3HJCA

Crystal structure of the carboxy-terminal domain of hsp90 from leishmania major, lmjf33.0312
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
405
structure length
387
Chain Sequence
HKPLWTRDPKDVTKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFPNKKRNNIKLYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPENLQQNKILKVIRKNIVKKCLEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLKDYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDFEDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLSTSPCILVTSEFGWSAHMEQIMRNQQYMMSKKTMELNPRHPIIKELRRRVGADNDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the middle and carboxy-terminal domain of HSP90 from Leishmania major, LMJF33.0312
rcsb
source organism Leishmania major
molecule tags Chaperone
molecule keywords Heat shock protein 83-1
total genus 130
structure length 387
sequence length 405
ec nomenclature
pdb deposition date 2009-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3hjcA03
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3hjcA01
3.40.50.12450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hjcA02
2IOPA 1HK7A 5FWKA 2O1WA 2O1UA 1Y6ZA 2GQ0A 3Q6NA 1Y4SA 1USVA 1USUA 2O1TA 3HJCA 2IOQA 1Y4UA 3Q6MA 2O1VA 2CGEA 3PRYA 2CG9A 1SF8A
chains in the Genus database with same CATH superfamily
3CEXA 4RIHA 5MN4A 1MX1A 5BMVF 1FXUA 1ZIYA 3P3EA 2V7QD 1QNFA 3HFJA 3KBBA 3S27A 4P08A 4Q4JB 4ZAVA 4PJJA 2F4VE 4NG4A 3TR6A 3TQTA 5FR2A 4BYGA 4KN8A 4NXNB 4F96A 3N24A 3FHTA 4AICA 4C3UA 4W9NA 1CE8B 3F9CA 4Q6WA 2NZ2A 2P27A 4RZXA 3K7DA 1U3DA 5HG0A 1M1XB 2IIPA 1A5TA 4FFVA 4DJ5X 1RW4A 4RLSA 5JZMA 2W2KB 1KOGA 2NYVA 2AK2A 2W93A 2V6MA 2EHDA 5FAKA 1KERA 2F90A 2WKQA 3TOSA 1CQIA 5NULA 3C74A 4ZVTA 1IW7F 5IKOA 5CB4A 1QRUA 4MWCA 4URVR 3KU4A 4JL5A 4KGXA 2DWQA 3DDHA 3JVVA 4DWWA 5HV9A 3HVJA 1KJYA 2CBXA 3NEAA 2EL7A 1EVQA 1JKMA 3IDOA 4NBRA 4P5PA 5GM1A 4PLFA 1O77A 1U4OA 2QXTA 3DW3X 4NFLA 5AVJA 2WU8A 3HYTA 1RFGE 1ZWLA 4HY1A 2BMVA 4JC7A 3U0CA 1F0NA 2ZREA 3K3PA 3W8DA 4YDRA 4ZQHA 1EBBA 4DILA 2HMTA 1IVNA 4EHLA 2EGGA 4B3XA 5EXDA 3PHHA 4XUEA 1M8PA 2YLIA 1SIBE 2GPSA 2W2OA 5F3RA 4E33A 2W43A 2FI1A 5A1JA 1E1DA 3B5IA 5IP5A 1K40A 5GONF 4K1OA 2AVNA 1HT3A 1MC8A 4MW3A 1ISMA 2AJ4A 5C5IA 1K2WA 3DT9A 3UKOA 4YRIA 4LHYA 3HCPA 3T5MA 4H18A 4LOHA 1JXMA 3NNDA 1JDPA 4P9FA 4N18A 1ESMA 4RMNA 4U0JA 1N7HA 3OEWA 3ZY6A 1JJBA 5CDTA 5JNWA 1N5MA 4Z0TA 3R7WA 1T8WA 1NRJB 3HKKA 4FR5A 4O4IA 2C4UA 4D26A 2H18A 1FR0A 3VKHA 4MVJD 4U2FA 4ZD6A 2PAFA 1SG9A 1RLTA 1T8SA 1W5FA 3G5LA 4H7HA 5TARA 2AZMA 1RRFA 1YZQA 4XPIB 5H9WA 4JUIA 2E5WA 5HJ2A 2JKZA 1XI2A 4GPIB 3AUJB 1RLIA 4J0IA 2CLLB 4TOIA 2VDWA 3P0RA 4IZKA 2B30A 4YH1A 3GEGA 4RVCA 3RS9A 1Y7PA 5AW5A 3KZMA 3PC3A 1IYZA 2H52A 4KGDA 1KL7A 1WJGA 3VF0A 3FE2A 1G7CA 5DS6A 1U3WA 3PK0A 4OMDA 3I52A 2XEXA 2AC4A 2BMWA 4AP6A 3V4RA 3AV0B 4WY2A 4Y7CA 1M1NB 2ZYHA 1OXXK 4KDRA 1MZPA 2V8OA 3O74A 3AU9A 3GRAA 3MELA 4BB9A 3SFVA 4JHXA 3K8YA 4UE2A 2RGAA 1H2YA 3QOYA 4QPJC 4N0DA 4QRHA 4TTIA 5EIEA 5JEAE 1SK8A 4FHGA 1PN3A 3HWRA 1SEVA 2UAGA 3T12A 2JBHA 5CD1A 3FUTA 3ON5A 2OXEA 2ZUFA 3BWEA 2JK0A 3IQZA 5FI0B 1M6YA 1OLOA 1YZGA 2BRUA 3AHFA 1MORA 2C4HA 3C6MA 3HB1A 4AZVA 4O1HA 3JQAA 5CLGA 4EG5A 4RJTA 3KYJA 4CI9A 3FFAA 2PT9A 3IJEB 4EGFA 1HMPA 2PT7A 2PO0B 1YE3A 1PJ3A 4E7ZA 3C3KA 4K6MA 3SDZA 4BFYA 1PV1A 3DQQA 5DYTA 3WV5A 2FMIA 4AL4A 1U0TA 1PBTA 4FN4A 4Q1BA 5FBHA 1DKQA 1FDWA 4YT5A 1IJBA 2UYQA 3G0DA 3ODGA 1O9HA 3KB8A 2VEOA 2XLHA 1AZWA 3H1BA 1FOEB 3GXBA 3ZJUA 3VPFA 3EZGA 4Q9KA 1I13A 2O2DA 1K5DA 1R6TA 1A6FA 4LDRA 2AXQA 2CBGA 3BCHA 2VQFE 2JGDA 3QOXA 3EJ6A 4U7JA 2F3TA 1G5QA 3ABOB 1CUVA 3COYA 3JV7A 2G88A 5EJGA 3WMEA 1TYZA 5EZSA 4DIUA 1CQJB 2DKFA 4C14A 1V1RB 2Q8NA 4YJGB 1SO8A 4R68A 3ROTA 1D5WA 5DGDA 1U1IA 3TNDA 3SP1A 2CCJA 1P4AA 2HNBA 4BA2B 3U37A 1WPGA 4QO7A 1P9WA 3ZDEA 3EEOA 2PO1A 2BFEA 2WMDA 1CEXA 1K7XB 1AZSC 2R05A 2BM1A 1OHHA 3B89A 4I4TB 3EWNA 5DI9A 2IBSA 1XVLA 4X1YB 1Z25A 4EW3A 1I51A 1B43A 3MNFA 4N8DA 5CAEA 4C0KA 2OOKA 5I7SA 3LUAA 3O90A 4RHUA 2N1BA 1G6KA 3BHNA 2IITA 3QJYA 2VPQA 3CGWA 2QOEA 2JVJA 2X8AA 4KX5A 1BU5A 4X20B 1A9ZA 2XTMA 3P9PA 4N7RA 3EPVA 2GPBA 4B3MB 1L4UA 2AEMA 3VC3A 1PLLA 4ZI7F 4OJKA 3L77A 4DEVA 3FGZA 4DV6B 2OMKA 1GQYA 4EF6A 4GU5A 1P2DA 4B6FA 1XZAA 2LJPA 2C4VA 1U99A 3QPAA 1BD3A 2FMFA 3NOOA 5DM1A 1SJ9A 1DI0A 1NBOA 2AR7A 4I1RA 1GM5A 1BRTA 3DXZA 1ST2A 5DP2A 4P7AA 4TTVA 2VQFI 2W4IA 2CNBA 4M0PA 5AJHA 1OGIA 5LB4A 4CM4A 3DZ8A 3QVOA 1IUPA 4ZQIA 2AH5A 3D64A 2JFHA 1ZP6A 3GUYA 3KTOA 2TMKA 3MJVA 1IOVA 4N6CA 4GW3A 3TXXA 4F8JA 3JQ7A 5IC6A 5DSXA 3TB4A 1O57A 4NR0A 1XFDA 4MKHA 5IW8A 4ALIA 4DR7I 1P1HA 4PO9A 2GB4A 2IZZA 1RS0A 1BXRA 1SCKA 3AMVA 3IPXA 3EFHA 1KO4A 4G1BA 4OM7A 1VXRA 3WRXA 4RDXA 4F5YA 4RY8A 1NMXA 5JD5A 2H2IA 1XZIA 3UVEA 3K5IA 4G0HA 2Y1GA 1CRPA 3C8GD 2R8BA 1EX6A 4IGFA 2BUCA 1E2MA 1BQ3A 1BXGB 4PZ0A 3MB8A 3MG9A 4FZ5A 4QXMA 4TYNA 3M49A 2FVXA 4P7BA 3T3DA 3T7AA 1EVKA 4IZHA 4KXFB 4FFOA 3VMMA 3CZAA 4MCHA 4B0PA 5CXUA 3WA7A 5IM4A 2B98A 1C7ZA 4FZRA 1Z83A 2I03A 2IUEA 4NL4H 2YTZA 3TD6A 3B0UX 5ALHA 5J5CA 3MWFA 1KZHA 5BQ5A 4X64B 3WYFA 3QTLA 4RLFA 5AOBA 2FV8A 1DC6A 1DRKA 2RAFA 1KP3A 2PVCA 2UVPA 3BAZA 3Q3JB 4EGAA 