3HJGA

Crystal structure of putative alpha-ribazole-5'-phosphate phosphatase cobc from vibrio parahaemolyticus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
202
structure length
202
Chain Sequence
KTLNIYLMRHGKVDAAPGLHGQTDLKVKEAEQQQIAMAWKTKGYDVAGIISSPLSRCHDLAQILAEQQLLPMTTEDDLQEMDFGDFDGMPFDLLTEHWKKLDAFWQSPAHHSLPNAESLSTFSQRVSRAWSQIINDINDNLLIVTHGGVIRIILAHVLGVDWRNPQWYSTLAIGNASVTHITITIDDQIYASVRSIGVPLVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative alpha-ribazole-5' -phosphate phosphatase FROM Vibrio parahaemolyticus
rcsb
source organism Vibrio parahaemolyticus
molecule tags Hydrolase
molecule keywords Putative alpha-ribazole-5'-phosphate phosphatase CobC
total genus 55
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3hjgA00
3MXOA 2P9ZA 1DKOA 3LG2A 1SK8A 5CX4A 1DKLA 1BQ4A 1BQ3A 1SKBA 3KKKA 4ARSA 2YN0A 4ARUA 1K6MA 3K4QA 5AJZA 2H4ZA 3EZNA 4JOCA 2WNHA 2WU0A 2RFLA 3DCYA 1C7ZA 4FDTA 4AROA 3O0TA 3LL4A 2EOAA 5AJXA 3LNTA 1ND6A 3QPVA 2H4XA 3IT3A 2HPAA 4GPZA 5HR5A 2BIFA 1QHFA 1IHPA 3D8HA 3GP5A 1RPTA 3OI7A 1XQ9A 4PZAA 3GP3A 1H2EA 4JOBA 4GPIB 1YFKA 4E3WA 1E59A 4D4MA 2WNIA 1CVIA 1NT4A 4MA4A 3ZHCA 2H52A 1SK9A 4D4LA 4IJ6A 2EKBA 1FZTA 1TIPA 3IT2A 2P30A 4ODIA 3FDZB 2GFIA 3PGMA 3FJYA 4JODA 3E9DA 2P6OA 2P2ZA 2F90A 1YJXA 5AJWA 1SKAA 2YN2A 2A6PA 1E58A 1T8PA 3F3KA 4PGMA 1QWOA 5PGMA 1V7QA 2DWPA 3NTLA 4ARVA 1DKNA 1V37A 3FDZA 2H0QA 3BIFA 3DB1A 2EKZA 2ENUA 2OWEA 4QIHA 5AK0A 4D4JA 2P77A 2P9YA 4IJ5A 2P79A 2P6MA 2ENWA 3HJGA 2P9FA 1RIIA 4TSRA 2A9JA 1C81A 5HTKA 2AXNA 4D4KA 4HBZA 5CDHA 4EO9A 2HIAA 5AJVB 3K4PA 1ND5A 1UJCA 3F2IA 3MBKA 3D6AA 2P78A 2P2YA 3R7AA 1C80A 3IT0A 3E9CA 4FDUA 2IKQA 1H2FA 3C7TA 2DWOA 3EOZA 1DKPA 1RPAA 3IT1A 2PA0A 1DKMA 3D4IA 1EBBA 2HHJA 5CU7A 1BIFA 3E9EA 1QFXA 1DKQA 2P75A 3GW8A 3QPWA 3QPUA 2QNIA 4EMBA 2I1VB 3NFYA 5AJYA 2OWDA 1UJBA 4PZ9A 1FBTA
chains in the Genus database with same CATH superfamily
3T1OA 3LE8A 3W0LB 2VDQB 2VYVA 2IS4A 3M3PA 3PKZA 4JSRA 4AY5A 2OA0A 1D07A 1RZVA 2BLLA 5SYNA 1GQ2A 2WYOA 2WUWE 1WO8A 1W30A 2X3UA 4UEKA 4K9DA 4E2FA 3SBOA 1Z13A 3EVFA 4DTIA 4G09A 2BJVA 4G5YA 1GILA 4RQBA 2BGWA 3AVPA 4DEYA 3VBEA 3M49A 4G8BA 4BGUA 3LECA 2A0WA 5KSOA 1XDDA 2ACKA 2H2GA 3PRYA 3ZUPA 4MWGA 1T2CA 1ZK3A 4WQMA 3I9V6 5AM0A 1WZ2A 1VDZA 2XCIA 3U3OA 1M83A 5K20A 4G5XA 4QFDA 3BWEA 3E3LA 4MYCA 2Z2ZA 1QPBA 3AT1A 1K08A 1VBKA 1JV2B 3QW4B 4U2KA 3ZDZB 5L7TA 2VPIA 3ZE9A 1MB3A 2QR3A 1P4GA 5JJ5A 1RWWA 4RTPA 2C1ZA 2BFBB 1NF9A 4PYKA 1AM4D 1LPBB 3MRTA 1DFHA 3WMGA 5C7YA 4UXHA 5F9FA 5A3VA 3MD9A 4XXHA 2ECKA 1HUQA 5KTPA 3HCPA 3NUGA 4UDXX 2BZ1A 4YHBA 4WACA 3FLMA 3R76A 4HN2A 3UMRA 3L8EA 3F6RA 3IBTA 4G84A 3TM5A 4HDKA 2X40A 1WB4A 4OKNA 5AKXA 2AEEA 3EXIA 1G8AA 1KSGA 5CH8A 2ZXUA 2C31A 4L0QA 2Y71A 4PFQA 2FW8A 