLA 3PVCA 1TAUA 3M6WA 4A23A 3DT6A 4O1HA 2OBBA 4W8PA 2RAVA 3U2QA 5AM5A 4J3FA 3HDTA 4UATA 3LYLA 2XUIA 4IDGA 1TXGA 2I7DA 3HHEA 1JHDA 3DH0A 2R6FA 3ZIAD 4PSAA 3NZKA 3L34A 3GRZA 4IGEA 4IRMA 1NV9A 1C3VA 2QVYX 3QBJA 3PC8A 1EE2A 5C8YA 4EJSC 4Q18A 2Q07A 4PK4A 1I5RA 3NUZA 4BO8A 4NATA 3IYLW 4FE3A 3P7MA 3M4JA 4KIUA 2A88A 3VKVA 1S0UA 2MSNA 3RFFA 2C3MA 2GK4A 4BNNA 3A2LA 1JMWA 1PD1A 1ADGA 1ISFA 1GU1A 3FDIA 4OBXA 4KI2A 4BA1A 1QGED 4I8XA 4M7OA 3EVNA 4EJFA 1J0DA 4AC9A 1NG9A 2IDKA 3FSEA 2Z5LA 4U8GA 3K6SA 3RPEA 3WGZA 3HB7A 3Q6NA 4K7BA 1IG0A 1FS4A 2NSLA 3WJ2A 2Y68A 3KSZO 3T1YB 1LSUA 2DVMA 5MDHA 1VRVA 4NAHA 4EABA 1RC1A 3ET4A 3ZHRA 1H7SA 4CFSA 1ZI8A 1DKRA 2PO2A 2AF3C 3QEMB 4RJIA 3NNDA 1Y60A 1K6JA 2VVTA 3U39A 3A6JA 4GI2A 4I1YA 2IU0A 3EZ2A 1KEPA 5JUAA 1G0NA 4CMGA 4TRNA 3UG7A 3S0XA 3EPJA 1Y8RB 1UBUS 2WICA 2CUKA 2JFPA 3ZCTA 5C81A 3UHJA 5DT2A 4PX2A 1ORHA 1O08A 4DR1E 4PTYA 3NTUA 2L82A 3NHLA 4S35A 3GGGA 1DJLA 3RS7A 3ROEA 4J7UA 1INLA 1HE2A 3GJYA 1D7OA 1HKUA 4R8MA 1QIIA 4HAIA 5JROA 4P4NA 1IEQA 1TNDA 1ZGZA 3ZDEA 1RVV1 1LWOA 3U31A 5BQXA 4DNQA 2NYUA 5JS8A 2HQOA 1TC2A 4IH4A 3K0EA 2C5FA 3VU1A 1TTPB 2B1RA 4ZI7F 4AUKA 2IGBA 4G56A 4MCHA 1Q83A 5FPPA 2PZGA 1U4NA 3VPFA 3SX2A 3D0RA 3V1NA 3FPCA 1P0CA 2IEGA 1HNZI 3IULA 5IKPA 1ISGA 1KY2A 1D6MA 4AVYA 4M0DA 3JZFA 3QU2A 3ZWNA 3C7AA 2DYSC 1IBKI 1NQOA 4GPBA 1JDBC 2NG1A 5AJVB 2EW1A 1GZSA 2L6FA 2YL0A 3P27A 2QN3A 4TTSA 5T4EA 1O95D 3O8LA 2B2NA 2YN4A 4ZVPA 1LK0A 2XH8A 2Q1YA 3EXEA 4DV7B 4EYKA 4TMXA 4XDGA 3QOYA 4BLRA 2VLBA 1DMRA 3ZHSA 2YHUA 3ABQB 2GCNA 1FS6A 1ENOA 1UOOA 5K0NA 3PJFA 3W7BA 5K0TA 2YYSA 4W7SA 5HDQA 4RJTA 3PVZA 5A5FA 4BASA 1QFJA 2GSWA 5ALQA 2Z2IA 1L7MA 1LLDA 1QQTA 2QEQA 2JRCA 4PJJA 4DG8A 3LTNC 1LRLA 1ISRA 3ZWKA 5EUCA 4GM1A 4S1TA 5CXQA 3GA5A 2ZWOA 4GXQA 1VLQA 1L5LA 3WKDA 4EA7A 1DT5A 5A69A 4EY6A 2ZPUA 4B71A 4HCJA 2ACEA 4LZAA 5IN5A 3L40A 2ATEA 4RV4A 4WD3A 2Z3VA 1NVDA 3IVMA 3SXYA 1QCCA 3G1TA 3B6JA 3QTLA 1YKSA 3I42A 5K8JB 3WU4A 1NOJA 2WV9A 5JS7A 4CG3A 5DS4A 5G3ZA 2ZUBA 1L1RA 2AE2A 1KKLA 3MBGA 1MOPA 4U5BE 4OSOA 4C0LA 3HK2A 2R7TA 5T8KA 1BYUA 4PGGA 3T5MA 1EGMB 5DYGA 4PSCA 1OLSB 4LN1A 4ZK6A 1DTSA 4X62B 4MWOA 3R3SA 2W93A 4G5GA 4O02B 5I7RA 3F9IA 1NDHA 4U7DA 5ES3A 1UBGA 2KSQA 1XMQB 4I7EA 3NT4A 1E63A 2GDCA 4O4IB 3W8DA 4O6YA 4I50B 2WJ3A 1RIFA 5K5EA 5G53C 1F17A 1XJWA 1BWRA 4FFSA 1HMOA 2LCQA 1NMZA 3T7TA 4D9BA 3JWHA 4YRLA 3NHWA 1FI4A 5IDYA 5HRCA 4U3JA 4ND4A 4MTLA 4M9CA 1XHFA 1MJGM 4BEBA 4REQB 2H52A 3RANA 4CV2A 5IVHA 2PUGA 1M2EA 1FRQA 5K45A 2Y0EA 3O75A 4EK9A 1MMAA 3I2HA 4WY8A 1JBKA 1G8AA 4UE3S 4WOCA 4YRKA 4L8WB 3EVBA 1CR1A 1U5BB 4Y2HA 3L7YA 1RBYA 1EM8B 1VJDA 1Z0BA 4DSZA 5HUJA 4M21A 