4YRZA 2HCTA 3QFFA 3DFKA 1ODJA 1ML4A 3WQRA 1JSZA 2B4RO 4G1UC 4BNVA 1E89A 3EZYA 1QTNA 1V4BA 5F3DA 1R7RA 3HK2A 4KIUA 3WNBA 4JU8A 5AHKA 4QOEA 1EEHA 1FFXB 1GZ7A 3JCZA 1V6SA 1DSSG 1XMQE 1OBCA 1D2RA 3IH5A 1D1PA 2BHRA 4B5KA 4NXMI 1K6IA 2BLNA 4LW8A 2MMCA 4D43A 4GZ3A 4F3KA 1A2KC 1EFTA 2JLBA 3REQA 5KU1A 1AHNA 5LWQA 1L5WA 2ANBA 3U61B 5HVNA 1KO7A 1SCDA 1ZVKA 2QD5A 2V9CA 4FP9A 4CMAA 3BXPA 2F67A 3OQ6A 2VIIA 4IKOA 2HA5A 4KXLA 3I72A 4LYJA 1O9BA 2TECE 1AE1A 4MVXA 3HB9A 4LBYA 2XV1A 2I33A 1DAGA 4M7OA 3E27A 4MLPA 3KJHA 4DNXA 3K0SA 1PEKE 2FEPA 2V59A 1W48A 3MRSA 4ESOA 4F3CA 4Z4EA 1C9YA 2GYUA 2BF7A 3A1SA 2RHDA 2VQ3A 3L4EA 4KH1A 4YMGA 4GPAA 2PMCA 3WHIA 3DVSX 5C8YA 3UV3A 4FGJA 4RBNA 2SKEA 4KDFA 2BBOA 4DHWA 3W2IA 1T9BA 3HTKC 5JR3A 1E3MA 3HY6A 4HAXA 4PYLA 3WZLA 4DJDC 4DPMA 4U3JA 3BD7A 3OPMA 5IJAA 1TQGA 1GKKA 4JVMA 4C3VA 4WCDA 5F9HA 3M7IA 4F3TA 5A9RA 1M54A 1HX7A 1LLDA 1JFSA 2XIQA 4P31A 2IK8A 1U1FA 1SUAA 5E4JA 5I3ZA 1FFXA 2G36A 1B62A 2KHZA 3MPOA 4N3CA 1GPAA 2BKLA 4NYMQ 1YJAA 4ME6A 4QQ8A 3WRVA 3C3BA 3FGOA 3V7FA 4A82A 4NXME 1GU0A 4MPDA 4YUAA 3SXPA 5I4CA 4LF5B 3GNQA 3NMJA 2Y71A 1CY6A 2DP4E 5DNYB 1FRNA 2FR0A 1EX7A 3TXAA 5BURA 4V1CA 2XKKA 3O4VA 1Y1RA 4DR3E 4N47A 1YZVA 3O8RA 1X7ZB 3TSZA 1Z0TA 4DLNA 2DR2A 4A1OA 3OVMA 1I1HA 2YWAA 1XZCA 2Q1TA 5JO9A 5TGDA 5IU6A 3NNNA 1T1SA 2G77B 4RK5A 4EO9A 1Z7EA 5A06A 2V65A 3C0KA 4OVKA 3M4YA 3L6CA 3QI2A 2OVFA 3RC7A 1LE2A 5AICA 2XHZA 3CPEA 4EQ6B 3WXBA 4LV8B 1DOHA 1O6CA 4QLAA 2UZIR 2Q1WA 2XGJA 3VYWA 1IQPA 5ADVA 1XU9A 2PH1A 2IXEA 3VV3A 3ME5A 1ZJ5A 4GPBA 4M0EA 4BO7A 2P9FA 5EJ9A 1FFTC 1C9EA 1TA9A 3GCDA 3PXUA 4FGWA 5CRIA 4WDQA 4N48A 3MLGA 1BQEA 2LUOA 2OR3A 2PPVA 3KE9A 3J7AG 3C3CA 2QP3A 1Z2OX 3AT1A 4DCJA 1ZIOA 2QR3A 4TMKA 1B6SA 1NI4A 3GLKA 2ZRGA 4D8TA 3UMCA 4TKVA 4UPDA 1PTJC 2H1LA 2PL9A 2O1TA 2EFEB 3EDYA 1O9GA 4YT4A 4MUYA 4WNAA 4H08A 4CW7A 4KAXA 2DR0A 4JLVA 1V54C 4BJ5A 1JNXX 1OXTA 1U1DA 2DTDA 2VP9A 2ZBDA 4OQQA 4V0KA 5DLQC 5JVDF 1Q7RA 5F4ZA 4BV2A 1G4AE 2PNJA 2V7GA 3UOWA 3GPCA 4OHCA 1CIPA 1ZRMA 2WYOA 2NNLD 3L0DA 4CFYA 2WFAA 3LJKA 3T1YI 4RXUA 5TMDA 4ZARA 4HMQA 4M0KA 4DUPA 3CJTA 3KE8A 2Q8QA 3UT5A 4OKSA 2PR2A 2HY7A 3W8HA 1GAQA 2OY0A 3O91A 4D0LB 2C1EA 4HC4A 3FOPA 1QIDA 2H06A 3GLHE 1CQIB 4LY9A 3SZLA 4NCJA 4DLYA 3M85G 5LD2B 4UJ3A 1X74A 2P0NA 1WUJS 3ET4A 3AOEA 1U0RA 2WWVD 3A8TA 3EC7A 3ZXSA 3IBSA 1XD8A 4I9GA 1SVMA 4JI5I 2IPNA 3BILA 3K1YA 5DXFA 1BR2A 2ATVA 2ESRA 2FAPB 2EP8A 4UDYX 4PX9A 1QFSA 1R6XA 5CTJA 3HB7A 3I9NA 1E7MA 2M4EA 1SUIA 2HO4A 4YJ3B 4DABA 5HRAA 2YY7A 3QQPA 4XR4A 3OSUA 3VR6A 5KX5B 2DY0A 3GEEA 2F1OA 3BE4A 4YO7A 4BV8A 1A76A 1SF8A 2Q0HA 1BN6A 2YRFA 1EE2A 2GK4A 2VP3A 2WJPA 4ARBA 2DH6A 1KH3A 2VCYA 2FR1A 3AI2A 5D1HA 4ESVA 4QUHA 1JFFA 2REXB 5L40A 1TEVA 2ZWPA 2F00A 2OO7A 2ZRJA 3LGAA 4MW2A 4JYPA 1OIWA 3ZWXA 4MIKA 2WP0A 5JZSA 3O4HA 3PL5A 1GPMA 2R8OA 1TRKA 3NR2A 5CB4B 3KOXA 1EDBA 3QW1A 1PGNA 3TJMA 2GHTA 2PLAA 4LYAA 4BLUA 2PNZA 3ADKA 4I5FA 5L0JA 4RE5A 2MYUA 4X8MA 3GJ6A 1FXSA 3WU6A 2P1ZA 3IDZA 5FA5A 4CMEC 3QUCA 4MV0A 4RVGA 3WB1A 3FUVA 4CG1A 4DLZA 1IL0A 3JASB 4K8OA 5C0XF 4LF8B 1ZN2A 5EA2A 4FYVA 1W2GA 3H7AA 3HU3A 3QT5A 2C96A 3E3AA 2R7QA 3IRVA 4B75A 5M7EA 1BDBA 3HEAA 4A23A 1V11B 1TCCA 2DHCA 2RSEB 4NTAA 3K2EA 2YWFA 3K53A 1Z68A 1NJSA 4W5WA 1YNOA 2NO5A 4KC9A 5IKXA 5A04A 5C0XB 2NU8A 4RVOA 3QEMA 4EYSA 3OURA 2C38B 3FNFA 3S40A 4K7JA 2E4ZA 4MUNA 5A5VA 5DHFA 1J21A 1Z4OA 4XPXA 2J9GA 3ETDA 4DYVA 6YASA 1IBME 3SVLA 1FLVA 3ZD6A 2AZTA 2AEEA 5TVGA 1U8YA 1T5DX 1W94A 3H4LA 3V8QA 1TF5A 3B29A 2ZSUA 5CHEA 5IJ9B 2C77A 4R1NA 5SYMA 4OKGA 1OZFA 5LMNE 5EZ5A 1N3LA 1FI4A 1H5NA 3GDFA 1HETA 2LDXA 4RCVA 2IXMA 4NECA 3P9KA 5T67A 3WOVA 4QD3A 4AMUA 3E7DA 4F4FA 4BB5A 2VEDA 3VHXA 1M73E 2V5VA 4EH1A 2R62A 4LF7E 5KOHB 1TK3A 2DBQA 5DASA 3D3NA 3OZEA 3X1WA 4B4KA 1LJLA 1WN0A 4ZAFA 3K6KA 2XLEA 3IP7A 3KVRA 1A2BA 4CKYA 1OKKD 1G42A 5BNTA 4UAGA 1R5OA 1KEPA 1KEVA 1WU8A 1YRQA 1ZXLA 2AN1A 2Y0PA 2WPNA 1NP6A 3DTVB 1P8AA 1PS9A 4G0OA 3DHWC 5EXTA 2W6JA 4MMYB 4BLOA 3EIEA 1T24A 3R5TA 1TK2A 5HW0A 4KC0A 4TTSA 3T95A 2PMBA 2R68A 3MJCA 4Q0MA 5CVVA 4DV0I 5KTOA 4JJAA 2JHCA 5DGTA 5CG2A 5BV0A 3UAYA 2VTKA 1E3SA 4UULA 2J7PA 2ZWIA 3Q40A 1XQWA 1XNRI 2GCOB 2HJVA 3SF8A 4BQNA 1NBMD 4FD3A 2Z30A 1LKZA 3OE4A 1MMFB 1KAHA 3C7DB 2DETA 5HK9A 3SEAA 4QT4A 2ZATA 3BQNB 3ZW7A 4RHCA 4RZIA 2Q3FA 1QHYA 2QX4A 2W45A 1PKEA 1JDNA 2M6SA 4MQLA 3OLZA 4QBIA 5JBIA 1DMSA 1GLGA 1XEFA 3L7OA 1SU6A 4LC0A 4Q66C 1TQ2A 5BVGB 2OGSA 3HJCA 2WD9A 2QPAA 4N1AA 1UPAA 1XDGA 1A77A 1U3CA 2DLNA 2GZSA 1UZUA 2GBLC 3QYJA 4EMBA 4F9TA 4WN9B 1AZLA 1HOXA 3ZQJA 5B3JC 1UC8A 3K9FC 4CIXA 2JLZA 4I7EA 2A0FA 1TM7E 3LUGA 4Q3OA 2AW3A 4YR7A 5JRDS 2QTLA 2NP6A 4G4GA 1HLGA 1K4KA 3FCOA 3IQDB 4ARVA 4HS4A 2C2GA 4YECA 1KEUA 1P4RA 1E4EA 4EMUA 2GLXA 2O7QA 3LLMA 2ZZMA 1RJ9B 3DOIA 4UHEA 4IDGA 1RVDA 3U80A 1QDUA 2YWRA 3LFTA 2AYXA 3MINA 1ULZA 4RYLA 2R8RA 3L0PA 5T8KA 5I9NA 4KXXA 4JI0I 1AK9A 4MHTA 1O6FA 3CE9A 3M6WA 1DVRA 4I4IA 3NI2A 3WP0A 1MNQA 4FYXA 3QVMA 2Q3MA 3FOAA 2FWBA 4N41A 3OQPA 5BW4A 2FMUA 2GDJA 2QM0A 3JARA 4RA9A 5TPZA 2V7TA 2AT1A 3KVOA 3CZQA 5KZMB 5G1PA 2P91A 3NX4A 3HDQA 3W5SA 3GZTB 3WMFA 3MS2A 3QMPA 4PZCA 3LKVA 1OX5A 1Z0UA 3EHMA 3OWHA 1JQKA 4CKBB 4CS9C 1UJNA 4LC1A 