3HJCA

Crystal structure of the carboxy-terminal domain of hsp90 from leishmania major, lmjf33.0312
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
405
structure length
387
Chain Sequence
HKPLWTRDPKDVTKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFPNKKRNNIKLYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPENLQQNKILKVIRKNIVKKCLEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLKDYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDFEDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLSTSPCILVTSEFGWSAHMEQIMRNQQYMMSKKTMELNPRHPIIKELRRRVGADNDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heat shock protein 83-1
publication title Crystal Structure of the middle and carboxy-terminal domain of HSP90 from Leishmania major, LMJF33.0312
rcsb
source organism Leishmania major
molecule tags Chaperone
total genus 130
structure length 387
sequence length 405
ec nomenclature
pdb deposition date 2009-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3hjcA03
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3hjcA01
3.40.50.12450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hjcA02
1USUA 1HK7A 1SF8A 3PRYA 5FWKA 1Y4UA 1Y6ZA 1USVA 1Y4SA 2O1VA 3Q6MA 3HJCA 2CGEA 2O1UA 3Q6NA 2IOPA 2IOQA 2O1TA 2CG9A 2GQ0A 2O1WA
chains in the Genus database with same CATH superfamily
1CZOA 1GU7A 2I66A 1Z0IA 2L0XA 3NOOA 3WGHA 1QIEA 5K8TA 4NULA 1P5JA 1SU4A 5G4KA 2FAPB 1C8LA 1FYFA 4EGJA 1NIPA 4O79A 1H4QA 5JZSA 1FTNA 4O33A 1RC1A 2GO7A 3DOCA 4HS9A 3H5TA 1UFKA 2AFHA 1KZ7B 4AJ1A 5IULC 3C7AA 1A5BB 2FR8C 1VTKA 1RM4A 3Q9SA 4PIVA 4C4RA 3S44A 3UAGA 4H18A 5DMHA 3WLIA 3DB1A 3ZU4A 2H5JA 1J25A 3G50A 3UWOA 4KR7A 3DMGA 4N82A 3N2ZB 5G3YA 4Q4HB 4GQHA 2NU9B 3VR4D 2AZMA 3NEYA 4ICIA 4BX8A 3QOWA 1SUPA 3RAGA 3AG2C 3LW8A 3ROEA 3WWEA 2DKFA 1CGME 3LP5A 3NDJA 1UKEA 3J7AM 5E8JA 1Q1ZA 1CUVA 3ZD7A 3E35A 1Z47A 1K7XB 1M2VA 1BDHA 5JQWA 2C1EA 4LY3A 5KYUB 3THWA 2YR0A 5HEKA 1CF4A 2D5RB 2P2GA 2R02A 1A9PA 2ZCUA 1P0MA 4MCHA 3QK7A 1MX0A 3GJXC 1Y0BA 4H6WA 3QJ5A 3A7DA 4FMDF 1JDSA 1RYMA 2WTEA 4ZQEA 3HCCA 1JPJA 1XZ8A 5DHTA 4RD2A 3DVQX 4NX2A 1PIEA 2VK4A 2JAUA 1FRZA 2YHIB 2E1PA 2CLCX 1ZOLA 2GXAA 3JQAB 4U9UA 2JH3A 2ZTMA 2V03A 3OX3A 5E7QA 2IZZA 2HF2A 1CUUA 2WU8A 4X0RA 2XCSB 3P8ZA 1I0IA 2YZGA 3RNLA 4NZNA 4G2TA 4GUDA 2YC4C 1RYNA 4QVGA 3EHMA 3UMVA 3DD1A 4QA9A 1XDSA 3DMYA 3FFXA 4PAQA 1RJ9A 4M1SA 1AO0A 4HNAA 3IP1A 2R4TA 5JEAD 3S1SA 4M6WB 4RTPA 1UK7A 4ND8A 2PGLA 3NGXA 2VDOB 3T4PA 4ZDJA 2X8BA 3D31A 4IF4A 4O6NA 3AW9A 4X1KA 2HK9A 3TLBA 3FFBA 1IM2A 1NKTA 2QTAA 3AUUA 3D6TB 1ZOIA 3T5AA 1Y8QB 4KAXA 4B45A 2PD3A 3LW7A 1BZYA 4DRZA 5EJ4A 5FWYA 3IEIA 2JAQA 4PLWA 2DRIA 4NTZA 1NNEA 3CSKA 3DE0X 3ZDAA 4C7XA 4P33A 2DBQA 4CM8B 1SHJA 4DS3A 3E9YA 1N9KA 1PFWA 4A6PA 3Q3VA 2PGDA 4OHWA 1JHRA 4R83A 2I1LA 1EVJA 2EP7A 2LRHA 4WEOA 1RFLA 1QYCA 2ZVQX 3FIUA 3CFYA 2R00A 2ON6A 3W4JA 3K1IC 3L6OO 621PA 4ZK2A 3B53X 3G59A 4ED4A 2W9XA 4G65A 3FG9A 3EVEA 1HE5A 1TZ2A 3UV6A 1VL2A 3SD7A 3NTUA 4LQCA 3TPFA 2FNAA 5DNLA 1IWPB 3FNEA 1OW3B 1XCLA 3B1YA 1KQPA 3W5JA 3D4PA 5CA1F 1TZCA 2ZJZA 3ORHA 2FWAA 5FNVA 3Q6IA 3DE4X 4UUMA 3QX3A 1JG7A 3FHCB 4IHQA 4MVCA 4OQEA 1PD1A 3HJTA 2PP4A 4RMGA 1AZWA 1J06A 1KVKA 1FNCA 3D5QA 1G59A 1OJLA 3DMFA 2ZBKB 3CVVA 2DR3A 2NSFA 2I4OA 4AZVA 3MCUA 3W05A 2R25B 3L5KA 3MHTA 2W37A 4BJHB 1U0RA 1DJMA 4K9QA 2JBWA 4JBYA 1MORA 2R6CA 3R7LA 1YB4A 2F1KA 1Z5WA 2VCBA 1W88A 5LC1A 3I1FA 3LKVA 5HF8A 2J5QA 5IVKA 2P40A 1N77A 3KH2A 3GJTA 1X87A 3P9SA 4HEA6 2LP4Y 2PNZA 1K40A 1T5SA 4OX9Y 4LYAA 4BVBA 1ZD5A 1VKRA 3D6HA 3UGQA 1EXVA 3D5EA 4J29A 3IJRA 2HV8A 3KU4A 3DAOA 2QLLA 5B12A 2WMDA 3EAFA 4F04A 2GPTA 2FW7A 3AHJA 2XAUA 3S68A 1Y33E 3WHKA 5AVVA 2J67A 4GI2A 4M8LA 4HFRA 3PUWA 1L7MA 1HDYA 3BSFA 4ZO9A 4C76A 1XTQA 2DFLA 2KPOA 1PD0A 3EN0A 1N34B 1LEHA 1V16B 4URZR 3EPLA 4A8PA 5JTTA 4NWIA 1ZD8A 4L2IA 3PI7A 3IB6A 1SB9A 1I10A 3TL3A 5EPUA 3GBPA 3PHHA 3DB2A 2FZKA 2GOYA 4B32A 2C5BA 1XEXB 5U9CA 3QIVA 3AC0A 5CJPA 5IAOA 3HADA 1K7CA 2ZSHA 2JRLA 1IEWA 5JY1A 3T41A 2I7XA 2WKSA 4ISBA 4LF9E 3K9WA 3DZ8A 2EP8A 4H0CA 4LF4E 3NALA 5CAEA 1PUXA 4KVFA 1G1MA 4ZT7A 1LSUA 4MV7A 1TRHA 3LUGA 2Y1CA 5HRAA 3V4OA 1B0PA 3B78A 3A1VA 4HYYA 1V5GA 5C8YB 1Y98A 1G3UA 2IYTA 3PNYA 4ZMBA 2N46A 5B3LA 1D0YA 4LLCA 3VSEA 2BL4A 3G23A 3RC2A 4KC0A 2ZBPA 3PC3A 4WXYB 5DO9A 4LDQA 2YN0A 5KNLA 4L4UA 4IQ0A 4OAQA 3BJIC 3TE7A 2GXSA 4LYDA 3HI6A 2QW1A 4OXQA 2EARA 4ARVA 4N01A 3A6GA 3CKMA 1E6CA 4FFBA 3P9RA 1F4PA 4EG0A 3NYIA 4YCLA 4KVGA 4LVCA 5DGIA 1I4TD 3GRCA 5JFTA 3PGMA 4DV2B 2IXOA 4DC9A 3VDQA 4JJ6A 2Y05A 4MW1A 4RVCA 3LUFA 2GK3A 5FORA 3HU3A 5H16A 4X71A 4E5UA 5LR6A 4A03A 4HFFB 1VRVA 4DV2I 3UB3A 4DXDA 2XGMA 1MXFA 5F7OA 1QH9A 4X3CA 2L17A 3AEXA 2ZRPA 1NBEA 3H86A 1J09A 3OQ1A 3E3NA 3OUTA 2YHBA 2WTNA 3GAZA 5D51S 3SVZA 1EFCA 4EARA 2QRHA 3Q88A 3LXMA 1XXLA 3FNFA 2IIQA 3FPCA 3M6FA 4LI0A 3HBLA 2A86A 2C57A 1JDZA 2IESA 3VHQA 1QU2A 4N5LA 2ZUBA 5ECWA 4DG9A 1IQ0A 1HXHA 2FX5A 4IW3B 1A4IA 1E9DA 4DLYA 3KLPX 3VYWA 1HSOA 1G1AA 2UUPA 3LT2A 1P31A 2QMYA 4WX2B 2LIVA 4W4TA 7MHTA 1I7LA 3FHDA 2BFBA 1TEZA 1WRBA 5THXA 4JLUA 4BKQA 3O92A 4HI0E 4U5EE 3K70B 2VDQB 4G5SA 5DS4A 2PT9A 4OQDA 1UEIA 4J4TA 2FK7A 