3QEMA 1Y6FA 5G0TA 3P9CA 3CNQS 1U28C 3ZG1A 4DRHB 1GTL1 4CT5A 2RHBA 1R0RE 2JZCA 5COGA 2QAIA 4LY0A 4TYQA 1LUAA 4YUYA 1Q1NA 1F60A 1F2VA 2FVYA 2MU1A 5E9WA 4DNFA 3A9SA 1Y8RA 3GNQA 2Y1OA 4MDYA 4ALIA 1M34B 3AUJB 1JFSA 3BIOA 3HGMA 3UNXA 2V8BA 4MW0A 3PE4A 3S1LA 3NBAA 3G17A 4JVLA 3EZGA 3BXZA 5JADA 4HGZA 4L5BA 2A8YA 4QYTA 5JQGF 4DLKA 3HSSA 3PENA 4V38A 4DEYA 2BF7A 1FFSA 1WB6A 1PV4A 5E9JA 5E1OA 2OZPA 2QTLA 3TNYA 1XCOA 3P9YA 4WKBA 1T0IA 1QJCA 1ZIYA 4ZQEA 2CJWB 3OZ7A 2ISSD 1C14A 3M1YA 2ZAMA 1PFGA 2CF6A 5KWEA 3GORA 4MVMA 5JNUA 4FGUA 1BMQA 3LBYA 1Y9DA 1Q7EA 4NMWA 2H1VA 2W4MA 3RHTA 4RUKA 1P7VA 2YIDA 2ICWG 1D09A 2VDLB 5EE5B 3WZ2A 5JYCA 4GLFA 1PGQA 3VAZA 3MD0A 1FNTc 5I9BA 4BXOB 1Q22A 4JL6A 2C4MA 2Q1WA 2WKWA 5H0IA 1T8YA 2IZ7A 4YV1A 3VNSA 1R4TA 3ZCXA 1ZN2A 2C7RA 3K70D 1NN3A 1KI4A 1BD3A 1V1RB 3K09A 4QSHA 1GTJ1 3Q3VA 4ID9A 4AT1A 3W4YA 1L5QA 3AGPA 1LSJA 1OXKB 1PX2A 2CXRA 3KE8A 1BE0A 1P33A 2Z58A 3EW9A 1PJ8A 5EHNA 4IO0A 4AZ0B 1KWKA 4G2NA 4MP6A 2QTNA 2BLLA 4B4UA 1QTRA 2UUAI 3GWNA 3FCXA 3FPBA 2GK3A 5HMMA 1SVKA 3A05A 1OYOA 2WYVA 4RTQA 3TKLA 2ZI6A 1Q0HA 3VKFA 3PSAA 4POOA 1SIOA 3ZBPA 1CUYA 1EFRD 3TLBA 2BGLA 2P91A 1M8FA 2PO5A 5IZ4A 1OU0A 2XCIA 1NJ8A 3SAJA 1XYYA 5JAPA 2E2WA 2AJCA 2NOAA 1CWUA 5JNWA 2F90A 1K6XA 4KN5A 4A27A 4DRZA 3HKCB 2OFWA 2JFBA 2O2YA 1SUDA 3QXCA 2W42A 1XOIA 2JI7A 3M70A 3UF0A 4YVFA 3DL2A 2VIIA 2DWCA 1L5KA 3NM6B 3RH0A 2DEJA 3OFSA 1QG4A 2BI4A 3UOWA 4ETNA 2UXBI 5LDDC 4FT2A 4HDSB 2QSJA 1QTNA 4MQFB 3KZKA 1SAYA 2I80A 1Q15A 1NHJA 3CLVA 3HYNA 1FUIA 4FYIA 4EHBA 5AJZA 5E4JA 3QVOA 4DPUA 3TNLA 4YCBA 4O4IA 1XMOI 1ZAKA 2I2BA 5E4TA 4I50A 2R7XA 3D7LA 1G20B 4RABA 3I9LA 3OD1A 3HCRA 2ASRA 4E07A 4AM3A 1VMEA 1TOAA 5IG2A 2YVQA 4Q5SF 4U3BA 1XDDA 1OTYA 4QQFA 4REQA 5FQOA 4V39A 5KYTA 3ZD9A 5DP1A 4QXOA 2R05A 1KMHA 3QUAA 2I4OA 3HVUA 3WG7C 5T1DB 3MK31 2B7BA 2NN6E 1QPGA 5J1SB 1U5BA 4DTCA 4EGAA 3WVNA 5IMSA 3JQ6A 4XTRA 4Y1GA 5AUQA 4B44A 3KS9A 2HIHA 4Z51A 4B3SE 1A95A 3GRRA 1USGA 2P4HX 1KYVA 5BQ5A 1IMOA 1YBVA 1YJXA 2VDJA 1KQNA 1KAQA 1KO8A 3DW3X 4YNBA 3ONFA 4XWWA 3KPWA 1ABFA 2OMEA 4OFZA 5FT9A 1XQYA 1KYZA 2B36A 5FUBA 5ARCA 2Q0HA 1DWUA 3QLTA 4DR2B 4NU5A 2CZ9A 4KAXA 4OO1A 3U8VA 3DL0A 2OCPA 1P0PA 5L4LA 1LW7A 2OGWA 3E3LA 1LLFA 4JTDB 4KQFA 4UUNA 2P2ZA 1SC1A 2JLCA 3FMPB 3TQQA 2ISCA 2Y27A 1HH4A 4QPDA 3FHOA 4B83A 2ZE8A 1Y42X 1BQ4A 2YL3A 2QX4A 4KYIB 4TXMA 3GT4A 2Q2EB 3LPDA 1KFBB 1FL9A 1S6YA 2CJWA 5FUYA 4BFZA 1O3YA 4RAQA 5CYGA 3RC8A 1DOWA 2AJLI 3EDMA 4G4GA 3OZXA 4UUBA 1SQFA 5FFMA 5AKZA 2VHZA 4X7MA 3AOEC 1T4CB 1P1KA 5LXTB 1R12A 1XZGA 4LZNA 1EI9A 1GT6A 5DK4A 1YE8A 1UPAA 1GQFA 2BV3A 4G37A 3LOQA 2ERXA 1QLHA 3NJRA 1H3FA 2VBFA 2ZRIA 