2I2XB 3QPBA 5CNKA 3MS4A 1SC4A 4JVSB 1HQDA 2WLSA 1TZ2A 4OO1B 2X13A 3JQEA 3AL3A 4KLRA 1OE0A 5BSRA 5JQWA 3LX6A 3O4GA 3BIXA 3E22A 2WT4A 5ALTA 5AVWA 2HSQA 1X15A 4IRMA 4HDSA 4ZXFA 2VO1A 3UJNA 5JD3A 3FDZB 1Y9ZA 3Q7PA 3CX4A 4FK8A 4WIAA 1IY0A 4F4IA 5B12A 4JI6I 3A1FA 5JVEA 2O57A 5LQNA 2C2HA 4X7MA 2WAYA 2LTAA 2HWWA 3QPUA 1K08A 2I1VB 4G6ZA 2IERA 3RSHA 4Q93A 4GVPA 3QEBZ 1B73A 3R5SA 4QJ5A 4QYIA 1LNZA 5H3CA 1GNPA 4I44A 2VPWA 3C8GB 1Z7WA 1G0NA 3IA2A 3MK31 2GERA 3OJEA 4OHXA 4TS3A 5EE0A 1ZVJA 1ZK2A 4PQYA 1I0ZA 3R41A 5F12A 1SH7A 2SHKA 3TPFA 3CHYA 3PX2A 3FDFA 2OORA 2VA8A 3DLPX 4MUHA 3R6GA 1XXHA 4UMEA 7GPBA 2HDWA 4HLUA 1USWA 3A6PC 1GFWA 4MKFA 4CGYA 4ZV9A 4DSOA 2FW7A 4E12A 4ZHQF 1I3NA 4PC6A 3KBOA 1NQTA 3W2TA 1HBJA 2Q5IA 3W8NA 3HB5X 1MTOA 4GPEA 1GRNA 2HF2A 1NX9A 2ZE6A 1N0UA 3ONWA 4D9MA 1S2OA 2ONCA 3LGSA 1J5EI 4J91A 1NN1A 4RZ2A 2XAAA 3KYJB 4ZOLB 1Z38A 4L3WA 2A9FA 1KEWA 3I6ZA 3MWDA 1U5BB 3TQFA 3V5ZA 4EJSC 4XEFA 2B2XA 5BMVB 5AVVA 5F5HA 5JJ5A 5L9AA 1J23A 5IVDA 1Q15A 1R4TA 1BHQ1 3FDZA 5C5DA 1LC3A 1IN6A 1HDYA 2E21A 2ICAA 3PUWA 1B63A 1FQOA 2IP2A 3U8PA 4N82A 2XXAB 3IOYA 3O3NB 5JFTA 4RGBA 4KR2A 3FFWA 3OIFA 1B42A 4G89A 1A8UA 1Z6QA 2W48A 3AFMA 5KNCA 4MS3A 4C3DA 2PYZA 4M0FA 3OLVA 3QVXA 1FVXA 1PTJA 2ODEA 1KAMA 3E7FA 4QFDA 1EFRA 1X7XA 4LZLA 4RDIA 5E7JA 5JS8A 3M6AA 1NI5A 4UE6A 4A5OA 5AKKA 2UUBI 2C97A 1NNEA 1MN6A 1QHGA 2HLNA 3MQ2A 3PNLA 5CCDA 4EKDA 4PJNA 2C2OA 2ZIAA 3MAAC 5JISA 4BMCA 1CRZA 3NGXA 4HRYA 5BYJA 3T9AA 1ZN9A 3KOUA 4IDFA 3LXXA 3RUFA 2I5PO 1ULTA 2Z3VA 1D9XA 5DH9A 4O2BF 4B4UA 4K87A 4CS9A 1NOJA 3ZHRA 1PD0A 4CMKA 2WIJA 3EUWA 3ZCVA 1JDUA 3LL4A 4NESA 5CU7A 1U11A 5KYVA 4AW9A 1TJNA 3HKCA 5HHTA 2OXCA 3BEOA 1QH8B 3S28A 3BTSA 4IQFA 3JD4A 3RT1A 2X14A 1ZN7A 3ZIAA 4P3PA 1DQYA 2V98A 3TCXB 4L16A 2W2XA 1A69A 1RMVA 2PO2B 1VKNA 3AF0A 1D2GA 1J9GA 4FR0A 3V55A 1ZH0A 1PHRA 2EX4A 3GAZA 5SYAA 2HSDA 3IV9A 4PYIA 4YAUA 2F3QA 4DANA 2WG1A 2BKUA 3SX4A 4LCJA 4N0MA 4F56A 1YL6A 3KB1A 4GR9A 2UV8A 1HZZC 5DM4A 2EFCB 3MB5A 4TLEA 5E1DA 4QTXA 5LZ7A 4OLJA 3IEUA 1ODFA 1X80A 3EGEA 4UHKA 1W0KD 4X6UA 5HEKA 4HDOB 2FEKA 1M34E 3VR5A 1U1GA 4BNUA 1KWKA 4X92A 1QE3A 1Q2XA 1OB5A 2DQ4A 2X5NA 4FUTA 3JVIA 1R9NA 4RF2A 1EM6A 2C0PA 3AVXA 3E9CA 4I99A 4D4GA 2AF3C 3HJUA 3U09A 3ETEA 1UJ4A 1CRQA 1IBLI 3CSDA 1H0SA 2FRDA 4ZOLF 4Z7OB 4GKJB 2W9YA 2FW8A 2PUTA 2XZPA 4L73A 4GI3A 2DPXA 5DK6A 3SMVA 4B48A 3F8TA 1NXPA 2NZUG 1X39A 3HV0A 3JQ9A 4CU2A 5EL0A 5TQ2B 2P69A 5LCXA 4UBKA 4BN5A 1G16A 3KJIA 4J9VA 1AOXA 3T5BA 4INOA 4BQIA 5LPNA 4DV3E 3CXUA 4GHWA 5EERA 3JU3A 1TM3E 4DR6I 3NHWA 3G1TA 1HLFA 4G86A 4J0JA 4MYRA 5DI3A 2IDMA 5TPWB 3RD5A 3TZHA 4AUMA 3ICQB 5D85A 5A4AA 1OLXA 2RK4A 2CDAA 2F3UA 4RPGA 5EWLB 5E4YA 4YFYA 5IFKA 1OQCA 4CODB 2GRJA 2WJWA 4PEVA 5EEGA 2A5YB 4EVIA 4HRVA 1A9XA 2HA4A 1UKYA 4UEOA 1G2QA 3ND5A 4JWTA 2CFCA 5CB8A 4IX9A 4G41A 1B6GA 2B3DA 2EZUA 5D87A 3LDFA 2NO1A 3AFGA 3DMPA 2C9BA 1UPUA 4XRGA 3TBFA 3UR3C 3R5FA 4R4JA 1Z5WA 3DULA 1RWNA 3FVWA 3G9ZA 5A6VA 3TZBA 8GPBA 3HLYA 4R16A 2PKYX 3F3KA 4IRUB 2ERXA 4DV1I 3FKSD 4WL0A 4U7GA 1C0IA 3VM6A 3DOCA 4R05A 4YDSA 1LK5A 3OIUA 1WCXA 4CT4B 4G0UA 1C4XA 4HRAA 4BHTA 4IWBA 4N76A 2J0SA 2FE1A 3JALB 1E0AA 5J2TA 2GO7A 3T61A 2VT3A 4KQVA 1BDMA 3OU7A 5KWEA 1F5NA 5GV7A 1XZPA 3SWWA 1DL5A 3RUCA 4DM3A 3JYHA 2BW0A 5LP1A 3EHDA 5DOVA 1HH4A 4YRCA 1PS0A 3JYYA 2Z5CA 4O0LA 4D3FA 2R3SA 5JASA 1MQ8B 4EHAA 2RAPA 3DMGA 1AIPA 2ODQA 4PINA 4WLEA 3TW6A 5EMLA 4K9DA 2HS5A 1NFRA 1RJEA 3WGJA 1DBIA 3HSYA 4XJSA 4AS1A 4MJ3A 1E3PA 3CH7A 3NV7A 4IFDC 1GPWB 1XDBA 2FYTA 3KWFA 3H2UA 3M2PA 2ZUUA 4GDFA 3J81Q 3OUUA 3B6KA 3O82A 1E79D 2ZJ4A 5HZHA 1NRIA 3CNHA 4Z7CA 3QI7A 4RVNA 4UHBA 5CVEA 2Z5BB 4EUHA 4FWVA 2PNMA 4BBZA 4LYGA 3CVOA 3S1AA 1M2NA 3LS2A 4KO4S 4U6NA 4WUTA 2BH2A 3ZDFA 1FNBA 3FROA 4I4LA 4CL2A 4A2NB 3TFOA 4YJHA 2YWHA 4JZKA 2ATCA 5JHHB 3ZY2A 4AS3A 5DSTA 1DOVA 2OTCA 4I4CA 4ZTZB 4B33A 4KIJA 3PQCA 5DIFA 2REBA 3HYLA 2C37B 4KRXA 4KXWA 5ERYA 1VPLA 2XLWA 3ACBA 3DQPA 4EG1A 4DA4A 4PU9A 4DV1B 1AXGA 4G9GA 3GEHA 1FLAA 2IESA 2G4LA 1E2NA 2B78A 1YYJA 1R66A 3DKAA 1H7IA 3HJGA 2QVCA 4URFA 5IEBA 3GCXA 4IG4A 4AN0A 1QAMA 3Q4GA 4KMMA 3F3SA 4Y2RA 1E4EB 3VPHA 4DOZA 4Z2AA 1MC1A 1N0WA 2AJCA 1X14A 3S0JA 3EG9A 4BEMJ 2QT0A 4RHXA 1Z4MA 1YBHA 1X77A 2COUA 2PH7A 2GLUA 4JXKA 2ZYRA 2W8BA 5G0TA 1T1JA 4C4XA 1ZD1A 3E2IA 2PZEA 4KB5A 1T2UA 4OIOF 3ABMC 3LCVB 5FPKA 3CRZA 1YQ9A 2WUDA 2QLJA 1MW9X 2HTFA 1YK1A 4RABA 2JH3A 4DR5B 1NI3A 3FTNA 4L74A 1XYVA 1C0EA 2VAPA 1KOFA 2BJHA 5FEMA 5IASA 3GLGB 5H68A 1VI7A 4B3RB 4I5GA 5H82A 4BFUA 1G20B 4WBXC 4DS3A 4Z54A 1WU7A 2X9VA 1XZKA 1UZMA 3GLTA 4GI5A 2VN8A 5TS2A 1G8GA 5AVXA 4P82A 1H2WA 4HFJA 1VLJA 2K6GA 3C24A 4AZWA 1E20A 3FPKA 5D3KA 4LVCA 3EIHA 1XCJA 4YRJA 4M49A 1LB1B 3RYIA 3IE1A 4IFBA 4DSAA 4RJLA 4FDLA 1LLQA 3ZZ0A 1ZOSA 3EVZA 4WKGA 2XM4A 3ZLUA 4F45A 2CSUA 3GP3A 5I7VA 4BDSA 2NXWA 4EFLA 5MDHA 1EA6A 4DU8A 4PRZA 3DC7A 4UDVA 3JQDA 1UBFA 4AE4A 1XHEA 2V5UA 2M2IA 2YZ7A 1E1YA 3DVAA 3D0KA 4MDTA 3P27A 1D2CA 4GZ6A 3TE7A 5J4HA 2NSFA 4D9CA 3AM4A 5K0FA 4IH4A 4KR9A 2WU3A 4IFDA 1U4NA 1Z47A 5KHAA 4CF6A 3G79A 3O8BA 3RSGA 1GT91 1ECGA 1EFVB 1KVUA 1QB7A 4DV4E 1YMVA 1MEJA 2BELA 3EGCA 3FPBA 5FQOA 4U2EA 5LZ8A 3I1IA 3MMZA 2IHYA 2O0HA 2R7OA 