2GCGA 4FSXA 5FYDA 4MWBA 1MX5A 1B8UA 1GKKA 2DJIA 2F43A 1TC1A 3HGTA 3BWYA 3FYCA 3RCBA 2OKGA 1F8GA 1M1UA 3KSUA 3NEJA 3C1OA 1F38A 4HX2A 3TDKA 4BKRA 2AQHA 4IHJB 5DKFA 3GLGE 2PZKA 2PSDA 1XB2A 2DHCA 4URHA 4B71A 4MW3A 2PD4A 3ZH2A 1DBRA 4E08A 1ELOA 1GN9A 2NO4A 4MMXB 4D3ZA 1LRJA 4FINA 3UXYA 5F73A 1G7SA 2B82A 5B3IA 3VKGA 2LQGA 1EZZA 1KVQA 3DEFA 5JPDA 4BA2B 3HGMA 3H3JA 4B0PA 2ASEA 4IZKB 4KGXA 4YRLA 1A9SA 3ZKAA 4AW9A 3A32A 4IGAA 1W76A 4XTKA 1JFLA 1QKIA 1TAUA 4HYQA 1ZC4A 2J09A 2RD2A 5I45A 3K7EA 5F1YA 2VBFA 3DEIA 4BJ5C 1OH8A 2O8EA 5COMA 1XN4A 3BMQB 4W9MC 2HU7A 4R9SA 1YU6A 4R8RA 5AKIA 3Q7SA 1DOVA 3DOOA 2V4MA 4RJJA 3X2EA 3ZE2B 3PL1A 4PQRA 1UDQA 3HXKA 4D74A 1DO8A 1TQ8A 4UUPA 1RLIA 2QAGC 4GDFA 1I2BA 4B6SA 3WLMA 4CG1A 2OOKA 2YWBA 1C7RA 1GS9A 1W47A 5CH8A 1SVMA 2ECKA 3U3BA 2OCCC 2FDRA 1C1YA 2CN1A 2DQZA 2A1TS 4FR0A 3AHIA 2YV2A 4IZHA 3S28A 3D0OA 1VKOA 4P36A 5H8WA 1REQA 2D3TA 1KDRA 3PC8C 3P2OA 1KDYA 3SVLA 2G40A 5T6BA 1LPEA 4KO3S 1MB0A 1Y4CA 1YF3A 4ZCLA 3CXUA 3DULA 3DWEX 1J8QA 2VTBA 1V7CA 4CLOB 1P1IA 2JPUA 1JVBA 2ZYVX 3TG2A 4I0WB 2X77A 2DYKA 3N2NA 5JDIC 3B1JA 3CY6A 1GDHA 2NZXA 5EJGA 4LOAA 4PCUA 4ZICA 2ZRJA 2NIPA 4F60A 1GAWA 2E3JA 2RGCA 4NTFA 3EGEA 3RVQA 4TOIA 4DG5A 3J80Q 3DVRX 2PRKA 3VAYA 1JDJA 2HI0A 4DCTA 3EARA 1J0XO 4JLSA 2VT6A 1F2TB 2KYHA 3ELUA 4GXNA 4Y18A 2JFZA 1JEYB 2EZUA 4G9GA 4QQNA 1EVLA 4JEMA 4AK9A 1W30A 4EX7A 1D1SA 1E2XA 3RAEC 4TM7A 3A8TA 3FKJA 3QTBA 4H7JA 3QX9A 1BS2A 2G77B 4RS3A 1ULSA 3PLRA 1XR3A 1YR7A 2PGJA 3B7GA 1N4DA 2ZRQA 3V7UA 1TCAA 1BA3A 5H4GA 3HVJA 2M6RA 5KZMB 1KKLA 5BT9A 4D97A 4P0TA 1Y3DE 5D5QA 1VPTA 3H16A 4F91B 3ANLA 4HZUA 4NU0A 5BUZA 1OVGA 5AVQA 2GT1A 2XIJA 5KOYA 1Y81A 4K8RB 5F33A 2VF3A 1RP7A 3SZ3A 1SCIA 1JU4A 2GD2A 4TWIA 1UMKA 4B6RA 4QRHA 3NDRA 4LJRA 2CYCA 3MJEA 3UZUA 2FH5B 4W5RA 1NN1A 1W6UA 3OT1B 1U0FA 4R9RA 4BZXA 1XVAA 5KSZA 2FW0A 4DDKA 3U5TA 2I4RA 1QG4A 1P4SA 1KMHB 3S8EA 1ZXMA 2PWZA 2PX8A 4WCFC 1XZDA 1K88A 3KZXA 4DRIB 3P4YA 1TGYA 3E2IA 2Q07A 2PXCA 1P44A 2IY9A 5IP5A 3HUTA 3TGPA 5K0ZA 2X8WA 1ST3A 3GLHA 1CDOA 2FRVA 4F5WA 5JD5A 5CI9A 2GA0A 5EG5A 4WT7A 3TNDA 1C03A 5KWSA 3V1YA 4US2R 3N2GB 2ZE5A 2YVAA 1JKJA 2H85A 4MR8B 3TFOA 3FXHA 1PKPA 2EL9A 3N8KA 1GRQA 4QFCA 1H0HA 1S4MA 2QD4A 4DJEC 1UBFA 4UBKA 3A6ZA 1U3VA 3U4DA 1EFKA 4IEFB 4KZKA 1W0KA 1CY1A 3CISA 1KO8A 2ZB8A 3QT7A 4YPVA 3DEYX 4QBFA 5B7GA 3K9NA 3HB0A 3PDWA 1PKXA 2GQ0A 4YCDA 3QTHA 1R6XA 4PFPA 3SJ7A 1XZCA 3DZCA 3GOQA 3QXHA 3ZHSA 2CNNA 4E4YA 3SYKA 3GFBA 1IQRA 5JS6A 1R0RE 4EM6A 4LDZA 3H84A 5FFNA 4C7KA 2AFHB 2JJ1D 3ELWA 3V1KA 4P1ZA 2PHZA 1OBFO 1YACA 2AOVA 2APJA 3PDCA 3H0KA 4H77A 5TJHA 4IEEA 1XDGA 3OIWA 1TTQB 2PKRA 4BJ6C 2Y3IA 4X00A 2RGNC 1U2QA 2X0FA 2BRUC 2ZR7A 1IZMA 5G1OA 4H6XA 4DPMA 3PT5A 5IMBA 5IUJC 3M34A 1NKVA 2VYNA 2NU7A 5EZYA 5AO9A 4HR7A 1HKUA 2GEJA 4BFCA 3OHSX 1M2VB 2MT9A 3SR4A 5JYBA 3THWB 1E9CA 1IG0A 3V4SA 1T3HA 2V6MA 1MENA 1VFNA 3N6VA 1W4ZA 1KP3A 4W8OA 4XFKA 2ZI6A 4HNUA 4JI0I 1HG1A 4KXYA 3IIJA 3UV3A 1U3TA 3FTNA 2Q2WA 1ZJ5A 4RW0A 1XXEA 1WXGA 2HMAA 1RI4A 4X6YA 3U9JA 4Z7OB 3JYYA 2X0RA 3JQEA 3ACBA 2JIPA 1H65A 1M1YE 2BHTA 1GZ6A 1VM6A 4IFTA 2F1JA 3RT1A 4Y9RA 1EFDN 1C3VA 5E95A 4DSOA 3B6MA 2Z8YM 4RIIA 2AE2A 2JT2A 2AG5A 3HGQA 4K40A 1U2RA 1I14A 3FFTA 3KLMX 2AWNA 1L5KA 3K6SA 2H7VA 3F2VA 1IH8A 2CJYA 4R51A 3AJDA 2NXWA 1T9KA 2GJSA 4LDKA 4O2BF 4J4BA 2A1UA 2AOXA 3I01A 1QCYA 4L6CA 2PV0A 5BY2A 1TIKA 1I7SB 4X1KB 4GVPA 3ANYB 4DKJA 3FRHA 2H4YA 2TMYA 1QGED 4Y2VA 1L7XA 2QL6A 4YROA 4AQDA 5I4BA 2F22A 3OLCX 4QD3A 1Y5YA 3LQKA 4XJSA 4FT2A 4EQ6A 5JAMA 3FF4A 5IJZA 4JI8E 2VP5A 4ZOLA 2IITA 3L1IA 4F1WA 4U7DA 4X8MA 4RPGA 3MLEA 5GADl 5BNZA 3F98A 4OHFA 5C1OA 3KSAC 3GAMA 1B6RA 3OLWA 4KXWA 3U1YA 2YIDA 3R9XA 2I6TA 1ZN7A 3HDTA 5C0OE 3QBEA 5ES3A 2J5KA 1KO7A 3ZU5A 3GGPA 3AQBA 4BPRA 1GRNA 3DSRA 4MI9A 2V7EA 1D9XA 1HA3A 3BE8A 3F8TA 4Z9XA 1X0VA 2P7IA 1KEEA 1SMYF 2Q8QA 3TW0A 2AEFA 4WZAE 2QE7A 4YFVA 2ODBA 3B2NA 2J3QA 5LP6B 4NCKA 5TARA 4CLHA 3QVXA 3QV2A 4HF7A 2B8EA 2O0KA 5J9FA 1F0KA 4QPCA 5H7XA 2CV2A 5JQGB 5FNVB 2W2MA 1EMDA 4R8MA 4B6GA 4QUIA 1VSTA 2ENUA 4I6JA 4BVKA 1T9DA 1E2FA 3Q2IA 1FEZA 4HV4A 2O2ZA 3ZI4A 4I1RA 3WKAA 1SD1A 1U1IA 2HCFA 4XWOA 3CNEA 4FONA 2A9KA 3ODGA 5DMXA 3HPQA 4QGBA 3DLBA 2DSNA 2HSGA 4DMMA 5B6PA 5GOTA 5T5QA 1RMVA 1SCDA 4FPXA 5FBKA 1KI4A 3TBKA 5A5GA 1CR4A 1M66A 4M1MA 1WMSA 5AW5A 4AX8A 2CL0X 2PNZB 2W83A 4E5NA 2I33A 4BEMJ 1PGQA 2P2LA 4LXYA 1LSOA 4QXAA 5KYUA 1E5TA 5JP7A 3SHVA 2GAFA 2VHEA 3OPMA 1UWLA 3UMGA 1YZGA 2WIAA 5ILQA 3DA8A 4AF8A 5TR9A 2KWIA 2HWYA 1Z06A 1FWKA 2C88A 3CNBA 3E84A 4KJXA 5LJLA 5HK8A 2YWDA 4LEIA 1GZVA 2Y1KA 1R8QA 4CDNA 2QGZA 1L5GB 4D9NA 1Y5NA 1U2DA 2OQ2A 3T54A 2P5YA 4RVHA 4FGSA 3LUJA 4OI0A 5DBHX 2TS1A 3X2SA 2YVKA 3AWIA 2Y1OA 4RKQA 1KOJA 4OOFA 4EBFA 4AM8A 1Y6GA 5MN5A 3ITNA 3IYLW 2Z58A 4L2IB 1QFSA 4WEQA 3LQQA 1H0KA 3GEMA 1DIBA 2Z3VA 5EWLA 3CW9A 3WA6A 4AKHA 3AF6A 2CHGA 3B2QA 4AKGA 3WIOA 4M6WA 1FU4A 4BO5A 4OUDA 4JP1A 3DMNA 4G0UA 2OP0A 4A2WA 2DXIA 1QYVA 2BZ0A 1XZFA 5CAEB 2RGWA 1GYRA 2GILA 5KX5F 4HGNA 1HO3A 2CXTA 3M70A 1VSUA 5ALEA 3I8SA 3OZXA 2X3FA 2G9UA 1XZMA 4FMCF 1U7WA 1AKUA 1ZM7A 3L4BC 1OU0A 2PU5A 3AL0C 3F3YA 4KIWA 3O1HB 4DIKA 1CKEA 1THMA 1TTPB 3J06A 4AWXA 2Z15A 3FCSB 2C3YA 4CM8A 