3ZM7A 1VMIA 3ERCA 2K2QB 3MJSA 1XRNA 5BR8E 4OQYA 3OZBA 5BNFA 2H2DA 3NHRA 1Q12A 2QNLA 1N7HA 4X91A 1V1RA 3AJRA 1SUBA 1HDCA 2R5WA 5TMBA 2BL4A 4DMKA 4IX9A 1NKVA 1G8SA 1OXKA 3ONVA 3AL2A 1NC1A 3N5KA 1RTKA 1R6BX 4D4JA 3IP3A 1ZK2A 3CQ9A 3L01A 2P2DA 3CE6A 3O8NA 3FA2A 2ZS9A 4AZ0A 4DYVA 3OAAA 1GAEO 4FOPA 1VDZA 3A2NA 2IL1A 2DZDA 2FJUA 3HR4A 4F11A 1T4DA 2OC4A 4FLEA 3FNGA 1KEWA 3CHYA 3RTAA 5BNZA 4HAXA 1MB0A 4XVHA 1JBEA 4LYGA 2R42A 4I19A 3WB1A 1HNNA 2YY5A 2QTMA 3I5QA 1W88A 5U4QA 4KXNA 2RJOA 3FYUB 5CEJA 4NMMA 1WTCA 4HQOA 1IK4A 4ENUA 1YZFA 1B8UA 5D5HA 1N0UA 3ZDLA 4X1YB 4GRIA 4LIPD 1G3MA 2GAIA 4USKA 1GR0A 3WHIA 1OYSA 4CR8A 1CUUA 3MQ2A 1B23P 2O2XA 4ZJYA 4YAUA 3T3OA 2NZ2A 3NIFB 2QR3A 4M88A 3MT9A 1HYEA 5BR7A 3ZUGA 5AP9A 2QBYA 3NFRA 4HDSA 1W9MA 1ZVKA 5EXDA 1QQ7A 3MWLA 2FPKA 5I4KA 4MPPA 2WVHA 2K5UA 3SX4A 5DGTA 5EL0A 3KLOA 1GXSB 1G20A 2MIIA 4M8IA 4E4TA 1E2IA 5JEDA 3LPCA 4EI9A 4IVQA 3RVNA 3FDXA 2NO9A 5HDBB 5DBOA 3CVOA 2C9DA 4R0NA 5SICE 3WRVA 1CE8B 1H4SA 1E1MA 2NTJA 5DHQA 5C0XD 4S24A 3ABOB 4ADSG 4JVMA 4DC9A 5KPJA 3IT0A 2C99A 1KVSA 3AR5A 3K33A 1WUUA 2E1RA 2X40A 4XIGS 2JGDB 2OB2A 3T0IA 1D0YA 3DDSA 4HY3A 4BWYA 3E05A 3EA0A 1FA9A 5J2UB 2C2HA 4LJ4A 4OM8A 3CDIA 2RDMA 4DV2I 2C58A 1GT91 1WBJB 3P19A 3CX6A 4F3YA 1XE3A 1Y6JA 2R7LA 1EKXA 3H2SA 4QUIA 1MAWA 4JI7E 3NBZC 3D3NA 1SQ5A 2XZPA 1Z2DA 3L1IA 3E4DA 1Z5NA 5E6SB 3QWAA 3KKNA 2FUEA 4M0PA 4MI9A 3M3DA 5IWAI 4HGPA 1F2UB 4DABA 3HNOA 3IJRA 3B70A 1TGVA 5KHAA 5JECA 1KNYA 1R0LA 4YHHE 2M6KA 2DPGA 3I4UA 4IDOA 4I8IA 1D1PA 2OESA 1SBZA 3R9XB 3JQ7A 1W8IA 1VL5A 1QFSA 1WPXA 3WTBA 2I6SA 5J4HA 4XWTA 2TECE 2WA2A 1ZRSA 3PJDA 2H2WA 1EWVA 1Y6ZA 4A82A 1FX0B 1B43A 1LC3A 2HHLA 1I0ZA 4ZCPA 1PJBA 1A8PA 4CN9A 3WHLA 2Q27A 1HDEA 5DZSA 4ZTZB 1PQUA 1N33I 4JUBA 4BKPA 3SQWA 4HGQA 2DQZA 2FHPA 4Z4GA 4CMAA 4OQPA 1HQYE 1IY2A 5GPBA 1JT9A 3ZIAA 2GPTA 4LF7E 1T4CA 2UUBE 3PQ7A 1R6UA 4RPJA 4ND3A 3DVAB 3ZXSA 5LXTA 1R8QA 4TL7A 3SHWA 2CLEB 3G9ZA 3QVXA 3VPBA 1X7YA 1WKCA 3D2AA 3S8MA 1EQAA 2SBTA 4QE3A 1A9XB 2QMYA 2B7LA 1PHRA 2QWXA 1W2WB 2YN2A 4UHEA 1KI6B 1OFUX 3ORQA 4POAA 1GQAA 3F3YA 3ANLA 5BSRA 4G63A 2ZUTA 2YN0A 5KJEA 2JATA 2YXBA 4UTZA 4JY7A 4BVLA 2D5RB 3IPXA 3LPNA 2PV7A 3PE6A 1ID8A 4YXWD 2Z15A 4ZCLA 3N59A 5FR1A 3KJGA 1PGOA 2UXDB 3TEFA 5JZSA 4RFSB 4X1OA 1A7EA 1Y0BA 2A9PA 3RDPA 1XHLA 2E4WA 2WYIA 3FNRA 3HMQA 3TRIA 1A7VA 2HADA 2OAEA 2D3TA 1Y3DE 2Y6VA 5F78A 2IT1A 3LLUA 5E0OA 3PR1A 4HQ0A 2ZJAA 2W98A 3FYUA 3F74A 1E89A 4CDNA 1VKZA 4S05A 1QPUA 3M6AA 2JHPA 4G7ZF 4ZODA 5C2JB 1HR0I 1S05A 4HBGA 5CDFA 1XNRB 1C30B 2V98A 3OETA 4FMDB 3OTOB 1TVCA 1BDMA 3BCUA 3AOGA 2BA1D 5G40A 3GCXA 4Q3AA 4W1RA 2NZUG 2QMEA 3BCHA 1E9RA 