The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
130
|
sequence length |
405
|
structure length |
387
|
Chain Sequence |
b'HKPLWTRDPKDVTKEEYAAFYKAISNDWEDPAATKHFSVEGQLEFRSIMFVPKRAPFPNKKRNNIKLYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPENLQQNKILKVIRKNIVKKCLEMFDEVAENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEEMTTLKDYVTRMKAGQKSIYYITGDSKKKLETSPFIEQARRRGLEVLFMTEPIDEYVMQQVKDFEDKKFACLTKEGVHFEESEEEKQQREEEKAACEKLCKTMKEVLGDKVEKVIVSERLSTSPCILVTSEFGWSAHMEQIMRNQQYMMSKKTMELNPRHPIIKELRRRVGADNDKAVKDLVFLLFDTSLLTSGFQLEDPTGYAERINRMIKLGLS'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal Structure of the middle and carboxy-terminal domain of HSP90 from Leishmania major, LMJF33.0312
rcsb |
| molecule keywords |
Heat shock protein 83-1
|
| source organism |
Leishmania major
|
| molecule tags |
Chaperone
|
| total genus |
130
|
| structure length |
387
|
| sequence length |
405
|
| ec nomenclature | |
| pdb deposition date | 2009-05-21 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Four Helix Bundle (Hemerythrin (Met), subunit A) | Four Helix Bundle (Hemerythrin (Met), subunit A) | ||
| Alpha Beta | 2-Layer Sandwich | Ribosomal Protein S5; domain 2 | Ribosomal Protein S5; domain 2 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