4FFBB 2OUKA 2VSNA 1E3WA 2VOEA 1HEIA 3KPWA 4DWOA 1FA9A 2ZREA 5H9VA 3P97A 3IEVA 2FQQA 3EXFA 3DO8A 3KSMA 2WFZA 1WD7A 3BGSA 2GPJA 2GMWA 5JANA 1P61B 3LIIA 4IGIA 3W79A 1FTSA 4GPBA 1ETHA 2DTDA 1APCA 1ZZPA 3EGOA 3EF1A 2CJWA 5I7VA 2F9FA 3ND5A 1SO8A 4P34A 1W34A 4RYDA 5DM0A 4PN3A 5FJJA 1ZM3A 4JKIA 4LAFA 4IOLA 5ESXA 4JMLA 1MAAA 2HBZA 4KRXA 2FKAA 4BBZA 2XL4A 1P5FA 3CNLA 5TGZA 3H7IA 1UKBA 1R0YA 4G9EA 4BNIA 3SXPA 1UBSB 4JC0A 4HDNA 3GJZA 2XBMA 4JG4A 3CH6A 3QFFA 1IPFA 5FOUA 2R25A 4X92A 3PICA 2ZE7A 4Z51A 3E3LA 3SFZA 2XDYA 3K4PA 5FT9A 5KYXA 2MYUA 5KVSA 1A9YA 2BFBB 3WISA 5BWLA 5JROA 4QAJA 4L8LA 5LMZA 2P6OA 2QRUA 4DIBA 3RC1A 2B5VA 4HLUA 4L16A 1ESNA 2R84A 1T43A 2RGUA 2BEKA 5EZSA 2ZU0C 2F43B 5IC4A 3RRFA 2OSVA 2ATEA 1MFPA 2AV6A 4K6FA 5DS6A 4BTVA 3ZDXB 4EFNA 4PGAA 3ZWQA 3HB5X 4HGPA 5TB5A 3O3OB 3ZDZB 3BE5A 4LXTA 2QLFA 3B3AA 1VSVA 2E4XA 3W90A 4EAQA 1ZD1A 4EHAA 1RXVA 4JBIA 1JDBC 1OAAA 2GFHA 4JQSA 2XLWA 5KS2A 1H0SA 3AETA 1C0PA 4LYGA 1OCEA 2HUNA 2CLOB 1MRNA 3W3ZB 4EMUA 3IBCA 3M3HA 3NT2A 4QOSA 3T1HB 4I9NA 4QUGA 1XQXA 1UT5A 2FXVA 2HXYA 3L34A 3P5BA 3ENQA 2W2PA 2EG5A 1TWCA 5A6AA 3L7CA 3WLNA 5INTA 3T1HI 1YQEA 3ZTMA 1UC8A 2QRNA 3EEOA 4GMGA 2DWCA 3DOEA 4EAAA 3X44A 3UR3C 1RJEA 5BVGA 4ZHQA 3CRQA 3T6GB 5A6KA 3U7GA 1B3RA 1DJPA 1BJRE 4ZZ1A 1TM4E 5AXAA 4HQLA 4FNMA 1EVKA 1LS4A 4BGUA 2VF7A 3H42B 5JEDA 4A10A 4OD4A 3QEJA 1REQB 2Z56A 2QD2A 4HC4A 4IZIA 4BGDA 4ZDKA 5CM8B 5AI0A 2QUBA 1JDPA 2V2VA 3OFND 2SHKA 1O95C 1NLFA 3QH4A 3QVLA 3L7DA 4YA6A 3GANA 2E85A 2VTBB 2BIFA 2WJIA 4IOJA 3QEBZ 3PQCA 4IIJF 3IP8A 3M2PA 1KZ6A 4RESA 3K85A 4Y7DA 2QGFA 2PR7A 3TM4A 3VU0A 1E66A 3KZCA 2AFIE 1MOPA 5AW2A 5HS6A 1UK8A 5TMPA 3M4ZA 5DBOA 1GY8A 1R0WA 4OJKA 1V26A 4TVBA 2D8AA 5FOVA 3OZGA 5GP1A 4M1OA 3J80C 4ND3A 4XTRA 3GT7A 4Y2HA 1QTQA 3DFMA 3OZRA 1W4LA 2E7ZA 1KR2A 2UUIA 2QTCA 5EE0A 3DOHA 4CFZA 1A2KC 4RENA 5JRAA 3NTVA 4OQFA 3I5MA 4RCVA 1QGOA 4XJXA 3SX2A 1Q12A 2QTNA 1CDDA 4MW9A 4S12A 1E6UA 3PRJA 5SYAA 2BISA 1DARA 5BSFA 3GVXA 4D26A 2R8BA 4MB0A 4W9RA 3FOCA 4KE8A 2D6FA 1P5HA 2IS2A 4JLNA 4DR2E 2JLRA 1SBCA 2RH9B 3ZE1B 1DBVO 1ZXLA 2ZYRA 1QO9A 4AU1A 1C3EA 1W36C 1JF8A 1GO2A 5A5VA 1RP1A 3L05A 4EZBA 2I8AA 1TD9A 2II6A 4X95A 4B3JA 3RASA 4KXQA 3R5FA 4UTGA 1OYSA 3KOOA 3GUUA 1JSZA 1YZHA 2FZGA 1ZSNA 2EBUA 3A0UA 2D2IA 1I33A 1U3WA 3VH3A 4LOIA 1TQDA 1PLLA 3C4VA 3E9VA 5DN6A 3F8WA 1BGWA 4CR8A 1MA3A 2GR9A 4BA2A 3OF5A 1W1UA 5E1BA 4KO8A 5JUAA 3E4DA 3JQCA 1PQYA 2QQEA 2EW2A 3CRW1 4OH1A 1NFOA 2ET6A 2RC5A 2RSEB 3KS9A 5BUOA 2UVDA 2Z04A 2ZJ4A 3O39A 3GLHB 3X1KA 1LPMA 2FA9A 4QELA 1E59A 3PQ2A 5IFLA 3N3BC 4QXOA 3AUYA 1UPBA 2OFXA 3EVDA 5KTOA 4A6DA 8OHMA 3E8MA 2BGIA 4AXBA 1OAOC 3QWFA 1J7JA 1JKJB 3W5HA 3IIEA 3E9NA 1C2YA 2CBZA 1HQYE 1XALA 3MJCA 4AY6A 1BVHA 4C4XA 2RJ3A 4PQGA 4DV5B 3PUIA 1BX1A 2FI1A 4UAJA 2QG4A 2CXOA 4F2GA 3ZZ1A 3DOJA 2JA1A 3WFJA 4MNTA 5HUHA 4WZ6A 4KMOA 3DKPA 4ZYTA 3IAXA 4JCZA 2NN6C 2FOIA 2J3LA 3B12A 5BXQC 1U8CB 4DV5I 1G7CA 5DJ5A 5DIZA 4ESVA 1PF7E 1IK6A 2JGNA 3W2FA 2EJUA 4CM4A 5ALKA 3ZLBA 4PXAA 1YCGA 4DUGA 3BQ9A 2VG8A 2SKCA 4FGZA 3IPXA 1XQYA 2JATA 1V48A 1Z0SA 5ALYA 1GLNA 2HRDA 4BVLA 3M6WA 2W6ZA 3F6SA 4RFLA 3GA0A 4YALA 4P5PA 4DOZA 4KQFA 2FJUA 2HK2A 1PT9A 4GQAA 1C8VB 2Q4TA 3LCJA 3JRWA 2XRMA 4QXRA 5K36C 5L3RA 3QW0A 5L3JA 3KQUA 3CX3A 2XL8A 5HKKD 4Y0NA 5A04A 2Z2JA 2J9ZB 3MD0A 1NOKA 1CUSA 5EUMA 5GZ3A 3ZQVA 4PYKA 3EJNA 5HX7A 3E61A 3KZMA 1YIDA 4UHKA 1L3IA 1B6SA 3LQYA 2ZE8A 5CDSA 3KQOA 3C7TA 4NMHA 2NU7B 3ZWDA 5A2QQ 2AWYA 2CMHA 3OOJA 1HI9A 3VMMA 1D9ZA 2ZR0A 3CR3C 1N8KA 1BQ3A 4G5XA 1JEYA 3ZHUA 4XXHA 3DZKA 2D1QA 3SYRA 1PJ2A 4UQLA 4V0RA 3H87A 1Q0GA 4LJ7A 2UZ3A 4R2KA 3QFHA 5C3MA 3ZGXA 4U3JA 3IRVA 1RIFA 1CZLA 3TTSA 1Z56C 3ICOA 2I1QA 1AIPA 4W82A 4HXZA 1PZEA 3WRXC 3PWKA 3ELBA 1PFVA 4G36A 1XZGA 4NAHA 1QYIA 2V5AA 4B3SB 1RJDA 1GIAA 3ITEA 2ZXEA 1L3BA 4QYTA 3E4CA 3SQMA 1RKXA 1TTHA 1I0LA 3TPZA 4F1JA 5CYGA 4LMRA 1AXGA 2P6PA 4Z9JA 2JEOA 5GAJA 3IQXA 2H7BA 5IARA 4B3SI 1ORWA 4GI3A 4DUYE 1D2HA 3Q9LA 4B3CA 5K0LA 5JEAC 1SFRA 2WFAA 2A1UB 3W2VA 2XZLA 4FC7A 4G4GA 5CW2A 2YQ5A 4AZWA 3FAPB 5AWFC 2WP0A 2Y0EA 1S1MA 4ONSA 5DLEA 3E9ZA 3NWJA 1OH5A 4HQKA 3HNIA 4JYAB 3IQCA 4Z3DA 2DPYA 1VMDA 3QVUA 5JT4A 3MBIA 2H8AA 4EQ6B 1A5AB 3D8TA 1CQJB 2R6AA 1UINA 1M75A 1PEAA 4ZOLB 2XMDA 1H2HA 1QG0A 4JVOA 4B34A 4BEVA 4JYAI 1UWVA 4WRRA 3AIOA 3ZV3A 4DR1I 3HC7A 2H63A 3MB8A 1ZMRA 3AR8A 2AZ4A 3N2GA 2W6JA 2XT9A 2P3SA 1T4CA 5GV7A 4BMDA 4BECA 3F9RA 2EBFX 2R9VA 4WERA 4W1SA 2H1HA 3ZVRA 4N0MA 4WK2B 1GG9A 1N7IA 2OOCA 4UHJA 5EIWA 2XCOA 3PVSA 3DYVA 3GRRA 1Z0UA 1OPXA 1PV4A 2NN6D 5DNDA 1IY1A 4MVMA 3U7QA 1I80A 1KEEB 3U16A 1RABA 3FOZA 3L0ZA 2FPWA 4GPIB 2I78A 1TQ2A 4FEAA 3UK6A 3DT8A 1WETA 4RZUA 5AM0A 3UJ3X 1ZCFA 3CURA 4DQLA 4U2KA 1XMXA 1RPAA 3WGTA 1AMUA 1UEKA 3M1YA 2BC9A 1OR8A 1A8SA 4QU5A 2VF5X 3OP4A 1A88A 5JW6A 2WB7A 2R8EA 3P9QA 5LSAA 2ZTUA 5K36D 4CKBA 1GPKA 1JQBA 3GFQA 3L7LA 2WA1A 4AJKA 1RWXA 2NXEA 3STUA 1NM5A 1K8ZB 1WZNA 4MEAA 1YFJA 4XEFA 1V9LA 4LJAA 2G67A 3R24A 3RGWS 4M9UA 3R9WA 3T3PB 1T8SA 2AN3A 3BGWA 1T9AA 4PTYA 1J1ZA 4BNUA 1VI2A 4XGIA 4MVXA 4WY5A 3RD5A 1Z38A 2IP4A 2XWJI 2WLTA 3CUVA 3LRXA 3OZVA 4IM7A 4AP9A 2DY0A 3V2GA 5FPKA 1G8PA 2CJXA 1GARA 1JPNA 2VDRB 3SHFA 1FLAA 4FYHA 