3HJCA

Crystal structure of the carboxy-terminal domain of hsp90 from leishmania major, lmjf33.0312
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
405
structure length
387
Chain Sequence
HKPLWTRDPKDVTKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFPNKKRNNIKLYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPENLQQNKILKVIRKNIVKKCLEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLKDYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDFEDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLSTSPCILVTSEFGWSAHMEQIMRNQQYMMSKKTMELNPRHPIIKELRRRVGADNDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the middle and carboxy-terminal domain of HSP90 from Leishmania major, LMJF33.0312
rcsb
source organism Leishmania major
molecule tags Chaperone
molecule keywords Heat shock protein 83-1
total genus 130
structure length 387
sequence length 405
ec nomenclature
pdb deposition date 2009-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3hjcA03
3.30.230.80 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3hjcA01
3.40.50.12450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hjcA02
1Y4UA 3Q6MA 2CGEA 2O1VA 1SF8A 2IOPA 2IOQA 2GQ0A 1HK7A 2CG9A 3Q6NA 1Y6ZA 3PRYA 2O1WA 3HJCA 1USVA 1USUA 1Y4SA 2O1UA 5FWKA 2O1TA
chains in the Genus database with same CATH superfamily
2AK2A 3W2VA 1KK2A 2PRSA 2QP4A 3L18A 1H6CA 1GTL1 1QQ7A 3SHTA 4YL0A 4IZJD 4ROTA 3AXSA 3DMPA 3G89A 4RABA 5B1YA 2PY6A 4OJQA 4W5HA 3FDFA 1EIWA 3E9EA 3NKEA 2PYDA 2Z4RA 3ZE0B 2I3GA 3W6NA 5IG2A 1P75A 4CG1A 1AZTA 3DQPA 4CJXA 1M56C 2O3ZA 1CY0A 2HDNB 2PT9A 2Z09A 3ROKA 1FRZA 3KZCA 4WK6A 4ASUA 5EKDA 2O0HA 4K0KI 3QU2A 3EEBA 3WYNA 1NT4A 2VAVA 2IPMA 4OHZA 2I2XB 2Q2OA 5CH5A 1SGWA 4A8JC 4INAA 2W7TA 3T54A 1CUZA 3ZXYA 4FAPB 2X1MA 2QM8A 1JIVA 3JCUQ 1PX2A 4I81A 4MR8B 4YAOA 3G6WA 3KVOA 4TLCA 1A5SB 3P5BA 1KH1A 4QPNA 1V95A 5JY1A 3W77A 5KMGB 1JJFA 2YQZA 3OQ1A 4OJTA 2WVJA 3G9XA 5C0XD 2C92A 4XR9A 1QG0A 1G5RA 3KETA 2PJUA 2GBFA 3K66A 1I4ZA 1UMCA 2I34A 2ZT6A 3LQ2A 5C80A 4XWWA 2P91A 2J65A 1SYQA 1IB6A 1P2TA 4FGZA 1LBEA 4RANA 5J9FA 3G8BA 4R40A 2WF9A 3AUAA 4P7AA 4TXMA 1HE8B 3IMGA 1K66A 3QWIA 3U3JA 1KMHB 4WRRA 5EIHA 2JKVA 4XRRA 2C58A 3IVRA 4AG3A 1A6FA 1IPEA 1KVKA 1DWPA 4R1LA 1B8OA 4EPXA 4ARBA 1WCIB 3DH0A 5JBIA 4Z4EA 1ABEA 4JI3E 1Z0SA 5H1YA 3TTVA 2PL9A 4ZOBA 2GETA 5L3RA 1OW6A 4C4TA 1KFKB 5EZQA 3L6RA 1V26A 2R6ZA 2WKPA 3LO8A 5IAKA 4B7AA 4JHLA 2M6SA 2O5EA 3MINA 4D99A 3IOMA 3ZWAA 5AD1A 3WA7A 1R66A 4OLAA 5FO1A 1HX7A 1WVGA 2ATVA 3DE2X 4CMIA 3Q1LA 4ZVPA 3KR9A 3AZPA 3QWHA 4FUQA 2PSJA 4RORA 4IRMA 1D1BA 4ISCA 3VU8A 4X8MA 4M9ZA 5BNFA 3WWZA 2HNKA 2Y66A 4FGSA 2ASVA 2XVAA 4I9HA 3RIPA 3VRHA 1CZKA 5D3MB 5E1MA 3ZJTA 2ECOA 3B5IA 1U3GA 5K0GA 9GPBA 1Z4MA 2E0IA 2HMWA 2Q8QA 3RR2A 3TB6A 2R6DA 3UWOA 4LDJA 3KSZO 4JLNA 1E3PA 1HXHA 5F5LA 5JO9A 3E82A 4IDCA 5JDCA 2EEPA 1XAIA 5DHFA 4RPCA 2Y3HA 3WU3A 1S02A 1FFCA 3CR7A 1NHIA 2B2CA 5LSAA 5D85A 3TZCA 1R9MA 3CSKA 5D92A 2A9KA 4EATA 3V7OA 2HU8A 1P77A 3ITNA 1IVYA 1YKFA 3BMNB 2I4MA 4XR4A 2W00A 4KJXA 4RVFA 4US0R 2F67A 3QLVC 4YPFA 5BW6B 3TOZA 1G9XA 1R4TA 1V2GA 5C1DA 1NZEA 2VJPA 2W2LD 3A7EA 3LGSA 3LBHA 4A2CA 2E85A 3SXUA 4B3SB 3UCEA 1B7GO 1JR4A 2YVKA 1RM4A 2QA5A 4GL4A 1G4AE 4YJ3A 3JASA 2OJED 1K3TA 3I73A 2K5UA 4S0XA 5ABPA 5LQAA 3QF7A 2ZRQA 3HA5A 3NC1C 1UDAA 3SQDA 5ICMA 5CD1A 5E0KB 1NFRA 4RO0A 3SVZA 2VFAA 2K2QB 4ID9A 4TWJA 3BIOA 2E5LI 1G20E 4CR7A 2PUDA 2HFIA 2IH2A 3Q5DA 4L9WA 2FSSA 4Q3DA 3OQBA 1V3TA 2OI2A 1YB2A 1DX4A 2J30A 3ABRB 2D13A 1RYYA 2YZKA 5BMVB 1PT6A 1HO3A 3MCZA 1CJKC 4H6PA 4D97A 4WFQA 4DUZI 1TW3A 3FROA 3G23A 2LDXA 4R2JA 1NU9C 3OX1A 2WPNA 4Q0MA 1BJRE 3T3EA 3ZZ1A 3FOCA 1SHKA 4B4VA 3PC4A 5BOSA 5EKSA 3LRTA 1OPXA 3KH2A 2XDQB 3LY5A 4ETIA 2LDBA 4UCWA 1N7IA 1P31A 3R5TA 1M2WA 3VDMA 5K6AC 2IP2A 2GUGA 3PNQA 1PIEA 3KPUA 3RWMB 3TYXA 2PKWA 2V7PA 4QLAA 4OP2A 1RQ7A 1XI2A 2IQIA 4R8RA 3NV9A 2GVNA 3H9GA 3R20A 4P92A 1XPRA 3C87A 3HM9A 3WB1A 3TG2A 4B7XA 3F5FA 4DS3A 3VZBA 1J90A 1T2FA 2WUEA 3OZIA 1D9ZA 2QB5A 4KQVA 2FV8A 3GRZA 3M7IA 4PZYA 1BE1A 2DPYA 2VNJA 3LHSA 4JU9A 1M2JA 3FTNA 4BRWA 4C0AC 2ZSEA 1XYVA 3GMTA 2NUAA 3OQHA 2AKAB 3RAPR 2HBRA 3COJA 1RM5A 5KOHB 3SE7A 1LWOA 1WA5A 1RI5A 1JUDA 2XSZA 4YT8A 4L27A 1E1LA 4C4RA 3ICEA 3NEJA 3OZFA 4GP9A 2A0YA 2G3KA 1N25A 3K7EA 3BXZA 3SHVA 4RD1A 3V1KA 2W71A 1O5IA 5DCYA 1QDEA 1B62A 4OX9I 3IPAA 2DU8A 4HQKA 4J4HA 5TS2A 1MU0A 2QDKA 2PWPA 1UBNA 2QRMA 1ZSNA 3QOWA 3WGNA 3VKHA 1W6UA 3HFSA 2XRFA 1L7PA 3HBLA 3LS1A 1WEHA 1N5JA 3LRXA 4JBNA 5EWMB 1E8DA 7ABPA 2C78A 4C6HA 3ROXA 2GCIA 4ZLDA 2M9MA 3P0FA 4JJ7A 4P4SB 3P06A 4XIYA 4HMOA 4M0CA 5JEDA 3R3SA 3AVYA 1N78A 4BB5A 3WOVA 4EGFA 2PO2A 1XQ6A 1U2ZA 1U3UA 2IPNA 2KE5A 1JU9A 2EDAA 2HK6A 2XH8A 3ANNA 4P84A 3P9CA 3NIBA 4GXTA 4PBTA 4RZ3A 4WPGA 1Q74A 3QVUA 2FSUA 4DOMA 1AGPA 3KMIA 3L0YA 4MCHA 3FZNA 3WRXC 1VQ1A 2FR0A 5G41A 2V58A 2RAFA 2VNIA 1JKJA 4FCVA 3SYRA 4LFCI 4C7OA 1PGOA 2BONA 2WFMA 1EA6A 1EI9A 2O2CA 4GP6A 3OFND 1VLJA 3FCCA 2Q07A 4EA9A 2QMZA 3RAFC 2R1VB 1OIWA 3LPDA 2I8AA 3ANMA 5FCDA 4BKRA 4BYGA 4CLRB 3VZQA 4DE5A 4RF4A 3REQB 3H2ZA 3S1AB 5AI9A 2P6MA 2P41A 3EX7C 1ZC3A 2H9YA 2OM2A 2V2QA 2FH5B 1YNOA 3RI3A 2OPHA 4DQVA 