3FF1A 2B6NA 2DSNA 3K0AA 2WINI 3L7AA 4UCWA 4XGQA 3H1TA 3UG6A 3KD2A 1GSOA 4XDHA 4EA6A 1NBME 1SRRA 3ELYA 4B6GA 4CBEA 4D3XA 5KNLA 3OPXA 1E5QA 1FU7A 1HTBA 3O4RA 3RUPA 5BQHA 4JI0E 4REOA 5LQDA 2DUMA 3GFPA 3ECCA 3Q2OA 3BOSA 4QL3A 3T5CA 5A3RA 5DNCA 3WGUA 5IH7A 2XADA 3LO8A 1JFLA 4OSPA 4WDRA 5E3CA 5LL6P 4DR2B 4HLUC 5JADA 3BYZA 1WEHA 4LGYA 2ID9A 5B36A 4N4WA 2TMVP 1GUDA 3QXHA 1JJVA 3HCRA 4H17A 4DIBA 1KK0A 5KOJB 1NOIA 2HSEA 1O87A 4HUQA 2VXYA 2Y1CA 4BFXA 1U3GA 1RPAA 1H0RA 1NATA 3BCUA 3PFNA 4IO1A 2C3PA 1XYYA 5AJUA 2O8DB 3WDMA 1GXSB 4B3CA 5KWSA 1YB7A 4DAEA 4HPWA 1F2UA 2GILA 2OZLA 1HRKA 1H93A 3O4JA 3PNMA 3IMEA 1QYDA 4HAVA 3F4BA 1NUTA 3QFCA 4FNAA 3RK0A 3UAXA 3RARA 3LG2A 1WDMA 3ACDA 5ALMA 1W93A 3JAKB 1DQNA 1QDEA 1UJ5A 4Q7MB 4AX2A 5H59A 2VZ8A 3LI2A 3QA3E 5C0OE 5THQA 5B6IA 3P76A 1V16B 2YHSA 1J7KA 2BOVA 4S1NA 1QFMA 5BUOA 4YJ3F 3O83A 4UTRA 4AN1A 1HGXA 1V7QA 2HFSA 2ZYWX 1J0DA 1R3UA 3CH4B 1S2MA 3JASA 3AL2A 5HP4A 3AKZA 2A0XA 1RABA 1U0LA 1TYAE 3RNOA 3AYXB 2G0TA 1ZONA 3T8YA 4DZTA 1RWOA 3Q6MA 3V2IA 1V11A 2FX3A 2PGAA 3FFBA 3LE8A 5ALDA 2RHGB 3WRYC 5CFNA 4ZVRA 2Y6UA 4OIPF 2ZRKA 2GF2A 1GNRA 1I32A 2H16A 2H2AA 1KI4A 3GRRA 4N8EA 5DYIA 2X8BA 1PEAA 3NTQA 1T1EA 3R7BA 4A2QA 1LE4A 3L6UA 2QTZA 1F0KA 1YT5A 2BTQB 2D62A 3OIYA 2Z6VA 3TVDA 1RMTA 4DSUA 2W6ID 2HJ3A 1PHPA 3DLBA 1MRNA 4DIMA 3Q7GA 3ZDLA 1ZW6A 1NPYA 4FD2A 3VR6D 3H7IA 3FGNA 5IY5C 1PIEA 1BOFA 3IHUA 1L4YA 4CDAA 2QMUA 3F1LA 1P3DA 5CX1B 1X80B 3VX3A 3F90A 4XEVA 4BMSA 2ZXWC 2XGGA 4MTGA 1OHHD 2EIHA 4L5CA 5JDIC 4QEZA 4HWRA 4W9NC 5DRRA 1VLTA 2D4AA 2GBFA 3IUPA 2YLGA 4ZO8A 2B69A 4JVSA 2W5UA 2BCGY 2JZOA 4LZAA 3ETGA 4PLCA 5AKJA 4ZVPA 5GVSA 4JLPA 4LDQA 2OE2A 3KWMA 1C1XB 1I33A 2NAFA 4H31A 4OA8A 3E22B 2JLAA 2PD4A 3NDRA 3VZPA 4ENUA 1F17A 2E1RA 4DJTA 3R7CA 4EL0A 5KINB 5DNWA 4DN6A 4AKHA 3HL4A 1A5AB 2CV1A 4KHPE 1J09A 3IALA 1G4HA 1JSLA 1US8B 3PGVA 1TM1E 3TOZA 3DKVA 1YI1A 4AZ3A 1REQB 3RRMA 1ESCA 1BJRE 3IMGA 5J63A 1ZOOA 1GZVA 1U9CA 1WHTA 3CH6A 4QVKA 5D8DA 1EG7A 4OJMX 4AY2A 2PDAA 3KSDO 1PF7E 1RXEA 1NC1A 1I4ZA 1ORRA 3A6ZA 4L6IA 1ILWA 3U1BA 1P29A 3NW9A 4J4BA 5COQA 1A5ZA 1MJGM 1ODCA 2VOEA 2FEWB 4OYHA 2UUAB 1BA2A 1OI3A 1T35A 1W85A 4G0VA 4BPBA 3AUTA 1K86A 3LOQA 4WAUA 4PC3A 4QVIA 3M82A 5G02A 4D46A 1M8FA 3GT7A 4MVJM 4MHOA 5FBLB 1I2CA 1X1AA 1DDIA 2IEDA 4IMJB 2IPMA 2J59A 3IPLA 3WYAA 4K3VA 5KSYA 4DT1A 3S8MA 1K4MA 2OFXA 3STXA 4BQPA 1GSIA 1Y4ZA 2CE2X 2I8AA 3DKRA 1GL3A 1JDZA 1YJGA 2QLMA 2A4KA 1PT7A 3ZU2A 5K20A 3U9LA 4O6YA 2JHPA 5FJIA 1XAIA 1OIVA 4HZIA 4B3BA 1UJBA 1P73A 2OZPA 3ORSA 4MRNA 5FOWA 3I61A 1U90A 1Z5PA 1Y82A 3C8DA 3BKXA 4D96A 4YK5A 5EJ8A 1VFPA 3OU6A 1SWWA 1FP4A 4EOGA 1CUIA 2I76A 1KNQA 4OG2A 1P7YA 3VH2A 1EKXA 2BTEA 1CUEA 4RJKA 5D7BA 4LX8A 4Q1CA 1T5IA 4HAUA 1Y9EA 2JIQA 4EF5A 2PMFA 1IN1A 4D4IA 2PYDA 1JALA 2EP5A 1WATA 2ILTA 3PG5A 1IBMI 3C15C 2ID8A 2GOYA 5DHAA 3A3OA 1WMSA 4IUDS 1SVIA 2FU5C 4ROSA 1YCGA 2L6GA 1YFJA 1EFKA 2YHIA 3A3NA 1T4BA 2ONZA 2D5LA 2ZD9A 1FDRA 4WKNA 3CX6A 4Y2GA 4O2RA 2HJHA 4GNKA 3P9SA 4FQ8A 2J0QA 3FAKA 4K8RB 4AXXA 2H1OA 4OU4A 4KPYA 3G5UA 4UEKA 2RHBA 1P0PA 3HCOA 2NWQA 3IE0A 5KWIA 1HTTA 5B3AA 2JL1A 4D9EA 4HNHA 2HDHA 2G67A 3DE5X 2ZB2A 1B8OA 4NC3A 3V80A 3WQBA 2P11A 3ASVA 2A78A 1VBFA 3GJSA 3LQFA 5HMLA 3SQXA 4WX2B 3Q1QA 5BRNA 3E82A 3TOMA 1ENOA 2C3OA 5DI3B 1C03A 5AI4A 4EHBA 4DXDA 1PSDA 1IXKA 1YZKA 1YFKA 2M6KA 5KQSA 4UCXA 2JFNA 1R00A 4MS2A 2HA2A 3ETNA 4UNSA 4WKPA 3H87A 1XXLA 4CSAA 1OLXB 1YCHA 4ZZ1A 5F28E 3EIXA 5F5FA 2XEDA 2GWRA 2OOSA 3TRDA 3VTFA 4LFBB 2GJSA 2L17A 2GVDC 5JIBA 4BQSA 1QJCA 3Q2IA 5JHGB 1GVHA 4IDHA 2GS9A 1SVNA 4RDAA 2CY0A 2PUVA 3SNKA 4N3OA 1ZD5A 1XALA 3ZNPA 3UT5B 1XL0A 4RHFA 3S2SA 3R9XB 3VVMA 2C92A 1PWEA 2PGOA 3L4BA 2IVFA 3OAAA 1DFHA 3ESBA 3HP4A 8ATCA 4XUCA 4XPWA 1X87A 2OWEA 2X42A 3GELA 4M9RA 1TZBA 4QU9A 5HS6A 2GI4A 2XLCA 3KX2A 3PNYA 5TEWA 1QZZA 3KOZA 4YWJA 1DBSA 3KT3A 4LK3A 4Q39A 2ZR0A 4TXLA 2OBMA 1DBRA 3CVJA 4OHMA 4TWAA 2JEYA 3UFXB 5EKUA 3W9YA 4NOJA 2CCGA 3GRPA 4BGIA 4UCFA 3DEJA 1F8GA 3EXFB 3EISA 3JZIA 2H6EA 3FN4A 2L19A 3LFUA 3SNHA 3ZZUA 3EQ7A 3N6XA 3NC1C 3OJOA 4K2HA 4L2IA 4LJ4A 1K88A 4N3BA 1O5TA 1M66A 2Q7XA 3LX5A 5GGXA 2PNFA 4H54A 3TM5A 5A4DA 3RKSA 2GA9A 4X9XA 1GDHA 4JC4A 4Q7JB 4D41A 4ZDJA 2CXOA 2EBWA 2P2SA 3BG5A 2C59A 4CEIA 1SA0B 5J5VA 2GD0A 3BKWA 4IXDA 1PJLA 4QUAA 4X1KA 2CMDA 2VHXA 4QTYA 3U7IA 1DIGA 5D5HA 1EUCB 1P9NA 2W6PA 3KZKA 1ISRA 3WVNA 5ALUA 1YQWA 2VZ0A 1CR6A 1HNWI 5DGXA 1XOIA 4AROA 4EEKA 2PX0A 3W2GA 3JWHA 2ZOSA 3C8UA 4MA5A 3RF7A 1ICIA 3UF0A 4D3YA 4KV7A 4WZBE 4ABTA 1E3DA 4D6YA 1VGQA 5ETJA 1B6TA 4K0KE 1OX4B 3NNSA 1DUIA 3PNVA 3KKQA 4NH0A 4OY3A 4RD1A 3V5RA 5ELLA 9GPBA 5DHQA 4UTNA 1XCLA 3O3CA 2CWWA 1YB4A 3UMFA 2O3JA 1AQYA 2UVDA 1X1BA 2ZJBA 2WVNA 3BULA 4UD6A 5BN4B 1WB4A 3ZDZB 3ANTA 2HJMA 1YZNA 3ZKDA 4HLDA 4X1IB 5JEDA 3VFDA 4I9UA 5JLAA 3FTFA 2TMDA 3HM2A 1DHRA 3OKPA 1AMUA 1R0WA 3C8ZA 5JNUA 2NN6E 2O8EA 1Q91A 3CY6A 1VIYA 4A9AA 3EAQA 4IFDE 3B6ZA 3HSSA 3IT2A 3K0KA 3QUAA 1L3CA 5EZYA 1YO6A 1NXSA 2QTVB 2F9FA 5GPBA 1II0A 2W2LA 3PNPA 4ZLCA 5AUNB 5HTOA 1W88A 3QW4B 4B85A 3U56A 3WS7A 4J76A 1VA4A 4JP8A 3HLKA 2B92A 1YS4A 4HVAA 3HDHA 2X9QA 2E4AA 5DTJA 1NQOA 2OPBA 4WOPA 4K0KB 2IC5A 1VISA 4U6SA 1TAUA 4CN8A 1KJWA 