1CNFA 1DSSG 4YO8A 1BC5A 3T5MA 2VNJA 3KEMA 3UT0A 4DGQA 1M2OA 3EQ7A 3EGWA 3V7YA 2PMDA 1RRVA 4YP7A 4D6PA 3JWEA 3M9LA 4Y30A 5HJ7A 2A1UA 4URXR 5CB6A 4OHUA 3TX6A 5LN1A 2BC9A 4O5AA 1GCIA 2ZSEA 4FHZA 1GL3A 4I50F 3QEOA 4BLPA 2HJSA 1KL7A 1NW4A 4GBGA 1ORWA 4MMYB 4N12A 2ZUSA 3U48A 3UGJA 5GINE 1ZR2A 1IG3A 1XF1A 3SC2A 1XZLA 3OU6A 1OFIA 3EDQA 3FFTA 4PPNA 3C8DA 4LDQA 2EEZA 2PCJA 4U39A 2WJJA 4NCJA 4ZK6A 5FBVB 1OJ7A 4O33A 3G8YA 3QUSA 4W7IA 1D2MA 1P4JA 3O03A 3ME5A 3AP2A 3Q9NA 1P45A 2YFQA 3KV1A 4MV4A 4BVJA 5FOXA 2GQ0A 3EAQA 3WR5A 4XJVA 2OPBA 4MVJD 4EUHA 2AEFA 3VNRA 3O8CA 1P6QA 1G3IA 3WLHA 1FFBA 4F1WA 4OI0A 3QKUA 3AY6A 1ND5A 3LP5A 4I6EA 4Z9AA 2GEFA 4DAOA 5IVKA 3UV3A 1AUXA 1FJXA 4LZOA 4EARA 3VPDA 1PGOA 2YINC 1E92A 4IXTA 4AZSA 4LDAA 4BVGA 2PYDA 1GPKA 5HKKA 9ATCA 221PA 2PE5A 1HSZA 4NBWA 4LY6A 3KAPA 1ARZA 3KAJA 2FAXA 4LPSA 1CRZA 1F12A 1N8NA 4WL0A 3ETJA 1OU0A 4FMBB 4AUMA 1X1CA 3RC8A 4LK3A 3W04A 5DSZA 3TZCA 3WMFA 2AF4C 1PGJA 1QO0A 3OD5A 4YS6A 1O77A 3C1OA 3FOBA 1PD0A 3HBFA 1QPZA 1E9RA 3HA5A 4HAYA 5KX5B 1EFKA 1QG6A 4HAUA 1IVNA 2IYZA 4IFIA 3GRYA 1BW9A 2B99A 2FZEA 1T5SA 2XUKA 3FZQA 3BN3A 1BKDR 4P84A 3V7WA 3WLMA 3RSQA 5JNVA 4Z53A 1U8CB 2ORYA 3HNPA 3GJSA 5CCBA 1C1HA 3OE4A 4YMWA 2XYVA 3BDIA 8ADHA 4IUDS 4K6GA 4TXLA 5L95A 2CV1A 1U81A 4UPDA 4EY7A 2GLTA 5IVPA 4L9WA 4GC9A 4BQQA 2VHZA 3TW6A 4ID3A 1JUDA 3PYMA 4EECA 5FUQA 5E2IA 2QVYX 1GNQA 5I9NA 4CMBA 5EJFA 4JCCA 3WLRA 5FI3A 2R79A 2ATCA 4AC9A 3HVHA 3D4BA 4B76A 1V8FA 3IDZA 4GOOD 1M1YA 3DUFA 4LGCA 1BGWA 2JEYA 1JHPA 1SQSA 5AUQA 3B1VA 2ZW9A 4RJIA 4MUAA 3ZW8A 3IUYA 6NULA 4Q9NA 4F91B 5FBHA 4BV9A 3X1YA 3IL2A 3B36A 2HSWA 2WT8A 4RKWA 1ZD9A 2XUPA 4IYRA 4UOQA 1B0ZA 1O57A 3Q3GE 4HNAA 5DHSA 3X44A 5DYTA 5TEVA 4AD8A 4YCCA 2J07A 3AUYA 2J0EA 1T8YA 1DWPA 3AXTA 2I54A 4LKOA 4RPLA 2BRUA 3WQSB 1YAHA 3NNDA 4DEVA 4UE3S 1MQSA 1XFDA 2QJFA 5BSMA 4JP3A 5EMHA 2I6TA 2YH2A 1SNYA 1Y5LA 1JRLA 3C3YA 4FYVA 4KQ9A 4PAMA 3T4XA 5BV7A 4PQRA 4EG8A 2KB0A 2XMPA 2YW9A 4FFDA 2WB2A 3OX4A 4OBEA 4HLNA 4XSHA 3U3KA 1Y3DE 4L5JA 2MMCA 1R4NA 1TYBE 2CV2A 2FQYA 2I4RA 1EEHA 1HKHA 3AFNA 3LL7A 3ANNA 3H2ZA 4MP8A 1NQWA 3NYIA 3B3JA 4Z54A 1CY1A 5K6AA 1JHVA 2PFKA 3OJCA 3LDFA 3T4EA 4R41A 4H4CA 2VK4A 3O94A 3G0CA 1MX1A 5HM6A 2LNDA 1EM6A 1NZFA 2KLBA 1PFVA 1R27A 2P77A 3PA8A 4YWHA 4TS4A 2QLNA 2BFBA 4LXIA 1TTTA 3CEPB 4I2VA 3KNZA 1F9EA 3NBZC 3PC3A 4YMGA 3DE7X 1PCXA 1U4NA 4IV0A 4RF4A 3C5WP 4BMXA 1Q20A 1W87A 5FBRB 4CLRB 1V7ZA 4JJGA 1BWPA 1TKAA 4EGCB 4J29A 4DNXA 2FQWA 5LKRA 2QUIA 3K2IA 4YR7A 2KPOA 4MJLA 4JJIA 3QBVA 3I2YX 1WETA 3BF7A 3T94A 5FF9A 1J8VA 1JT2A 2DC1A 1JFRA 1Q7RA 3AQIA 4RWZA 2E5LB 3RIHA 5EWLA 4X62B 1J5XA 3QEMA 1SU6A 1FIUA 1ST3A 3TQCA 3GLIA 3H6HA 5HK9A 4AF6A 3QY9A 3QHAA 1XB2A 1NMEA 4QGGA 3SSAA 3W1WA 4K28A 2HDOA 3E1KA 1KQGA 2FPGA 4JKYA 