2WD8A 4AUNA 4D98A 1M2VB 1U8FO 2QXUA 3KZNA 5FYQA 3RFXA 3ZHCA 5LLTA 2W43A 2P5UA 2XQJA 3R3UA 2OQMA 3RFUA 1WCV1 4UOZA 3A1TA 1E5TA 2JFXA 4M21A 3F49S 4O4HF 4OKGA 1CJUC 2VTVA 5F2OA 4ZYWA 5FAKA 2GJ4A 1BFDA 1C2TA 1QM5A 4FW5A 5BSUA 3DJUB 1T26A 4E08A 4OIRF 3OJEA 2C8KA 2EBHX 4FDMA 3ESQA 3GORA 3RAEC 2EFDB 1B8UA 1R2QA 1JH9A 3D0OA 1D7AA 1XYYA 3O9MA 1X7YB 2P9EA 4IHQA 4LWPA 1SCKA 4ZIRA 1NN1A 1W4BA 1XVVA 2VDOB 4DA9A 2I9KA 5DK6A 4E46A 2HADA 2XM0A 3FPLA 2WD7B 3N75A 1Y48E 1TVMA 5LWQA 4LZLA 1JXOA 2Q4BA 4Y7DA 5PGMA 1RLUA 1K9SA 4QRDA 5KNCD 2OYRA 2GLXA 2HF2A 3GDFA 2XUKA 3VDXA 3W9SA 2C7QA 4QDZA 4LSGA 1QSPA 2ZT8A 4L4SA 3Q8XB 3BTUA 4TV9B 2KPOA 2ZWOA 2CEKA 3QXSA 4I9FA 3OZBA 3SC2B 2NWQA 2W6ID 2WQ7A 3HPRA 1SXGA 5C8DA 1V5EA 2JL1A 2Y1XA 1FRFS 3RQFA 2ZM6I 5CI9A 5AC4A 1KIFA 2V5VA 4MS1A 4Q1BA 4ESOA 5HNKA 5EGSA 2BI8A 3SX4A 4BN0A 3U5ZB 3VU9B 1I9CA 2IZ6A 1EWVA 2GFIA 3GRAA 1MOQA 4GSKA 3KEGA 2LE0A 1Y82A 5DNYB 2IY9A 4MDEA 2LCQA 4CHTA 3WGYA 5H9VA 2IYYA 1EHCA 4X1YB 3RVSA 4JOSA 3MMZA 4J75A 2ZUSA 3J81Q 3F98A 4YJKA 1FEZA 1ZGBA 1P7ZA 1NN0A 3BICA 3LO5A 5DNDA 5DX8A 4PV7A 5TRTA 5DIFA 2IHJA 3L7DA 1QVWA 3JD3A 2RG7A 1IBLE 3DTYA 3BGSA 4MWSA 4FZJA 4ZANA 5TV2A 5EXXA 4C0QC 5C7OO 5C8XA 3DE4X 3QUQA 3KJFA 4J0JA 4OMCA 1FNBA 5D5QA 1OASA 3GU3A 3ZZMA 5CB4B 3RVLA 3BAZA 1EZZA 3H7IA 5HIAA 1VTMP 3V8VA 2RJ3A 4A0GA 1SUPA 3P45A 1I32A 2VJBA 3LKDA 4D3XA 1IL0A 221PA 2OCDA 3FGZA 3RANA 4EKEA 2UYQA 3S8YA 2C42A 3YASA 1DDGA 1VL6A 3IOEA 3MUFA 1J8MF 1TJPB 1X77A 2Y8EA 4Q3BA 3VTKA 5K09A 2CDQA 1Z0FA 2QLAA 4OK5A 1D5CA 3WYBA 5A2GA 1DU4A 4XIGS 4GBGA 2VCYA 4V0QA 1NMXA 2EBWA 2W9YA 4KUEA 3IT1A 4QLBA 3OQMA 1NQXA 2JLSA 4WK4B 2EV9A 2FMIA 2DQSA 3D59A 3D6UA 2PX4A 1GZ6A 2V8BA 1KC3A 3CRMA 3QFHA 1L2TA 2F1HA 2D2VA 5HMLA 1IMJA 1YFZA 1VPDA 3JCZA 3AC0A 3HL4A 3CHYA 4LQLA 4RM3A 3S1AA 3T1VA 1T15A 4WVFA 4ZO6A 1XQYA 1P19A 3P76A 1W35A 3PYLA 1PTKA 4TXJA 2FCRA 5B3AA 2BEWA 4ZI5A 2WYUA 1M6HA 1TFUA 2Y69C 4QOSA 1C3OB 3PUIA 4FOSA 1F9AA 3VR3D 3ZR4B 4H7IA 3FOAA 4KQXA 4IQ8A 2EJWA 2ANCA 1EP3B 2C5SA 2Y27A 5AVJA 4AXBA 1DAPA 1MABB 1T34A 4HQ0A 4MGYR 5MDHA 3F2IA 5I4KA 3WL6A 4I55F 3NHAA 2FW1A 4PZPA 5I4IA 3OPNA 3GBVA 1J4AA 3RS2A 5AUQA 3ZDYB 1R0WA 3SWWA 3L40A 4GW3A 1DT5A 1N2ZA 1X92A 4KQFA 3AXTA 2P2YA 2PO2B 3GR6A 4KXUA 3M5PA 4LSWA 4Q6WA 3FXHA 2DHCA 4UE3S 2WG0A 1L5QA 1X6VA 4QG3A 1OH5A 3RYFB 2W8BB 3FCYA 2K87A 4GWKA 2PR2A 4RVDA 2I4TA 3RRFA 4NNJA 4IFDF 2YHBA 4MV1A 1NUSA 4A4DA 2QYSA 2IHKA 1YJ5A 5BQ3A 3CWQA 2GMWA 3SEFA 2ECKA 3EY9A 4DMUB 1OAOC 2FWMX 4FMCB 2O5VA 4QTZA 4Z9BA 4NZPA 3QLVA 3VO2A 5BR8E 3ZV6A 4OOFA 1LSSA 2H0QA 5ED4A 2NSLA 4FEAA 2YHUA 4KH1A 1LWNA 4MJLA 5IDYA 1U0NA 5H5JA 3LQ4A 5C51B 1N5MA 3HFRA 2IELA 5JNLA 3EZ7A 2CHUA 5KU7A 1MIOA 5B7NA 2Q7DA 1UXOA 3EUEA 1PG0A 4DAOA 1R4MA 4IOKA 4XB1A 3ZUPA 3NPMA 3Q9LA 4C0BA 1A7EA 1S16A 5NLLA 3QUAA 3TULA 3D2AA 5EWLB 3UMGA 1DOWA 6ADHA 3EAQA 4F4HA 4CQNA 4CIDA 4XOUA 5BSTA 4QVIA 4YHHE 4RU1A 3ZK8A 2WYIA 3THYB 2IZZA 1SKBA 1W73A 2TS1A 3GCWA 4GOOD 4KUGA 5FPTA 3R9XA 4TYWA 1Q1QA 4G9GA 5JUAA 1T2EA 2OCXA 2X2FA 3BKXA 3DDHA 4HNGA 1KEVA 2IEBA 4ZU3A 1Q5PA 5TPWA 1HK7A 1M6YA 3IBGA 4KMRA 4ZMBA 2CNWD 3RFTA 2Z43A 5AICA 3BCSA 5JDIC 1TZJA 3TMYA 1SAYA 3KYIA 2GCOA 2IEGA 2XE4A 2PMCA 1MG5A 1XWFA 2LW7A 2ZJBA 3KEFA 4WKPA 5B64A 1UAGA 2IUUA 4OTZA 1HYQA 4L6RA 4LCEA 5EP1A 1E18A 1JDTA 3C1UA 2GBIA 4Z9XA 4MP3A 3IOCA 3U6KA 1XVUA 3N0TA 1ZGAA 2EQAA 2WJIA 2OMKA 3GF4A 3QE2A 1EXVA 3RVJA 3LUPA 3REGA 1VTKA 3MFNA 1R3UA 1Z4JA 3TLAA 4BGVA 3PUXA 1N5IA 3SJUA 4B8YA 3BXPA 4G5XA 2NVBA 3VOAA 4Z54A 4Z1MA 2XCSB 2NXEA 4YAIA 1Y63A 3V3KA 5AVYA 1U6KA 4W4TA 4DPMA 2RGEA 3WFZA 4ZOQI 3L7BA 4PSCA 3ZY3A 4NG4A 1C1XA 2EFYA 5K2MA 3THRA 3GDWA 2QMYA 1KRHA 4RXUA 5MN6A 1U80A 3B12A 3D64A 2UUBB 1M2KA 1PN3A 3AILA 1YSCA 3N28A 3C6KA 4P33A 4E14A 2BCJQ 3LT4A 4WGFA 3G02A 2VBIA 4J30B 1YL5A 4G78A 3LQRA 1MTOA 1WMSA 1TVEA 4HY1A 1IQ0A 2ACKA 1RCFA 2B69A 1LLCA 1A27A 2N42A 2W9XA 1IBMI 2RSLA 2J5KA 4IHKA 1AV7A 2C77A 3K9WA 1G3MA 1YDMA 4O0MA 4XGRA 3ADOA 3DMGA 2QROA 4GPTA 4EHBA 4C4XA 1KJNA 2R7AA 3PD7A 3B3GA 2A0FA 5B1DA 1EDOA 2FK8A 1P1KA 3A6JA 3PWZA 4FBLA 4QZVA 4DLPA 5GINE 4N41A 1A9YA 1C4XA 4C4OA 2QTNA 3B3JA 3ZCQA 2IA5A 4PN3A 2C39B 4N5LA 3VR5D 2NP6A 2Z5BB 1SY7A 3L8FA 3NIDB 4MS4B 4M1MA 4HB3A 3W2HA 3ZCVA 1VIDA 3FNGA 4JHXA 3BHMA 1FNCA 2BBWA 4JUIA 3VTZA 4LTDA 1HZJA 2IV2X 1DBRA 1WMFA 4OIPF 2H63A 2P30A 1Y1QA 2R7SA 1RI2A 2OVFA 1PR1A 5HPYB 3GLGE 5T3UA 3C18A 1CIJA 3R5XA 2QN2A 1W5AA 2VOJA 1S5PA 4MYDA 4R1PA 5FUYA 9LDBA 3OQOA 2FP4A 4HX2A 2VQFI 1R9JA 3ROFA 4KLAA 1RTKA 2AOUB 2AK3A 2H59A 4IL5A 4JODA 4TWZA 3VUFA 4DBLC 3FOFC 1TRKA 1WSDA 3QVZA 3BE5A 3OEEA 2YL0A 5AJYA 3VVMA 5J40A 4Z5XA 3L0SA 3O26A 5JALA 3CCCA 3OU7A 3G2KA 2R8OA 5D01A 2ZJOA 4G1MB 4ZICA 3PS1A 3CU5A 1E3WB 2PH1A 2IIQA 2O59A 4LF6B 3H4MA 5FWAA 2IWRA 4AQYI 4U0JA 2G9ZA 4Z4GA 2OPBA 4JMPA 2JLBA 4P0PB 4IV8A 2OXFA 3IEPA 4RY8A 3FY4A 4N1AA 4QGBA 5F73A 4OX9E 3L84A 3WHIA 4BUJA 4DM4A 5KYKA 5FTLA 1CERA 1OLOA 1U04A 1A9TA 2YASA 4NZMA 4YRLA 3UO8B 2DULA 2GFQA 4AC9A 1B0PA 2W4BA 3QKSB 1J33A 1EFPA 1AQLA 4R2HA 3PJDA 5D7BA 4C9BA 4F60A 4JGBA 4C29A 4DM3A 3KHUA 3KWJA 3ABOB 4YGXB 3ABSB 2FSGA 1DG9A 1C9YA 3ZWPA 3BXFA 3E9RA 4AQYE 3LGAA 1G8XA 1P0FA 1Y33E 3L77A 4J0HA 4AMBA 