2PQ0A 2F1DA 4MYTA 1CF9A 1B41A 1CY4A 2Q21A 3OX3A 4HJXA 5B58T 16PKA 3ANXA 3N8NA 2O2SA 3UK1A 3N74A 3AC0A 2A7XA 4EPWA 4MH0R 4FEEA 3FKSA 4OM8A 5GJCA 5A4JA 4DCOA 3S81A 1NKSA 3TJ6A 2GUWA 2EJUA 2QTHA 4Y6QA 2Q1SA 3UFBA 4ALLA 1DCTA 4CS8A 2GAOA 1KFEB 3FM9A 4XUDA 4Z6KA 1DINA 5F35A 1PFKA 5DLEA 4Y0AA 1UOEA 3IAUA 2RH8A 5GTDA 4CL0A 3MWLA 2E5FA 4H59A 4XWTA 3RYTC 1P7WA 4HDKA 2YN2A 3BMNA 1N6RA 1ZK3A 2WVQA 1DNPA 2ZJ8A 3R09A 2VF3A 1A0OA 2CLKB 4M9ZA 5KTTA 1C1HA 1CLEA 3FPHA 2XWPA 4G4SP 5CLFA 3DJUB 3I5AA 4R7GA 3QVGA 2HA0A 5ALPA 1OPRA 1RXCA 1DFIA 1TD9A 5JXHA 2I4RA 4W8KA 2BBWA 4HZUA 3WYNA 2R11A 2QORA 2HK2A 1PZEA 1VIVA 4II3A 4WLNA 1XN4A 1U2QA 3IEEA 4YLEA 4DMFA 4ZJUA 4BYMA 4QLBA 1NF2A 5K0EA 5ALFA 3GIDA 4KACA 3WB2A 1V47A 1SQFA 3PXDA 3BXOA 2EKPA 1EGMB 1VL8A 1SUPA 2VSXA 1FS4A 4DM7A 1HPLA 3PEWA 3A3YA 2HGZA 2QNIA 5J1TB 4I6GA 5KJ6A 1ABBA 2IV2X 4Y67A 5C7OO 2J0UA 1AO3A 1CJVC 1DAPA 4IOMA 4MI9A 3PWZA 5L8VA 4RPFA 1C9NA 3K0HA 3WIDA 2AZ4A 2PQ6A 4KN9S 1LCIA 4YCLA 5FNVB 3ZUGA 4F91B 2AXPA 3DCIA 4OO1A 1IONA 1BGXT 1NMEA 3D7RA 2HU2A 1UIRA 4O2AA 4OB7A 5JYBA 5D7NA 5AKXA 3IYLW 1XPJA 2W6NA 4WXEA 4GLBA 3C3EA 3SDBA 4HBZA 4N06A 3I0MA 3KXIA 2IIQA 4KWTA 3KOWA 5IDYA 1IMJA 1R3DA 2VJLA 3PL1A 4ER7A 3EX7C 3X2SA 2XYHA 2C04A 4NCQA 3D1VA 4TLDA 4JLDA 2J33A 3BJRA 1E1CA 3TSWA 4BX0A 2BFFA 1NF9A 1FYVA 1UQUA 2YC2C 3CF4G 4RNDB 1O3UA 2BJWA 2F9MA 1H1TA 2X1VA 4BAUA 3VOSA 5JPIA 5E8JA 5HKOA 1IPFA 1UOOA 1G8FA 1MR3F 2CUNA 1OR3A 2F17A 2V1XA 2WR8A 4ZOQI 3UMKA 3KHUA 1E77A 1CZHA 2AZDA 1LC0A 2AHRA 2HCRA 1TJ5A 3BWCA 1X0VA 3KXDA 4RF4A 5B7PA 4J0HA 4J0QA 3FDQA 1KJIA 4NULA 2C99A 2DG2A 4YJDA 3UGQA 1FUYB 1IBLE 4BKOA 5A1TA 3S68A 4CLEA 5C53B 2D13A 1DCMA 2X6QA 2FRVA 1CYEA 4DE5A 3ZBPA 5LSAA 1C0LA 3CG4A 5E38A 4WI1A 1OWLA 3DEAA 2J7PD 4JELA 4QREA 3LT5A 2Q07A 1D5CA 1VG8A 3GRUA 3AVOA 1ZM2A 5ICSA 2WVGA 3RS7A 5IPFA 3OCZA 1QC5B 2VT2A 3SR0A 3DMHA 1ISSA 3NH9A 4HVTA 4JB8A 1BKDR 1XFAA 3T4EA 4IXMA 3TD9A 1YVDA 1FRQA 3I9V1 2BE5F 2CJPA 4US1R 1E0JA 4JBHA 4P3KA 1PS8A 3SEOA 1DP4A 2A5GA 2ZJ3A 3LLCA 1C3JA 4OGWA 3MOSA 4X44A 4K81B 4LJ9A 1BZ4A 1T4GA 4RTLA 3AM3A 1G7SA 1MJNA 4LZNA 3WDSA 4DR5I 3SZMA 3BB1A 3X2EA 1VZ2A 4GL2A 1KIJA 1IWOA 4HN9A 2PNLA 3H11B 4ALKA 3VU1A 1L4KA 1X2EA 2FGKA 2XBLA 2ZSDA 1E1NA 5LYYA 1JTFA 4HNAA 2XMQA 3MM4A 4M54A 4G5HA 2F8MA 3OIDA 2FW0A 5JANA 1CY0A 1JIUA 4JC8A 2A0KA 2OQRA 5KWJA 1IRIA 3Q9UA 1WMFA 4HDCA 3T6GB 2YVAA 3CDIA 4PZDA 1OW8A 1M1YA 5ECGC 5A9TA 1TYEB 1KVKA 4CVNA 4F7DA 4ARSA 2J46A 2VNIA 3SFZA 7REQB 1U3VA 1US8A 1VECA 4O4JF 3IUJA 4B9EA 5HM8A 2V1UA 4PR9A 1W5AA 3IGFA 4GBMA 1DQZA 2GZMA 1XMSA 2QSYA 4IDNA 1PZNA 3AEZA 2NO4A 5E2BA 1N7JA 5EVJA 2DOKA 3AESA 2YWBA 4P92A 1XF1A 1R8QA 2WWTA 4Y6LA 3WJ2A 1D2HA 1JZTA 1DX4A 3B7PA 2P1DA 4L51A 1K8RA 2ZSEA 3MJHA 4NEQA 2R7RA 1ODLA 4JI5E 1F0YA 1E5XA 2DGDA 4OIMA 4ENPA 4HEA1 5JQGF 1HFWA 3OM1A 1VMDA 3QG5A 3EXEB 5LZ2A 3DWEX 5LA6F 3HULA 1TZJA 2CJYA 1L4HA 2VYVD 3A27A 5FBRB 1HURA 3EQ2A 1K8XB 4H3VA 4HFRA 4HGQA 3RVRA 1ZHFA 4EBJA 2HCJB 2ZCUA 3R0VA 2FQXA 5I8PA 3W79A 1CP3A 5ED4A 1M0SA 3VH1A 4GF5A 3KKBA 4W5TA 3Q41A 4NYIR 1T9ZA 1JVBA 1WSAA 2AEJA 2JFBA 2R2GA 2VRCD 3OECA 4KPUB 4X6LA 3M9WA 2DBVO 5HRUA 2VKTA 5C0XD 1V96A 4PN7A 4BJ6A 1NUQA 2OBLA 5K7SA 3P4YA 3RODA 2X3YA 1HC7A 2PT6A 4B2PA 5GIPE 3Q8MA 1AS0A 2GNPA 3GJ0A 4MVCA 3LUJA 2IQ5A 4ZOEA 3SHVA 1H72C 1S02A 3G2KA 1GG8A 4H7KA 4JN6B 1Q0HA 4URXR 1Y7LA 1RWKA 1VL1A 4KJXA 4NNPA 2HHJA 1L3IA 3CZCA 3GEMA 1E9RA 1X1DA 3QY9A 3EVFA 3FMFA 4YMTA 1KDPA 4FN5A 4DU7A 2ZQYA 4P32A 3RS3A 3TX2A 2FFQA 3IEKA 1HW2A 3QA9A 5D3ZA 2WAMA 3DE0X 4EL5A 4OFZA 1WUIS 2OG1A 1K7CA 1SEPA 3ONVA 4OFWA 4V0RA 3EHNA 4YUWA 2B1RA 3TQHA 1PX0A 4GMFA 4U7WA 2VC2B 1JDBC 1QRAA 1ZUHA 3QBJA 1F20A 3QV1A 4K6GA 4O2BA 1UBJS 4RD0A 4XQEA 1ZITA 4JBYA 2W6MA 3TCNA 1TEZA 3ZDYB 3TLBA 5DZSA 1KK1A 3TUJC 2PRIA 3AIKA 1YVPA 2V3WA 5HQ3A 1DLJA 4PK4A 1QGED 1NZEA 4NBUA 3PXBA 4BZXA 3PENA 3L06A 4CM9D 4QIHA 3CUWA 2N3ZA 4HX2A 1VE6A 3D6MA 1CGOA 1ESZA 3OTIA 5J2UB 3NHZA 3GZNA 4AJKA 1T9KA 3OA2A 2UYGA 3W05A 2A57A 4BP1A 5HFJA 1TO2E 4H7DA 1ND6A 5JSUA 1Y33E 5HOEA 4GYWA 1RADA 3LU1A 5KYXA 2E6UX 3OMLA 1QYVA 1QGUB 3BXEA 3UAOA 4F38A 3IVCA 1D6MA 3C8HA 5LR6A 4WZAB 5CHYA 2C95A 1NYLA 1OYPA 1IQ0A 3QENA 3ROGA 4WZBA 1GG5A 1HDCA 4I6JA 3VO8A 2HHAA 1ZK0A 2VJBA 1KZ4A 2C9ZA 3V4ZA 4BB6A 1HDEA 4DOMA 1S3FA 2JLQA 4U9IS 4DA7A 5FBKA 2GEFA 4HWKA 1H4QA 4HEQA 2BI7A 4ZEVA 4WACA 3LL7A 3PQ6A 3EG5A 3GUHA 3CA8A 4EBKA 2DT5A 5LDDC 4R0NA 3ORFA 3VC2A 1G2IA 3NM5A 4DUZB 2EKBA 4LJ7A 4ZANA 4QFCA 1PR0A 4UBMA 3U7EB 3ZVLA 4UTVA 9ABPA 4JJ4A 4JOCA 2A67A 2FW1A 1UM9B 3OBBA 3QF4A 4AZ0B 2HJGA 1BDHA 3IAFA 5FI3A 3BZBA 3MTBA 3IB3A 3G5TA 5T3YA 3TM4A 3IKMB 3S2UA 3SEQA 1FUIA 2EG5A 4GUAA 1F9AA 4D8XA 4ZYUA 5I6DA 2R7MA 2BKVA 4ECAA 1NASA 4S1OA 4LGMA 1XWJA 2A88A 2OLJA 2NYRA 4MUXA 2XWJI 2ZBKB 1DIBA 2QB5A 3GZNB 1H2ZA 4M7WA 4U6QA 1N6PA 2BUAA 2J4CA 2WJJA 3DGEC 3R7LA 3ZU5A 4EPYA 1TMYA 2VJQA 2TSYB 1DG9A 2V7UA 4UNNA 4YBZA 1RKCA 2QRPA 2OORC 4BFTA 2CEAA 3O8LA 4A2CA 2GMWA 3NHLA 4H1WA 3WHLA 2CCKA 3CISA 3AVVA 2FG5A 4WK6A 2ZSJA 4GRDA 3UJ9A 2O2HA 3MUFA 2BR5A 3FY4A 3WGOA 4DLWA 4C7VA 4AMGA 1JLMA 1POWA 1WDLA 2FEAA 1U3FA 3OH8A 4O63O 5FI1B 3U81A 1GGQA 3TKAA 5CFRA 1QCYA 3X1OA 1GAWA 4XGNA 1GLVA 2QD1A 