5SV2A 5BN1A 3HBNA 1X13A 2HCFA 3BHMA 3SGLA 3V8BA 2OECA 2QV0A 4FTWA 1CUHA 4IXWA 4XUDA 1CUXA 1QC5A 2WIGA 2IELA 3IVRA 4NU0A 2PL9A 2XMZA 2J9FA 4O2AB 4CVNA 1GTSA 2J41A 4YJFB 1YGPA 4LJKA 3B8EA 3F6SA 2XRMA 1GG9A 1WPQA 4YJDA 5JSHA 4P4SA 1FRZA 3VHXA 2GWRA 3ORFA 3EZXA 2BR5A 5CYGA 4U2DA 4P58A 2O6LA 2OMEA 4LXQA 4HUQA 3WDMA 1V26A 3BSYA 4RTQA 3OFSA 1GTG1 4QARA 5K0JA 1YZGA 1G7SA 3HCFA 2GM5A 3HJTA 2QVXX 3I52A 3ILYA 3Q41A 4KLCA 4KUGA 4IXNA 5CTJA 4ZU3A 3ZWMA 3ZQJA 5B7NA 4FHCA 3TW8A 4JIGA 2F9FA 1H1DA 3D81A 4Q4HB 1I4EB 1PR1A 4WLOA 5A5EA 1D2GA 4JEUA 3EPHA 4BNWA 4OH7A 3OF2A 5CLHA 3TFOA 3K6RA 4XLTA 2RAVA 4X1YA 4NJMB 4OJTA 3SHFA 1NONA 4B81A 2E18A 2EV9A 4LRQA 5TX7A 1QORA 2HUPA 3BE8A 1M7BA 2QY6A 4PLCA 1JLRA 4FNGA 5A4JA 4IQ0A 5ALZA 4BKMA 3SWWA 3VNQA 5FHRA 5CA1F 5EKDA 3PNYA 4JBLA 3DBHB 2CLHB 3LBYA 1MF7A 2JDIA 1QBGA 4UBMA 4XX0B 5CD9A 2FN8A 2PNFA 4DW8A 3H42B 1M6WA 3HDGA 5GONB 1EUYA 4RZ2A 1E2QA 2VDPB 5FJJA 5ERYA 1SD5A 3D3JA 3E9NA 3FSJX 3S70A 4QU0A 2QLJA 5I45A 1JKMA 1Y4SA 1XMQB 3DNFA 1VCHA 3GDFA 4MEAA 3PD7A 3NT2A 4D1YA 5B4VA 3KVOA 4L3VA 1L4NA 2EQBA 3AB8A 3WHKA 1AY0A 4BNFA 3MB5A 4ALJA 3EZFA 1XEXB 1DIRA 4RESA 5LYYA 3RSFA 2APJA 1EBUA 2JPDA 4EF4A 3CN7A 3ROPA 1LV8A 1R8XA 2WTNA 2CMFA 1B26A 4MQFB 5GZ3A 2QE7A 2WSBA 3WLEA 4BNUA 1XU4A 3CSDA 1UBTS 4K3VA 3EA5A 1J8FA 1L3CA 2G40A 3DYVA 3FDZA 4IF4A 4JT4A 2XWQA 2W9XA 2I78A 3IO5A 3AKEA 2VSNA 2AG8A 3UMVA 4X1IA 2CGEA 5CW2A 2W8BB 1ZJWA 4OK6A 1AK9A 1QO9A 2HWXA 3CEMA 2BEVA 5J2TF 5KO2A 3VUEA 4JLBA 4DA8A 4DN6A 3QVGB 3ORQA 1VHTA 2GDJA 2X58A 3T3IA 2JATA 1GFZA 3DOIA 5B3AA 2HO4A 3AESA 1V3UA 1VLJA 2E4XA 3MWEA 2GTIA 2RGGA 3KJXA 1CE8B 1QYIA 2HHAA 5K0BA 1L4EA 4MCAA 1GA1A 2VF7A 2YY7A 4XCQA 4AWXA 4DG9A 3EZGA 4BLOA 1XCMA 4LJ8A 2F43A 2GB4A 2MJLA 4H31A 2DG2A 3G5AA 1THZA 1T5HX 3FVWA 1H66A 5KJFA 7REQB 4JU9A 4L5BA 1TEZA 3A2LA 5HGXA 3KOZA 4JLDA 4LGMA 4LK2A 1PV4A 1G4HA 2YJNA 3K0EA 1DC7A 5KNLA 4B1FA 2HJGA 2OQ2A 3E15A 4ER6A 1QRDA 2PA0A 3DP9A 4TUYA 3N07A 1L9XA 3C3XA 4O4HB 4GD3Q 1YAJA 1EBBA 4U8GA 1VPEA 2X0EA 3OPNA 3PVCA 1HV8A 1Y1RA 3QWHA 2XQGA 2Z5FA 1KQPA 3Q5EA 2IYAA 3IEPA 4FFSA 2NZYA 4ZXPA 4DJEC 2ERYA 4EHKA 1OW3B 1GRVA 1PWEA 2GZRA 2WUEA 3UBMA 4X7RA 3EB9A 3PVZA 2HBRA 3L04A 1EVEA 4PHFA 3W4IA 1SKMA 4IIGA 2I3DA 4MWTA 5HG0A 4UTPA 1LJLA 2YN0A 5FWNA 1E7MA 3MJTA 3TD9A 2F8LA 3TQFA 4EY8A 1CE8A 3PDCA 3EIEA 3KKMA 2JKZA 5A6VA 1U7PA 1GZUA 1GV0A 1WCIB 1X7YB 2YQ4A 5K0LA 1VECA 1P62B 1GSAA 2NV0A 4NBTA 4DG5A 3FLBA 1RBQA 3HJAA 4ZT7A 1VKNA 2GYUA 2X9QA 1II8B 4RC9A 1LBEA 4IFEA 4XWTA 2OC4A 3UJ9A 1KVUA 3B9RA 1II9A 2N9UA 5FCDA 1V6SA 1SR8A 2Q1WA 3OUZA 4TXHA 1MVNA 1P1CA 2AGVA 1U7UA 2IXAA 5F7ZA 3VX3A 4X64B 1X7HA 1SC3A 3W9SA 2OV4A 4XTRA 4G63A 5DNCA 2NP7A 3FYCA 3GJ4A 1JR4A 4LY0A 4JLWA 3RHZA 4BX9A 4D4MA 1EB8A 3QLVC 4PW0A 3RABA 1Y82A 