4CKCA 5BN5B 2H06A 2WMNB 4MR8A 4Q4DA 5JNSA 3SF8B 2APJA 3B8EA 2R2AA 2IYTA 1OOEA 2WFLA 2ZSAA 3E4DA 3K9GA 4Q7MB 1E4YA 3G0DA 3PUHA 2V2VA 3CZ6A 3H13A 3PGMA 3AF6A 5FHRA 1S8AA 2W5UA 4WERA 2VHCA 3URMA 1UIRA 3HXQA 3T6JA 5KNCA 2I2WA 2ODWA 3AEYA 5K3FB 1QYIA 1NVXQ 2UU9E 1U0TA 2D59A 3A06A 2HM7A 4OQPA 3WLAA 2W48A 1D0XA 4DKXA 3GEHA 4MKFA 5A3RA 3BEDA 1OLSB 2NZWA 2G9UA 3CQ9A 3DMNA 3D7RA 4BVJA 1IAVA 1SVOA 4H7HA 4UTNA 3RIHA 4H0FA 1XNGA 2JLWA 1IWPB 3AR4A 4NCIA 2D00A 1SBYA 1CUAA 2OHFA 3FETA 3QVLA 4MLDA 1QIKA 1BXRB 1GQFA 3MC1A 4NJEB 1VB3A 4WFKA 3RVBA 4D43A 1SR8A 5M04A 4QBGB 2OZLB 3KQKA 3EWIA 3DC7A 3ONWA 4GBED 3QV2A 2LTAA 1RADA 3KJGA 3OY7A 5EGNA 1QU3A 4ZJPA 1ONSA 4FOTA 3SLRA 2R5WA 5JT4A 3EVEA 2VWGA 2IDKA 2CC2A 3HWRA 2AYXA 2YC2C 3LTNC 3T7AA 4U7GA 3TDMA 4TTVA 1KQFA 2VRWA 1V7QA 1Z0KA 5EQFA 4I9GA 3I12A 3NDPA 4DUGD 3OTOI 1KKUA 2PFDA 1P2VA 1QBKC 2J9RA 3DM5A 1ZFNA 4TRJA 4CKBA 2OORC 3T9OA 1L5RA 2AYZA 1C50A 3LVBA 3OQPA 4O3FA 4TV8F 4TT3A 4DR1B 2RONA 5F7ZA 1P7YA 3D6VA 4WOCA 1V2HE 3LYLA 1KDTA 1P6QA 1ZO8A 2NNWB 3BGWA 5DHAA 4EH1A 3I28A 2VHZA 2BT4A 1ZAYA 1CQJA 1XNRI 2O2DA 3S2ZA 3FKQA 2ZAMA 3I64A 3KZKA 1I3MA 1N4AA 1RKEA 1ZKMA 3RBAA 1N6IA 4IX9A 3OQJA 4Z49A 1VE1A 2BCGY 2O4UX 3Q5GA 4M7RA 4R7TA 3V7YA 1MO5A 2EL9A 2GBPA 1E1RA 3QEMB 3OUTA 3T06B 4O25A 2CW0F 3EVAA 4HY3A 1RACA 5F1PA 5JZBA 1FJXA 5EP3A 4BAGA 3U7RA 5ED0A 3BAFA 2I6GA 5DNWA 1OBCA 3MJVA 5CDTA 1E5DA 2YY6A 3KQOA 2FUCA 3C74A 2Q6OA 1SCIA 4IUDS 4LX0A 2AR9A 4M88A 4WCFB 1O97C 1N1MA 4DV6I 3AGPA 3NRHA 3HABA 4LJLA 2P9TA 2IHYA 1GZUA 2VHYA 2M32A 4KHPI 1Q44A 3ZGZA 3G8YA 4LRWA 2MU1A 3M9LA 5CB0A 4OO1E 4PC7A 3W2IA 2EF1A 1DARA 4NICA 5BQHA 3UV6A 1U4OA 3VAYA 5AKHA 3RVZA 1H2XA 4A7PA 1BMTA 3KLBA 4A92A 4YWQA 3P4XA 2VBGA 2V7XA 1DXOA 2NTVA 3JQFA 2J0UB 2FPIB 4HAOA 1H2WA 3GQVA 1AKMA 3RB8A 5JAUA 1KFBB 1XRRA 2CDAA 2FDRA 2GCOB 4BRUA 1W88B 3HJAA 3QT7A 2VDUE 3DPUA 2WLSA 4LBWA 5HE8A 4JI3B 1YIAA 3ZQ4A 1U2TA 1JWLA 1S3GA 5HBRA 1EQ1A 3WNBA 1ZHFA 1Z4QA 1CF9A 4DVZA 1NLFA 2GO1A 2PZ8A 2O2YA 2JEZA 2Q1YA 4DY6A 2A1IA 4KLNA 2MMGA 2F4VI 1TM3E 1W9HA 3O3NB 3QEAZ 3BYZA 1QX4A 3IIIA 3HB1A 4FK8A 4HE8D 4IKOA 2YN0A 3WGQA 3TS1A 4CS7A 4BPBA 2NO6A 3ZK9A 2VSFA 3AUXA 3ZPXA 2EW1A 3NWBA 4OGKA 2X0EA 4LOKA 3CF6R 4ECEA 4UBLA 4MHOA 1PR2A 4R8KA 4HUTA 5KC9A 1G7TA 1SHJA 2F2TA 3JQAA 4LF7I 3QU9A 2A14A 1N1GA 2WD7A 4R7GA 2QL6A 3AHFA 4L5JA 3QFRA 4MRPA 4BE9A 5CLJA 3FJ1A 5DN6A 4N6CA 2I2AA 1G63A 4TMWA 3QA9A 1BU8A 3WB2A 2HHAA 5LOVB 4BB0A 4MJ3A 3RW0A 5AW2A 4R1NA 2VJMA 4UVEA 5G0TA 2WV9A 4U0KA 3W3AH 3WB9A 2FGKA 4MV0A 4DCNA 1YJXA 2JH3A 5K8TA 4A36A 3NT2A 3QEOA 2SECE 2G40A 3ZZUA 2ZGVA 3OJOA 4K46A 3R6LA 4OBBA 3UJBA 4LDKA 2IYEA 3ED1A 4M99A 5IYZB 2JLZA 1CUCA 3BGIA 4M9RA 4PYIA 5M2QA 4DJ9A 1O9BA 4KTTE 2FTKE 4Q12A 4EI9A 4CEJA 1Z39A 1E7RA 1I3KA 2I29A 5HWSA 5K45A 1ZN2A 3AQIA 5BR1A 1E9SA 3L8DA 3PI6A 4DXLA 1VYKA 4JYAI 4CX9A 1J9ZA 1VL5A 3GJ6A 3VSAA 3W5JA 3ILVA 4JKOA 3HKBB 5KAMA 2JHFA 3UN1A 1JALA 5AUNB 1NVMB 4MVXA 4OQNA 3T0FA 4Y98A 3AUSA 2VHWA 1SUDA 2HSQA 3UOGA 3WLIA 3PEWA 3EA5A 5ADWA 4JV5I 2V6MA 2EIMC 2FN4A 3D8BA 2VQ6A 4ZAFA 2OP0A 7YASA 4EG3A 5FPPA 1P5JA 1TYDE 3B2QA 1P3Y1 2FWRA 3L93A 1L5GB 4DVJA 3IMEA 4ZAGA 4LK3A 3QFTA 1R6TA 1DXYA 1EDBA 5I7RA 3RVYA 1OLUA 2V7TA 2PSFA 3P94A 1ZYRF 2WSBA 3VSDA 1JFVA 5E2IA 3F6YA 4OY3A 5DEOA 2XXJA 3F6EX 2DUNA 3D6MA 3FHOA 4J90A 1GSIA 4B7CA 1PVVA 4E5PA 5IWAI 2ZUCA 4RIIA 4PYNA 2YL1A 1NVBA 3BG5A 1P1BA 2XNSA 1D5WA 4F5WA 2CVFA 4G0QA 1IWOA 4OP3A 4KXVA 4JY7A 1CXZA 4XLPF 1Z5VA 5ALHA 2ES4A 1KJWA 2BHNA 2XUHA 1MMGA 4NV1A 3ROPA 4Y2YA 4I5DA 3B78A 4G41A 4MAFA 2A88A 5HCIA 4AF7A 4S35A 5JI3E 1DHTA 1JHUA 3CVYA 1HI9A 1NVFA 2P9QA 3NDRA 3QY9A 4P2BA 2RHLA 3W5BA 1E5VA 3AESB 3F5QA 4ALNA 3NBKA 3VJLA 5HZGA 4OLFA 3IVMA 2GWRA 1HRKA 1HZZC 1MX9A 3FGNA 3KTFA 3OG9A 4TYPA 2XUFA 4DEVA 3F6RA 3PQ4A 2V34A 1EVKA 3U1KA 3CAXA 1T43A 3RAGA 4BNXA 2WKSA 3HVUA 1WBBA 1N7JA 4CGYA 1HT2E 4LJYA 3C6QA 1Y6QA 3FYUC 3UXEA 1O94C 2WK1A 3EGOA 4MB0A 3JD2A 4XYBA 5DTQA 1E2FA 1U2DC 2B8WA 4PZ0A 4WNAA 3J80Q 1QKKA 2XMCA 2Q50A 1U0RA 1P5ZB 3TLGA 5CRIA 3G5MA 1X1EA 2OGZA 3LUGA 4AY6A 4LHZA 2IIVA 2VDRB 4TV9A 4ZO8A 2GM5A 1WG8A 2X8JA 3BC1A 2OCCC 1YV9A 3OT5A 4BLUA 1RRMA 1CGNA 2KNHA 5AM1A 2BTEA 2R7NA 2C3MA 2J41A 3IKLA 1WF3A 2IY8A 3VPBA 1E3WA 3P2YA 1B73A 4CS9A 4MJXA 5FPYA 1UC4B 3A3NA 2XDQA 5JBNA 3THWB 3ZNQA 1QK4A 3JYHA 1L1EA 2A1TS 2HB6A 4WY8A 2BSXA 3RVPA 2EARA 3V4VB 2JJ1D 2AS0A 4QUJA 1QRAA 1NE2A 4C87A 3NHSA 5TNXA 2J67A 2QORA 2XTNA 3OOYA 4ZCIA 3PRKE 3NIFB 1HW2A 3NGLA 4UXJA 4YONB 1CDDA 1GEEA 1ACLA 1BA3A 4OGGA 2BGMA 5HIMA 4K88A 3W0LB 3FOPA 1J0CA 3CY6A 1EM8B 2FA9A 4JKVA 4KXWA 4Z0NA 1F6WA 4KPFC 3IV7A 1AZWA 1LI7A 2DBZA 4R6XA 5BV8A 1V16B 3V7WA 1MAUA 4K9DA 5LZ7A 4UUQA 1Y5MA 1CYDA 4XB2A 3MTJA 4FMCF 3R8FA 3W4JA 2X22A 3DFIA 4ANJA 2DKOA 2CB9A 3IP7A 5FD8A 4EK9A 1OFTA 1GAEO 5EEGA 3NMJA 3QMKA 5DI3A 1DBQA 1ORRA 2WZLA 3RSCA 1KL7A 3LDAA 3PGVA 1XMPA 4F06A 1Z2EA 4PQFA 3MLEA 3TSOA 1V8DA 5CDGA 1UR5A 3AG4C 1UKCA 2RHWA 3KTAB 1A9PA 3D43A 2XF2A 3O5AA 3P71T 3R4VA 2WJZB 4FYWA 4OBEA 1NVTA 5G1NA 3M5CA 3GJQA 3SC6A 4OBWA 5AUPB 1I51A 1XHLA 1U3CA 4MV5A 1TD1A 3V5XA 2HT6A 3K33A 2OCKA 2UYOA 3CJRA 4ZT2A 1SUWA 2ZSFA 1KPIA 3ZWNA 2KJQA 2Y1WA 3PKZA 1DBWA 4L2IB 1JWAB 