2G08A 1Z15A 3KZVA 3L0IB 2LPMA 2H4FA 3CZMA 4G0NA 2IUTA 1RYFA 2PUWA 2F4VI 4QXRA 3UFXA 3AUSA 5ISMA 1ZCAA 2H7XA 3UPTA 3BD6A 4KXMA 3MHTA 2CB9A 3HY4A 2QNLA 2FUCA 3VBCA 3V7NA 2VWPA 1GCAA 2CLSA 1OBOA 3BVPA 1W76A 2W8ZA 4A1FA 2OBFA 4O2AB 1CZUA 2XQIA 4AL1A 4DARA 1U65A 2YV4A 4LZPA 1E99A 2AG0A 2H63A 2P9CA 4ZT7A 2WD7A 3AP3A 3OMWA 1YVRA 4ZVOA 2ILVA 5HGXA 4GX2A 2CFTA 1HDRA 4LYHA 2KNHA 4EIYA 2NN6D 3L6BA 3QMWA 4IMRA 1PJQA 4R1OA 5TDHA 3OZSA 3SC2A 1N2ZA 3H5OA 1UH5A 3ILXA 4URZR 4XM1A 4EMSA 3ZTMA 1FP7A 4CX9A 1AXEA 3KJZA 3O5AA 1ZEMA 2WOOA 4YQEA 4CQMB 1PW7A 1J4AA 2JFUA 4QDJA 1LNQA 2AMYA 5JI2E 3NBAA 4RQUA 5GQSA 2O8FB 1NF8A 4JGGA 4HDAA 1HE9A 3ZPXA 4EITA 2YXPX 1PYDA 1E83A 5A9SA 1E3IA 1PAUA 4CM6A 3I5PA 1A9OA 4CM5A 1F7VA 1YHZA 3P2JA 4FLMA 4PO1A 1P2GA 4WT7A 1JJIA 4MK4A 5H83A 3K1IC 1PSZA 3LA6A 1U2ZA 4HNTA 4PNEA 3PT9A 3I9FA 3VPXA 2BFAA 1OCOC 1PLJA 4X6XA 3RFYA 1Y6ZA 3UCEA 2GEKA 1EVIA 3O95A 3KHKA 4PNPA 4F6CA 4IZKB 1L7AA 3CC8A 4C3EA 5G2OA 1Z26A 3M79A 2JJ8A 2JIZD 1CUXA 1MOZA 1PG2A 1UBUS 4DR3I 1YB2A 4M36A 3OD5A 5KC8A 5JS2A 2X19A 2A1UA 3MINB 2ZUCA 5K6TA 3MTQA 3DWGA 3QNWA 3R0XA 5A6KA 4GAEA 1Z8DA 1GR0A 2GA8A 2JFFA 4HV4A 1RDFA 1BW9A 1X8KA 3RFUA 1RREA 3B71A 2IHNA 1QIEA 3NLLA 2D4UA 2ZXOA 4CTKA 1LFAA 2IYRA 3HG7A 5BORA 2YXNA 2QUZA 3DEIA 4K6HA 5K8TA 3OZVA 2WBLC 4DVYP 1X0XA 3CQ9A 1K06A 1RQXA 1XTSA 1XT6A 1QCCA 4WXMA 3X1YA 1L6IA 3D0OA 3REFA 2JRLA 3D0RA 2OCIA 3ESCA 4G3XA 4L0CA 3WK4A 2QZPA 1KPGA 1XK7A 1GWNA 3ND7A 1N1DA 2QXYA 3S4YA 2IHBA 3QPWA 1CGME 1EU1A 4PQFA 1OAOC 1G17A 3GFQA 4LHXA 3TQCA 4BC0A 4RH1A 1H65A 4MS4B 2Q1YA 3W2WA 1U28C 1YU9A 2AX3A 3D2CA 2V9ZA 2OFPA 2IIVA 4Q1FA 1TAHA 4JYAI 4ICIA 4YHHI 1MQAA 4M1YA 1L4FA 5LA6A 3WLAA 3VAYA 3SS9X 4A7PA 1KFBB 1S4QA 3JATB 1XWIA 2OB2A 2RGXA 2XYQA 5IN5A 1WDWB 4FWHA 5CA0B 1SCJA 1YCDA 2VZLA 3PR2B 5IBCA 3TSOA 4CEIB 3ITEA 4Q21A 3SF0A 5A4FS 3BMOB 1M6EX 5AO9A 1TWCA 1Y5MA 3FOBA 3HKDA 4Q7LA 4ALNA 2BHLA 4UUAA 1F9EA 1QKRA 5HRCA 3T1QA 1CKEA 1E8MA 4MULA 4G0MA 4IDEA 3L1VA 4HAOA 2PKCA 5CLQA 3W06A 2BMDA 4YRAA 1X13A 4GDMA 3T1OA 2C7PA 5HE9A 2QJRA 2WB2A 5FTWA 4BNYA 5CFZA 3MBKA 3R2PA 2WFMA 3F6PA 3GJTA 1EBUA 1P1RA 1Q44A 3X1DA 1ZCJA 1EVLA 1GYQA 4JVOA 4N54A 4E88A 4JV5E 4X1YA 1FRFS 3HU2A 4PC2A 1VLVA 2JD3A 1G5ZA 2EFHB 4JP1A 4JEHA 4X8HA 3B52X 2PYIA 5TS3A 3U2QA 1QYCA 4E2ZA 3C3MA 4KRFA 2YKZA 2JCSA 2Z1MA 3Q3VA 4AKTA 4D4KA 3ELDA 4U5CE 2XKBA 3GRKA 4G37A 4MB2A 3VDRA 1V1JA 5K8VA 4FWDA 2P40A 4LRTB 4UOQA 3A1EA 3TL2A 1UPCA 5C5EA 3BGOS 3VDNB 3TN7A 5FFNA 4D1YA 3OT5A 1GLNA 1YOVB 2Q49A 4KTVE 1IXYA 4CKXA 4YQZA 5I01A 4R1UA 4ZGGA 4OSEA 5AESA 1KDVA 5DB4A 2FXVA 2CD7A 5CX1A 1ULHA 1PFVA 4J0DA 4MQUA 4OHUA 2O8CA 2NO7A 2N0SA 5ALGA 2MSDB 5AHRA 3ST7A 5CCBA 2AWOA 1LRLA 1RP1A 3T5DA 1SR2A 4JURI 1FUKA 1M8GA 1BQ4A 1TM4E 4JLJA 2ZXFA 4F2WA 5DHTA 5HM6A 4KR7A 1BMTA 1QG0A 5CT6A 2ZIFA 2JGAA 4JQZA 1K0UA 1U0NA 2MSWA 2WM9B 1RRVA 2JHFA 2VNKA 4U5BE 1SZCA 1ZLYA 2GPWA 1WULS 4HNRA 1I36A 1QCDA 4JLAA 1A5BB 4ND8A 5I7HA 3DAFA 2WAAA 2ZIUB 5IABA 1MTZA 1PNQA 5IWAB 1SC1A 1PJZA 1O8CA 2ZIWB 1KMHA 1M2WA 2C8KA 3DFFA 3FWYA 3N0VA 4FYJA 4MW7A 5ELMA 1V25A 2NQTA 3GLHA 1WW3A 5CMLA 2ODPA 1YS9A 1M0EA 2ZJAA 4CHGA 2XVZA 4AJPA 2JZNA 2J4FA 2I29A 3SD7A 2K5UA 2WHXA 5DT9A 2PRJA 3CTMA 4FDUA 1KVQA 1KI9A 4NDAA 5JZ9A 2WW4A 2HMVA 5BR1A 1X7WB 4OBEA 2H5JA 1ODTC 2FPIA 2NTYC 4DSZA 4FWTA 1HDXA 5TF4A 2VAXA 1II9A 1G63A 4R8LA 4RH0A 5TGTA 3SZ3A 3ZWDA 1M75A 2BP7B 4CV1A 4G1MB 4HGZA 2P9TA 1WX1A 4GMGA 5AK3A 3W5HA 1UR5A 1D4FA 1GRCA 1F3LA 1MQSA 3KJGA 1KAGA 4IDDA 4JJ8A 3VKFA 4L8GA 3RREA 3C4QA 5EIWA 1L8OA 4I1PA 2AB0A 3NEPX 3HJRA 1U0GA 4WNIA 1EA5A 1XTQA 4J0EA 4QFMA 1DQSA 1R8XA 2QTRA 1Z16A 3V8BA 5CM8B 5F1KA 3P2EA 3EZIA 3P06A 1JAIA 3VX4A 5BUSA 1B4DA 2XTZA 1VJ5A 3KM0A 4XR9A 4OI2A 3X0DA 3E9ZA 5CM2Z 3WBBA 1IZ0A 3EXAA 4U63A 5BOSB 3DLCA 3REQB 3QF4B 4X24A 5KMGB 5HNKA 3L05A 1XF9A 3MCZA 2HTEA 5ELXA 1LU9A 4JR1A 1P2FA 4DGSA 5A7FA 1XDWA 1G5IA 2WKSA 1XZGA 4QPNA 1SBIA 4EB6A 3TK1A 4DR4I 2HMQA 1E6EA 1ZWKA 3DNPA 1IIRA 3U9TA 3ZH2A 2H57A 5I7EA 3GO4A 1IIBA 1IXRC 1QRDA 3EC2A 1LTQA 4G5FA 1JQ5A 1NW3A 1YI8A 4IV5A 2HKVA 1YDHA 5KJFA 4Q1VA 1P5FA 4XB1A 2CDRA 4P4UA 3UXEA 4DG8A 4B2IA 1Z75A 3IC5A 3QLUC 5ERGB 3KWJA 3IP1A 4C6SA 3KTDA 1WB9A 4LBZA 3DMYA 3F7TA 3P0IA 1DFGA 1G4US 4Q3LA 1EUQA 4EF4A 1XGKA 3UMGA 1NHJA 4ND4A 4B5LA 2O8BB 1NW7A 4NHOA 3ZGNA 1MX3A 3LYAA 4WBSA 1K4YA 5EFZA 3MILA 2WSYB 5IKEA 4R9UC 2FG7C 2A3NA 2O5CA 1EDZA 5D3MB 3UMBA 4QYTA 1C0KA 3C7AA 5DVWA 2AFIE 1FSZA 1YNSA 4I1YA 1A7EA 2V8PA 1LVHA 3DOHA 1ZCFA 3Q5DA 1ACJA 4X61A 2AJ8A 1NZJA 3CUTA 3H17A 1C9MA 5DLPA 4K6OA 4TRJA 3VBEA 2FZLA 1Q0LA 5KQPA 3C7TA 1T8UA 1FYFA 4J7XA 2PKXA 2PVPA 2ETXA 3PRHA 4MOWA 1QKKA 3IEVA 3EMDA 4TTQA 3W2VA 1NI4B 1I2ZA 3DKPA 3C1OA 1KBOA 4FE4A 1DAOA 4BQOA 4R32A 1EP3B 5IVHA 2H2WA 5C32A 2V4UA 4AULA 1FNTc 4Y9UA 5EL9A 4PX3A 2WWFA 4XB2A 2VHJA 1U5AA 4WCVA 3L43A 4DMMA 1P5JA 4L75A 3IBTA 4Z4QA 4UTXA 1LBQA 1N0HA 1PUJA 3KG2A 3H1AA 3R9XA 5KVAA 3OZIA 4O2BB 2XNJA 4MZXA 4EZEA 4AL0A 1DRJA 1QRTA 4NMXB 2F7SA 3RVPA 1E4YA 4ZRNA 5HQ3B 3FRJA 2CGEA 2ZRMA 4K1LA 5I9BA 4OLBA 3GM1A 1IAQA 1TF7A 5CUQA 2NQ2C 4EHNA 2XLVA 5GJWC 1WW2A 3ZD8A 4GH5A 1IHPA 4JBLA 3BX1A 1FP6A 1N6HA 4BVKA 3UH0A 5L0CA 4GKJE 3L9XA 4AYTA 4XB6B 3W6UA 