1K5GA 1Z39A 1P1FA 3LHIA 3DL2A 3OSZA 3IC5A 4NEGA 5F64A 1F38A 1B1CA 3H13A 5EEGA 2WQ7A 2VR1A 4MRRA 4Q1AA 3QMWA 1EWVA 4I6JA 2GN9A 2E55A 4BHTA 4HVAA 1UQRA 4QYSA 2DUUA 4D4KA 5KSZA 1D9XA 3MG9A 1JYEA 2H5EA 3CB2A 5IDQA 4EF6A 1KH2A 1A4XA 2DX7A 3E4CA 2J30A 2NAPA 3TI9A 5DTRA 2C9CA 4JT9A 3D6MA 3HEBA 3NBYC 1MB4A 1IXKA 1RLOA 3B89A 5ES4B 2QQ5A 1M0TA 3VJMA 3AF1A 2CKMA 5I4BA 5JH7F 4YRLA 5KSYA 3ADBA 1J5EB 4R98A 3QLUC 4I5DA 3DC2A 3KT0A 2GNPA 5CH5A 4CEHB 4LTDA 3JQ7B 4X41A 3NLLA 3V4VB 1KMHA 3DWEX 3L84A 4QDKA 4CG0A 4I81A 2WJAA 3O47A 3U4AA 4DJTA 5AUNB 1CF4A 4EVQA 2IXTA 2WWTA 1NRJB 2RJ3A 3F9RA 4WTOA 1O1YA 4HDRB 3LPAA 5G4KA 3NBMA 1JLLA 3ZNQA 2BBSA 1TTHA 1E1LA 2NOAA 3WL3A 1PW5A 4RPCA 1WHSA 3CJQA 4JI5B 2Z9BA 4LXGA 1AA9A 4H7DA 4P92A 4RK4A 4UUBA 2W2XA 1NQVA 1R4MA 2PD3A 3F5SA 4INZA 4CTOA 2PZKA 1NRXA 2YRFA 5ECYA 4BX3A 4ETIA 1BYIA 1R9NA 2OCYC 3VVCA 3ZBTA 1PQUA 2NSDA 3ZJTA 3T54A 2QXUA 4B2LA 4WBNA 3RTGA 4H0CA 4EW1A 1LBSA 3CRQA 5SYAA 4PRKA 2R11A 2XLCA 2DLDA 4LY3A 2FZ4A 3ETHA 5MGNA 3JQ7A 3QVOA 3B78A 3M4ZA 1SULA 3PEEA 3GJ8A 4Q3LA 3P0EA 1YZVA 4HKTA 3HB0A 3ILVA 5H7XA 5CLFA 2MDTA 2CXQA 4Y7DA 3QEMB 4JBHA 4UM9B 3CH5A 2DQYA 1QLHA 5DSTA 4AJKA 4HDRA 4NCBA 1X15A 4PSAA 1E6CA 4RPIA 3ETEA 5ICCA 3W2GA 2HADA 3KL4A 4RA9B 2VWGA 4YJKA 4YDSA 3RTEA 3CRZA 5E3JA 3RVPA 2QUBA 3UMFA 3RU3A 4DLRA 2V9PA 7ADHA 1E7YA 3R3WA 3WL6A 1JAXA 3DAFA 1EM8A 1P7CA 3BX1A 3TPCA 3NDJA 4JLVA 3UK2A 4YRMA 1T4CA 1JR3D 4P7BA 5GMOA 4V0LA 4RFLA 2E85A 3L05A 4LYDA 3WKEA 3L06A 3LXRA 3U5ZB 3EGEA 3L7AA 5DHPA 3OEHD 3ZU2A 4AAYA 2V4UA 1M34B 3DMDA 4EATA 1QTQA 1BSVA 4NEHB 5KDDA 1A9RA 5F35A 2RSLA 2OYRA 1FNNA 2VK8A 5J1TB 3WTBA 4ECEA 2QM8A 3GMIA 2DLCX 1CC1S 2XA9A 1NY6A 1P4RA 1Z8NA 3DVLA 2J59A 5IMBA 4EKNB 4EZEA 5LBUA 2JIOA 1JKJA 1YMUA 1H8ED 2CE7A 4LWOA 2Z5VA 3T3EA 5AW4A 3UW3A 1Q77A 2W4MA 1GUAA 2X5NA 2D7JA 4IXMA 1Y5IA 4F3RA 2W2VA 3NBFA 2J9GA 4MVYA 5F23A 5ER6A 4R1MA 4MR7B 4TKVA 5DF1A 3MWDA 2X7JA 2GAAA 3FCOA 4UMEA 4WY5A 1ANKA 2PV0A 2FLWA 3MTQA 4YHHB 1P7VA 1N2CB 1ULTA 4C4XA 4LZPA 4JJFA 5GADl 2XB6A 3I04M 4BU1A 4HH1A 1U0TA 5G0TA 2ODPA 2WJ6A 1KO7A 2C5SA 1HR0B 3Q11A 1Q95A 3HB4X 4B3CA 1ODLA 3ICEA 1VTKA 4UFNA 4AYTA 1N6NA 3N8KA 2AMLA 5JSZB 5PGMA 1CUYA 4L8VA 5AM4A 4DLWA 2YRWA 5JRJA 3DLIA 3U3DA 3IVGA 2Y1GA 4UM7A 2D5IA 4CIWA 5KQPA 3EG5A 5CX1A 4M55A 3PCRB 2HV8A 1PR2A 2GBGA 1G19A 1Z28A 3ZTYA 3BCHA 2OVFA 4IZHA 5KNDH 1QBKC 2ZQZA 5FWAA 1BX3A 3LBAA 2XF2A 4NBSA 1Q1NA 5JQGB 5JI3E 3JQRA 1KJIA 3LYAA 1OZAA 4R8RA 4YH1A 1RYMA 1MKYA 2VDMB 3OQVA 5IXSA 5FNVF 3C4QA 3AM1A 3GJ7A 3ZDXB 3PQCA 1M7HA 1RBZA 3VTKA 4UEWA 1Q0UA 5AOAA 5K3BA 2FPIA 2WYUA 2QNRA 2X5KO 4CKEB 4RTKA 1S2NA 3WLPA 3KLMX 4U3JA 4Q3NA 4YAOA 1B4DA 3EARA 1XMIA 1B0UA 1U2GA 1R1DA 2VNIA 4FDUA 3JASA 3PYLA 4BO3A 2EFHB 1CY7A 3OLCX 3Q8MA 1B43A 3OZGA 4W5WA 4N5MA 