4RJTA 2JVIA 1N2JA 5KU1A 1M2HA 4OQ4A 5A0FA 1Y6FA 3KJHA 4JCOA 5JFTA 1RQRA 1QHHA 4KIGA 4HH3C 2PO7A 5K8VA 1ECGA 2HJRA 3DKRA 4UM8B 2VH2A 2VATA 3L5OA 2CXPA 3NBMA 3O4HA 4G1FA 4BPMA 3LDUA 2CXTA 3ADBA 3FHLA 3WWCA 1RHRA 1APCA 4URWR 3AM1A 1C4KA 3MOSA 5KJ6A 3HLKA 3JQ7B 5JMOA 2YS6A 5TIIA 1P39A 1DX6A 1ZD2P 5I7FA 4K6GA 5A7GA 4XWYA 5D2CA 3HR4A 2ZRDA 4I1MA 3F5SA 3WRVA 5HHTA 1CJTC 2UKDA 3AM5A 4IKPA 3PFGA 1T2DA 2I15A 2LGJA 2FAPB 3DDNA 4F56A 1A8QA 2Z6AA 1SHLA 1WGWA 2AI2A 4HZIA 4YRPA 1IBLB 1P7PA 3DE5X 1TYCA 4P93A 1VJ0A 3BGDA 4OQXA 1URPA 1K7CA 2WIJA 2DUUA 2Q5EA 4IIHA 3Q7QA 1T8WA 1UCFA 4B4KA 3K1AA 3K5HA 4DXDA 5B2FA 2R85A 1NJ8A 1QGDA 5CUQA 2QRJA 2HMAA 4OM7A 1JIXA 1QP4A 1QRRA 2GYVA 4LE0A 4N49A 5IVDA 2FPLA 1IG3A 4HQRA 1EJBA 1Y3AA 3OSUA 1LLDA 1RHJA 1DWUA 2V5AA 4FSXA 4QG7A 3JRTA 4LF4I 1XCBA 2HW8A 4B9EA 4H77A 1ST3A 3VH1A 3DOIA 4DV6E 3BRQA 3HJFA 1PRYA 3I62A 3FPGA 1K97A 2WWGA 3K1TA 1JH8A 1PNOA 1V8FA 1Z5PA 2D0DA 4A5OA 1G21E 1XL0A 3ON5A 1FYVA 4CWAA 1Z74A 2P0EA 5EFZA 2WUFA 1DP4A 4LFAI 2R62A 3A10A 4N0QA 4TRMA 5GTDA 4PRKA 4G26A 4UEOA 2R65A 1E1KA 3GEGA 1H5UA 4XDYA 2ZJ6A 1AKRA 4V0ME 3MT8A 3STUA 4PAQA 1UDBA 2J0EA 4BZXA 1AGYA 4BP1A 5DBGA 3OMLA 2YMQA 4OIQF 4PSDA 1NQOA 1RC1A 4XE5A 3U4HA 3SLKA 3EIOA 5A3JA 1JYSA 2AF4C 1QCCA 1H0HA 2FZEA 2XGOA 4GOLD 1P9WA 3V00A 4FCTA 4X1KB 1D2AA 1L7OA 1MJGM 2ZYVX 3AVQA 4AN4A 1RC8A 4Y67A 1OVMA 2R6JA 5HCNA 4JITA 3DB1A 4PYMA 2D2IA 3HGQA 3LPSA 2AVDA 2X5NA 3IAS6 4LS3A 4NS4A 4CIYA 3O8NA 1NPDA 1WHSA 4MWEA 3FHCB 3GIWA 4NOKA 4QUGA 3SXUB 3FH0A 3PFHA 4RZUA 1FAPB 1GL7A 1TKBA 4NBNA 3ENZA 4TMFA 4B80A 4F9GA 4MQEB 1VPLA 3SQWA 1MNEA 4L5IA 1UEJA 1M1YB 3K05A 2BFMA 1F51E 1KVSA 2GB4A 3DLAA 3OECA 3R0JA 4UBIA 4H17A 4UTXA 2IF2A 1GYRA 3PHCA 5K0JA 3EWAA 3K2BA 3THXB 3OC0A 4ER0A 1VKNA 3DDZX 3W8HA 2AEMA 4MRRA 3VXKA 3GWZA 5KNBA 3A58B 1P0PA 4LHVA 4EG6A 2KK1A 3DEFA 3U1YA 2NM0A 1EEHA 1D0IA 1QBGA 3BMCA 1BCSB 4A2NB 1P9NA 1GA6A 1SC3A 3C7AA 3SNHA 1MLDA 2O8VA 2XE6A 3DFFA 3HA2A 3P32A 3TQHA 1NC3A 3NTVA 4PLWA 3ZV5A 1NXQA 4BTVA 1VHWA 4PXAA 1L4UA 3FNRA 3PYEA 3KAJA 4JJ4A 3W04A 5FX2A 4FFBB 1YTLA 2GASA 5DLDA 1JFFB 4U6SA 3UYKA 3FTPA 3I83A 4ZDIA 1QS0A 2FF7A 3FDZB 4KDRA 2JBWA 4X64I 3DE3X 4DU7A 4RIFA 5DGIA 4UUPA 2J6HA 2Q28A 2BHLA 4BNGA 3EPJA 2H6EA 3NR2A 4W1RA 2C9CA 3NYJA 2WU3A 4MUIA 4RY0A 3V32A 3FCEA 3L0IA 2QRKA 2ZWVA 2PX2A 3U1BA 4ODIA 2Z9CA 5ALJA 4BWGA 4AMUA 1X8XA 3DOHA 4CLEA 5JHHB 2CY0A 4BGEA 2NYRA 4B3IA 2IE0A 1OXUA 3QJGA 4HDNB 4FDTA 5FULA 3Q1KA 3RRYA 3OCVA 4HBZA 4D4JA 3FTQA 2PLAA 3KE9A 5KS2A 5AI4A 1MDFA 2GOYA 4FWDA 1WDTA 3MB5A 4CTKA 1RP7A 1ZRHA 2P35A 1ODKA 2GEVA 2ZRIA 3O21A 1P1IA 1TRHA 2CXSA 4KVFA 1J5PA 1G2PA 3PFNA 3V5YA 1FW8A 3JQCA 5M7EA 4Y2SA 2X1LA 4MDFA 4FOLA 2WQ6A 1IN6A 2BTQA 3B1VA 5FRDA 2F8LA 3L8EA 5DS6A 2HLNA 2P9YA 1QAMA 1DXHA 1PQPA 2X8LA 2ZIXA 1EAMA 3MUEA 4LYFA 4TWAA 5CXXA 4AJNA 2FLWA 5ICSA 5F5FA 3EIQA 1VJTA 3GARA 4J9UE 1PJSA 4DA4A 1F8GA 5KVQA 2UXCI 2NZUG 2ZE8A 1Z47A 3U62A 2FNAA 3WU4A 3BB3A 3NWOA 4IYRA 3RS8A 4ZIRB 3VX4A 1U7TA 4L7VA 3ZDRA 3KBBA 5KUTA 1CLUA 3EQ8A 3E9DA 1EUCB 1Q20A 1PVOA 2EZUA 3OO0A 1F06A 1RW4A 2IEAA 2NU9B 1RJFA 4WN3A 4Z9YA 3WY9A 1V35A 3UGOA 2VHEA 2YN4A 3B1KA 1A82A 3IA7A 5CT6A 4JEHA 3DCYA 2B99A 2GZ2A 1T1RA 3EDMA 4GG1A 1BWQA 1MPTA 3FTFA 1N36E 1W4LA 2C5BA 4BLOA 2ZVPX 3ZW7A 4CM1A 1EGMB 4BFUA 3UK7A 4TL6A 4CYMA 2FPMA 1NPTO 4HXYA 4HYTA 5K0NA 4LRQA 4YP7A 2FCAA 5JZMA 3KHTA 2H0AA 5L6LB 1DQPA 1LLUA 1W29A 4PFJA 4URHA 3M5WA 1UPXA 3DVAB 4R9NA 3WLKX 5IRCD 5A6VA 3SBEA 2IS6A 3TKAA 1EK5A 3JV7A 3VKWA 5LMNI 1U0BB 1IM8A 2QN1A 1RFLA 2VDJA 1VLHA 3K73O 3JQDA 3DFKA 3OJCA 2JFFA 3DJFA 1QRUA 2O9JA 1T9DA 1Z68A 3N53A 4LZNA 2IZ7A 2VOEA 1MC4A 3BRWD 3I2GA 4HHEA 4OK6A 3JSEO 1CZLA 1UXHA 2IEIA 2J9YB 1L7NA 4GGMX 5FOVA 1O0BA 5KQMA 1E2QA 2FN8A 3MYFA 1IRXA 2WZFA 2P79A 4HB0A 1YQQA 3OPVA 3RS4A 2FYTA 2UV8A 5FBKA 3TD7A 4BA1B 1KARA 2CHFA 2HIMA 3Q3JB 4PTYA 4IFBA 4KXMA 5BNWA 4TRRA 4C3DA 1A9SA 1KOJA 1IXYA 4LI3X 2DWQA 4M0MA 2MSEB 3GXBA 5ALVA 3M49A 3O31A 4UBMA 3PHIA 2ZE7A 1UZUA 3FUUA 2QP3A 1SBHA 3E6AA 4ITVA 1I10A 4OQYA 4UVGA 3DAYA 3EUWA 1HTTA 1E0DA 4LF8E 2JIMA 3BWMA 1MQAA 3M70A 4HCJA 5F51A 2QPLA 4AJ9A 1NULA 1UANA 4GNRA 4TXHA 1ORYA 1V4NA 1VP3A 2C1XA 4RCYA 4MR9A 2YLDA 2NN6E 1TW2A 2YWJA 4IOMA 3UB3A 3WJ7A 2QVCA 4MUEA 4UPDA 1SVMA 3VR4A 4AJOA 3D1VA 3DDWA 4F2WA 2D3WA 3ESAA 3PD1A 4C88A 2RG1A 2VYVD 3ZE6A 2BFPA 4RLHA 2O6HA 3AKDA 4YI5A 1XVLA 2XOKA 1EP2B 4GFDA 2HREA 1G17A 3E0XA 4I4TA 1VFNA 3T9AA 5DW3A 1UT8A 1POXA 2P0AA 3KZOA 1ZJJA 2X7JA 1T2VA 2AOTA 1NM5A 2XA9A 3MLBA 4XPXA 1Z34A 1GUFA 4L3WA 4AROA 4C78A 3O4FA 4C4YA 5FLXC 3M33A 3J7AM 3T9BA 4BS9A 3AFOA 3CVWA 1MH9A 4TMZA 1X15A 3MPUA 4U5BE 4CDAA 4IFTA 5IC6A 2HHCA 3QUBA 5IDQA 4JI0I 1KVQA 3H2GA 4TLMB 2QLTA 2GPNA 3KLMX 1CZUA 1WL8A 3WBBA 5C5CA 4Z8XA 1BQEA 2H1VA 3B6ZA 4RJKA 4WK2B 2VXOA 4USMA 1L9XA 3ES9A 4OI1A 2W2NA 2GCNA 3X43A 2ZI6A 1CY8A 1ESMA 5JEAD 2P6UA 1Q91A 3MFQA 3N8DA 1JHMA 2ZU6A 5EEHA 2D5IA 3DEYX 3NBUA 5I7SA 2PZGA 1FMFA 4QASA 2VAXA 2WTNA 4JZAA 5KTMA 2PN1A 4UUNA 5DSXA 2OXIA 1N32B 4MLPA 1YS7A 4MHTA 2H7OA 1UEIA 4LC9A 4UCXA 3G5UA 5L3JA 4JB2A 1F2DA 1HNWE 1QPZA 2Z1MA 3FMIA 4DLSA 2P6NA 2RHGB 4AO7A 2WB7A 1YACA 2AOTB 2H31A 3KSRA 5F1KA 3CTPA 3NEYA 1LSJA 3A36A 