5BR1A 4UVIA 1VL5A 4CDAA 5DASA 3ORFA 3WLRA 4GR9A 2B4RO 1GKYA 1EXWA 3MUOA 3R7SA 4R16A 3VNBA 3IPLA 4AICA 3DL2A 2ZKIA 4MUJA 2C97A 4H4CA 3TK0A 1C02A 2AJDA 3VTZA 4EF4A 3PMRA 1C14A 4YY3B 4C0JA 5D85A 1H2BA 1ZICA 5B64A 5CEFA 1BVUA 3RWBA 2UUCB 1EHIA 4JR1A 1F8XA 1IRIA 4CXMA 4IJKA 5EWLB 1OIVA 5M2QA 2NGRA 1F3OA 4OP3A 2BONA 1DBWA 3CZ4A 4LFAE 4WZBB 4RMIA 3NG1A 4YY3I 2GERA 1W35A 4FHZA 5IDWA 1JDTA 5DP2A 2QTZA 2J33A 3QWIA 2BLNA 4OUDB 4CIXA 3PNVA 4RYLA 2UUCI 4R71A 2B4QA 1ZGGA 1IONA 1TW3A 2IV7A 4I50A 1XV5A 2L42A 3LZCA 5F9FA 4WXHA 4ETIA 4X90A 1XEFA 4DANA 3LO5A 3BK1A 1BU8A 1M0EA 2XM4A 2PKQP 4WN9A 3KHKA 3N8GA 1M6HA 4GSKA 2HLDD 4LGVA 3UCXA 4MU3A 5CA0A 1BKNA 1KL7A 2X2PA 3T4EA 4LMAA 4C5BA 4PFOA 1JHXA 4UJ5A 1ESCA 4ND1A 1Z4OA 3U8VA 2P75A 4R2JA 1E3WB 3ZQJA 3IQ5A 4QHYA 3JRTA 3V2UC 4ROSA 5HM8A 4FHEA 3RSLA 3A28A 2FSVA 2QVXX 1FK8A 3L7IA 2HU2A 3RABA 3EXFB 2HJ3A 5EPEA 1AZTA 4JL5A 5HIKA 1XXHA 5WRFA 3KQKA 1ID1A 3KYIB 2WKPA 5BR4A 4Q6WA 3SXKA 5LP6A 2ZRIA 4C89A 2OENG 1DC5A 2PZGA 2CJWB 2OWDA 3RTBA 4JA2A 5JNRA 4MVJD 3OT4A 5BV1A 3L92A 3LEVA 4E13A 4NTBA 3NBXX 3SMQA 5JQGA 3VR3A 5MN6A 3RSSA 4TKVA 5F7JA 5G0UA 3RUHA 1K5PA 4NU6A 1AXRA 4M83A 1Q83A 1T5OA 2VSFA 3DE9A 4KVAA 2C7RA 5BSVA 3MM4A 2NAPA 3JRXA 1TUEA 2XS8A 4HDNB 2WP8A 2W11A 5F2KA 5AJXA 2Y1GA 2HIMA 3U81A 3HHPA 2B83A 2JK1A 5GVRA 2A68F 2Q3TA 5TJ9A 1QDLB 4MINA 3SQLA 3K9FC 2B99A 4K9LA 1UDBA 1ZGCA 1F6WA 3D6MA 1UK9A 2XWQA 4PZLA 1LZLA 1G42A 5KYXB 3HA3A 2ERCA 2WLSA 4JBGA 4QQKA 4F85A 3LPAA 1XD9A 1SKYB 3FUVA 1QM5A 2QPTA 3V7FA 3C7DB 3SZGA 1RS0A 4G0XA 1VIMA 4KN8A 5ELXA 3L82B 4U9DA 4L7QA 4YO8A 4TLEA 4Y2XA 1AV7A 3ZC3A 4NS4A 3IX7A 1GSAA 3L4JA 3COVA 4V3CA 3KAPA 1K05A 1YJCA 1RR9A 3HB9A 2H1IA 1R6DA 4E5KA 4FOTA 4QX6A 4IV0A 1E92A 1Z4LA 4DA8A 1ZUD1 4H3SA 1EA6A 2VQFE 1J99A 4Z9IA 5GPBA 4MZDA 4X66B 3H9GA 4MMYB 3KJXA 5G0SA 2XR1A 1D8AA 2GA8A 4Q9HA 2Z9CA 4HQNA 4LDNA 9LDBA 3AHFA 1GTL1 4B87A 1E2BA 1H9TA 3F7NA 4YUXA 1H73A 1JEOA 4DV7E 3AETB 4P4UA 3IHUA 3UK7A 3FLMA 1N34I 1LC3A 4X66I 4Z3KA 2FPSA 5IH3A 4D2IA 1T8PA 2QZ4A 4CL8A 1U9CA 3WMRA 3DEZA 2A9RA 3DXJF 3PCTA 3PFIA 2EJTA 2XMGA 5LKRA 4BO4A 4Z9HA 2INGX 5K45A 3SDSA 4J1TC 2P30A 1DP4A 1SQ0A 4GYTA 1HY5A 2YLGA 3DLPX 3FGZA 5EJ6A 2ID9A 4D99A 3RSZA 1YOVB 1DFIA 4Y0VA 4WQMA 5FI1B 5BVGB 2ZUWA 4ZHQB 1PDWA 3V8PA 1XMOB 3DR3A 3KYBA 3I6ZA 2OVFA 4HYMA 3W3AH 1NU7D 2WMOB 4QRDA 2GEKA 3DWIA 3FFWA 1P7WA 1AEPA 5ALSA 1SC4A 2HRRA 2ZDGA 3HJGA 4MRSA 2RAFA 4I55F 4NXNB 1XMOI 4PTZA 3OUUA 4CQJA 1UIRA 2WZDA 1G20B 3KQVA 3EGWA 5BQ5A 1SKAA 4HUJA 1Z5PA 3QBDA 4W1QA 2F3RA 4IFDD 4NXNI 2HJ9A 4RDXA 1MHTA 3I5QA 1MP0A 1RWWA 3KR1A 4BQFA 2PWPA 2IEZA 3NHKA 1OFTA 4U5FE 5G40A 5HMMA 1IXZA 4AD8A 3TLJA 2WV9A 4JUDX 1WM1A 3BGIA 4WDRA 1SEVA 2EJWA 1X7HA 3H8JA 3AI3A 2QD1A 4G97A 3AUTA 4LFBB 4E1AA 2WZCA 4EYEA 5G1PA 1E0DA 3TJZA 3J81k 4KKXB 2I3ZA 1EGVB 1KYYA 4BNGA 1I2AA 4LY6A 1MPXA 4UZEA 1DUIA 3OQMA 1UWCA 1Q0TA 3OX4A 4GSYA 4AS1A 2ZWAA 4KAFA 3IUSA 1IL0A 4AURA 4ZVLA 3LG2A 1ZMBA 3PSHA 2OZEA 3CVWA 4OHVA 1VJ0A 4MV5A 4RKWA 1CJMA 5B57C 1KERA 2DLNA 1VJ5A 2Z2KA 4G1MB 3LDUA 4UTZA 3EWNA 4YJWA 1NAHA 1Y48E 4YRMA 5C7YA 2VT2A 4PX2A 3OECA 3CUEF 4CMEC 2ZUVA 1JG3A 3IBYA 2A9JA 2YFQA 4FXOA 5KJEA 5C9ZA 1CC1S 3JYHA 1B43A 1P4AA 3NC4A 3L6BA 3BERA 3A10A 3HSSA 4ASUA 3M0EA 4CCAA 3ZGVA 3HR4A 2ZUEA 5D5HA 5GM1A 1OQAA 2PQ6A 3NBFA 3LLKA 3D8SA 5COQA 3V42A 3JCZA 2X2FA 4G5QA 4EYQA 3ESCA 4N5MA 3GMEA 4XCVA 3QE0A 3HA5A 4LNAA 4HDSA 4H17A 4Y2TA 2L18A 3ZK7A 3HJUA 3I2YX 1CFJA 4NKRA 5KNBD 1ZG3A 5DZSA 5A3VA 3WGKA 2FHSA 3NMIA 3TQRA 5HF9A 3V4VB 4HDKB 2G71A 3G0HA 2J3JA 2RE8A 2AE8A 3QQ5A 1RR6A 3ZVMA 4WDQA 2H3HA 3WLQA 1CT9A 4M55A 2R6FA 1K7FB 2YQ4A 1SYQA 4OH7A 4GPD1 4JLJA 4WUDA 1I51A 3OJOA 4B3IA 1MXHA 3IAEA 3TIIA 3EZ2A 2JGAA 3FUCA 5CVDA 1ORRA 3BE6A 5KTYA 4LTMA 2NZWA 3HVUA 3QHPA 5KVAA 1D2GA 2DEUA 3A4YA 1E2MA 4WOKA 4DFDA 4B3TB 2GJ8A 4ZAXA 1P91A 3U4AA 2WIFA 4LYEA 1SD5A 1NC3A 4YRZA 1G17A 2JCXA 3F4KA 3ESZA 4N5DA 4B3TI 5JS5A 3R3SA 4UUQA 2JFOA 1LDGA 1JR3E 4Y1FA 3AXSA 1A50B 4RKRA 1P5RA 1JHOA 1R9GA 1DKUA 2C7PA 1G8JA 4PSVA 3ONFA 2LV8A 3H5IA 2XLEA 3QHAA 3K31A 5CTJA 3MZ0A 3WE7A 4CM4B 1XIVA 3W1EA 3OICA 1M0WA 1VSQA 5AC4A 1YE8A 3V33A 5KYKA 2LR0A 3G0IA 4EOGA 2AW3A 3KQTA 2AXQA 2JAHA 3KL4A 1X9IA 4JI2B 4KQIA 4BPMA 5I9TA 2XS1A 4XB2A 3HV2A 4CODB 2UXCE 4RK7A 5CXSA 1G9XA 4DZRA 3VR4H 4JI2I 1DAEA 4YJKA 3MYFA 3AGPA 4B47A 2ODNA 2DU8A 1E1MA 3NGLA 4J7AA 3DUFA 1TQ6A 4L5YA 4XDGA 3WIEA 1QE3A 3QLVA 2I8CA 3KHSA 3SS9X 3TEMA 4RY0A 3B1WA 2IOYA 1ADFA 2VBIA 4HEA1 4JJEA 2VKTA 2WT9A 1K3TA 1I4WA 5DE3A 5EK0A 3VKHA 5CG1A 5A2QC 4DN6A 4KR3A 4AFNA 3USZA 4K0DA 2BPOA 5C3UA 1K6EA 1JI3A 2FWRA 1CETA 2BZ1A 3G49A 3Q11A 1R27A 3N58A 1L4FA 4KE6A 1E9RA 5F1PA 2HUPA 1M8KA 3FHJA 4U3JB 3EQ7A 3QLJA 4PIPA 3MJHA 3T5MA 1SC3A 2CBGA 4ND6A 4YH1A 2HKEA 4ER0A 2ID8A 1OW6A 1M74A 2MTBA 3IUBA 5JISA 5AP9A 3UHFA 1A9RA 4KITB 2DZDA 1H66A 2A69F 1UUFA 2IXEA 2FPIA 4K88A 4YMWA 1EWRA 3IR5A 2ZIFA 1E96A 3GPCA 4V3BA 2JGLA 3WMFA 3K1HA 5FL3A 3T7KA 4LOMA 2VAMA 1UOPA 2ISCA 5LVAA 5E38A 3QNWA 4MWCA 1VPEA 4Q3BA 5HMLA 4HSGA 2PUGA 1LVKA 4PYQA 2QN2A 4RA9A 1HG0A 1NYTA 5DGTA 4K9DA 3IDAA 3RYLA 5FCLA 1VE9A 1RAHA 4YJDA 1KE2A 1IU9A 4X8HA 3NIDB 5EJ8A 2BMVA 3UWPA 2XOKA 2O5CA 1V54C 2Q3FA 