4KK3A 3SSOA 2H18A 1JXOA 1GU0A 4RA6A 4CV1A 4IG9A 4ZYZA 4EVIA 5CM8B 3NBKA 3M0EA 4W1SA 2OPHA 1F2DA 1YR2A 2WHPB 2ZB4A 2LV8A 2H2WA 3OZ7A 5K2MA 3GA0A 1EH5A 3RSOA 3UK6A 3CZCA 2BSXA 2ZBQA 1R4ZA 2HDNB 4YRNA 4IO0A 2WT4A 1RKBA 4TWRA 3ZY4A 3NRCA 4UD6A 5FI1B 3OHSX 5AIAA 3BFKA 3PI6A 2YWEA 5ALNA 4ASUD 4TPKA 2EFGA 4ZOQI 1PZGA 4ARUA 3D54D 2JGLA 2D1QA 2OGTA 4DLXA 3COSA 5LFAA 1TJ4A 2MYUA 1PGPA 3JYOA 1QK5A 1U0HC 1ECLA 1LW7A 3N2GB 3EZYA 4PTLA 5J58A 1JQBA 4OL9A 4A8HA 2CY0A 3AI1A 1YL5A 1DG9A 5SZJA 1DXQA 3F8TA 3TSZA 1H42A 2VUTA 2YWFA 2Z2KA 3DJYA 3WWPA 4F2HA 4Y1FA 2JDID 5SICE 3LW8A 2W6IA 2V7VA 5EWLB 1AS0A 4B3BA 1F14A 1YOVB 4ZQFA 3ZS9A 3VPCA 1G5HA 5JU6A 3TLEA 3O8DA 3QWFA 3R20A 4EA9A 2FGJA 3HUUA 1GP2A 3WS7A 1PO7A 1P9WA 2QEQA 3WYEA 4D98A 5HKAA 3E2PA 1KRWA 4DLKA 1CX9B 1I9CA 3EIWA 3PC4A 1XD9A 3T1YB 3I32A 4CGZA 2GAOA 4QDXA 4WH0A 4ALIA 4WY2A 1U3FA 4R6XA 2BEUA 1AQUA 2ZWVA 4N39A 3V4PB 4C4PA 2B8TA 1ZUNB 1QIEA 2PDAA 3VUFA 5LWQA 2WR8A 4PNZA 4C0AC 1ZP6A 3FUUA 4BNHA 2ODEA 3RBAA 1PZFA 3O21A 2F1KA 1Q74A 4FNOA 2FFAA 3IT2A 5KNBH 3ZC3A 1D9ZA 1ISGA 2Z95A 4JYPA 4ZPJA 5FUXA 2VDJA 3O1IC 4Y1RB 1GPBA 2CJFA 4FOSA 1TZBA 4M9CA 2QGNA 3GN1A 2HA2A 4H6VA 5JVDB 1NASA 4LC0A 1YMVA 5IK2A 3ZH2A 1USVA 2CVZA 2E89A 2VAWA 1JLKA 5JXJA 2PGNA 2E4ZA 4FNAA 2OO5C 4JAVC 3PHLA 3U4DA 3I5UA 1LBQA 1S3GA 1L7PA 1SXJB 2HZBA 3JQBA 3Q7SA 3U4MA 3GLTA 2W2LA 3O74A 3OC0A 4UEJA 4CM5A 3H5VA 2G9QA 3O8OB 4TLLB 3BIFA 3WNBA 2QTWB 3BFJA 3TR0A 2WV9A 3NHYA 2X2OA 4DA6A 3NCHA 1ECPA 1QIDA 2Y0DA 3DOUA 4FN4A 3LHFA 2AFRA 3G2JA 3R5XA 5CURA 1ZNYA 4BZZA 3MWGA 5AH0A 2PBZA 2DR3A 1F4PA 3EPLA 4GOND 4HXGA 2R6ZA 4ND8B 4Y1GA 5DPMA 3NTVA 3T4UA 4IJKA 4X8MA 1U9IC 1CP3A 1JDBB 1NNI1 3MQ2A 4RJ2A 3O9VA 4H59A 1LLDA 5HBRA 3GQBB 3MS2A 3PI7A 3MCZA 4CKCB 2ZRNA 3ZBPA 3CISA 3PEVA 4D92A 5KCZA 2V7WA 4WJZA 3ROTA 3KWMA 4DPKA 2Y1LA 2IYFA 5CVTA 4B73A 4PWYA 2PKCA 5B2ZA 3B70A 4DMHA 1NYRA 1ZW1A 2H7XA 3WIOA 4LY9A 5KPDA 4UAGA 5BNIA 3ZIDA 1J1UA 1UT8A 3C3PA 4KVGA 4TX1A 5H59A 4XM2A 1TW3A 2YV4A 2H48A 3AUKA 1Z4PX 3ETDA 3TZQA 3ITKA 2NTYC 2ERCA 2PO5A 3C8UA 2ODNA 1I2CA 3PLAE 4FZ5A 4RY8A 1S3IA 3M1IA 4LRSB 1CLUA 3AL2A 4BCBA 3UJ6A 2G63A 3DVSX 3GQVA 2FP3A 3BREA 4KPUA 4X85A 1XYYA 2VG8A 4YRTA 4AQDA 1POXA 4Z4IA 4FSHA 3WVNA 1I0IA 3QNUA 5D51S 1WY5A 1VE5A 5C80A 3UK0A 1C41A 5FX2A 3PLNA 1XVTA 3EC1A 1IXSB 4KV7A 3I39X 1C30B 1OE0A 2IPMA 3AR4A 3BRWA 4PO8A 1IJEA 4GZ3A 2OXEA 1YTUA 1NNUA 2B5VA 1GKIA 5CM9C 5I47A 2ESRA 1L7XA 1CUEA 4MSUA 1AB6A 4DLSA 4X95A 1KOGA 1Z5VA 2VP2A 2W6OA 1B15A 5JJLA 3K1TA 1GGNA 2C4WA 3PZBA 2FMTA 2HQ1A 2YWCA 3R24A 1SCUA 2QAJA 3ZIUA 4P22A 4XQ9A 3KSRA 3HU2A 3K0HA 3WO0A 1DAKA 3W8FA 3GP5A 1CZRA 3OCYA 4OAPA 3V33A 2WQZA 3EIHA 3EZLA 3R0XA 1RAFA 2ATEA 2GCIA 2R85A 5L7WA 2B83A 1HQDA 3EMKA 2DBVO 4BJ5A 4BYGA 1GQSA 2VRCA 3TMAA 1E66A 