3SS7X 1T5LA 3R3YA 4TSRA 5K01A 2OQ2A 2VLIA 1ORWA 1RJWA 2PUJA 1KZ4A 1WUIS 2V65A 1N8TA 3UAVA 2P9CA 1MMDA 3NZEA 1RHYA 2N1BA 3O9ZA 4QT0A 1NJFA 4Y0AA 5EJAA 3PS3A 3NTQA 2JKZA 4EB0A 1VMAA 5K0LA 4WMLA 3QITA 5K36E 2VK2A 2Z8YA 5DX0A 3ZWOA 5FOWA 4O6YA 4C5AA 2VYQA 4FWIB 4B3SE 4E17A 4OXKA 5ALXA 5FOTA 1Z7WA 2Q4RA 4HN9A 5D84A 4ANFA 1M2GA 3RODA 3LI2A 3LUDA 3ABIA 5AK3A 4PSKA 1NUQA 4JROA 2AHRA 3DZGA 4NR0A 1W2HA 4HADA 4IDEA 4NABA 5FA6A 2RGWA 1JQLB 2QRQA 3ZY4A 1L5MA 5IM4A 1EAYA 4FW9A 3CLTD 1FSZA 3MBKA 4GWGA 3CH7A 4U2FA 3DJNB 4J3DA 3CLVA 1QRSA 4ARCA 1LE2A 2XITA 3FX2A 2WHXA 3I0MA 1TMOA 3WGJA 1PF7E 2GN1A 4A10A 3E48A 1LVHA 5TMBA 1M7GA 4J3JA 1YUBA 3UJ8A 4X92A 5J4LA 1YDIA 4CQLB 3PDIB 1L8AA 2H4JA 2IL1A 4B75A 4HAZA 2PCLA 4G8JA 5FTNA 4J7TA 3ZXIA 2ZIZA 4RA9A 1OZHA 4NXME 3IKVA 3T3PB 5EMMA 2WZGA 3JWHA 4US2R 3Q8KA 3EJWA 4IMIB 1NDHA 2HV9A 2FZ5A 2GD6A 4I44A 5DEIA 5AO9A 2PF4E 4LXXA 2LCHA 1FUEA 4I1UA 1IUPA 1TYZA 2AC7A 1ZEJA 2JA2A 2PXCA 2FZGA 2GN0A 2GXUA 4TLDA 5H81A 2PNLA 3G59A 1ZOOA 2ZJYA 4NNOA 2XRYA 3U4GA 2PT6A 4FFDA 5DLEA 3H1FA 3LL4A 1TZBA 3EZGA 2H2AA 3IUSA 2B82A 4CSAC 1SEPA 1HE5A 4HUQB 4O2RA 3RYHB 4DV1I 2QZ9A 3AOEA 3GH1A 5C5EA 5JDIA 2HHJA 5I01A 1GTSA 4EG7A 1ZL2A 5IMSA 4C05A 2RC6A 1Y8QA 2VA8A 3ZE2B 4EY4A 4AKIA 3LLKA 3SZRA 2VF8A 1JR3E 5PNTA 1U0HC 2W90A 3QNUA 5IH7A 2J8WA 3U0CA 1JIKA 1YQDA 3O84A 4L0CA 4LI0A 4R2IA 3AJAA 3I2YX 3H1AA 3HGTA 3IPRA 3TH5A 2EX4A 1KU2A 1W2WA 4B73A 3MFYA 4DCJA 3RUEA 1COWD 1KYQA 1KY4A 1N5LA 1UC9A 2JAQA 2JI8A 3PNMA 4IPTA 4JSRA 2PNZB 1Z4KA 3HCPA 3CBGA 3TOMA 3GLFE 2CFCA 3D2LA 1KXZA 3WYEA 2IVFA 3GJRA 5JVDB 3GVPA 1T9KA 1D6NA 3AB7A 2Q2WA 4AAYA 4C3ZA 4G89A 4RSHA 3WLNA 4KDCA 4BO7A 3K70D 2WIGA 1J1ZA 1VOTA 1V71A 3WZLA 3AVWA 5SYAA 1G38A 3B60A 2XWJI 2ZXRA 3WZ2A 3K53A 2W58A 4QA9A 2PUTA 4GXNA 1YZVA 4PC1A 4H3HB 3BL5A 3PRJA 4WZBB 1PWYE 1TTQB 5IAGA 3T0IA 3U3OA 1GRQA 2R1TB 3QVOA 1LF0A 4Y30A 3N1UA 3AF5A 1QKJA 2OV3A 2V9ZA 3HCBA 4IILA 3IILA 1TA0A 1TCBA 3G82C 4QDJA 1XBTA 5A5GA 3KPHA 4NS1A 3TVYA 1MENA 4KYIB 1G60A 1P8AA 1ISPA 3CW2A 4YAWA 2OUKA 2ZSHA 4J29A 5GY7A 3SIPA 1N2OA 2HV8A 2JFGA 1QZ3A 2Z3ZA 5F21A 4AZWA 1R6BX 3HDVA 1ZYUA 3FM9A 4DYDA 2BF7A 1O9GA 1ZUNB 4MTGA 1CRZA 4N5IX 4DDMA 4QGHA 1RWMA 1Y7PA 3ND6A 4QBHA 1LTHR 4NE7A 1YK0A 2J0XA 3W5VA 5LXTB 3BSFA 3QE0A 3KYJA 1P81A 3I04A 2R68A 3OZWA 4Q93A 4LIPD 4IZ6A 3I34X 4DIEA 4W5NA 2HAEA 5CX1A 1TECE 2XWBF 3RSQA 4GWLA 4IXWA 1DIHA 4RKQA 1Y7IA 4MYSA 4ZPJA 4QRHA 3A2KA 5ECYA 3FAPB 1FRVA 3LEVA 4YY3E 3UBMA 4D82A 5DTJA 4JLDA 1KSFX 2BM1A 1GO2A 2K7ZA 3M5DA 4RFVA 4B81A 4BLTA 5HOQA 1ENZA 4B3TE 3PIDA 4RULA 2O54A 5B6PA 1N5DA 3G3EA 1KP9A 1CE8A 1LF5A 2P67A 1QIMA 4OH7A 4Z3KA 2F59A 1UPBA 2X7HA 4B8ZA 4ERXA 1IFXA 3ZKDA 1WXXA 3CF0A 2ZD9A 1PL6A 4OREX 4UHDA 3F46A 1J2TA 1ICIA 1VJ5A 4C5BA 1IZZA 1XYGA 4V1CI 2I4RA 2OMEA 2VESA 1KO8A 2YJGA 2NYAA 4UDOA 2Y3DA 3B6JA 3PEFA 5L3SB 3HKEA 1FXWF 4RD4A 3ZHBA 3S2GA 1E77A 2CXQA 5GJCA 1H2HA 1E2LA 3N86A 4N6NA 1DV2A 2VRNA 2PRKA 3T5MA 4AZ0A 3ZHTA 5BN4B 2GVZC 3R7LA 5BW8A 1YA9A 4FFSA 1W8IA 1IN5A 1LTKA 3FNEA 5LZ8A 5I3CA 3K1IA 3KEOA 3KJIA 3LUBA 3DA8A 2HO5A 3STHA 3FDJA 3DMDA 4ZHSA 3G85A 3ZH9B 5IJ9A 1NMQA 4AKSA 2O8FA 2BCEA 4XLNF 4UU7A 1U5BB 3BRWA 1GLVA 4UJ5A 3PFCA 3OTWA 3TR6A 3W9YA 1QP7A 2Y1DA 2VA9A 3CRNA 3KXKA 2BFBB 2X6QA 4DNFA 1PNVA 1CF2O 4J8PA 4BLWA 1P7CA 4EUEA 1BHSA 4IH4A 2H7VA 5HVNA 2WPDA 4ILKA 3QBTA 4YYZA 2ZCUA 3K35A 5EINA 2ZUUA 4FFLA 4DU8A 1CJCA 1NUPA 3WMEA 2FJ0A 3HJCA 4F4UA 4QOGA 4YCNA 1A0OA 1OVGA 1MO4A 2OZEA 4X8OA 3JALA 1B6TA 1M75A 1REQA 3FDIA 3L6EA 3MHPA 1FFXA 4NPAA 4BN5A 1P44A 1ACMA 1JQJC 3FYCA 4EYOA 4RKWA 3DBHB 1PZNA 3MTQA 1NTRA 1QZTA 2HWXA 1WX1A 2DBRA 3PA8A 3T3IA 5ILOA 3GUZA 3H5WA 2ZI9A 3SD7A 2YLGA 4B4UA 4TYYA 1IDN1 4UULA 5IBQA 2Y4NA 3U7IA 2PX0A 3JPWA 2HV6A 2XE8A 1PGNA 1JG6A 3F71A 1CRLA 2G6TA 1B6SA 2FPGB 3CLUD 2NVWA 2HK2A 3B1ZA 2NGRA 3JWEA 4JP1A 3NXKA 4WXHA 4U5CE 2B94A 3ZOZA 1QCYA 5K8CA 1E8MA 1KAMA 3KQQA 4MS1B 1RRFA 4DHWA 1T9BA 2YFQA 3WBFA 4D44A 3RGGA 5JV5A 3WA6A 1HFEL 2B3DA 4TL9A 3ZLTA 4J32B 3ONNA 1PZEA 3PE6A 3U4CA 3O38A 3LC7O 5IXSA 2I3AA 4I4TB 1VPVA 2QGNA 5DT2A 1Q15A 1QE3A 1P2UA 1W6RA 2OC9A 4WOBA 3DMTA 4BNMA 2C8LA 2O20A 2J9XB 4JSTA 5CA0A 4GKVA 1QG4A 2RAVA 3BE6A 2F22A 2EPKX 3SK0A 1XCMA 2W11A 2FWPA 1DTWA 3EAGA 2OO7A 4TQUS 3R75A 2KMLA 3T3OA 3ZDZB 2YHSA 2TMYA 1FP2A 1L5WA 4JKYA 3RKOF 3GLLA 4W8KA 3NX4A 4G5YA 3D5QA 2WWYA 1IOVA 2IIBA 1R8SA 4OKNA 3DS8A 3DZIA 1FFDA 4PQGA 1FLVA 3RQSA 1X1CA 1JFRA 2IXOA 2UUAB 4O4LF 2DHRA 4G8DA 4RF3A 2H4XA 3E3LA 3H5OA 3M6XA 4K3UA 5FTWA 3D1LA 4PG6A 1BZ4A 1EX6A 1EVLA 2BHRA 2NZJA 1QSGA 3KLPX 4BFLA 1T2UA 3CLRC 2BVNA 5AOBA 4JBGA 1I6WA 2VJQA 3KVNA 4P2GA 3TTSA 2FR8A 4GIBA 3LC1O 3BIWA 4ZVQA 1FDIA 4X6XA 2QW1A 4KITB 4BB9A 3TN7A 5L3QA 2PX6A 3H2SA 5E6RB 2O4CA 3SIRA 1X87A 3S4YA 1ZG3A 5IEBA 1O8CA 4JCZA 3HKCB 3KAQA 3MOIA 4QRIA 4YJGB 5G4KA 1M0EA 2PE5A 4G7OF 3PUWA 5FPHA 3PKIA 3WGMA 4KO8A 1PEKE 3HUFA 1IPHA 5JEAB 1D6JA 1DEOA 1ISMA 5EE0A 3DTTA 3FYHA 1QOZA 4U9UA 2DXIA 5LDHA 3RBZA 1AK1A 2ZQ5A 4I5GA 4R68A 1A8SA 2DF8A 2V0CA 4CTOA 1DCTA 3QPBA 2FZKA 4PO9A 1YC2A 2C4UA 2EGUA 1CBUA 1Z4NA 3U3DA 4DREA 2AJ8A 1RJ9A 3ORFA 3TCXB 1RYNA 5JMTA 2QQ0A 1KJJA 2WFAA 3HUTA 1FS4A 1IH8A 3E2MA 4AJ4A 3WIDA 1C3EA 1E98A 