2XNJA 3PI6A 2XDAA 1IUNA 4DCSA 5ILOA 4MDEA 2WUDA 3KJFA 4JUAA 1HE4A 1GUZA 3ONWA 2AI1A 1OWOA 3P96A 4XASA 1I9CA 1NQVA 1AKYA 1OIWA 1S2OA 3MD9A 3QVJA 2JFVA 4A8TA 3H5RA 4LN1A 3EFBA 4LOKA 1OLUA 4G4IA 3IELA 5AW3A 3DKKA 3ZJVA 4LY0A 2BEJA 1DOAA 3BRQA 1XVLA 1JLMA 5CXUA 2QM0A 3ROXA 3TFWA 1T4CB 4O4HA 5J2UA 1EINA 1D6JA 1TA0A 3JQAD 3JRNA 4QDXA 3BICA 3G5UA 3KYCA 2HTFA 3LTNC 1QC5A 3H8VA 5AK5A 2IS1A 4BRWA 4MP6A 3KR2A 4UE6A 3RVNA 4I44A 1CEYA 4NR0A 3U7QB 3RADC 1X1TA 5HYVA 2JEZA 3A9SA 1X13A 3PB3A 2P4EA 5BNFA 5LMNB 1RVDA 2GRJA 1WZIA 4WIAA 2C58A 5A4DA 1Q0PA 4F9GA 1A7VA 2H59A 5JPCA 3DL7A 3RE1A 2WRZA 3EZ6A 2FUNB 5JSYA 3VGJA 2YEVA 3QP9A 4HGQA 4IG4A 4XIIA 1G6KA 2ZYDA 1GGQA 2NZUG 3TTYA 3EQLF 2CD7A 1TM5E 1BDMA 3GVCA 4CKBB 1NBAA 2IU3A 4FYWA 2XDWA 2VL7A 5ALXA 4QDLA 3QPBA 5DNCA 4KIUA 4QLOA 1JMVA 1VXRA 4EWCA 1FSZA 4D79A 2H8GA 2CLDX 1Z4QA 2BCEA 3CJTA 3FMGA 4BNWA 3ROTA 3BB3A 4WUTA 5DWVA 2C7VA 2Q4BA 1QBGA 4RIEA 2ZBEA 2IK8A 1FQWA 1NL3A 4YXWA 3B9RA 1N1MA 1DWOA 2GLXA 3CUSA 3OF2A 2WJ4A 3C6ZA 2HHJA 4YYZA 4E5SA 2ZITA 3BJZA 4GI5A 3DEKA 1JJAA 3I9OA 1HNXB 4BIIA 2CVOA 4G1EB 4IRXA 2BGNA 3GJ4A 1G3QA 1QPBA 3VKVA 4JROA 1NNSA 4EHLA 3L7AA 4ZVQA 1NVMB 4J0IA 5AOCA 1IB0A 3G0OA 3L6UA 2X1MA 3T1YB 2IX9A 3AFIA 3JYQA 2CXHA 4HB4A 3I5XA 1RTKA 4FUQA 3L7KA 1W5SA 1ZK0A 3AHCA 4GP7A 4F2PA 1LS1A 5E0OA 3AVQA 3FBWA 5HBGA 2FW6A 5ELWA 3GI1A 2Q4EA 5HA5A 4QUHA 3PJDA 4N9QA 5IT9A 3LLUA 4C78A 4E1BA 1KMCA 1BHJA 1DIRA 4XH9B 4OSEA 2G1PA 4CKZA 2AGVA 3NMUF 3R2JA 5CBPA 1SBHA 1AC5A 3AR4A 3QITA 2O3TA 1JSXA 3CQZA 1N4AA 3QPCA 2QNLA 4J1QA 3GLIA 4E1VA 5DRRA 4Z8YA 1ZITA 4ZCIA 1XF9A 2HMSA 4MQFB 1P18A 3VU8A 4J0FA 2ZUUA 4I50B 8AT1A 2X58A 1Y1TA 2Q5HA 4AMZA 2I4TA 4O4LF 5FPTA 5CK5A 4WN9B 1CQJA 1UJNA 4AAYA 4G6ZA 4JU9A 1YIAA 3DD7A 3GWNA 5GGXA 3GONA 3PCVA 2OGZA 1GXSB 1Y3HA 2QBYA 2KM1A 4NPCA 5EY5B 5CA0B 2PQMA 4TMKA 4C0LA 1E6LA 2FRXA 4US1R 2QOEA 4HB3A 4MRPA 2O3SA 2BFEA 2ZJ2A 3REQA 5JEAF 2K6GA 3S40A 4DG8A 4NYJQ 4DEXA 4IGGA 3BWEA 5TE9A 1NXQA 4RPLA 2XL6A 3QELB 5IJXA 2OI2A 4TL6A 4FDLA 4RANA 1E2GA 2O1VA 3HYCA 4MQ6A 3GZ4A 5T67A 1XXHB 3KQMA 4D9CA 4BX2A 1E18A 1OXSC 1YS4A 3W7AA 3EWIA 4TQAA 4K9SA 1GQRA 1RXUA 3DLAA 5DP1A 1GPDG 3H9BA 3V1MA 4B5KA 3FAZA 4TKVB 4F4UA 5IBCA 2Q5QA 5MDHA 4Y2SA 1YNOA 1FFXA 4LF7E 3MFQA 3ADOA 2WP8B 3AWDA 1HDOA 2RKBA 1EDZA 2C9BA 3A3PA 2DFPA 1R3UA 3V34A 4P8RA 4QNNA 2V7VA 4KXFB 4OA5A 4EPTA 3RFYA 3J7TA 2B5OA 4YC7A 2EWMA 2W2XA 2H48A 4Q3CA 5G2OA 1XNHA 4EBKA 4GLLA 3NNDA 4BEBA 4WLVA 2I4MA 1KZ4A 1HQDA 1XD8A 3EB9A 4QUDA 4TQUS 1B1AA 3D0QA 221PA 4KMRA 1RKVA 4JT2A 2A1DD 3CKLA 3QUAA 3RGGA 4M1YA 3PRHA 1VMEA 4ZVNA 2H4FA 1TKAA 1M7GA 2V7WA 4KLNA 4MW7A 3S8YA 4E2XA 1NR7A 4HUQA 2GXUA 4G0QA 3W1VA 2C39B 1V5IA 2EKDA 1IBME 3LQFA 2F1RA 3BUSA 4QKQA 2CHUA 4U2BA 3T7EA 1OYWA 4EZEA 1JWAB 5M04A 3AI1A 1AKQA 2YWJA 5E6SA 1BH2A 4LVOA 5KNBH 1R0ZA 3O03A 4C4ZA 5T7BA 3GRVA 1RBMA 4IINA 1QYXA 1WP4A 4U02A 3RVMA 2FTKE 4MZXA 3JYPA 3U0BA 1F0PA 2NYAA 1JHPA 1KTIA 2XYHA 4PRLA 3IPCA 4XAQA 4PLHA 3WMWA 2B78A 1M5TA 3Q15C 2A9OA 1JZSA 1UDSA 2WBLC 4FU0A 2PMEA 1Y1LA 5ALDA 4YAIA 4BXOA 1YDWA 4Y2PA 3TOLA 1JFTA 1WPGA 3AM5A 4FNOA 2ZJ7A 4WZBA 3SHWA 2LCIA 4Z5XA 1Y5IA 3KWJA 1NW3A 4HDAA 4KREA 3DF9A 3PCXA 5EJAA 1CRPA 2EEZA 3N2IA 4UZSA 2BKXA 3K2EA 2CFRA 1E1RA 4JJZA 1UFRA 1PV3A 3VJRA 2RC6A 2C94A 3VNQA 1CWUA 3AR5A 5A7GA 3SQOA 4QRIA 1QHEA 2PVCA 1UBCA 2PJDA 4PQEA 3H2JA 3PHJA 4CI0B 2H9IA 2I9PA 1SXQA 1SVSA 2IHTA 3NVAA 3GCZA 3ABKC 2CY0A 4ZV4A 2CYBA 1I1QB 3ABOB 4R84A 1KSJA 1RXQA 4LSWA 1ISSA 4CT5A 1KKHA 1WXHA 2ZS9A 1EX6A 4LRYA 2Q3JA 1VL6A 2VDKB 3EPHA 5L0CA 3TNYA 2UXBB 3C18A 1ZHXA 3HSKA 4G41A 3TRHA 3NIFB 4UU1A 2Z6VA 3KYIA 3SPXA 1Z0ZA 4PACA 4Q3NA 4TRJA 4DLNA 1G38A 3RLFA 1LK5A 4IH9A 4AUEA 1PQPA 1XT6A 4E2FA 4TLCA 2UXBI 1HNWB 1PEDA 3O1LA 2XXAA 1KRHA 1IVYA 1TW2A 3WBBA 1OF1A 4X6UA 2H0RA 2CW5A 3M79A 1DRJA 3UAZA 3IUQA 4JC5A 1P1FA 3UWSA 2ZYUX 4ENTA 3ZU3A 3V7NA 1HNWI 1VLVA 2AD1A 4NDZA 4QEZA 2NN3C 1H8EA 1Q2UA 4JIOA 4NYMQ 3CM0A 1DAOA 4FEYA 4I4NA 3MSCA 1G18A 4COKA 1USWA 3FNHA 4TMXA 4P31A 2J9YB 2LDBA 3CWCA 2AW5A 1X1EA 4B2IA 3F1KA 1OROA 3E9QA 4JI3E 1YIOA 3HFSA 3BCSA 4P7AA 3H9CA 1RQNA 1BQEA 4ZVRA 1IXYA 1A8IA 5EJ5A 4W5WA 5H0IA 3E7PA 4N1AA 4RD4A 4HQ0A 2OWEA 3PE4A 2JLCA 1IOVA 1KFKB 1E89A 4HDSB 4LCJA 3HYTA 4LGYA 1RAGA 3K09A 2P6UA 3EZ9A 3NORA 1Z7WA 3ZG1A 4D98A 4H16A 3KTOA 3IEXA 5PGMA 2K7FA 2P0AA 1NG9A 2ODWA 4QOIA 1PR2A 2B25A 3T94A 4CDMA 4C06A 4WVLA 3BJMA 1UG7A 4Q1BA 3E22A 4R1QA 2LSEA 3TLCA 3OTHA 1UPTA 1W0JA 4LXQA 4D25A 4LF8E 3S2UA 1MNEA 3OIFA 1RAAA 3ZHVA 4C4SA 5T3WA 2XJ4A 4Q9JA 4LLEA 3I52A 3BM5A 4BFLA 3TAXA 1B93A 1YVEI 3JRMO 1H94A 1R5JA 4D4MA 4DV3B 3TW8A 5FQNA 2HTEA 3IERA 2JGRA 4L3VA 2O2CA 4X44A 1KU0A 5CB4F 3MIZA 4ZPJA 3CF4G 4I14A 1XHEA 4DB2A 3HKKA 3QXXA 4YDQA 5BSKA 2PAFA 2VJKA 2BKUA 1UBUS 3IKJA 2OC9A 1YOVA 4KO4S 2PX2A 4TM8A 1A71A 4OP1A 4AO8A 4BGVA 4J0EA 4IIGA 1R8XA 2X2OA 4KSBA 2HHAA 2XQFA 1IG3A 2I2BA 1Z8FA 3KLNA 4G0PA 1AZLA 5I4CA 3MQ2A 4KWCA 4C0SA 3FF1A 1EK6A 3H13A 1NBHA 3K6KA 1GTRA 1A2OA 4RSRA 1SHTX 1B62A 1U3DA 1CUXA 4EHFA 4FDUA 1G20A 4ENRA 2GPWA 5K05A 1M56C 2CVQA 1L2TA 2VH1A 3C8GA 4NG4A 1ZIXA 4KWEA 1Z3IX 1M2GA 4MWEA 1ZJ4A 2P67A 2XITA 2HH9A 3E70C 4G9BA 3UGJA 2JCBA 2AX3A 1W19A 1DNPA 2FZLA 