4LXUA 3O1IC 4MU0A 2Q6LA 3BL5A 1HKUA 4G25A 1IHYA 2VHTA 2IEAA 1YUNA 2O0KA 3TW4A 3V8VA 3WIEA 4C0LA 7YASA 3KDSE 2VLBA 3KKNA 5KTKA 1KP2A 2FSSA 1W36D 4S1TA 4W5OA 3B1JA 3O8QB 2Y1XA 2FSVA 1HWYA 1T1IA 1J2YA 1R88A 3MAGA 3P0FA 2IBTA 3AR6A 4MDEA 1OY1A 4EY4A 2GD1O 3KUKA 3MW8A 4ZCIA 1KR5A 4IICA 4WHMA 2PP4A 1GGJA 3M34A 4HPJB 4MW0A 5TMEA 2YWXA 3I2GA 3PDJA 1D0YA 1FPQA 2HMZA 2QV0A 3K0CA 4NX2A 4X0EA 3RYFA 2L6HA 3H6KA 4RSHA 1L1RA 3R3JA 4ZHQA 4CIDA 2VPZA 3EWSA 1RIIA 2OZKA 2FPPB 1NY5A 2XTAA 4EVQA 3EXHA 1OFUA 1ZFNA 2YJZA 4H4KC 1Q11A 1VXOA 1Z4LA 3P9YA 2X0FA 3USZA 2EKQA 2K7FA 2HBZA 2WV9A 3O9ZA 4GX0A 3SZGA 1P9RA 2AOUB 3TZKA 3JQFC 3LP8A 5KB3A 5MFZA 3MUOA 4YXWA 4JODA 1BMFD 4YLYA 3HBNA 3CVUA 5I9TA 2FFRA 5LUAA 4QWWA 1DJMA 2JIMA 1NN0A 2PUJA 3EF0A 4C07A 1ZXXA 3AK4A 3H9CA 4DRZA 3MJTA 1IH8A 2OHGA 5DTEA 1C1DB 4AJNA 1JHQA 3BJZA 4H3SA 3K85A 1CC1S 3EDCA 1WD7A 4GRAA 2Y93A 3M1AA 4EWLA 4A8HA 1UKBA 3ZV7A 3J7AM 4GX1A 1Z82A 3RSOA 3OLWA 4JOBA 2FWJA 1M1NA 1WXFA 1L5VA 5LP6F 1U8TA 1J8DA 1CWUA 1KRXA 4L22A 3U9JA 4YCJA 5E6SA 3F6BX 3QVLA 4PVCA 4BC1A 3CVWA 3HE3A 3LRPA 1QPUA 1AT1A 3B7GA 4K9SA 2YZKA 1E2JA 2IS1A 3ETLA 1G38A 1U94A 2NM0A 1H8HD 2OAP1 1CUHA 4DXHA 3C62A 2IYFA 1USVA 4FT2A 1ESEA 3V00A 1P72A 4U4AA 1O97C 4U3BA 1VCMA 2JAPA 1E9EA 1E9CA 1W25A 1UFQA 1E85A 1A96A 1G19A 2H1SA 2R4QA 1PDOA 3MTJA 5AVSA 1G41A 2XSZD 1QVVA 1Q95A 5ALEA 2D7CA 2BYTA 2D7JA 3AETB 3TNLA 3USCS 4L5BA 1L7QA 3CYFA 2X1LA 2E18A 1KNXA 3I4FA 4PGHA 3SS8A 2YC4C 3AF6A 4RIGA 3T1HI 1ZGJA 4W8OA 4B81A 3HMKA 2A2CA 2FHPA 4PSVA 1P1FA 2EP7A 2DWPA 5KTYA 2XUFA 3QPVA 4NBWA 1Y7TA 2M9MA 3FPLA 1VDZA 2O5VA 2QPOA 3MTIA 5KVCA 1Y4DE 2FWAA 3H1EA 3LBYA 3BCSA 1DEXA 4I1IA 1U7TA 3CKMA 3H8JA 5AW7A 3TNYA 1M6VA 1BW9B 1U9JA 5AR1A 1M8JA 2ZVDA 3QKWA 1R8SA 1TAQA 1WSBA 2DFVA 2V5AA 2VBGA 5AK6A 2V3CC 3OAAD 3RVYA 2JLVA 5EAIA 3NYWA 5ALXA 5GV8A 2ZQ5A 3DYIA 4JK3A 4CDMA 5CLJA 1PR9A 1ZKDA 2G76A 5BOVA 1A4RA 4UVDA 2D0DA 3EGOA 1QIGA 3EXHC 2XUIA 3GWGA 4A0HA 1EDDA 4PLGA 3ZS9A 5BVGA 2I2AA 5G4KA 1P0MA 3GDHA 1ZLXA 3GLGE 2YASA 2OUKA 2VPXA 3KCNA 2Q62A 4F86A 4Q3NA 4M38A 5AFSA 2PZBA 1IY8A 5ALKA 3ZW8A 3BH0A 4J3JA 3HA2A 3PDCA 4O6NA 4IJ6A 1U6IA 4PICA 4UM9B 3MWJA 1IMOA 4O1MA 2EW8A 4UXJA 4EPRA 1CF2O 2W6JD 5H0IA 2EZ8A 4JIOA 2FN3A 2DE0X 4YLGA 5L51A 3UGJA 2JLWA 5JYEA 4XUGB 1LI4A 3HN6A 4KQ6A 2R1TA 2YJTD 4QTZA 2YOHA 1KEEB 3CMMA 5EP3A 5LLDA 4BWYA 4EFNA 1TYCA 2D0PB 1SR8A 1E5VA 1OILA 4XD2A 2HYIC 3GC6A 2EJBA 1QHNA 4ARCA 3Q9NA 1NU9C 5JEAB 3I8SA 3EZFA 4B43A 1RI2A 1T15A 3WYBA 3SR4A 3GCWA 1KIFA 1UEXC 1TRHA 2XDQA 2H7CA 3C45A 4L9SA 1RACA 3A1UA 1U9YA 4QYMA 5FL3A 1IZMA 1QH1A 3FVRA 5BR8B 1D0VA 2WWXA 3FJOA 4ISBA 3N2IA 1G6Q1 4RS3A 1C81A 1U8EA 5LJIA 3L6OO 3IT0A 4UJ5A 1D1TA 1ZOPA 2G7MC 4WY8A 2J5RA 2FUEA 1PLKA 4AWAA 4B7XA 4DIKA 2GK3A 1KYWA 1WVMA 1ZUWA 3GZJA 3Q8XB 4LX0A 1K6XA 4DPKA 5JYCA 2FR8A 2J9FB 4E7SA 2KB0A 4ABYA 1BEZA 1PZGA 4PFKA 3RVQA 1RMQA 2MYPA 2WF8A 4XYGA 1KY4A 1X9HA 9MHTA 4TKUA 4CDNA 1KMIY 3UXHA 3VDQA 3DO8A 3F73A 2C38A 3BRQA 2ZRDA 1E9FA 4MTOA 4HEHA 2Y6VA 3K8QA 5HQJA 5C0XE 1G6HA 4HNUA 3N0XA 5LQUA 3ORYA 3WZMA 4LY3A 4JT2A 5DYNA 2I15A 3TULA 1QWOA 1U8XX 5L0GA 1Y1PA 4LGVA 5BR8E 2VQSA 4ARIA 1SOVA 2JAHA 2RJOA 4XJXA 1PZFA 3QXGA 4WGFA 1QMPA 4KIWA 4CCYB 4EYEA 2HDNB 2HREA 2J5XA 2Q2OA 4BO3A 3MGCA 5CURA 3KQPA 1QQAA 3QZCA 1BX1A 5BQGA 2XVAA 5E9JA 1Z88A 4MWZA 4X63A 3L4BC 2QQ5A 1XHFA 2Q0XA 1DJNA 4P38A 5GMOA 2W70A 4EJ6A 1DMRA 4ENTA 3WLRA 2PRZA 3LBAA 5EMHA 4EEZA 2YQYA 2AN4A 3IBGA 3JY6A 5SY9A 3HYRA 3M89A 3HYCA 3FCSB 5G40A 4DRIB 1LWNA 1WPQA 3T54A 2P9ZA 3TDNA 5LBIA 1INLA 4CDYA 1KS2A 3DT6A 2CHEA 3KEQA 1CJBA 3WOHA 4D0GA 5C52B 3FNRA 5TLSA 1Z2CA 2FSVC 2C4MA 4O4HA 3O7MA 1IN5A 3HDJA 4AMVA 2LKCA 2GCOA 1P1KA 1F3OA 2IOQA 3HWSA 1E6MA 1DEKA 3RC9A 5FUWA 4JI1B 1XHKA 3NIGB 4DDVA 2GLTA 1VGRA 4GNRA 4EY8A 3TRKA 4BWVA 2AI1A 2ZVPX 4ND2A 4R40A 1YSCA 2K87A 3GAAA 3OPYA 4POOA 2ZI7A 1N5RA 3N3BC 4HDMB 4WKBA 5TF0A 2OHHA 3H4VA 4HMOA 4QI0A 4MUIA 5H3LA 3SXUB 2I9KA 4CS8C 1VB3A 4S1PA 1UG7A 4ZVVA 3JQFA 2CDQA 3CSSA 3DCJA 2R6HA 3VHQA 4DB4A 4PC1A 4IAQA 2A86A 4IBOA 1D9ZA 1XE3A 4K2AA 2M32A 5E8RA 3S2EA 4FI3C 1T6ZA 3OPNA 1Y8CA 4Q48A 3RJTA 5JXWA 4NS4A 1BXRB 4F4CA 3KSRA 4FW4A 3MT0A 3M6VA 3LHIA 4HLCA 4N7JA 2QE7A 5KTNA 4QQNA 3TIVA 4JI6E 1X19A 4BVBA 3ABIA 1URPA 4O4JA 4YP1A 2P75A 3UMSA 3TE6A 5L7YA 3KJFA 4RSGA 1D2AA 2D7DA 4ZQGA 5T6BA 4EX7A 3EFEA 5D92A 3IOEA 3QYAA 1WF6A 2IZ7A 1E4VA 4HQLA 4I55F 4DV4I 3L7NA 1BO6A 2EPNA 1V8PA 1N5LA 4OA5A 3R0IA 2CK3D 2HFIA 1V9LA 3BQ9A 5DMHA 1PUXA 1R8YA 3LLVA 1R4NA 4TYMA 1BWRA 3O92A 5J3JA 1L6RA 3OCWA 1GPBA 3RASA 3UAWA 2PIAA 2GF9A 2KJQA 2C7OA 4IIXA 5BSHA 1GDTA 3LVBA 1U2GC 5ITZB 4NYJR 4BNFA 4DIFA 4DV5I 1XA4A 3ZLTA 3PQ8A 1MRZA 2GAFA 2BA1D 2IODA 2XX3A 3MRXA 3PC8C 4NSNA 2DFPA 4NXNI 3RBAA 5EIXA 3FNBA 3RRZA 4QXQA 2PUDA 3NMIA 4KRGA 5GZ1A 2WB7A 5DOZA 1OYVA 1ATZA 1RYDA 1QV6A 1I2MA 2HMWA 2XWSA 3E1KA 3MOIA 1ORHA 1V3TA 3PCTA 3EMKA 3PDIA 4NYJQ 4MO9A 4O0MA 1AKVA 4CLXA 1F06A 1SUWA 4M88A 2QRKA 1UAYA 4JEIA 3EXG2 3E7PA 3FGPA 4ZQBA 1FYDA 2C2ZA 1LDBA 3ABSB 4DDMA 4NCNA 4JBXA 2F1RA 3AZPA 2VASA 4E22A 1U8FO 1TJ3A 1Z5VA 3IE2A 4UEWA 2CLDX 2VTBA 4OJNA 3L8GA 4HUJA 2XI4A 4GM0A 3T5GA 1KXJA 2QDXA 3TTSA 3CZRA 4KWIA 5LYJB 5CW1A 4N6NA 