1NKSA 3P26A 3REGA 3BH0A 5BN5B 4OIFA 1PFUA 3VC3A 4B3IA 2A58A 3VR6D 4YMHA 2ZB7A 2PGAA 3R44A 4KDCA 5BW8A 2KM1A 5DNWA 3L7BA 1JW9B 2J09A 1UMDB 2CL5A 4OKIA 2VXCA 4JQCA 4LPFA 3IIIA 4PZEA 4BEMJ 1R0CA 1LBEA 4Z0NA 1XPOA 2BGTA 3LPLA 3TQIA 1JR3E 1NATA 3F5FA 4ALNA 2ZB3A 1DKNA 2XYPA 4HI0E 2W11A 1V5IA 3KCQA 4KN8A 3ZJTA 2OQRA 2DP4E 1AKNA 1RWOA 221PA 1DAIA 4ZVVA 1KRXA 4EB8A 3NRHA 2IPLA 3PKJA 1VJTA 3OVMA 4CODB 4Y9RA 3AQBA 1CE8A 2GN4A 3SU8A 2BMVA 5E3IA 2QN1A 3TINA 3FNHA 1E98A 3X1XA 3PC2A 2Y1LA 4K9NA 4Q1FA 4DRIB 4R51A 1O95A 9ATCA 1TK2A 3L46A 5FOSA 5EMJA 2PKXA 1ZXNA 1PT5A 2I87A 3DL7A 3REOA 2FSFA 2HHHE 2LPMA 3M7ND 4MTFA 3K70B 3BDAA 2Q8NA 4XGNA 3WO1A 4J3NA 3OMWA 1U3WA 2Y6UA 1ZK1A 5E6SA 4WJ0A 4YY3E 1Y1KE 5LLSA 2RHGB 3OCUA 4QOEA 5AK4A 3UGOA 3O0TA 1GRCA 3B9BA 3W6ZA 1WA5A 4MK4A 4G0XA 3VYTB 3VYSB 2AR9A 1W96A 4Q34A 4XFKA 1L3PA 3PE3A 3WAKA 1E3TA 4OHMA 4FPXA 3NTLA 3O94A 4HUQB 1LV8A 4UHJA 3BL8A 1MTOA 2GKOA 4QT0A 4YL1A 3NYIA 2PO1B 1V6CA 1WZCA 1R0YA 2GA8A 2VAVA 5AW9A 4DZRA 2CLLB 4P7KA 1MRSA 3OTQA 4DCUA 4OPMA 3UUFA 2ZRGA 3DVAA 3WODF 4Q48A 3QOFA 3ZR4B 5DDIP 2ERCA 4EW2A 1ZMTA 3RAEC 1A9XA 1X15A 4Y6RA 3B3QA 3NC4A 2HMQA 1W2WA 1AO3A 2DJIA 4KOAA 2AOTB 1DOZA 1T9GR 1CVLA 4DFDA 4KUEA 3W5CA 1P4SA 1TM1E 4C0XA 3R77A 3RTDA 3T34A 5JSKA 3PA6A 3AUFA 4V24A 1KBOA 2Q0XA 3P2EA 4FDUA 4E0HA 3Q1KA 3VBCA 1LQUA 3QNWA 4YRBA 2QJFA 1VHWA 4QLAA 3EGCA 3ZHOA 1VCMA 4JIMA 3RC9A 3NDRA 1VSBA 4LK2A 1HY5A 4YP9A 2HSDA 3SDBA 4DUYI 4ZO9A 1VLZA 4F4DA 1MV5A 2PMFA 1ORIA 3JD3A 4J0IA 4JV5E 3M2TA 1C30A 4PX5A 3OCJA 2R6HA 4PHGA 4XSGA 5BN3A 5HKKD 2ZPTX 5HGJA 3LLVA 2H1OA 2HMTA 2AS0A 2GO7A 3EPPA 1T5LA 3OPQA 4MUBA 1F20A 2GN8A 3B1YA 2GPJA 3IBCA 5BN5A 1PK9A 1RPJA 3QPAA 4JBHA 1APCA 4EUSA 2BT4A 1IJEA 4Y6GB 4DR6E 3ITEA 4J7CA 3GDWA 4AF8A 2REOA 1TZBA 1URPA 2D1SA 4XJXA 1ZLXA 4B85A 1XUOA 2FZLA 2VNHA 2E1PA 3FLEA 3DKKA 1N78A 4YDRA 3VUEA 4LE2A 3PPXA 2IZOA 5LL6P 1QYCA 5BQHA 1XVIA 1DB3A 4ZYLA 2C57A 2H1LA 3WNBA 3W6OA 2X9VA 4X7RA 3CLUD 3O90A 3PD1A 3BFKA 5A5VA 1EJBA 1T34A 1GQ2A 2GXUA 1QIFA 1T4MA 3QYAA 4WVFA 1V8FA 3HRHA 1PT8A 4C6TA 3OLYA 2I6UA 4EZEA 3BF7A 4CGYA 4C01A 2RGRA 4DCOA 4Z7CA 2ZRJA 5F2KA 4BVEA 4MAFA 3IR7A 3IP7A 2WM3A 2R03A 2DERA 2JIPA 1XNQB 3CUKA 4L07A 2ZU6A 2IHYA 4LC9A 1SUCA 1D04A 1OU4A 1QLJA 5AJHA 3GN1A 5SYNA 4J0GA 1UBLS 3L0BA 1B1CA 3G6KA 1BROA 4D4NA 4D25A 1GAQA 2L19A 5DHAA 1OE0A 1XR3A 1X6VA 2H16A 4FCCA 3DVSX 4F92B 2P5TB 3QXHA 2XS8A 1OZFA 2OCIA 3RV4A 2VYND 2PT7A 1PCXA 4YXFA 4AX4A 1N9KA 2ODEA 3QP9A 4GP9A 3MOIA 3ZKAA 5CXXA 1VE7A 4NOMA 5EJMA 4IDCA 5E3CA 1BMFD 1EFRA 3HBJA 3VBEA 3GT7A 1Y8CA 3UJAA 1AK2A 2P9CA 5KQSA 3QT5A 3RHZA 1H9BA 1TWGA 3GVXA 4DR1I 4GOLD 3W2EA 