2YIVX 4FKZA 1H1DA 2HSWA 2PM8A 1K98A 2AG6A 2FW9A 3UY4A 2OCAA 4G86A 4FOOA 1PQWA 1S8NA 4IVNA 3EPVA 1PK9A 4BBJA 5T8KC 2D4AA 4NBNA 3ECSA 3DUFB 4IWXA 3GD5A 4C20A 5FPYA 1G5PA 1N2EA 3GNLA 1YI8A 2Q1XA 3HN2A 2I99A 4R9NA 5AW9A 5IYZF 2CBXA 3ZYCA 1KDTA 2PQ0A 3M1AA 3N7AA 3G2IA 3ZJTA 2X5XA 2E18A 2VYVA 3M7ND 3I39X 1I9GA 3GUHA 1QJCA 2B1QA 2FWNA 1XRLA 5H82A 3RK4A 2G0NA 1RRFA 5F98A 1JDNA 3HLYA 2OD9A 5L6LB 3MIIA 2ZI7A 2WD7A 2PMKA 1BHO1 1CBUA 5AI8A 1Z0CA 2LTAA 1GTSA 3SU8A 4NH4A 1JKMA 2ZDHA 3N39C 2XA1A 3QTLA 3IAM6 4UTXA 3KVNA 1E99A 1U9IA 4EYKA 1DHRA 4JP2A 2FPIB 1JIKA 4BLPA 2C8VA 3RUCA 4QJ3A 4JQZA 1O6CA 4WBXC 1G55A 3GK3A 4WBNF 1ZINA 5FTJA 3JZDA 3P9PA 4JI5E 1RIIA 3C48A 2H2WA 4X65E 2HRCA 4G1CA 2DYRC 1C9NA 4P7FA 4UDXX 4QFBA 4N7RA 2YL2A 4D7AA 3RTGA 3QT8A 3SZLA 5LD2C 4RA9B 4HDKA 4HZIA 1TYBE 4HEHA 5CJ2A 3O73A 3H97A 1GL6A 1GSOA 4QDJA 2HMUA 1WQ1R 1M6WA 3CA8A 3KXIA 6LDHA 2OCIA 1L9KA 1FFCA 3P0FA 3FNQA 1PWHA 4RLSA 3T9AA 1Q50A 1KO5A 2CNLA 1OLUB 3CNOA 2IZ1A 1Q6ZA 5SYMA 3A6PC 4OHRA 2HR1A 1KYIA 1E3JA 1F4VA 4K6OA 4O4HB 5KQGA 2XUDA 5J2UB 3AG1C 4WCDA 3F0TA 5EXXA 1Q7TA 4FYPA 3KYCB 4CHGA 1QC5B 4YAUA 3ASYA 4DCMA 3CH5A 1QLEC 3ZKDA 2O3QA 1N0WA 2H51A 3IDZA 4ANFA 3ODPA 4P7KA 2I5PO 3UMCA 4EHBA 1AY0A 3SBOA 3I45A 5U4XA 3HVKA 2FV8A 1GNSA 4D4KA 4N8SA 2X7JA 3TLYA 4CTOA 1LGYA 4DJ5X 5CDTA 3AJ9A 2H7CA 5K4AA 4YECA 4DIEA 4OLAA 1MHPA 1P73A 2GBIA 4AJEA 2B7LA 1YCDA 3U9TA 4EZIA 3D1LA 2O6LA 4INJA 3QKWA 4ZFNA 3VZSA 4MUHA 5ALJA 4MQLA 4FWVA 4RORA 1A7UA 2JGFA 2R6R1 3DVAA 1XFAA 3CW2A 1RHUA 4JOBA 3PUKA 4RHFA 3AOGA 4FW3A 3QFTA 3O0TA 3DL0A 4J4HA 5GTDA 3KBOA 3K66A 2GK4A 1LX6A 3WYBA 5EIFA 4Z4IA 4B48A 4AN4A 3E81A 3WI7A 1EVEA 5ALOA 4PYRA 2LFFA 1UXOA 4YAKA 2BDTA 8ATCA 1NW4A 1N33E 1IRXA 1P4JA 1SWWA 4Y2GA 5KSPA 1FNTc 4FMBB 2PUVA 2MSDB 1VI7A 1XVUA 3ETEA 3ROMA 1DUVG 3MUNA 4CEIA 4A4AA 4HRAA 3OPVA 2IYNA 3T9DA 3L6DA 1G5ZA 4YRNA 4PZEA 3CRNA 3HWX1 3KZOA 5BV2P 4MTCA 1C7EA 2Q27A 1LBHA 3VZDA 4RDIA 5H3LA 1IHYA 1KAMA 1A1VA 3SIWA 2JFPA 5FP0A 3PHF2 5ECYA 3TXXA 2HMQA 1BN6A 4ZZ0A 4MH0R 2POQX 3HEMA 2PL5A 1ZIDA 4OF4A 2D5LA 4HAIA 2FMTA 1TQHA 3QYFA 3O0DA 4WA7A 1N1CA 4DR4E 2H1CA 3ENKA 3OM9A 4TV8F 3LPLA 1SCAA 4Z0NA 4L0QA 5JEAE 3WK5A 2F4VE 1JALA 5CBPB 3GLFE 1F9EA 4RO0A 3UPDA 4Q4AA 4CCSA 2R48A 3LC2O 3WL6A 3ZBQA 2Y76A 4ZOQI 3EVBA 1DC7A 1ADCA 3VR5A 2FG7C 5F3DA 3WY9A 3OPYA 1NVBA 2XTAA 1ZHWA 4MU4A 1U90A 3GLIB 4DCUA 3OU7A 1Z37A 2PN1A 4MLDA 5ED4A 3MOSA 1Y8CA 3BWBA 2VQ6A 1OA1A 4X7BA 5FULA 3R0XA 4E51A 3I5AA 1EHYA 4MV9A 4FDMA 3I73A 3IODA 4XCQA 4JOQA 3IBGA 1FXWF 1GPAA 3OSUA 2VJPA 2FP4A 3FB1A 3JAWA 2QBYB 2C98A 1E5XA 1FYVA 4F9FA 1LW6E 1HMOA 3KUUA 1UODA 1Y8RA 1EDBA 3KV3O 5C0XC 4UUNA 5CFLA 3KPHA 2R8XA 3HUFA 1IBCA 3O3CA 2BFEB 1E98A 3KYDA 4YWHA 3REQB 2OBYA 2Y2UA 4V02A 1JG6A 1I2ZA 5L95A 1DC3A 4H6VA 1MTOA 1Q11A 3N8NA 3ZDBA 4ZJYA 4BKPA 2H1LA 3AIMA 1BS9A 2GJAA 3HTXA 2D7JA 4G56A 3ZIAA 4WKOA 1NDHA 4D44A 3F1LA 3WL4A 3OCWA 3C97A 4DU8A 1OI3A 1HUQA 5IVPA 2W45A 1K7EB 1JIVA 3FYSA 5FOTA 4E22A 3U3ZA 2FMFA 4XIJA 3OEEA 1VDMA 13PKA 3B9PA 1FFXB 2FEKA 3NYJA 3RAPR 4AJLA 2GZDA 1CV2A 1W5AA 1TEVA 4M8KA 5I3CA 5A05A 3VSDA 4EL0A 1OVMA 2LKCA 2NSGA 1UJ4A 1EK1A 4L9SA 4AF7A 2JH9A 5JC8A 2YWXA 3AFOA 5CITA 3TDNA 3FX2A 5HW0A 2ZU6A 2VNKA 4RJLA 4ZN6A 3NDBB 1TO2E 5TEVA 2Y3HA 2JIMA 1GJRA 1Z2OX 1T24A 3TEFA 1OWPA 4ZAWA 3T5BA 2VUUA 4NEHB 4JP8A 2ZIAA 2C0PA 4UNIA 4HUQB 4UEKA 2PUFA 4L75A 3O91A 2B61A 3C6YA 3EZYA 2H4JA 2HPVA 4JYPA 3A37A 4X84A 1J2TA 1W25A 4HGZA 2BEVA 2V7TA 4YJHA 2XUKA 4O8ZA 2UYHA 2DUMA 5E6SB 4BYMA 3CBQA 1LUAA 1FRQA 1MDFA 2ICWG 2YWRA 3UT6A 4FXPA 2WWTA 4RZ3A 4ILEA 2Q1YA 1SPXA 4K6GA 4NU8X 3B6JA 3MXTA 2GRAA 4YUVA 1VE1A 4ULWA 2XMZA 1XX6A 4CU2A 1U1EA 2Z08A 1Q21A 1IN8A 3RYCA 4BXOB 2H0AA 4XQ0A 1FFYA 1KEZA 5C5IA 1V9CA 2B1GA 1A7DA 1UMBB 2H57A 2H08A 1WMDA 4ZAGA 1Z29A 5FTNA 4OLHA 2IYEA 2QUZA 1OE0A 3PJEA 2FWBA 1X7XB 5LWHA 4MQFA 4EO7A 3D4LA 2AEMA 1DG1G 3DHEA 3IVXA 2CNWA 3KSRA 3VR6A 2WJWA 1NF8A 2IEAA 1T1RA 1KIMA 2JLBA 3QMVA 3VC1A 3M81A 3N2LA 1QK3A 1A9ZA 1Q14A 4UBJA 2CKDA 1N0IA 5K3BA 2VJQA 4RQAA 3ZWYA 4OBWA 2W42A 3FGNA 1KH2A 1GXSA 2J3EA 3AM3A 1O3UA 1GHTA 1QP0A 2M1ZA 3K9QO 1PVGA 1QJ4A 1J23A 4M7PA 2DTEA 3BMOA 5C0XD 5DW0A 3PTAA 3PWZA 1T1IA 1NRJB 2H2FA 3QXCA 3AIKA 4W8PA 1N3YA 2KI5A 1KPIA 5JMTA 2VHCA 3IP7A 3JQQA 3ZE7A 3R2PA 2OCKA 1R15A 3UXMA 3SG0A 4NRDA 1NZEA 4IFDC 2VRCA 3QELA 3UCFA 2NPFA 2YWEA 3OOWA 3FBGA 4DBVO 5ITWA 4TXHA 4ZJZA 4KXXA 4RPFA 4CEJA 3D8BA 2IC5A 2P6NA 1EKYA 4DCCA 4KV9A 5J4KA 3L4EA 1NQAO 5F51A 1GCGA 1GQSA 1EWTA 5LFAA 4BLOA 3A0RB 2EC5A 3WR5A 1XZPA 2XXAB 5F9HA 1AQ6A 2GJ4A 1FFSA 1QNLA 2OBXA 1PR3A 3R0IA 3OQ6A 4CFSA 4OMUA 3I2JA 4NYMR 4E6PA 1G8MA 3A4LA 1YVUA 1XNJA 3OT5A 4NJOA 2HA7A 1A9QA 2R03A 3VFDA 3O95A 3AHDA 4DR6E 1NHWA 3EMKA 3GLVA 4MW5A 2Q21A 1HE9A 4P08A 2WWYA 3MVEA 1YVPA 5ELMA 1WPXA 1R0XA 1NMYA 1I1HA 4E07A 1DO0A 5E7IA 2XE8A 4DE5A 1WHTB 3AGQA 1PYDA 4QDZA 3AEKA 3NAZA 5LIPA 4BLVA 3JAKA 3Q5DA 2J0XA 1BOFA 1IWBB 5H59A 2GEFA 4MGYR 5I9IA 3BB4A 1E62A 4YI5A 3UBMA 2J7PA 2WPNA 2NTNA 4HTAA 3V4RA 1H2EA 1IQUA 1X3SA 2C39A 4Z9YA 1UBOS 4IMIB 2OXTA 4OJTA 3TZHA 4BFUA 2QA5A 3AJ8A 1H2YA 2OEVA 4G1FA 2ZM5A 4Q9LA 1FW8A 5BSEA 2WC1A 1U0GA 3QVZA 3RVKA 1EA7A 2OUIA 4OY3A 4W1RA 1SAYA 