1TM7E 4HTFA 2P1ZA 3F9IA 3PQ5A 2HJWA 3BK1A 5LB2A 1Y1SA 2I2WA 1J25A 2PZ8A 4KQMA 2AVNA 2IDMA 1U0RA 3F6PA 4IZ6A 4AWAA 4Q0MA 2PFSA 2WAYA 1E3DA 3IPXA 3H1PA 2QIOA 1WSBA 3RT7A 4CNQA 4BC0A 2AQHA 4O63O 3TLKA 1PNVA 4CU2A 4TROA 3IQEA 5A05A 1U02A 3JWIA 1F7VA 4MR9B 4DJDC 2LCQA 4ESEA 1YRHA 1CHDA 4F5YA 1ULHA 1L5FA 4WIAA 5BSVA 3KQPA 2PSDA 1KERA 1FFCA 1ZOOA 3EH2A 5JI2E 2I2DA 4CWAA 5EJGA 5BV0A 4UTZA 4Y2SA 4V2UA 5ESRA 2BMFA 2K6GA 3D6NB 4I1VA 4CQMB 4DM3A 1QWSA 3RAGA 4IGFA 3FHTA 2XDYA 2REOA 2NSYA 2Q4OA 3QE3A 2H0QA 1SXJE 4K9SA 1O9BA 1JIJA 3I9MA 4EEZA 3B3GA 4OQMA 1Z0JA 3K2QA 1DTWA 3MN1A 4FEYA 2AJCA 4NHEA 5AI0A 4AMGA 2ISCA 3LC0A 2IVZA 3I64A 1Y1KE 4QSMA 2PRKA 4BO1A 1UPUA 2C0CA 4OBXA 3H5TA 5BN4A 3HSYA 3ZWDA 4B3RB 1FTQA 1KIMA 1GXSA 1O8CA 1Z68A 2HM7A 2QTRA 4M87A 1NW3A 3SDBA 2E5FA 5C1PA 5C5CA 5CDHA 3IAUA 2ILTA 1MJGA 3U4QA 1ECFA 2VH2A 4EYKA 5BW5A 4MHSA 1KQNA 1DPFA 4OXIA 2IW1A 3WOHA 3HA3A 4M7PA 5DI3B 2GVZC 3NVDA 5AVTA 2ZIXA 4QWMA 3RUCA 1F5NA 1BRTA 1NOJA 2FLVA 2LGJA 4PAGA 1NXWA 3O93A 3RSGA 2PGXA 4YN3A 4RHFA 1L9KA 4DIOA 3HDVA 3H97A 3PWTA 4IUBS 4LRWA 4OXQA 2KHZA 1DAIA 1U0EA 3CZ4A 1VSVA 5CXSA 1JIKA 1H69A 1CS0B 3A4VA 3DMNA 3G2IA 4H60A 4IIVA 1TCUA 3LX6A 1FA9A 4MQMA 1SUSA 3GJ0A 4NULA 4MA0A 3A6GA 2BMJA 2QNIA 2NLOA 4K9MA 3D0RA 3OQNA 1GCOA 1KETA 2HRQA 2QX4A 3KJQA 1ZUNA 3WZLA 3SAJA 2EG9A 1QVAA 1VMDA 4PZUA 1ICIA 3OZSA 4YRZA 1YVUA 2B0JA 2XVAA 3LPMA 3IHLA 4IQFA 4BQOA 2CCJA 2E3JA 2RKWA 3BDVA 3QWBA 4RS4A 4N7BA 3BCSA 3SKVA 1NUAA 2J33A 4CT5A 1JMYA 1TZ2A 3INTA 2YS6A 4MKHA 6PFKA 3BS4A 1Z5WA 2CJXA 1F51E 2VTVA 3P4XA 4P32A 3OIGA 5KQRA 2QF7A 3MAJA 2O2SA 4UCQA 4Z9YA 2CE2X 3R0ZA 4BFWA 1M10A 2P6PA 3DKPA 4DVJA 3JQBC 4CMGA 4MDYA 3VPHA 3TZHA 3FJ1A 3HN6A 4M1TA 5CK5A 2HOQA 2FOXA 2JW5A 1BDMA 4KOAA 1L5GB 2PVCA 2HDWA 1YS9A 4LHVA 2VTBA 2QENA 5IBCA 4EGSA 2AE2A 2C2WA 3AEQB 4GO1A 4PIVA 3JVIA 1G21E 1QCCA 3CPSA 1VLZA 1TX4B 3PT5A 4LJ5A 4Q4HA 3ZPXA 4EI8A 1GTRA 3THWB 1NI3A 1G4AE 4CQLB 4CDGA 3DNPA 2A59A 4IH4A 3ZKWA 2D5BA 1P31A 1V11A 3HCCA 4B82A 4Q1CA 1G7CA 2WDPA 2BFCA 4F4JA 4P83A 2E0IA 2OL4A 4FR5A 3U0VA 1R16A 2GJKA 2J5RA 2O52A 3THRA 4BRSA 2C3UA 3DDNA 3MGCA 3VNSA 4AP5A 1ISPA 3EEIA 2J87A 2JZNA 5ENVA 2GA8A 3PGA1 4OQLA 2D1YA 3FX2A 3IGFA 1A72A 5CT8A 1H2WA 1NJSA 1ZD4A 3UHAA 2F48A 2X8AA 1EM8B 1Q1AA 2AA3A 2GAJA 3HB1A 4GOMD 4LISA 2WWXA 3RVSA 1RKQA 3T6KA 5KNCA 2RGAA 4JFRA 1UJNA 3CLRD 1CSEE 1J5PA 2B3TA 1B41A 3JCZA 3RS4A 4EOGA 3EVZA 3F3SA 3ZI7A 3O0DA 1NR7A 1JYFA 5JPDA 3KC2A 4OJKA 1GDHA 2R5NA 4NNPA 3SK0A 3W8NA 5BVHA 1T9BA 2AKAB 1A5BB 1L7NA 2IJGX 5FI0B 3VISA 4V02A 1RLIA 4B9AA 3PUZA 4QNMA 4RXTA 3WWYA 4ENSA 5KTMA 4NZPA 3GGGA 4D99A 5B6PA 1I2DA 3HLYA 4NOMA 1R5JA 2QL6A 3G79A 3QFSA 4FEGA 1DGQA 3FKQA 4IMJB 3LUHA 4MRSA 1WM1A 3AIIA 1EFRD 3F2VA 4UD2A 4XWAA 3KHKA 5FUWA 5HE9A 