5F35A 2FB9A 2B78A 1GQYA 3E7XA 4E5UA 2V6IA 4CX9A 3AONB 3HY4A 1HFWA 1I2MA 2GARA 2PYDA 1CUGA 1LBTA 1KZYC 4FHGA 3DMPA 4PQEA 5EPUA 2WF8A 2HHJA 5FOXA 3J06A 4QPNA 1EFUA 4UNQA 3UH1A 2PFKA 2A0XA 4RF2A 2IXEA 2P2NA 4H7DA 2J3EA 4TX1A 3GFQA 1E79D 1AY0A 4IWXA 3O73A 4XVRA 3SX0A 3ZEAA 3A25A 4YRNA 4YK7A 2QMZA 1P7YA 1ZK4A 4NTAA 1LM3B 5C0XB 1JPVA 3LMKA 3PU6A 3AP3A 4TTTS 1JT2A 1TWHA 3WK6A 1XEAA 4ER7A 1RI1A 3EFOB 3KZVA 3U0CA 4OB7A 1S9DA 1XTBA 5DSXA 5JD4A 4TTAA 1QBGA 2OSBA 3AIOA 3U4HA 3OOWA 4H3KB 2ZIZA 4O08A 4XGQA 2OT3B 3S2SA 5B3JC 3LCMA 2QZZA 1NQXA 3D7NA 3IXLA 3KJIA 3US6A 4ZAVA 1I1NA 4JI8B 3U4DA 1DDGA 1YRYE 2O5EA 3DB2A 1CP3A 3TFWA 3GPBA 2JIRA 4EP1A 4D02A 2W6MA 1SIUA 1Q50A 4NYIR 2JBAB 3FOWA 2HCTA 1TAGA 1BOOA 3MTQA 1PWZA 4CL2A 4TXHA 1A3CA 1L4HA 1I1QB 1GVNB 4QTYA 3RVOA 4P9FA 1JJIA 4A7PA 3D8BA 2XPCA 3CONA 1G6KA 1OCRC 2A92A 2VT7A 3J80A 1Y33E 1ZYRF 1WEHA 1UM9B 2ZAIA 1UBHS 1E3HA 5E2QA 3K5WA 2O8VA 3AVWA 4W5RA 3RRMA 5AJUA 3ROPA 1UEIA 3QKSB 5K20A 4EW6A 4LXUA 3F7MA 5GIPE 3B52X 621PA 2G7ZA 1M1YE 2JIZD 3KB6A 1RXQA 1T6IA 2OV6A 5JVEA 1R74A 3FOZA 5C5DA 2C29D 4FTWA 5I6DA 2CYBA 1JQDA 1AVTA 2ZJ2A 1YR1A 5AKKA 3CPSA 2OBNA 4FKZA 2VCHA 1NX6A 3BXEA 4I6EA 3GFVA 2FR0A 4DVJA 5B58C 3SXPA 4CTMA 2PRIA 4UBLA 2DR3A 3RSCA 3F7NA 5FTWA 5LMNB 4XGIA 3C8UA 3OT5A 4M0FA 4TMFA 4E08A 2CUNA 4CF3A 3LPMA 2X8LA 5B3IA 5JBNA 2SKDA 2P7IA 1KYIA 4WMLA 5JSHA 3I2IA 1SXJE 1D2EA 5JJBA 3TECE 1OCOC 4UEKA 5LZ5A 2BR4A 1WG8A 3QXSA 3T5CA 1IL0A 3UB4A 3JQGB 3VR4D 1VLVA 2AXEA 4OB6A 3GIDA 5F52A 5D3MA 3GU3A 2PSJA 4LDKA 2C5HA 3BGSA 4PLGA 1MZPA 4HP8A 1GNVA 1KHHA 2VLIA 3QELB 2WB7A 5MGNA 1IG3A 8AT1A 1YS4A 2HLHA 3BMCB 1GADO 2V7TA 1GPWB 1VA5A 4O1MA 4G09A 2X51A 1NJGA 2G9RA 2AUMA 3H1GA 3U4CA 2X1HA 3M5CA 3ZHVA 5FUQA 1N9GB 4JSTA 2FQXA 3AW9A 3T6JA 1R8YA 4BLWA 3IB3A 4XJVA 1EK5A 1A5AB 3NFYA 4JT2A 3VVBA 3AGQA 5EHHA 3JRMO 1H2HA 3H83A 2B8JA 4QIHA 5E1BA 2GXAA 5HCNA 2RHTA 5MGBA 3RVYA 3KKEA 4KGXA 1B76A 2VJYA 2YZKA 3M1AA 3CLSC 3GLFE 4RZ3A 1YA9A 3DG9A 1GUFA 4BFLA 3ZXIA 1ZPDA 3H86A 2ZULA 3SMQA 1EKYA 2R11A 2OFOA 2WIJA 3D6JA 4AKHA 3TRDA 1IBCA 3H1FA 1RQNA 121PA 3PDUA 3EFOA 1S2GA 1Z2NX 1E5XA 5D87A 3VU9A 3ACBA 4EF4A 4L51A 4FWTA 3VM6A 2DE0X 2PUAA 1DKLA 3Q1QA 3L1MA 4MVJF 3O2NA 4ZQIA 2FWMX 1T8SA 4L02A 2OQ2A 2IHTA 3DOUA 3W6UA 4PO3X 1U7UA 1EBBA 1G98A 4KQVA 3FR7A 4JEHA 1A4UA 2HJMA 4TLLB 4F4IA 1USWA 5IT9C 5D51S 2DFLA 2A5FA 3PYMA 4IDAA 4FWBA 3CVVA 1OYVA 2C7PA 4EMDA 2EZUA 3LL7A 1CEEA 4X93A 2AZTA 2X6QA 2H5LA 3M6FA 1K3TA 3BTSA 4OXXA 1ZM2A 3HU5A 2ZJ3A 4PSDA 4A8HA 5AOAA 2JGNA 2B5VA 3JZMA 4L4RA 5EJ4A 4RIFA 3QU4A 4I6GA 1R5NA 1FYVA 5GAJA 4LDPA 1BGVA 2QRHA 2GB4A 1ONSA 1T9BA 1CUXA 4R7ZA 2O5VA 