1DRVA 2XV1A 1IN7A 3CKYA 4YRSA 1DVRA 1P4RA 3PPIA 2WYVA 3TSCA 3E22B 3IVMA 3AMVA 4ISAA 3BK7A 4L78A 4NXMB 1M34E 2WF6A 1WXWA 2QX7A 2HAEA 4M36A 4J3DA 3BIOA 3HU1A 1TI7A 1GG2A 1O96A 1CPRA 3TW8B 1IZ9A 3K2QA 4A27A 3T9EA 5D92A 5KNDA 3TXYA 3R9KA 4NXMI 3CCCA 2ZS8A 1RC0A 3R0VA 2QRJA 1QLJA 2CNKA 1JAFA 3WTCA 3SJCA 2XF8A 2OYRA 3CG4A 5AW1A 3RI3A 3IKTA 2R8OA 2AEJA 3P76A 4N5NA 4GQIA 3ANSA 3F9IA 1XZIA 2DLDA 4JC7A 4OK5A 2OCPA 4HJRA 1QSPA 4GIBA 3ZWVA 4ZGWA 4IXDA 3D8RA 3UJ6A 8LDHA 1ZSVA 1EVIA 3G2JA 1QH8A 1TA9A 1LJUA 1GZSA 5JH7F 5F5FA 3FCYA 1NLMA 4C6RA 4HB2A 3D2AA 2FMXA 2LD4A 4MS1B 1WNFA 1A0BA 4N48A 2EW1A 3PGLA 2VSQA 4Y6PA 3HN6A 2EYUA 1ZN9A 4NICA 5TF0A 1QTNA 3C8GB 1YQUA 3GIDA 1M1NA 4CNQA 3F49S 1P75A 1R0LA 1UKZA 4KIFA 1XNQE 1J0CA 1DKLA 4NC3A 5KOHA 2FETA 3QWBA 4CIPA 1J1UA 1BEUB 1PV2A 2W22A 3I6QA 2O2GA 2IYZA 1PGOA 5L6MB 1LM3B 2UYQA 4M37A 1LDEA 1E2EA 4S1NA 4PC2A 2HJRA 3R8XA 5JNSA 3E0XA 1T01A 2OXCA 3WLJA 2V98A 1AUPA 3LUDA 4YP7A 3SX0A 4XVUA 4H7FA 4LFBI 1ZH6A 2I3DA 1PAUA 2AMJA 2W6OA 1NXSA 4Y1EA 4Y98A 2OHXA 3EUEA 2I87A 3JTMA 2C4WA 3GRPA 1ECGA 5DSZA 4R98A 2EQAA 1Q7GA 1E3TA 3LY8A 3T6JA 5C8XA 5EQDA 4DBQA 2X7HA 4IJQA 3HNLA 2K2QB 4YP0A 3IT1A 4NCHA 4TV9B 1TM7E 4LA4A 4OPMA 4JLMA 4XYMA 4PRXA 3GA7A 2WD7B 3H0CA 4BX0A 2E9SA 2L9JA 4JV5E 3K0HA 3ZV4A 3ICEA 1QZ3A 4MKFA 4Y6RA 3TR5A 2IE8A 1I36A 3ND6A 2QUHA 5JYDA 1F8FA 1W4RA 3PFNA 3K16A 1U8ZA 2WTMA 5BUCA 1B7GO 1U9JA 2OL4A 3MTDA 2XMBA 4YCAA 1VA5A 2WJGA 4ITRC 3IIIA 5TSDA 1N32B 2JDIA 5K4GA 4MJ7A 1G4WR 4X54A 5FPPA 1SUBA 1VJDA 3ZPXA 3V1LA 4AKIA 2IW3A 1K5DA 3TI7A 1YB7A 2GF0A 1UPCA 1R4MA 3BXEA 4C2UA 2VYND 3OKPA 1HYBA 1H4SA 2RI6A 3OWOA 4NCIA 3NHYA 5A6JA 4BP8A 3G8YA 5JZVA 4WESA 3K5IA 1PR0A 1EBUA 3K0CA 1KVUA 2BFOA 2LJPA 4GWKA 4NV1A 1GGFA 4GGPA 4DDWA 4JBLA 2GYWA 4G0ZA 4AY2A 3VDRA 3N3AC 1RU3A 3HDYA 2OFWA 1U94A 1YR2A 5A3QA 2XRHA 3UM9A 3WRYA 1K86A 2WE8A 1P81A 3UKOA 3W2TA 3P9KA 1RXCA 1U2DC 2WI8A 2FGYA 2OV2A 4DMLA 4LZPA 1TJ3A 1WASA 1Z0KA 4QEKA 3NANA 3QPUA 1R6UA 3GEIA 5BN5A 3ZQYA 2JZNA 4CS8C 1QMGA 1V25A 3LI2A 1EA8A 2FZCA 3FCEA 4B17A 3HL0A 1KOFA 1V1RB 1AGPA 3EXG1 1MPTA 4MYSA 2HEGA 5DW3A 1N2OA 1HW1A 2PS1A 3F7OA 3K6JA 3CZRA 1DKRA 1T6QA 1Y89A 1KP2A 4NARA 4CG2A 2AQKA 1ZVJA 3II6X 3JVDA 1XGKA 4NAUA 1PNVA 1PT8A 4LE0A 3N8IA 3R7WA 4ZYUA 2JAPA 4FFLA 2EX1A 4ZU3A 2G8LA 1GYQA 5JRZA 4OIPF 1P9LA 2VYQA 4Z7QB 2X1LA 1YFZA 2VOJA 2OQRA 1WL8A 1V45E 5B6JA 3OLYA 3DVAB 2HV7A 1ISGA 2JHPA 5HF5A 2JGEA 1HFKA 3U3RA 1QX3A 3IHLA 1QXSA 1Y9AA 4W7HA 2XB8A 3GZNA 1WSDA 1AD2A 1WMFA 1BE8A 4BO8A 3PEWA 3BEHA 3LLCA 1L4HA 2OVBA 3ZWCA 4OD0A 2QQFA 3VGPA 2DCUA 1L7BA 5B30A 3BVPA 2RGRA 3HE3A 2VK8A 1HURA 2FQXA 2ZAIA 5D86A 3TSAA 3HXMA 2OFOA 4F96A 2NACA 4CEIB 4HEQA 1F2UA 4EKIA 5HRUA 5HGXA 2XMQA 4EECA 4Z4QA 2G72A 1Z0AA 2Q7OE 1N5MA 4JXXA 2F9LA 4DBRA 2ZXRA 3DF7A 1FNNA 3CLTC 1YASA 3OBIA 1NXPA 1WB6A 4BJ1A 1JXOA 1DDIA 2OXIA 4B1FA 2H1FA 4MWZA 3SQXA 4K9KA 4PZ0A 2YVLA 3TX2A 4S0XA 2YUTA 5EUBA 4PXSA 5TS2A 4ILKA 2CDCA 4Q4AB 3OETA 3DT9A 3QPAA 3LUTB 3L18A 2A0BA 2B92A 4Y6LA 3OPYB 3ZHBA 3W8RA 1GPBA 3IKMB 1T25A 5HQTA 1FBNA 1R2QA 1WA5A 2G76A 3DTTA 3OLZA 2G36A 2WFLA 3IURA 4XGRA 1NV8A 2R7WA 2DB3A 5AVTA 4HLUC 3CUTA 4EMTA 5K3DA 1FYXA 1JIXA 3EJ6A 3NKDA 3OPYI 2HWUA 5ENVA 1CJCA 1ZOPA 3M83A 3HEBA 4QC2A 5C7OO 5KTMA 4DA7A 5KTKA 3UANA 3PYEA 3FSGA 3IILA 3BCRA 4BNMA 3MGGA 4W8GA 1KVTA 3O55A 4MYDA 1V5WA 2FP4B 3JAWB 2LIPA 3H7AA 1BFUA 1SB8A 4U8GA 2VCHA 4AL1A 2XUAA 3JQFC 5HFJA 1M6TA 1RYYA 1H8HA 2FLKA 1N5KA 1Y8RB 2FR1A 2ZSAA 3IOBA 3B85A 4OTZA 1UZLA 3ZV7A 2EIKC 4YASA 3KYDB 5KC8A 3MW8A 1UBLS 2DCMA 3K9LA 1N6NA 1JJ7A 1URPA 3AF2A 4QXMA 1PK8A 5CIVA 1TPYA 1PUIA 2RI0A 2R05A 3QVWA 2IIBA 4H7HA 3WGNA 4O2RA 2TMKA 4LCBA 2NQ2C 4LHXA 3FPGA 1F7UA 3KKPA 3CTMA 1D7AA 2PZAA 3CVYA 1BR2A 4MVJH 4DV0B 4E18A 2A6EF 1CEQA 1K08A 3ONEA 2PEZA 2ZZNA 4YS6A 1OXMA 3CAXA 3DNFA 4FAPB 3KOZA 4UHCA 2D5IA 2ADOA 3UTDA 1I94E 3DPIA 2WJYA 5LMNI 4DV0I 1FB5A 4IO1A 4POOA 1YH8A 3PD1A 3OQOA 4B3DA 3GCDA 3KQNA 1Z0GA 1JWLA 2H2AA 3I83A 2HQOA 3VU9A 3RTCA 3CLRC 4R3UC 4PWZA 1QQ6A 2GKGA 2ZXPA 2HA3A 3N8HA 3ONVA 2XZPA 1XCBA 2DH5A 2Y27A 3EVCA 3IVAA 4UCWA 1LKZA 2VNAA 2NN6F 4I9GA 4TRMA 2AN1A 4M9ZA 3GD7A 2C7BA 3WRWA 4NH0A 1MV8A 2VA8A 1XU7A 1ZP6A 1KYZA 1GNQA 1H93A 4AJ2A 4AMUA 4XTCS 1FFBA 5TIIA 3CR7A 1XCJA 3ZX4A 2A35A 1C0KA 4ACBA 2MSEB 3GCMA 1QVZA 2R7KA 2ZJ8A 1N2HA 2RCNA 2BEVB 4I5DA 4YJHB 5K36F 1DELA 1ZPDA 3KEQA 5IASA 1HNXI 2F3PA 3BSSA 5B5SA 5AJHA 1Z9BA 4KMSA 2ISQA 3QLUA 4LWQA 4L5JA 4F4FA 4MX8A 3T1YI 1JR2A 4DLKA 2ZIXA 4TMWA 4KHPE 2YJ3A 3CLTD 1YT5A 5SZHB 1KORA 1Q0LA 1WDWB 4R40A 2Q3CA 2O2DA 2QRZA 1IBLB 4MTOA 3M9LA 1D0IA 2G5TA 1CZKA 5FTMA 3RYCB 4DV6B 1S0UA 5DGCA 2EPOA 1ISHA 1ESZA 1IBLI 3S1LA 2XB4A 4FGLA 3A9WA 4U00A 5BVHB 3F5FA 4B6OA 1USGA 4L7VA 5KHLB 3UAOA 2G07A 5JXWA 3DJYA 4DV6I 2VYFA 2XXJA 2C0CA 3ESXA 3K70C 1XWWA 1E9FA 2KX7A 4KYUA 1W49A 4ZKEA 1IPHA 4XSVA 3PDUA 1M7BA 3F6YA 1TPZA 1N3IA 3L77A 5IJ9A 4OXIA 1EXDA 5BO5A 3OP1A 4YBRA 1VKNA 3OJEA 1NSTA 5KB3A 4YB8A 5IEBA 4UHHA 3BMOB 1HK7A 2QXTA 2RI1A 5AKLA 1AQYA 2RHHA 3MWDA 2Y9MB 3L9XA 3OE1A 3S99A 2CXXA 1JHQA 2FF5A 3A6EA 1OGYA 4U0KA 1T0PA 1G8GA 3PGKA 5EOVA 4HRXA 4CEJB 1QGUA 2FN3A 1PWEA 4Q3LA 4KSYA 2E5LE 1BYIA 5ALVA 3ANXA 2IUEA 