2VB6A 2GFHA 2H3EA 2O3ZA 2R7NA 1K3TA 2RHLA 2XBUA 3ILVA 4QDUA 3EZLA 5E95A 4E3WA 3EXEA 2RH4A 5K36C 4FMCB 4OX9B 4JNKA 4LWOA 3M6IA 4CM3A 4CT5A 4MTLA 1Y5YA 5TV2A 1WVIA 4RA6B 4MA0A 4M83A 5JUWA 5KTMA 4BCDA 1C29B 1WE2A 3KR1A 1DDGA 4JH0A 4LY0A 4RJ2A 4EATA 4JA0A 4C5BA 2LQGA 4MS1B 5C8YF 2P1AA 5T4BA 3H2IA 2R7XA 3C1UA 3D0QA 4MJ7A 3ESDA 1NUHA 4C2AA 1AHHA 1KI6A 5A2QA 3DFZA 4J8PA 1K27A 1MC4A 1EH5A 4JX9A 5E6UA 2MCFA 3HXOA 4HDRB 1M2EA 5EC8A 5B4UA 3L7DA 4M22A 2IDKA 1M5RA 5HKAA 1GA6A 3R8FA 1XRPA 3EW9A 4QBGB 3U7FB 2WPDA 3PPIA 2WQ6A 2AOVA 4Z4IA 4WUBA 3KVVA 4TV8B 1M33A 5EPUA 4W7IA 4LOIA 1J8MF 3U48A 2ZRAA 1F8XA 4R7ZA 3NVAA 5JCXA 8MHTA 2C78A 5DSZA 4CZ2A 1FX0B 4X66B 4CF5A 5BR7A 1FZTA 1I2AA 3ZWAA 4PGGA 5BN5B 2FSUA 3NG1A 1QYXA 4WJKB 1XZQA 1P31A 1NC3A 1YR9A 2WYIA 3G7NA 1DKLA 1ML3A 1YIOA 3WBFA 1O1YA 2HRCA 3A04A 5AOAA 2FK8A 2ODTX 4KITB 3HM9A 3K70C 2FPSA 3CRRA 3D81A 2XCRB 1VIMA 3HXKA 2V7PA 2ZM6I 4I1OA 4CM9A 4MR8B 3FMVA 1EP9A 2VJYA 1KR2A 1O6GA 1I5NA 2QPTA 4L7VA 1Y3BE 4TUYB 1KI3A 4NIMA 4UDXX 2A1IA 4HF7A 3U44A 4I5DA 3FYTA 2WAOA 4PZAA 5KDOA 1EINA 4RVSA 4RLQA 2AFHA 4Q9IA 1E2DA 2C5HA 2KM1A 4CR7A 3Q5GA 5B4TA 2H00A 1CB7A 3ROEA 1JG6A 3WKBA 4G4IA 1RQNA 3JYOA 4GBGA 4MLDA 4NARA 4QRDA 2D4HA 2OFFA 3VR5H 1WUKS 4N5LA 4DUGA 5AUPB 3T1HE 3KR9A 4W82A 3ZHYA 4ITVA 2XYRA 4HE8D 3GWLA 3LCMA 1T5HX 2WZCA 3PNBA 3TLGB 3K70D 1QU3A 4KE9A 2RGWA 3L8FA 4BBPA 3OZCA 5K8CA 2IZ5A 1NVDA 3S0XA 2G82A 2O3QA 2J9ZB 4CE6A 1LBTA 3GFOA 5AJVB 3MBIA 3DT8A 1PU2A 4ZRDA 3THYA 3DQZA 2BHSA 3GVCA 1NXOA 3AJAA 4C3OB 5AXAA 2QT1A 1TWGA 2AWYA 3IDFA 4BFSA 2PXCA 2YEVA 1Z0WA 3D4IA 1B3BA 3PI7A 4KN5A 4YASA 4YAIA 3LPNA 5JSLA 2JPDA 1J7JA 3TTXA 1Y80A 3UV7A 3DWWA 4NCBA 4EYKA 3QFRA 1E7YA 3BORA 3MUEA 2WHQA 4MR8A 2RCYA 1WBDA 2JFXA 4GE0A 3O1LA 5AI6A 2ZJ2A 2UYCA 1VFNA 1U2DC 1X7YA 4HQ0A 4ERNA 2O48X 1RPZA 1DV1A 1B8VA 4D25A 5HE8A 2FPXA 1J2EA 1ECPA 1DBPA 3RK4A 2QRLA 3BBLA 5IDVA 5GJVC 1TR2A 2NXNA 2L69A 4MQ5A 4DUYE 2QZSA 1AY0A 4BUZA 4B34A 1CS0B 3NB0A 5LNK6 5AKLA 3OJCA 2O3SA 2AV6A 4ZPJA 4E5MA 1C50A 2J1LA 3NALA 4FFWA 4HWSA 3S7TA 1T6QA 3VAZA 4DR5E 4LWPA 1DKNA 3RAPR 2FEMA 2H2HA 1X3SA 3ZX5A 5KNCH 3PD7A 4BJHB 3TLAA 1GPNA 1MO2A 1KIMA 1I4OA 1JT2A 2NN3C 3DUFA 4HJRA 3QU9A 3ZHBA 1VG0B 1NYQA 2DKNA 3N1UA 4H1UA 4LQ4A 5PGMA 5LMCA 1E8DA 2G0AA 3HS3A 1WBBA 2JFWA 3URKA 3L1IA 3OF3A 4H27A 1WKBA 3NKVA 2PMWB 2C7BA 1YZ3A 4PZLA 4TWBA 4BZQA 4JLWA 2ZVQX 2JC3A 3OWXA 4AJHA 1JG4A 1SBQA 2GESA 5IM5A 2J6BA 1SQ5A 1YBVA 5NLLA 4P80A 3PQDA 3RPEA 4F93B 4CJOA 1RWWA 4ZI3A 4FT4A 4C6RA 2JVKA 2I1LA 3C4JA 4BIMA 3L6EA 3C3JA 4C6TA 3KYDA 4PE5B 2YOGA 1VK5A 3G2OA 1KDRA 5ADUS 1FFBA 1WPRA 1H2RS 3JZMA 4MI1A 2AN5A 4QAQA 4D80A 4ZVUA 1EUZA 2IOHA 1Y3FE 2PRYA 3DOOA 4IXTA 1GCIA 4N40A 1KJNA 1T26A 3RSQA 1UJ2A 1JA0A 3FTCA 2ZB4A 1Z3IX 3WAKA 1MFPA 1G5FA 2D1RA 2YWEA 5FAXA 1JKJA 1IBMB 1UKCA 1OZ0A 2CT8A 3VR6H 4IFDB 5C0XA 3OTOI 1QQ5A 2IZOA 4ILKA 1ZSYA 1B00A 2YL7A 5M04A 2IUYA 4N6HA 3BWVA 1XDZA 4NTFA 1J20A 4ZLDA 3DPIA 4WE3A 1Y4CA 3TMYA 4B6QA 1F2UB 2OZLB 5DBFA 3AQCA 4ZT3A 1BR4A 3JARB 5BWBA 1T5LA 3DE1X 2ENWA 4PZEA 3ROFA 1F6DA 4HKTA 3QP9A 4YRTA 2B4QA 4QOIA 5SZHB 3VNSA 1IBKB 1VI6A 2HF7A 2BMFA 3JAKA 4LNAA 3T9BA 3ZBQA 5JCPA 3FI9A 4IV0A 3KDPA 5ITSA 1NU8A 5E7IA 2R6GA 1C1YA 1P5RA 3TLCA 4F2PA 5CITA 3H11A 1KYXA 3JR7A 2BD0A 2GZ3A 3RJMA 1CJKC 4M9XA 1J0EA 2RI0A 5J4YA 1KHHA 2ZE5A 4GYJA 1I8TA 2CL0X 1E3LA 1T36B 1UPTA 2IZ6A 3WLEA 5COFA 1Z29A 1JIKA 1IB0A 3PVZA 4IO0A 5EINA 4OX9Y 1C4WA 1EFUA 3LDUA 4RKWA 5FZTA 1RVV1 3ZLVA 1KA9H 3QEAZ 4E1AA 1P39A 4AIMA 4XIGS 1I94B 2HWYA 3FG9A 5AUQA 2GM5A 1QNLA 1KC1A 3KYCA 4P4GA 5BSEA 3BRWD 4LRXA 1CEQA 1D0ZA 5B5SA 1WUYA 2CLOB 4C0SA 4QUIA 3KUXA 3HP1A 1CUAA 3GFGA 4MQ9F 2JFVA 4HGRA 5AT1A 3FPAA 1FWLA 3R76A 4CV0A 4EKGA 1SIWA 1JEQA 1ONSA 3T0GA 2D6FA 2X2PA 4L0QA 2UXCB 1TW2A 3KAKA 2XCLA 1S9HA 4TMYA 3O73A 3PDHA 4DTCA 1IG3A 5JZVA 1S3SA 1RD4A 4Z8XA 1HO3A 3O10A 2UUCI 4UU1A 3SYRA 2IW3A 1XN1A 3FAZA 3C6BA 5KAMA 1L3BA 1XTPA 3CF6R 1T0BA 4IOKA 3HO6A 2J9XB 3FYSA 1MO3A 3LHKA 4N9WA 2G62A 5ECWA 3NBXX 4XVUA 1KO1A 3NORA 4I4TA 4EMTA 4JASB 3DFMA 3T9EA 4U2GA 4U5HA 1DRVA 5LN1A 1XVIA 1HDZA 2PF4E 3NH6A 3EWAA 3MYIA 4AM3A 1A7AA 1NM5A 1XMQI 3PYDA 3U9MA 2Z58A 5DF1A 1WW8A 2O19A 4K6KA 4M1SA 5JJBA 1K63A 5BOSA 3ZKWA 4II7A 2EZ4A 1K8ZB 5BQOA 2GCEA 1CETA 2VTEA 4B6RA 1LTHR 2VBFA 5H8WA 3UBMA 4DLBA 1E59A 2ZR7A 1YB1A 4AZ3B 1XNQE 2LP4A 3PEEA 4QEKA 4WXHA 4DCVA 3EQLF 2X5OA 3I83A 2Q4FA 2OLKA 1HNNA 2XNKA 3IR6A 4NEGA 2XECA 4F5ZA 4L5YA 1ORYA 5EE5B 2VG8A 1FYXA 4MPJA 5FB3A 3CIFA 4HAIA 4R9VA 4DL9A 1W2WA 4WASA 2XL8A 4G78A 1IEWA 3WL6A 2CYBA 3E5MA 1XQVA 3K1IA 2IOPA 3CG0A 2ZAIA 3M2TA 4FOSA 1VJDA 3GUCA 4BIIA 3C48A 1SVUA 1P3JA 2RCNA 3NWOA 2BFNA 3K32A 5KYYA 5KYGA 1AU9A 4PG4A 5KCZA 2WSLA 1E96A 4IHJA 2B25A 4MEJA 5JVDA 1JR3D 4IJVA 3R6TA 3FXHA 1ZD9A 2NVOA 4O3FA 3M5CA 2EBUA 1ZW1A 1Y37A 2NQ8A 1KTIA 4N49A 3HLZA 4HACB 3IULA 2E5LE 3ND6A 4RMGA 2AN9A 2DUWA 1Q21A 4HD8A 1PGJA 5IMBA 2YRWA 4P34A 2VSQA 5F1PA 4IUCS 1JBQA 4MYSA 5HSGA 1V74B 5I5GA 3PQ5A 4O8CA 4E2YA 2HMYB 1LSSA 3F7OA 3T7EA 4QI2A 4MVJE 5DLDA 2RHHA 1CTQA 3DDOA 2JGKA 1L7EA 1FIUA 2J9RA 4QUGA 2P7IA 4H16A 3TRHA 1O0CA 1NMYA 3U3FA 3LP5A 2VJAA 5F3WB 5A5GA 3ECSA 2JDID 3C85A 3F8SA 5ARDA 5K3FA <