3FMIA 4B45A 3QTTA 3HSYA 1UM9A 2SICE 2C61A 2GCPA 3WB0A 3NEJA 3KJZA 5TF4A 1AKTA 4RSMA 4JCZA 3L6BA 4ZQHA 3UENA 3MT8A 1BRMA 2GAFA 2Q9BA 1MN6A 1J20A 4D74A 3EGIA 1RXWA 3O21A 2NN6C 3U6KA 1ZH6A 1YIOA 1QZRA 1I9CA 4KLNA 2JARA 4K86A 4JKOA 3D5QA 1CUEA 3BCRA 4BV3A 1YZKA 1USVA 1HOXA 5C8VA 2RKWA 2RB4A 4UDNA 3ZD7A 4OB8A 2Q4DA 2CVOA 2Q2VA 1NTOA 3P52A 2G7MC 4Q3NA 4ID3A 1N2HA 3BXGA 1YZTA 3H19A 1H8HA 3CYFA 1A8IA 1YDIA 4ON9A 1UOPA 1Z0AA 2WIGA 4P5PA 4DA6A 1QVXA 4YXWA 5LCXA 2F3SA 3THXA 4HXYA 2JCSA 4EYOA 4KI0A 1SBHA 1I94E 3NORA 4DTIA 4BUJA 4R2JA 2A78A 1CERA 1OXTA 1NF2A 2UYOA 1MAVA 3NHKA 3Q11A 4ZP1A 3SR4A 1JDTA 4PFSA 2F43B 3A6PC 1CGNA 3D2CA 1E62A 4QGFA 3QPBA 2AZDA 1JFVA 2XSEA 2WWIA 3IO5A 2L18A 3E8SA 1XTSA 3DLBA 2XUQA 4DV1B 2YIJA 2DWOA 4CG1A 2Q6LA 4O6MA 4JBXA 2TS1A 1OTHA 4GNRA 3MSXA 3JQGA 3H2YA 4B3SI 4N03A 4MW8A 3A70A 1UXIA 2NTNA 3GZ4A 3WL7A 5A2QC 1OWLA 1C3OB 3MERA 4KPYA 3QELA 4CRWB 3HULA 1AQYA 1YDGA 3RIHA 3LUPA 4QJIA 2OV2A 3LP6A 1ZUHA 2AMFA 1V4VA 2A94A 4CIPA 3SF8A 4RK6A 5F4ZA 3VR6A 3PXGA 1EX7A 3C8ZA 3OA1A 1S2MA 1FSPA 1YI0A 4JI5I 3TPFA 1WDMA 5B3LA 4FGZA 2RSEB 4ZTBA 5MN6A 4DVYP 4US0R 3DGFC 4GX1A 4MEJA 1NURA 2W2TA 1QSPA 1U5CA 4B3TE 4LA4A 1B0PA 5E9QA 2AI3A 1P74A 3Q5DA 4YP6A 2HK2A 2I99A 2WZFA 3V7UA 3U7GA 2ZYVX 3OZSA 4OU4A 4EHIA 4PYKA 4F4UA 3DDCA 4DADA 4RMIA 3FRJA 4LE0A 1CS0A 1RFGE 2XEDA 3GI1A 3H1CA 1SG9A 2ZD9A 1FF9A 3KP1A 5EQDA 4M63A 3ROTA 3RABA 4K9LA 2AG8A 2ST1A 4U6SA 5BR8I 4YEDA 4GYJA 4B6EA 4ZMSA 3O3MB 4URYR 1TZJA 5L7WA 4R2HA 1OJ4A 2QTRA 4EARA 3AH8A 3COYA 4YCDA 1GLGA 3QTBA 2FW1A 5BSWA 1QYWA 4RSGA 2V6MA 4HXEB 4G0YA 3C0KA 4PJMA 1H0KA 4DT1B 5IC4A 4ZD6A 2WW4A 3MELA 1MC5A 3CW9A 2IUYA 2FPRA 1HY3A 1VLSA 1N5LA 5KWIA 2DBRA 2WZQA 2VTKA 3REQA 5DYWA 3BOSA 4BMNA 2E85A 3GJXC 1X2BA 2HLPA 5EEGA 2DT5A 2QAGC 3WAGA 4WFQA 2WUEA 5AOBA 3DZFA 1FMCA 4LRYA 3AP2A 3B85A 1PR3A 4KWIA 3CNNA 2G4VA 4GZ6A 3CGGA 5DM4A 2HLNA 4WFKA 5FBKA 3TPZA 5G4KB 3FM9A 3UAWA 1RDFA 4X20B 2I78A 2X4GA 5L6LB 2QD2A 5JNRA 4KQ6A 2MOKA 5THKA 2DEIA 1B2RA 5A7HA 3D6NB 1GFSA 5ANRB 1U0OC 3INYA 2QVBA 3WJAA 2H1HA 2W2XA 3AI7A 4BECA 3O9MA 4B9AA 2Z4TA 2E6KA 4K9RA 4JZKA 4O0LA 2YL7A 2OWEA 3ZVNA 3FCYA 3TW8B 2XF2A 3U26A 1U31A 3A0RB 2LQGA 5ECGC 2BKLA 4Q0MA 3T5DA 4UBMA 1JLKA 2ORYA 3OM1A 2D7CA 4K9KA 3WRWA 4EA6A 3UHFA 3EIQA 1QQAA 1QX4A 1MPXA 4BJTA 3D2LA 2WJYA 5I7SA 4E0IA 1SWWA 1Y4AE 3OJXA 1AS3A 3L8GA 3HJCA 2P0YA 1EJ0A 3ZCUA 1ZHXA 3GUHA 2YZNA 3C3BA 3PWTA 1CV2A 2C59A 1VP3A 3QVVA 4R68A 1IDN1 4WFJA 2YQ5A 2F43A 1UBFA 3L6DA 1TQHA 5LPNA 4NMHA 4FFNA 1OOEA 4J30B 3OLXA 2CXQA 5FBZA 4DYDA 1SCBA 4MA0A 1RHYA 2DHQA 1S7CA 2VJNA 3EAQA 2IDZA 1RYMA 1FQWA 2F00A 1XQ1A 5JAIA 5C8YF 5BORA 