3N07A 3GONA 1DUIA 2XM4A 3OTOB 1F1JA 5ER6A 3OKCA 2M6KA 4U6NA 4S04A 3VJRA 3W6PA 5JQGF 5KYWA 4RTOA 2PUWA 1OR2A 4M9SA 5ETJA 5SY9A 4UARA 5HP4A 2MTBA 5J59A 3UA4A 2B6NA 3TKLA 1DDOA 5IT5A 3REFA 1GQAA 4DYHA 2XCUA 4MVJG 5JNWA 3C5EA 3DV0A 4CMHA 1PT7A 3KYBA 3AHCA 2DAPA 3U4IA 4YUYA 1N5RA 1UQRA 4QUHA 3RM3A 5L7TA 4ZOCA 3N8KA 1XWWA 2JFZA 4JLOA 4GECA 1P5FA 3WDLA 2HSEA 3OZCA 3A3KA 3F47A 1KEEB 4H3KB 4BO0A 2NOAA 3VPDA 3OC6A 1KMQA 3PQFA 3SYNA 1NXPA 2BTQB 3QHAA 4HFJA 1TQ6A 1KKHA 1FYWA 3PUYA 4CG0A 1T6IA 2BA0G 1JN0A 2C3PA 2J4CA 1TIPA 2Q1XA 3NGXA 3QKRA 1R12A 5FORA 3RD5A 4LECA 3U1VA 3F9IA 2QL7A 1TPYA 3LK6A 4AY4A 3CLSC 4F1KA 1UBJS 3LVQE 2OR3A 4HGNA 1H69A 1L8LA 3CSDA 4EFMA 2GCPA 5JC8A 5LU9A 3LY9A 3TI7A 4A15A 1JFTA 2BKUA 4Y9TA 1HL3A 3JRXA 1ZONA 4II3A 4ZQEA 2J6IA 1EZ1A 4GM0A 3UHPA 1GQOA 1WMDA 3T1HE 2X6TA 4DM7A 2DLDA 1EXMA 4GU5A 2WEKA 4JV5B 1JEQB 4UTZA 1Y98A 1GUYA 1TTTA 5IDWA 1C8LA 3FPJA 3UMHA 3KRTA 4FT2A 1OROA 1AIPA 1I3NA 2G4CA 2HI0A 3BA1A 4B3RI 2V97A 3FA2A 1I2MA 3OIWA 2EFGA 4GLJA 3NRJA 4YREA 5AW3A 1M83A 5K6TA 3NWPA 4A6PA 1A4UA 2D1TA 1FFSA 1E7SA 4LGVA 3RS3A 2CB0A 2O50A 2LP4A 1PFVA 1SCBA 4HATA 3IEUA 1VE9A 3A2NA 4NSNA 5KJCA 2XZTA 3ETDA 1ULBA 1CGOA 2DFKB 2HPVA 4DV1E 2HY7A 3NBYC 2MYPA 2CFIA 3AONB 2E21A 2WSSD 1JZSA 4XLZA 2XUGA 4BP3A 5DGXA 1E3HA 3RU3A 3N5CA 4LXQA 2MHRA 2DG2A 1LLFA 2P3SA 2WABA 2ZWMA 1E0JA 5CFMA 3E1KA 2C5FA 4GKJB 2G76A 4HDAA 3J06A 3ZLUA 5KDOA 5KHLB 2YRFA 5UKDA 1Y5YA 2QLLA 4Z7NB 2AC2A 4MCAA 4OV6B 3U9SA 1OB2A 4RK5A 1Z23A 4YUXA 4Q39A 1AZLA 2IITA 4LKRA 4I19A 5MFPA 3RUFA 2BEKA 1X2BA 4LXHA 3D6HA 3HSKA 2O2XA 1XZHA 1QP8A 1T0BA 2CVQA 2GZ1A 5EXPA 2R7UA 2QZPA 2VHXA 2RGCA 1J8YF 1W75A 4L08A 4KR2A 2GD2A 3I01A 4PZAA 1QQBA 4N4AA 1I6KA 2YVQA 3GPIA 5KQSA 1FBNA 1QQTA 3D3JA 3K5PA 4MTCA 2ZVDA 3BMNA 3R1IA 2I55A 5D1HA 1U2EA 2YR0A 3VMFA 4H54A 3IQXA 4AF8A 4BVHA 1BJTA 1Y4DE 1W94A 5EMLA 5HJ2A 1EFCA 2JGEA 1K7FB 2OB1A 3BPSA 1YYXA 3RE1A 4E5SA 3X1ZA 1SIBE 3QP9A 4C0XA 3UB4A 1GPMA 4HTFA 4FFMA 4YP1A 2W42A 1TAQA 2FG6C 2ANBA 3DGFC 3L49A 4LJKA 2E6UX 1D2GA 4U3DA 4OHPA 2H1HA 1II8A 1GS9A 1LTQA 3I32A 4EYQA 5J4VA 1ZM3A 4C2UA 3HFGA 4M53A 4UUOA 2QRGA 4ML3A 2OLKA 1NV8A 3UENA 1ISRA 1SG6A 3U7JA 2BMVA 2C84A 2HFJA 4TROA 4INZA 4TUYA 1WP4A 1GQQA 4KE8A 3BE4A 3RSGA 3QW0A 2JFHA 4QYIA 4H4DA 3N7AA 4D57A 4E5YA 5FWYA 2EX0A 3NAQA 4PACA 1P6XA 3L6DA 3U3KA 1BH2A 1ZH0A 4HKTA 4F45A 1RXIA 4KO4S 4X90A 2V7QA 4LJ7A 4O7GA 1R1DA 1GDTA 1J2RA 2H1WA 1QLEC 2H2IA 2OENG 3IJ5A 4NYJQ 3KOUA 5K2OA 1H4VB 5GGYA 1P0CA 3KUCA 1FP4A 1T13A 4R1SA 5DHSA 5DW0A 3RHSA 1EFKA 1XNQI 2GAJA 3MRTA 2GBCA 4IDDA 4KSYA 1H23A 4DLBA 4DV7I 1FUYB 4Q18A 5GIPE 1IN1A 3ESBA 3K1JA 3DEHA 4EHHA 1FCJA 4UMEA 1K68A 1I2DA 3SHOA 2G72A 4X0RA 3LEOA 3P2JA 3I42A 1M5TA 4MDYA 1SU7A 3S5UA 3UH0A 2AFHB 3ZU2A 2HA7A 3O55A 2K7FA 3LTOA 2O8EB 1G8FA 3V8QA 1M74A 1N1EA 1QLWA 1XTZA 1KSGA 3TE7A 3MQFA 4MR7A 1ZJYA 2EZ4A 2AZXA 2H7YA 4MV4A 1MMAA 1EE2A 5BOVA 4X44A 3VKFA 4HVCA 4KQEA 1NL3A 3DC2A 1J1UA 4WKGA 3VNAA 1SUEA 3B2EA 4EJ0A 1U94A 4BQNA 2AOVA 4B3JA 1LJ8A 1FFXB 2VSXA 3G9ZA 3BE8A 4HSGA 2JKYA 421PA 2NQ2C 3C1TA 1EHIA 3FDZA 2DT5A 1CRQA 1YQXA 2HHHB 1PEDA 2CMKA 2OBYA 1EBBA 4QIHA 1IC6A 4MULA 3AGTA 5LM3A 2BGLA 3G13A 4RZSA 2NNLD 4K1OA 3Q72A 2CLOB 3TL2A 2GUWA 1A5TA 2NACA 1P8JA 3Q3IA 2P7HA 4Q3OA 4B84A 4FW7A 2N1MA 5JMPA 1UMBA 3EEFA 3DTVB 4V0NA 3O73A 1ZNYA 2W6NA 4IDOA 4P22A 1A1VA 2QRLA 1S7GA 1GKLA 2PPVA 3LG2A 3VR4H 4ZK2A 4N39A 5JHGB 3EEYA 2LKDA 3OTQA 2K6GA 1IZ8A 1BVRA 2O1EA 2ZREA 4N3AA 3W90A 4F4JA 5B6IA 2HJHA 1LPMA 3H3JA 3ER9A 2P1ZA 1KERA 4BCDA 2RCNA 2QJOA 4DPXA 4IVRA 3NCTA 2FLKA 4HWRA 1YQ9A 1P7VA 3ZGNA 1GNLA 3G2JA 1W19A 3V4SA 4ROSA 2AE8A 1CIPA 4CIXA 5FBQB 4CLRA 2Y1LA 3NW9A 2PUFA 2FQYA 2E5WA 4XW2A 4BNDA 1Q14A 2YWEA 4BQPA 1FQKA 3MF4A 2ZULA 4IWXA 4JC5A 1RLJA 2ZKIA 4R2LA 4AMGA 1JKJB 1YT5A 3BERA 4PJLA 3IUYA 3O2QB 4CT4B 3DO5A 3EGDA 3NZKA 2I33A 3RC9A 2QQGA 4BP8A 1TUBB 4WHMA 3MTGA 4A0FA 3ELDA 2JAUA 1XEXA 1E2EA 3A6EA 3U3MA 4XVUA 1FI4A 1B68A 3M1LA 1ICEA 2D1RA 3C5VA 4EMBA 3EXHA 2Q5OA 2JFVA 2G63A 1JLKA 1P4SA 2XUZA 1XC7A 1YL6A 3TJ5A 2DTEA 3NXSA 3OQ6A 5TMEA 2Z04A 3R23A 1I7PA 3IULA 3K9FC 3PUKA 1SB8A 2ZAOA 1NJ5A 3C98A 4OHMA 3OX3A 3FCXA 2WVOA 5DNLA 1D2HA 4DAEA 2QENA 4JNCA 4EFNA 4XQGA 2CSXA 1IUKA 2WZDA 2CCYA 3TSWA 5FQOA 2J31A 4OFBA 1IJFA 1JU3A 5KHAA 5SZJA 3D2CA 4J16C 3BREA 5JCOC 1Z59A 2KWIA 3AVXA 1WF6A 4RSMA 5CITA 4YS6A 4CF4A 3N70A 1Y6JA 2COUA 1U90A 2A7QA 1E58A 5KOHA 2VZ0A 3KOZA 3LT1A 4RHYA 3B5EA 4IJVA 2H1OA 3LW7A 2XTMA 3DW1X 4Z8YA 1T9CA 3QLEA 4GPD1 4HGOA 3IPXA 1PDOA 4XGIA 2CYCA 1ZGHA 2PM8A 3SR0A 4DLXA 3MBIA 3W3AD 4XSHA 3TW8A 2X5KO 4HGQA 4D56A 4RDAA 1I7QB 2HGZA 4R2KA 4V03A 4FCWA 4G0OA 5TVKA 3CT6A 4KEAA 1XTBA 3TVTA 1Z2CA 1GJRA 3ZC4A 3FKSD 4QXQA 5EJIA 2JZCA 4CL0A 1YCGA 3CXRA 2VCEA 3A14A 3Q8WA 5CFLA 2IX3A 3F97A 3ECSA 1LPEA 1WETA 2DFPA 3RFFA 1Z73A 1P5HA 2EPOA 1RP1A 4B43A 1S6YA 1THZA 1U1GA 1ILWA 2JJ1A 4HTAA 2BGIA 1WTYA 1OKKA 5ALNA 3NOOA 1PSDA 4DR6I 5IKMA 2G83A 2FSHA 4MPJA 4GICA 3VC7A 4C14A 7MDHA 3TQQA 4C2BA 3HVJA 4NZZA 3STVA 3JQQA 4FWTA 4BJ3A 1RU3A 2NU8B 1YFLA 1Q0RA 1NXVA 3VDNB 5ITZB 3ITDA 4CMEA 1U8UA 1CJMA 3A4TA 3VNQA 3R7AA 3SZOA 4BJHB 5B1HA 2Z4TA 1MB0A 3LPLA 3ZUGA 1NR5A 3A3OA 1ESEA 4CS8A 