2ZJ5A 1NF3A 4LF6B 4RZHA 2JHGA 4YT5A 2UKDA 2ZRLA 4YHHB 4UPEA 4NY3A 3FPEA 3KKOA 2AP3A 4L72A 4UTRA 5B1DA 3I4FA 2ATXA 3VPSA 4IICA 4KPFC 4LF6I 5EMKA 1U8XX 1OC2A 4YHHI 3K20A 2ZR8A 2GESA 4E5MA 2JI9A 3ACCA 3V8NA 3WKBA 1QRRA 3LLSA 1IHPA 4LBVA 1J70A 4DPWA 4O3FA 1Z5CA 4TXNA 5KHOC 1TLFA 5FO0A 5A06A 3VYVA 1IN4A 3MGCA 2ZBUA 3PQ6A 3CLRD 2IXMA 2NTYC 5DBGA 5BSMA 1YVIA 1C80A 1WTAA 3AEKB 3OTIA 2P90A 1FJGE 3JAKB 4F4BA 2XVZA 3W5DA 2BC5A 2VFAA 4MVJF 2O2EA 1LZKA 3QE9Y 3BZUA 4C4OA 1LRKA 3U56A 4RSMA 4HWTA 4ZCQA 4B46A 2GNAA 1U1GA 2D54A 3UATA 3RHSA 2O07A 3RODA 3M9WA 2QMUA 1QZTA 1GNPA 4MDHA 5JI2E 3K33A 2M64A 1SG0A 1EJ2A 1PP4A 1U9YA 3SXUA 4D9GA 1I24A 5K6AA 5B6IA 1Y8AA 3RVDA 3EK2A 1FL9A 3HRKA 3CT4A 4KH0A 2DBZA 3PJGA 2ORED 3NM5A 3FAJA 5T3TA 5LL6R 4GC5A 1AKVA 3P9ZA 5HUQA 4IS3A 3EPKA 4TYNA 3FOAA 5F1OA 3DMHA 1TJPB 1J0DA 2GZRA 1ZCJA 1HF3A 5GM2A 5FL7A 5F2EA 2HYDA 1AUVA 1E3IA 3UK2A 4BAZA 4MTGA 1VE7A 3EC1A 4OFZA 3T1OA 3IQIX 3KL2A 3QJYA 5FBWB 1QGDA 2PQ2A 2O2HA 3WU5A 3DPUA 4BQOA 4KQ9A 1O96B 4GU5A 4YT4A 1UMBA 4MGHA 2WT4A 4E33A 2HT1A 3X1YA 3KUXA 2GTHA 4ER3A 1FPMA 4L50A 1AQUA 4R2LA 4Z4GA 2X0DA 4W5NA 4QGHA 1X7XA 1L5RA 4C3DA 3RC8A 1EQ1A 3K70D 1NX6A 3BILA 2O4UX 3IB3A 1WDMA 3EDCA 4I4TF 2B94A 2GUWA 6ADHA 1ZH8A 4NCNA 4BZWA 3NYMA 3EW9A 2VXOA 2X1VA 2W8BA 4MUXA 5CIQA 5AM1A 4U0JA 1QH8B 1FS4A 2EKQA 4RIGA 3N7UA 4PWYA 4H7KA 3ZC4A 3I9KA 1T26A 1EYZA 3COYA 2G08A 3LHFA 2VCCA 1ZR2A 4DMKA 3PDHA 4LXGA 5DN6D 1ZQ9A 1MB2A 3HFGA 1M1NB 2HMVA 3CUYA 2VC2B 3Q8WA 3EHEA 1MO2A 4MUMA 4OGFA 5ETJA 5KOHB 3I42A 3IOCA 3T6KA 4EK9A 6ABPA 4ZVSA 3O4VA 4KPEC 5HQ3B 3EGXA 3MERA 4XIFA 4YDHB 4RY9A 1XZEA 1Z7YA 3T1NA 1JXQA 4QBHA 5J23A 2QDXA 4M87A 1G8XA 1AF4A 4K86A 1XEWY 4FCVA 2FMUA 2HRZA 1Y42X 2JIQA 1Z5NA 5EJ9A 3NC0C 4Q1EA 2O7VA 4GNRA 4E5YA 3GLSA 1ZW1A 3WGLA 4Z2AA 2A2ZA 4N49A 3CCBA 4I1VA 4U7HA 1AXEA 1HR0B 1NN0A 3QF7A 2IYSA 3G2NA 2P9HA 4IFDF 3ASUA 4JHXA 1U99A 3UUGA 1WHTA 5ERGB 4B44A 4AWBA 4DUGD 1PEYA 4B6PA 1SNYA 3TRIA 2BMFA 1HR0I 3UHMA 2WYHA 4AJNA 1JEDA 1TKBA 2Q1UA 3G7UA 3RO7A 2R7MA 1KZHA 2NSLA 4RNDB 3SC4A 3C5VA 3WGJA 4EWLA 1FYDA 1W1IA 5AVSA 1PCXA 3EYAA 5AHRA 1E3PA 4MIKA 1F2VA 1PVVA 5FLEX 3B48A 1ZK2A 5T3UA 3AEUA 1U6KA 5B58T 4EJFA 2IYOA 4A1FA 3N0RA 3I8OA 4GGMX 4YL3A 3VO9A 5LZ5A 3RUAA 3BHIA 4DA0A 3BMNA 4YK7A 3TD6A 2QDKA 4QBGB 1ODKA 4C0BA 3BFJA 1NUTA 1KC1A 2PCLA 1IHOA 5BRAA 2I2DA 1R4MB 2PNMA 1UPUA 1XYGA 2WTAA 3WDLA 4JX9A 1ZN8A 4JI1B 5C51B 1TCVA 3A1UA 5DOZA 4DJTA 2B0CA 5L45A 5TEWA 3FE2A 2GHTA 1SQFA 1XKLA 4WESB 1NQUA 1ZVMA 4PLPA 3C98A 4O02B 2GM4A 4JI1I 3G5LA 2IOPA 2VATA 2V0NA 2WVQA 2ICAA 3F3SA 1A9TA 3GG9A 3G2LA 2OM2A 2XYQA 2NO5A 2C0QA 5IVDA 1S3GA 3VTFA 1OWMA 4M9RA 5IT9Q 3R44A 4DV3I 3VYTB 5B2ZA 1SU7A 2P9EA 1R37A 3ZGNA 1NUAA 1EGHA 3ILSA 1UJ6A 3C6QA 4PU0A 2Q62A 4W8KA 1DAIA 4QTZA 5K3EA 3H83A 2XZTA 1JPVA 1GPLA 2BL2A 2XSZA 2PX5A 2V7UA 4H54A 2YXNA 5BN5B 3HVIA 1H2ZA 4IYRA 1OGIA 4I1OA 2PXAA 4G2NA 2DPXA 1EK5A 4R81A 3RARA 3EY4A 3G89A 1CUWA 5LNK6 1ZGHA 2Y1WA 3JS5A 4MS1A 2CVPA 1BH6A 3H3FA 1TR2A 4MPTA 2Y1FA 4ULVA 4LI3X 3G1UA 4QWMA 1DKPA 1VLZA 4YP9A 3C3KA 4XW2A 1E0KA 3K8OE 821PA 4MVQA 5CDHA 1XEWX 1O3YA 4XUGB 3R7WB 4XLZA 4FGKA 3PTZA 5EXTA 5EFOA 4EGSA 1V0JA 3BK2A 1UBHS 3X1WA 4QG3A 4M0UA 4FMPA 1FRVA 2DHQA 3A4IA 2W6JD 3FPFA 4HH0A 4KGVA 4WI1A 3HL4A 4R1FA 3GZNB 2C07A 3NCHA 3IVCA 1ZW2A 2YQYA 2Y3DA 1G4HA 1B26A 4CF7A 3ZY4A 1A3CA 1SVLA 1P7YA 2Y77A 5LM3A 2V7XA 4FIDA 2R00C 2DQYA 4FE4A 3V6LA 3V8EA 1V3UA 5LP6C 5DGXA 3EFOA 4P3KA 2EKPA 1AS3A 2Z4SA 1F2UB 3OZCA 4TV9A 1NVUQ 3P4XA 3FDFA 5EVCA 3VH2A 4PG8A 1VXOA 3R09A 3H1AA 2HL6A 4P7JA 2YS7A 2VYCA 4LERA 1SXGA 3VJLA 1YJXA 1BE0A 3TD2A 2QX4A 4PNEA 4DVYP 3I58A 4ABYA 1KEWA 5C37A 5JE8A 4FW5A 5LLDA 4YN3A 3TULA 1B2LA 2HO5A 1VHQA 3GELA 3IT2A 4C3OB 3GVHA 3QUCA 1QGZA 4PX5A 4RCZA 3FZQA 1Q95A 1S2GA 4WSOA 6Q21A 3DV2A 3RKRA 4YT2A 3W4KA 2Q6LA 3RVOA 3PF9A 5EJIA 1Z88A 4PONA 3R5TA 5IANA 1OB2A 4TZ0A 3TZKA 3O8NA 1Y8ZA 3OH8A 1RHKA 4JR0A 2WFLB 5JS1A 1ZGBA 3VXKA 1NMZA 4IXMA 3T7TA 3BG5A 5KTRA 4XZ3A 3QYAA 3TZ6A 2JLZA 3U3KA 1LDNA 1Q91A 4X5OA 2QMEA 3BHNA 1Z0JA 2J4DA 2I76A 2Q1SA 3C6MA 2BT4A 5GY7A 3KQWA 5JRJA 2CLLB 3LDFA 3Q3JB 1XNRB 1Y7PA 3A11A 1CRWG 3OZFA 3PWTA 5FBHA 1ZUWA 4MEJA 1K1EA 2XUOA 4G26A 4MIEA 3ZZTA 4PQFA 3GJYA 2NN6E 4USMA 2HPAA 4D6YA 4WTOA 1XNRI 3VTKA 4X64B 3QFRA 3GEBA 7ADHA 1PTKA 2Z30A 1V1RA 5T6MA 5C5CA 1FSSA 1BEEA 1Z4NA 1EI7A 1XN1A 1QYRA 1AGXA 4MYHA 2VQEE 1E2UA 1JHUA 1NG1A 4X64I 4HWSA 4A91A 4PYOA 2JLSA 4IRUB 1L5VA 4BRSA 5K36E 3FUWA 4RK1A 3M6XA 4DR5B 4FHCA 1W46A 2ZSBA 5JDCA 4UBNA 3ADDA 1N3BA 7MDHA 5K8JB 1SIWA 3GAFA 3NI2A 4ZCRA 4XX0B 4IKOA 4UTNA 4IARA 1T3GA 3F78A 5H02A 3MYYA 1V74B 1SVIA 4DR5I 3VU9B 3AFNA 3ZN2A 4OHYA 1XTVA 2CYAA 2ZRNA 3H2VA 2VDWB 5JCJA 1UP4A 4JI6E 4MULA 3LTEA 1PR5A 1GPJA 2CEAA 1VIVA 2Q6VA 1RSZA 2DERA 1D2AA 3NT4A 1E6EA 2HGZA 4DMGA 3Q4GA 4N39A 3JD1A 2VDJA 3WYGA 2JAWA 1EDOA 1GFIA 3OHMA 1PBNA 3HSYA 2O1XA 4O25A 1C0LA 1DZ3A 1Z18A 3FCCA 3AVWA 1QKKA 5HVNA 2ZIZA 1RXYA 4DTIA 1ORHA 4OL9A 3AG5A 2R6DA 1SN7A 4FHDA 4Z7CA 1Z6ZA 4D45A 1MMGA 4GC9A 1V8BA 4B79A 1WXIA 10MHA 2HREA 2LUOA 3WB1A 1JFRA 2XI4A 2ZIXB 1D2RA 3E3OA 5IC6A 1JX6A 2B7CA 2IZ7A 5AI9A 1ZA2A 1LLCA 2VS1A 3ZG6A 3QBTA 1X38A 2DFDA 1TK9A 2RG7A 4KR0A