5BSTA 3UA4A 3W2EA 1E62A 4QTYA 4C5CA 1NF3A 3HB5X 4OP3A 2PJRA 1CT9A 1U7OA 2FP4B 3UOWA 2AFHA 5AKEA 5CIQA 4BNXA 1AMOA 1QHHA 2VEOA 2B4YA 5L9AA 5JSYA 1V39A 1G64A 5TMPA 5HK8A 4L76A 1D8AA 1RWQA 1PX2A 3GRRA 4DPMA 4A3SA 5ITZB 4LSMA 3D7KA 1SCBA 5JADA 3KL2A 3PWZA 3HWX1 1T8RA 4DCUA 3I34X 5JXWA 1IOVA 3MBIA 2G83A 1FU7A 4EJ6A 4O4LF 2PWPA 1E9FA 4A2PA 2YJGA 2Y99A 3IJPA 3LJKA 4RWEA 3NWPA 1YUBA 2ACWA 2PGLA 4PZ9A 1MEOA 1NFFA 4TRRA 2L42A 3U81A 1Z4QA 3EXAA 2QUKA 4S0ZA 5CX4A 4IY1A 1BQ4A 3QH4A 2C4UA 4FFMA 2ATVA 2J08A 4DUZB 2Z9CA 2IITA 5JS6A 1YVEI 1TYEB 3F97A 4JITA 1M34A 4WFJA 1FSFA 4HZUA 1HLFA 3EDOA 3PUXA 2ZE7A 4I2NA 2WBLC 4B7AA 2PWYA 7MHTA 3FH0A 4NMHA 3G0HA 1JHQA 5ADVA 3A4MA 4FN5A 4X66B 3UC5A 3OE7D 3AI2A 4WUTA 1C3EA 2XKAA 3T38A 3V4SA 5JSKA 2XWPA 3USES 4XRRA 3E0XA 2C42A 4J3JA 1TMYA 3RHFA 4OPMA 1WXXA 4R16A 2K4MA 4KU4A 2J0QA 4OX9B 2MSNA 1YS6A 4N1AA 3A6DA 1XEAA 2P27A 3LT1A 3OD1A 4ITVA 4AN0A 4F4CA 3UPUA 2PPLA 1M8PA 4YRSA 4YJHA 1J39A 1RZUA 1E7QA 5F9HA 4NQRA 4F12A 2Q62A 4AO6A 4DXHA 4WLFA 1V8PA 2BAGA 1ZKMA 4MWBA 1U7ZA 1BU8A 2L0XA 4Z7JA 2NVUA 3KP1A 4CLXA 1R4NB 1VLMA 2NNLD 1TZCA 1N0UA 1HEUA 3CUSA 3AQ4A 3P9XA 2QTTA 2FF5A 4QYIA 4C76A 4EGAA 4GMXA 4Y2JA 1W5FA 3E81A 3KE8A 5E2AA 1O89A 3RFTA 3GUZA 4ENPA 5FT9A 3GMSA 1YHYA 2FWPA 3GVCA 3FPCA 4CI0B 1H4QA 1KH1A 5BSFA 5AVZA 3N8GA 1UXOA 1KGSA 2LIPA 1BAPA 5IJZA 5EJEA 4LJRA 2XIQA 2NAFA 3DVAB 4QYTA 2AFIB 1PEAA 3SZLA 4I4LA 3P2JA 3M81A 4XIFA 1NW7A 2HO5A 4GM4A 2GASA 5IC6A 4RVDA 4DLLA 1NHGA 3NIFB 5ALHA 5KQMA 4RTOA 4K6KA 2NZUG 5E1DA 2JAPA 4FOTA 2CWWA 1G0OA 2IEBA 5ENDA 3KSBC 1FYVA 2G28A 4GICA 4LTNA 2XH8A 4PO1A 1ZM3A 1JT9A 3BQMB 3TMKA 4TM8A 1H3EA 5GP1A 3H1BA 4JHXA 1JTEA 1H93A 2HB6A 2WIKA 3VO2A 4UM5A 3BXPA 1E64A 4JYMA 2FE1A 3JQ8B 2FPSA 3ZD6A 2FPPA 4CEJA 4F6RA 1K0FA 1TVCA 3O73A 4H6PA 3L43A 2UYHA 4C0JA 3T7KA 1T0BA 1N5DA 2O1WA 1W59A 4GMDA 1FFWA 4QT0A 4WBXC 2ZI9A 5TARA 1VDMA 5TPWB 1FTNA 1ULAA 3K16A 2HIAA 3Q0EA 4N7MA 5BQPA 3RVRA 1NVXQ 4M0KA 4UKDA 5AKJA 3UQYS 3N87A 4DSTA 1JAHA 2PX4A 1Z6AA 2O2HA 3N2YA 3RROA 1WCYA 3R5TA 5LU9A 1BWSA 4HDMA 1TE2A 1EMDA 1GJRA 3BHIA 4L5CA 3LCMA 3PL5A 3TS1A 4I66A 5B3KA 1RAHA 1EK2A 3A25A 1RJ9A 3ESXA 1OV4A 4ZOAA 3VR5H 4GT1A 3QFTA 4DBLE 1GZSA 4K1XA 2QD4A 3UXMA 4ER0A 4B6OA 5C1BA 4U7HA 3E53A 2OK8A 4Q3EA 3UWPA 4EFLA 3W5VA 1M34E 1YACA 2XVXA 4LMAA 4U9UA 4JI1B 2BEVB 1ZC3A 5C4IA 2VVTA 3LWZA 1YJBA 3L4SO 1B6TA 1MD9A 1V45E 4OV6B 4PSDA 4RM2A 1EQUA 3O4IA 1ZEMA 3R6WA 4ZEMA 4FK8A 3FPSA 1E2FA 2PO7A 4INAA 5DX1A 1OB2A 2OVBA 3OBBA 3F5QA 3EWIA 4DDUA 1ECCA 1C7FA 2IPAB 3A11A 3DW3X 1O6GA 1JQDA 2J7PD 5CLQA 4F0JA 3LPNA 2TMKA 4IIYA 2P0EA 3L2OB 2QMUA 2IU4A 1XTRA 3Q12A 2Q1YA 2HF8A 3KEQA 4O2AA 4O4JA 2BEUB 1QNLA 3QPVA 3U6KA 5BW4A 1Y6QA 1ZRHA 3KPVA 4L16A 5J40A 5YASA 2BCJQ 2JBHA 1OXUA 1JFFA 3GU3A 1UM8A 