1CUJA 1OXMA 3DYVA 3VPSA 4IS9A 2P9BA 1GR0A 4G8CA 1SOAA 5JE8A 4X3CA 3ZHSA 1VHDA 2F3QA 3L8CA 3IGFA 5F98A 2FFHA 4PX5A 1JTEA 3ZTZA 3KB1A 2O07A 3LFUA 4XUEA 4MVSA 1KY3A 4Y2XA 2DWCA 5KZMB 4U7PB 4ZYLA 2YBDA 4TZ6A 5C52B 2IZ1A 5EJ2A 2PWAA 3EGDB 4GNKA 4Y1EA 1V1MA 3LU1A 1DGQA 5JEAA 5DJ5A 1J2EA 3M7ND 1T8PA 2BR5A 2ZR0A 4BASA 4NDNE 4Y7CA 4CBVA 3AEUB 5DU2A 4RW0A 3KUUA 4RVHA 1N6LA 1FMCA 1OBFO 4P4GA 3CVJA 2F1RA 3DHNA 2F3PA 3ORSA 4RKFA 2YW2A 1ONBA 4OINF 3D4PA 1G5ZA 2OAQ1 4JI1E 4WY5A 1S7ZA 5DNVA 1E7MA 3EH2A 2YV2A 5ALMA 5ECGC 5JIBA 3F90A 2OFOA 4PR3A 3BFKA 1HY5A 2HFSA 4O2LA 5T67A 4M76B 4LF5I 1MTZA 3X1JA 1R18A 3BFJA 3WLPA 5C1PA 5KQGA 4Z0TA 4RJJA 1GCAA 1FA9A 4L8LA 5TQ0B 3WGIA 1E9VA 1Y7HA 3H6HA 5AK0A 1EJ6A 2XVMA 3C3MA 2Z5EA 4A0QA 4QOHA 5DPMA 4E0IA 3AJMA 5CM2Z 1L4YA 1YOVA 3RHZA 2JI7A 2Q3EA 4LWZA 1A41A 1BS9A 4P3YA 1KDVA 2HCTA 1U9IA 3UCFA 4U2GA 4ZCPA 2VG8A 5BR7A 3BFXA 2PPLA 3WKEA 4HR7A 1SBNE 1Y5LA 1QH8A 3DLBA 2XVYA 3K5IA 2NUTB 3LC0A 3CNQS 5EFOA 5LYJB 4GLFA 1L7EA 1Q0ZA 2R47A 3I5MA 3LWZA 5FT9A 4CV0A 2QM0A 1OH7A 1OTXA 3DQQA 1ZRSA 3AFNA 3CEAA 4D26A 2DWPA 6PFKA 4N06A 3F4BA 3WGOA 3DZKA 1RXEA 2XMSA 2ZI7A 5GADl 2GM9A 4XTJA 3I4CA 4DWVA 2BD0A 2DECA 3RQGA 4BNZA 1QK3A 3ULKA 2DYKA 4BO9A 3ORQA 4Y6OA 4YBRA 1WHTA 3IP9A 1NF2A 1MC5A 1OKKD 2J6CA 5TARA 4ZGGA 2Q6VA 3T99A 4RDCA 5D6NA 5T4BA 4I2NA 3T1HB 4KREA 3RH3A 1NVWQ 3O4IA 1TA9A 13PKA 4KQ2A 1SUAA 1XDBA 3RIGA 4J6FA 4NBWA 4ND7A 4OYHA 1VLLA 3Q0EA 2Q99A 3JS5A 4R2MA 5JT1A 2AZ4A 4OGLA 1YASA 3BQ9A 2PBLA 3QTLA 4PHHA 4U1RA 4X71A 3HLZA 3R74A 1FXWA 1BXGA 1CPQA 1B93A 3BQNB 3FLAA 4PZZA 1KO7A 2EQ5A 2FPIA 2Z2KA 4IDGA 1HR0E 4KIJA 4C0LA 3Q98A 2BH9A 1KE1A 1LQ2A 1HDCA 1NFOA 2NTNA 3KV3O 1ZICA 3E9YA 1JG2A 4YRFA 1E5XA 1VIYA 2I5PO 4PIPA 4FFVA 4RAOA 3MWEA 1EDDA 2AE1A 3PZBA 2GRAA 2ZG6A 3GL9A 1O9HA 5ESWA 1KOFA 3K72B 1VDZA 1DC7A 1UM9A 2JDIA 3WI7A 4J16A 3U13A 2WWRA 1GA1A 4AJHA 1L6IA 2FPOA 3HXLA 3PGA1 2KSFA 4FP9A 5I7WA 3DKKA 5BUQA 3ADKA 2ZBVA 3DZ8A 2UXDB 1TIKA 3BZUA 2Z15A 1JP7A 3W6OA 3X2SA 3OKPA 1NXXA 3K92A 1E0AA 3R7NA 4D3DA 2XB6A 5KNLA 3U17A 1LK5A 5KKNB 4B6SA 4LEIA 4ZYVA 1I0IA 1EFHA 1KJYA 1MX3A 3C8UA 2WINI 3MJCA 1ZHYA 1YCHA 4TLAA 4M6WA 3FJYA 3LBFA 1VPTA 2Y0PA 4E5NA 3QI7A 3U80A 1H4QA 4MCIA 4YQFA 3FYUB 1C81A 3E3OA 3MA0A 4BGDA 3HKEB 1XZFA 2GSWA 4R8MA 5EMHA 5I51A 3IDOA 5IASA 1SVIA 2LFFA 3RPEA 3GQBB 3AVUA 3WNZA 1XDGA 3R9IA 2AXPA 3LF2A 1FX0B 5AKZA 2AFIB 2DFVA 2VF2A 2IYAA 3GDOA 3JATA 2Q3BA 5JH7A 2A9JA 2C4KA 2FSVA 2I4OA 1G20B 1M33A 5AOCA 3ZKWB 4ZYTA 5KQPA 2ZJ2A 4LCHA 4NMLA 4BP9A 1HETA 1LS6A 3ZDCA 4PG4A 5AFSA 1Z8FA 1ID1A 2LIVA 4LY9A 2LIPA 4DUYE 5DGTA 3WFJA 2X41A 4E6PA 5CG1A 5LU8A 5KI6A 2R6GA 4NE9A 4RELA 4ZALA 4B74A 4BMDA 3AP1A 4PU9A 1NW3A 4CM9A 1Z28A 4M83A 1DO2A 3ADDA 4CMAA 2PYIA 4LY6A 5K36B 2F1DA 1XMQE 1YUNA 2V8PA 1OQAA 4D0RA 2F00A 2OGUA 5LJIA 4OAOA 1WXWA 1ZA1A 4ZMRA 1N7HA 3F7TA 1KKMA 4NMHA 4C07A 4DLLA 1N32I 4L0MA 4F1JA 4XM2A 5LDGA 4P9NA 2R7QA 2NO1A 3CUVA 1PYDA 1UXGA 1NXOA 2BZGA 3DQZA 2W2KA 2L69A 3KYCA 4PFOA 4FI3C 4JBXA 5I7EA 3T7SA 2NPFA 1CETA 3IT2A 4AM3A 3PR2B 2FPRA 4O8CA 4A8JB 4KP7A 5DYWA 1FTNA 2C2BA 3P27A 5TJ5E 1QDUA 1HE2A 3U9LA 4WN9A 2PUGA 2JK1A 4X64B 3UHMA 1UPAA 4GR4A 1WTCA 4XUGB 5AXDA 3T38A 5AKKA 1SPXA 4AJIA 1PT9A 3ZE1B 4UAGA 4ZLCA 4EMSA 4LJAA 1O6CA 3JD0A 5KREA 1P1CA 2NU9A 3SXKA 2HK7A 4AX2A 3U2MA 2JATA 2Y1FA 1YDFA 3AV3A 3NBFA 4TZTA 1O0CA 2C2YA 2RDMA 2X0JA 3GG9A 5BR4A 4DR4E 3U3BA 3U3RA 2EYQA 2VTBA 1F8UA 6ABPA 3HXKA 2PQ2A 5JQGB 3WYCA 3C7JA 1N9KA 1J6UA 3OJXA 4BNVA 2B9EA 1SXIA 4HD8A 4WD3A 4WZBE 2JBAA 3NU1A 3U7QB 3MWEB 4YJ2F 3BRCA 3HNRA 2O8NA 1AJEA 3R9KA 2CJYA 3FBWA 4ABYA 1I4EB 4DLTA 1POWA 3NHJA 3GOHA 4N03A 2O48X 4OIMA 5HW0A 1MJ5A 5F2EA 3UTCA 2QD4A 3ENWA 3AL3A 3DVRX 1FWKA 1X19A 3GLRA 4IIYA 4M7PA 4HT3B 3AI3A 4L3VA 4M86A 5KPJA 2G5GX 2NQ8A 2V5UA 2Q0QA 1XDDA 2ATEA 1NVVR 4Q7QA 3ZIUA 2XE7A 5KYUA 3AETA 4HPWA 2XPCA 3JQPA 4CL8A 3E3AA 4FZ3A 3R7DA 4COOA 2SNIE 3JAKB 4DSUA 3C4QA 3Q15C 3NKDA 1KYZA 1L5HB 2ORWA 5HQ3A 1QVZA 2CFTA 4GR9A 4JFRA 1TU4A 1X7ZB 3IAM6 4JOQA 3TIVA 1WHTB 2PGNA 3KM0A 3QV1A 3HWX1 3DWEX 4NLLA 1U7WA 4NZOA 2G9NA 4EFDA 1PR5A 4HZUA 3SBDA 5FH9A 3RKSA 2PL3A 3R3ZA 4RF5A 1LSUA 2PXAA 4HUQA 3RYHA 3HULA 4AZSA 3KD2A 2NPUA 2H7CA 1TKAA 3CNHA 721PA 4JLKA 3MXOA 1O96A 2AFHE 2DKFA 3QEMA 1L7BA 4WGZA 2A2CA 3DHYA 4KAFA 1Y6DA 3AY3A 1XAHA 4I46A 1TM2A 1INLA 1XEFA 4PJNA 3CX4A 4HBGA 4N65A 2UUCB 2NUTA 4PNPA 1X7XB 4TMXA 3PEYA 1EJ2A 2MSNA 3ER8A 3EFHA 3O4JA 1MMFB 3TRHA 3DCIA 5JZ9A 1M8GA 2DQ4A 2HBZA 4FB5A 4YR7A 1U8EA 3K6SA 1D0ZA 1IZ7A 1BX3A 2WJWA 2IHUA 3RC3A 3W1WA 4PPGA 1OLXB 3S29A 3AT1A 3RIMA 1QAQA 4M9XA 3AFMA 4W82A 2D74A 3DF7A 3GLHA 4DCSA 2VHVA 4Z7JA 4YK7A 1JSZA 1K75A 4I1YA 5DXFA 3UPDA 2GYYA 1W7AA 4YRGA 2LK4A 1SKYE 1O77A 1I7LA 2WYOA 2E3JA 2X19A 3NKFA 4UBJA 1LW6E 2H1FA 4J0DA 1PG5A 3WQHA 1D07A 1KAOA 4DLZA 2H57A 4BO8A 4EW2A 5KX5B 1Y1LA 1EVZA 5CVEA 3ZWQA 3N2ZB 3WG9A 3IVGA 4KO2S 3STWA 1KDRA 1E1CB 1TEVA 1FXUA 2YOHA 5ECWA 4A9AA 3NHPA 4Q82A 3VNBA 1MU5A 2NW6A 2XQFA 2JIDA 1BGVA 3M9WA 4OSEA 5FOSA 3RADC 1OXKB 4LW8A 4C2TA 3USZA 3OEHD 1C29B 4CI0B 3TRDA 2PEYA 3RVMA 5AXAA 4E4TA 1OYSA 2GR9A 2V4UA 3C48A 3PWKA 5BW4A 2ETVA 1H05A 2ZU0C 3L8JA 2RKBA 3OE7D 1YR1A 2YV4A 2CNBA 1DAIA 