4JZAA 4JI7I 1HYBA 2BONA 2GCIA 3EVZA 1D9XA 4F5DA 3B51X 4ANJA 1W5AA 1XU4A 1C3OA 3FUTA 5HV9A 3FPSA 5IAEA 5HKKA 1BSVA 2J9BA 2QLMA 1X7WB 4YHHI 3NC0C 4P4GA 1YCDA 3JQCA 3H1TA 3C87A 2WHXA 2VDMB 5KDLA 2Q5OA 3TKYA 1DL5A 1T13A 2PIAA 1Y5YA 1JG4A 2WTXA 3CT4A 4TTPA 4CW7A 2C92A 1SELA 3B20A 3T12A 2ZAGA 2L81A 1O7JA 8ABPA 3GJ7A 1P9NA 4B7XA 2XXBA 4DG5A 1X7ZB 2WB4A 4ACBA 4GX2A 1E9EA 5EIOA 5L3RA 2ZEJA 1IN4A 3HO8A 4J0EA 4WY5A 3N70A 2P9BA 2OV8A 1E66A 3FFAA 4LF7I 2C0PA 4GYTA 2UUBI 1J2YA 1N2CE 1I1HA 1W19A 1GS9A 5H80A 1H8ED 4XPZA 4JBYA 4N0DA 5TX7A 1ISMA 3U9JA 5K1ZA 3VI4B 4M1SA 3V5XA 3PFGA 1HMPA 4BLOA 1JDNA 4C76A 2VQ6A 2V6GA 3DBVO 4K1XA 4F93B 5IBPA 4A6PA 3LJKA 3C97A 3DHNA 1R6TA 2XMDA 3C98A 3OQNA 4IDEA 4OOEA 4LFCB 3MTJA 4H17A 4OI2A 4DT1A 3IV7A 4RD4A 4LG1A 3TCKA 1EB9A 1KZGB 3EHEA 2B8EA 5J4YA 3ETCA 3HMKA 1Z7EA 2OXCA 4DBRA 5A3VA 4JLBA 2EF0A 2PMBA 3I4LA 3UGPA 2NPUA 4B43A 1LI5A 4LKOA 2VDUE 2AN1A 4C5BA 3KQMA 1AOXA 3DAOA 4H0FA 1LBHA 1LLQA 2VYNA 3CFYA 3JAKB 4L4YA 4QGSA 4TSKA 1WW3A 1V4NA 2IYRA 4P4TA 3RTGA 2IXPA 1TUIA 4MRMB 1ZD8A 1K9VF 3R09A 2F4NA 4D99A 1BMFA 3G8AA 3D64A 4LGYA 3J81A 5G4KA 4X20A 5FEMA 2FX2A 2Q5CA 3NYLA 4LF4B 1YQGA 1ORDA 2C07A 4I55B 1OH7A 3O2SB 3I12A 4I1SA 1JH9A 3BUSA 1RACA 1W35A 3R3HA 4H7PA 3HR8A 2NTYC 1RM0A 1YQEA 2COEA 1N5KA 4MQYA 4OH7A 4N0QA 2FV8A 3HPRA 1KDYA 3TW8A 4BMZA 3USES 5CYOA 3EXHC 3GROA 3AKEA 4R0VA 2ZREA 4CEHB 1OLSA 1ZVJA 1M2FA 2JA1A 2Y3IA 3ENNA 2MYPA 2D7DA 1GEGA 3ZOKA 3DF9A 3T38A 1CLEA 3O3OB 3TQRA 4CU5A 4F9EA 1W36C 1X14A 3LCJA 2PS1A 4WNIA 4GL2A 1MQVA 4MEAA 5LP6F 1BU8A 2F4VE 3IR5A 1E79A 1R6LA 1L4UA 2CEAA 4ZDWA 1D9ZA 5K0LA 4F12A 1G4HA 1WULS 1IM8A 1L3CA 1J0XO 3EHMA 2FEOA 1XJCA 2GBLC 5E95A 3EDCA 2YMLA 5JRAA 1XPUA 2B34A 3I62A 2DWUA 2P62A 1HQDA 4KV7A 1ATIA 2XADA 2VZEA 2HHHI 4C1NA 1G4AE 2GHRA 1GU0A 4HFFB 3JX9A 3ADDA 3F6PA 4AY3A 1AKQA 4QUDA 4MH0R 5CLIA 3IALA 3LW8A 2HLDD 3T4PA 2X22A 4GKVA 4YT2A 1RE0A 4BNVA 4YY3I 1XTUA 2R48A 1LF0A 1FWKA 1EM8A 3URKA 3TI9A 2QLNA 3N6RA 4Z1MD 4J0KA 5CXUA 4V3CA 3T6BA 1IHYA 3AF5A 4QU0A 3D59A 4OMCA 3C43A 4RKFA 1WZIA 3C45A 3ZY5A 4YO8A 2K87A 2JE6B 1ZW6A 1QIDA 5B57C 2AFIE 4PRKA 1M34A 1ZH8A 1EJ2A 1NLZA 2NU6B 1LPMA 2CL7X 2X2FA 3I4CA 4PLZA 1WXFA 4WNYA 3ML1A 5IBCA 4ZARA 1JFFB 2D2XA 5EZ5A 4H77A 1VSUA 4ZEMA 2EJWA 3MTIA 2IYWA 4R8LA 2NZVG 1QE0A 4HAZA 3S2ZA 1WX1A 3CNHA 2JLSA 4N6CA 4MPJA 4L16A 2YFHA 2NUAB 2X0IA 4X7BA 3VR3A 1KWGA 2I55A 5KDDA 1ZGBA 3T4XA 1U0BB 4C4TA 3NVKI 2IXDA 1SVOA 4NBVA 1WGWA 2JIZA 3BTUA 4DA9A 1HE9A 1Q57A 2ZYDA 1YZ3A 3EOBI 4IDQA 4EGSA 3BX1A 1S89A 3H9GA 1C29B 1U0LA 4Y7CA 4WFIA 4D46A 3K31A 2EGGA 5HZHA 2CVHA 1Q1ZA 5K8TA 1X1DA 3B1XA 2Q1TA 3CBGA 4BXOA 4PC1A 2GA0A 