4EI8A 4Z4HA 4RTQA 1DRJA 2QZSA 2XQKA 1ZNXA 5HDBB 5D86A 4RTPA 4FW8A 3VKGA 1Z07A 3O6VA 3VVLA 4HAXA 4JI6I 3A4YA 4BX0A 2A0BA 4V0OA 4PQEA 1HNWB 1TD9A 3IAXA 4IVNA 5ERYA 3GNQA 1TM1E 1VMDA 4IRXA 4BNJA 1Q0KA 2ZTVA 3NHMA 2XL4A 1T4CA 3NJRA 4JBLA 3QBVA 3C8HA 5JRJA 2R7LA 4LF7E 1AUXA 2ZJ8A 5IP5A 1V37A 1YE3A 1NBOA 1ZIDA 4I0WB 1KJ9A 1RDFA 4Z4FA 2ZSJA 5FWNA 1BA2A 1XRLA 4CDRA 1MNAA 3A9SA 4Q6BA 3T1HI 4GE3A 5CX4A 2BP7B 3NTXA 3EPKA 3A6PC 2IUYA 4AP5A 3SX0A 2IXMA 2W93A 3R7WB 1WASA 1XZQA 1JSCA 2P2DA 4J7YA 1DO8A 4OB8A 3I6YA 2ZYRA 2IOPA 1R0RE 1FDOA 1BJKA 1Q0TA 3R5KA 1Z0UA 3CMCO 5ENVA 4JJKA 3UK1A 2CLEB 3CN7A 4GOXA 2Y99A 4M0DA 1KU0A 5IXYA 2Z56A 5KX5F 1SCUB 2BP7A 1MC1A 3RYCA 2FQXA 1UOOA 1EVEA 1F60A 1RAFA 2RHJA 5GGXA 4DV1B 5EE3A 1FNTc 1JEYB 4RA6B 4HGPA 3WWOA 4OIOF 4NQZA 4B6RA 3GFOA 4S1NA 3TZKA 3F5MA 3VR5A 3WLRA 3HEMA 2V6IA 4GKJE 2C7PA 3H3XA 3M4CA 5TVGA 3B70A 3JTLO 3KQLA 4XJSA 1N9GB 4Y2RA 5EOVA 3D4IA 5JSLA 4P83A 3M34A 5KOJA 5I4CA 1PUXA 5CJJA 1QRTA 2PUHA 1U5BA 1W1UA 2IHZA 1YGYA 2VP5A 4WNIA 1ODLA 1A7VA 4QODA 2CVEA 1BXKA 1QHGA 1YAHA 3RG8A 2ODQA 3V1LA 1T3LA 1NBMD 2C2KA 2JGIA 2SKEA 4D42A 4CF7A 3U7EB 3QXGA 3WHLA 1SN7A 2X9QA 4UM7A 1YVIA 4GSLA 1WLSA 1JAHA 2CXXA 3CWVA 3NM5A 5EQDA 3TXYA 4DG5A 4OXIA 5JPDA 2XB4A 5KNDH 2OKCA 3DP9A 2QJTA 2Y05A 3IMKA 3WSWA 1UL1X 4L2IA 1E3TA 2LRHA 3DT8A 3EISA 3IALA 3LX6A 1OV4A 3GT7A 4PQYA 3ET5A 2G5PA 2EL7A 4EDHA 4CXMA 3G7NA 3JASB 3ONEA 5U1PA 4C04A 3G8AA 3NUGA 4RY9A 5KJFA 5C35A 1I0LA 2IU6A 3OIDA 4GGPA 5DGDA 1FNMA 3RBVA 3X2QC 2REQB 2O1XA 3K30A 3C6YA 2GARA 2IEYA 1ADBA 1R10A 4M8SA 3HDJA 3PR3A 4RTKA 3L8IA 1IOLA 1C1DB 1ZHWA 2PXHA 3RV4A 1CYEA 4LVCA 5AKJA 2OXTA 4S2EA 1EP9A 2FUG6 1X1BA 3OUUA 5AI8A 1SCAA 2ZRMA 3LIIA 4HGYA 4BBJA 3EG9B 1XIVA 2C96A 1T3TA 4PZUA 2YQ5A 5JNRA 2WWVD 4UMFA 2IGBA 5LXTA 4DSNA 1UBLS 3LT0A 5KVAA 1VFPA 1VZ2A 2FHSA 2Q9UA 2JGMA 3DLCA 4QFCA 3U16A 3G0HA 3H5LA 3H9JA 1TM7E 2G1KA 3UCXA 3N3BC 1E92A 1NAHA 3UIEA 5JBQA 1EUQA 5A6JA 4IQFA 2YNMA 1Q6ZA 2HDWA 3GAZA 4I14A 3CCFA 1WE2A 1KBOA 2O1SA 2X4LA 5JAHA 1F0KA 1GSAA 3HADA 1H9CA 2YQ4A 4JDUA 2ZXOA 4DR1I 3VYSB 4RH3A 2ODPA 5C34B 1QC5A 2EBFX 3CZCA 2FUG1 2F9FA 3QOYA 4PGMA 1BYUA 2VUSA 1T0PA 4IJKA 4BWYA 5EHHA 1TO2E 1RLMA 1PVGA 2JD0A 2HBYA 3PDCA 4LTMA 2J3JA 4FMDB 1NVAA 4E31A 4JI2B 3LUAA 1KDYA 3GZNA 4KQ9A 3BTVA 2WJVA 4CQMA 5I7VA 3ESXA 3EEOA 3HDGA 1Z5GA 3BEOA 4RPHA 4AM8A 1PQ4A 1W5FA 2Y1CA 4EMTA 3FMFA 1H73A 2I6TA 4LUCA 4NBTA 2A0UA 3F8SA 2UZ3A 4EPWA 3E9MA 2DGDA 4P0QB 4BNNA 1V1RB 4GMFA 5FFFA 3K0FA 3PYFA 1G8AA 4WDQA 521PA 4EBBA 3PQ6A 2FI1A 4JYCA 3SHFA 2H4WA 2ODTX 3U61B 1V55C 3O8DA 4H1HA 1EGAA 3EVNA 3AKCA 2QTZA 4G8BA 3WK9A 2QVYX 4O3MA 2O8EA 1XZAA 2WWWA 4ZD6A 5KKAA 3SCZA 3PVCA 3OMWA 2C54A 4NATA 4R98A 4HV4A 821PA 4PCAA 1V9LA 1VI5A 1QYXA 4CQJA 4BHTA 2XZPA 2Y3BA 1BR2A 2HNAA 4IIBA 4WVLA 4Y18A 4X62E 3L5KA 3UHOA 4ZEVA 5KVCA 4N76A 1EESA 4JL6A 3EFOB 3PR1A 3TLZA 4IHAA 5BXQC 4JGGA 4QYSA 4YAEA 4Y6GB 5E1OA 5BO5A 4JA0A 4YDHB 1HE9A 1IY8A 3F6BX 1T9GR 2BV3A 2QLMA 1AXEA 3NMIA 1FXSA 2A59A 1LVUA 2DPGA 1JKXA 1T9HA 2JD2A 1CT9A 2NAPA 2PX8A 3VO1A 1OBOA 1VIVA 2NN6D 2Q6IA 3R0QA 4JBIA 2PSSA 4OUKX 5IW8A 2XL6A 2OFWA 2J46A 2HF8A 3HRKA 3KUXA 4ZVSA 3SMQA 3UJ6A 3T5DA 3T7EA 5BSVA 3LKVA 3TTUA 1X70A 3JTEA 2EP7A 5M34A 3B48A 4OL0A 4DBLE 1OGYA 1JLLA 1Y5RA 3AINA 1ZD9A 3FD8A 3GOQA 3HG7A 2AT1A 4MUBA 2NN6C 1WDWB 2A9OA 2QTVA 2ERCA 1GFZA 1XEWX 4PAGA 4OK3A 2AEEA 1NLYA 1ORSC 2X4DA 4HACA 3WSVA 4DV4B 4IG4A 5J2UB 5ISMA 1XE3A 3TJMA 4KH0A 2A6HF 1L4HA 1BCSA 3UKOA 4AP6A 3K70C 2UVPA 2PMKA 3B3FA 3TR5A 1E3IA 4U63A 5ALIA 2Y1KA 2BRUA 4LISA 3ICVA 3PB3A 2WUGA 3TB4A 4YMTA 5KWSA 1GITA 1T0UA 2I22A 2OE2A 4S1PA 4BLVA 2AMVA 3IAS1 4N6OA 4IJ6A 5KTOA 2XOKD 2WHPA 4FD2A 5GOTA 4D8UA 1M1XB 3ZZNA 4FHCA 4MIKA 3KOXA 4PM4A 256BA 1Y1SA 1FWLA 2AOXA 1JLMA 2C4NA 1IONA 3F0TA 5KWEA 1WV1A 1KI1A 5AKYA 3GRPA 3COVA 1HYHA 5EKUA 4FX5A 5AKLA 1TA4A 4V3CA 4EEKA 4C7JA 1U0LA 4KPUA 4NCAA 2HT1A 4L75A 3A9WA 2G7MC 4KAAA 1XX6A 1HMPA 1YFJA 5AP9A 2IH5A 4HXFB 3OWTA 1YS6A 3OF5A 5F28E 2IF0A 1ODJA 1SCDA 1T3HA 2ORVA 1CQPA 3QWFA 4E07A 3EZYA 3HJHA 4V2IA 4F9TA 3GEPA 2OO5A 2ZBEA 4ASUD 2R5FA 4OX9B 1BW9B 4JYMA 3HP7A 4CU5A 5I3ZA 3QIVA 3SQXA 2W6JA 4P4SA 3L7IA 2DPHA 3IQEA 5BQOA 3RJ5A 4HACB 3S81A 3HYNA 1ZR2A 1O5OA 2FPPA 3CKMA 3NOXA 1RHQA 4XVRA 4LFAB 2W6PA 1IXKA 2R48A 4KG7A 2V7VA 1EG2A 1EFLA 2I8LA 3QVWA 1AU9A 1JR3A 1W5SA 1XEWY 4WUVA 5TLSA 5CTAA 4JVSB 1B74A 2YIDA 2ZSBA 1JEEA 4LYJA 4JP8A 1GV0A 5K8JB 3LY8A 5C0OE 2I3ZA 3MCTA 1AK2A 3QOFA 1Z06A 2LPMA 3WXBA 2CT8A 4Q9NA 3GM3A 1J9EA 2JA1A 2GJKA 1RYMA 2R60A 5JSZB 2ZSDA 2BKAA 4Z4CA 3TCKA 1ADYA 3HYSA 2WMDA 2CXHA 4FB4A 2XJ4A 3VHXB 1AMOA 1MRSA 3IQWA 4ZO7A 2C0QA 4OA5A 2WPDD 4MK4A 3N5KA 3G4ZA 1JEQA 1V74B 2D54A 3MGCA 3W78A 3HJGA 1DFIA 3MLGA 2H9IA 1K7SN 3F6SA 3SMVA 4U4AA 4KACA 4EHIA 4ARUA 2C2MA 3NEAA 3LWDA 4KNVA 3K1AB 2KJGA 4UATA 3E4CA 1NU8A 2RH4A 1GRCA 2FSFA 4UHKA 3B0PA 4B0OA 3LP8A 3Q9NA 4O4IB 3PHLA 3SP1A 2CW5A 3EXEA 1CRWG 3NT5A 2CVOA 5TMPA 4UUAA 4A1OA 4KR3A 1QF7A 3E15A 2XS1A 3P9QA 4YRDA 4H18A 4Q4HB 1AUVA 3IP6A 2J0UA 5LN1A 1NG1A 2ZUVA 1NE7A 3HUUA 5LPNA 1NQVA 3QEKA 1QG6A 2K2WA 3RVQA 3UPUA 2B7CA 1TLLA 2X42A 1NMSA 1C4OA 2QUJA 5EP2A 5BWBA 1NQWA 2OWEA 4QTUB 1EK1A 4KHPB <