3H2JA 1SYQA 5LQUA 1TCBA 2ZXOA 2FEKA 4ND2A 5P21A 4BNZA 3K16A 4Y2TA 3C5EA 1X1SA 2ZJOA 5EHQA 3P9SA 4LXHA 4B1FA 5BQ3A 3LQQA 5CD1A 3OJFA 1HUQA 1L5SA 1U8EA 4IDHA 2OAGA 4K6FA 3V7NA 1XTQA 4MV6A 3QY0A 1EFAA 4AMYA 3IQWA 4PIPA 4GRDA 5CU7A 2EP8A 3JAKA 2Z30A 5LLTA 3D1VA 1N36B 1PSDA 1WNFA 3MCAA 1OT3A 2XX3A 4MRMA 1VG1A 3MJEA 4YQEA 4JV5I 3VR4A 4WJKB 1S7GA 5HJ2A 3HA3A 5CPFA 2ORVA 4IARA 4ARUA 1CX9B 1F8UA 3L05A 4KMSA 2R62A 1NPDA 4I55A 2NPFA 4ZZIA 1TRHA 2NYAA 1LTQA 3UV3A 3HPQA 1A69A 2LIPA 4RH0A 5DVZA 4BZPA 2CNOA 4N3AA 3E48A 4DR6I 2XGSA 2B2XA 4U2FA 3SVTA 2HPZA 3PJRA 2BBTA 3HKCA 2RHWA 2IPMA 2IS6A 3HJRA 4KO4S 4E88A 3CNBA 4AIIA 1JR8A 3CJTA 2WFLB 4LF9E 4PVDA 2BTOA 4UNIA 2G63A 3A4YA 3AG6A 1BVYF 1FRNA 2E55A 4NOJA 4TQUS 5DM0A 1EHIA 4MQFA 3ER6A 3EVTA 2R96A 3HB5X 2HU7A 1XXHE 1NQTA 3ENZA 1HT0A 4RW0A 1BS1A 2X77A 3U0BA 1R9NA 3UWSA 4E7PA 2GKSA 2XRFA 3TJMA 2WTNA 3F6CA 3GBPA 1K3FA 5JS1A 2WUGA 2J0XA 4H7KA 3SPXA 3QLVA 5JW6A 2BPOA 4YJ2B 4JLPA 2JIOA 1JUDA 3TIIA 3LP8A 4EJSB 3C3XA 4LHWA 6ABPA 1N2IA 3H1EA 1UPUA 9GPBA 4IAOA 3LVRE 5JPCA 4X95A 4MLZA 5F5FA 2XOKD 4D57A 2CDQA 2WP0A 2A14A 3SR0A 3GOQA 4QG3A 3DKAA 3T15A 5E0KB 4NZNA 4ZVRA 1WSWA 4A36A 2KWIA 5JXIA 1X1TA 4WL0A 4J49A 4YRFA 4MHTA 2D5AA 2YY7A 3FN4A 1WL8A 3HEMA 1S2DA 4PFKA 2IFTA 3HVIA 4I4TB 4AJKA 1B63A 1YJCA 1DWPA 2QRVB 1ZH0A 1Z7BA 3R4CA 4A73A 2JE6A 3E9DA 4DNPA 4E33A 2L6GA 4HD8A 3LOPA 3ZWDA 1IK6A 3AL3A 4IZKB 4WK2B 5TQJA 1XP5A 2NU6A 3T3GA 2I3BA 2MWMA 1ZCJA 2FGJA 3FJYA 3M5PA 2PA3A 1LD3A 2GPBA 4MU4A 1JFFA 4D3ZA 2ODQA 4XA8A 4LF5E 4RMJA 1HNZB 2G3VA 3SHOA 1KEEB 4YRGA 4ES6A 3KPHA 1IBKB 1SXGA 2AN9A 3AVOA 4O2RA 2NUAA 5AKYA 5LQJA 4MO9A 4MUXA 2WF6A 2YUIA 4LV8B 2X1MA 1ZRNA 4WHMA 2SKEA 3FJ1A 2OHXA 5KOHB 1MU0A 4IFBA 5T7BA 3CRVA 1Z6AA 3OPYI 4QWWA 3T3IA 1FQKA 4OO1F 4OHFA 1QH0A 1GDTA 2ZM6E 4NC3A 2N47A 3P76A 1GPMA 1K8QA 3M4BA 5L3VA 2BN4A 3L04A 5JFGA 1MG7A 3EFBA 1ZZPA 3EGEA 1C1DB 3HG7A 4F45A 1E9DA 1WZ2A 1KETA 1XLUA 1U2SA 4QYWA 3QENA 2L17A 1O4VA 2BBSA 4A1FA 3MQFA 2J7PD 3AR2A 2H9IA 4U7WA 1OH6A 4RE6A 1BGWA 3M4XA 4C4YA 5BQGA 1TK3A 4CV0A 1YJ8A 2B5WA 3U3MA 1RZ3A 1JDBB 1N6KA 3FNBA 5CJJA 1OFHA 4L4UA 3KV1A 3BYZA 3L41A 3DEFA 4QJ5A 4AW9A 3W8FA 1CQPA 4KDFA 1UPXA 3H8JA 2HXSA 3N6XA 4FHZA 4HDOB 3PIDA 4GR9A 5ILOA 3KQNA 3ZBUA 4ETIA 3IT3A 1CT9A 5DTIA 4O7GA 3BB3A 1WDWB 2AYXA 2IUSA 2ZRQA 2R9RB 1EE1A 2ZROA 2QGFA 5EVCA 2PUBA 2VUIB 4FGKA 2JFUA 5JNTA 3QV2A 4N7MA 1E9AA 3WMEA 1ESDA 4B4KA 5CJPA 2ZAYA 1UINA 3T3HA 3RNOA 3DZ8A 4TWRA 2IW1A 2YRXA 3A3OA 4X1YA 3L7ZB 3UXYA 5ECWA 1KU0A 1RKQA 4Z2YA 2HJSA 2BE7A 4DJEC 3TM4A 4JRZA 1JE1A 3BHJA 3LT5A 3O10A 3N2GB 2JLXA 1JKIA 2WFLA 1ZFNA 2IV7A 3KPUA 4BFUA 2JEYA 3RSZA