4PLTA 3H5OA 1IHDA 4OGGA 1YUNA 1HO3A 1YNSA 1TCCA 1TUGA 4B3HA 3TEFA 2R96A 1VI5A 3NHFA 3MCVA 1N2OA 1M2VB 2JA1A 4TYWA 4R8MA 1I7QB 4I9HA 3ADDA 5JXIA 1UIRA 3I42A 4JLNA 4H27A 4XCXA 5LPNA 4GKVA 1L2TA 1NMZA 2HMUA 2VSQA 4J2TA 1W8IA 1G0NA 2O8FB 1GQFA 1BS2A 2VLBA 5DXJA 4JKIA 3UZUA 4ZZ3A 3V1TC 3GBVA 1M33A 4I8DA 3LUJA 2KBFA 4MGYR 5HKKD 3FPKA 4PLGA 1F06A 3KQVA 2BFNA 1ULSA 4PR3A 1YCDA 2NUTA 3H3FA 2H9IA 1GU7A 2ID4A 5DGXA 4N5DA 2O50A 1P5FA 1GWNA 2RGBA 3R0QA 3RKUA 4MW0A 3TLCA 3MRXA 2UVDA 5GVRA 2GHRA 1RM4A 1G2IA 4ZYLA 3MMPA 1S3SA 2ZTUA 3K5HA 1C4KA 4RADA 1W75A 1WD5A 3GHHA 5H83A 4BNZA 1M67A 2IY7A 5EGNA 2MYTA 3MCWA 3HDYA 3B5EA 1TU4A 4ZEXA 1WLYA 4AQYB 3N6XA 3AVXA 1YZHA 4QULA 3IQFA 5JSQA 4QXRA 1JU3A 1UANA 1CY2A 1ZK2A 1JGTA 2B7LA 2ZKIA 1YB4A 4XFDA 4C1NA 1AUVA 2YV5A 1N9KA 5KOHA 1EFUA 1AKNA 4JGGA 1NDHA 1MH1A 4LWZA 1UXKA 5E4JA 1W9MA 3CNOA 5EXDA 1F0KA 5EQJB 1YCFA 3EF3A 4XGIA 1NU8A 3K30A 4QOJA 2FX5A 4ZDIA 5ILGA 4Y6RA 1CQJB 2IOHA 3UA3A 4A10A 3NYRA 2MMGA 3FTCA 3AUAA 2FVYA 4OQZA 2IOFK 2HMYB 2OLKA 2CL6X 2IF0A 2XNHA 3IERA 2BGRA 1Y7IA 3VHQA 1E3IA 3OAAA 5DWDA 5F21A 3X1ZA 1J6UA 3O4GA 1XRPA 2RBGA 3L4EA 3DE5X 5FTJA 4PO3X 2VJBA 2DTEA 3PUIA 2P90A 5KHAA 2WIDA 3IEKA 1GVNB 3K6SB 4DCSA 3CRRA 1NF8A 3N8DA 2V7TA 1L8LA 1ZOLA 3CNBA 4JR2A 4YMIA 5AW2A 4JR1A 5EIWA 4WLNA 3VR4D 3EC7A 4PG7A 2GPBA 3EVBA 4U02A 1SXIA 4LJ7A 4A8JA 1UDXA 1TMOA 2A2ZA 1Q7CA 3OCUA 4I1IA 1AE1A 3KT6A 4QD3A 3SR4A 1ULUA 2A86A 2C1EA 4M99A 4QAQA 1A4RA 1H6BA 4EMTA 3CLTD 3E2IA 3HXKA 1ZCFA 2C9ZA 3ETLA 2ODAA 3OM8A 2I4TA 4J2OA 5C3UA 3BJZA 3WJ1A 4DKJA 1DAGA 2ODBA 2GCGA 4NCIA 5IULC 2D2VA 1FOEB 2HSJA 1PT9A 1WS6A 1Y8ZA 3RTBA 5BN4B 2XSZA 4M53A 4P3NA 1DXHA 4B4OA 4C4RA 3ILXA 1Z4KA 2VOJA 4ZVOA 1GR1A 4HQ6A 4BRWA 5EJAA 1VPLA 4ZAYA 1V5WA 3OFNA 1V35A 3DDHA 4UUQA 3K9WA 4CE6A 4ZJPA 3HV0A 2VAPA 1E5QA 2X2EA 2IUSA 3KOWA 1LWOA 1I7NA 1KIAA 4TKMA 1R5NA 2XGJA 1P72A 1W4AA 3TQRA 2ZJ0A 1RKUA 1XKLA 4FGWA 3JY6A 4PZLA 2WKWA 3D8RA 4BNGA 1EESA 2H59A 3C74A 3RYFB 5IX8A 3G2KA 4A7PA 3NHLA 2H31A 3SZOA 3D4NA 3M1YA 2DCMA 1FQKA 3UB4A 1QJCA 4BOYA 2E4YA 2CDCA 4LZNA 1UXHA 2H00A 3UBTA 3CT4A 1TYAE 1THMA 2ZRPA 2VWQA 2PX0A 3CWCA 2BGGA 2CDNA 3GF4A 4JB0A 4CODB 2BHSA 3H4TA 2JFQA 3DE0X 4PPYA 1EE9A 5FPPA 4DR5B 2R48A 1QGDA 1H2YA 4G26A 1CEXA 5B1SA 4HFNA 1N1EA 1NV9A 3WJ2A 2CB0A 1LQTA 1PWXA 3I8XA 1KJ8A 5CK4A 5TEWA 3RAJA 1IVYA 1O5IA 5DHQA 1U2SA 3B3AA 1W2GA 3H2BA 3K9CA 4IDPA 2B37A 5DIFA 2Q3MA 1R0KA 4PLPA 1CUIA 3R41A 1G8JA 5TQJA 4LF5B 2I4OA 2Z0MA 4TT3D 4OOFA 4GOJA 2J48A 4X90A 2VP0A 2FDRA 2UUPA 4M9XA 1L5LA 4BZQA 1SKAA 2G0NA 1XROA 3TLXA 3HKDA 1SCKA 3QBDA 2JAHA 1KFJB 3STWA 1HL3A 1G8KA 1LV7A 1XP8A 3GARA 3H87A 1SHJA 4K6CA 1DKNA 1OLXB 3O83A 2AOXA 2Q46A 2BL4A 1N6PA 3K73O 5EZSA 3WLOA 3PQ8A 5ECDA 4K40A 3KT8A 4ZVVA 4JI0B 4B3XA 5P21A 1CDEA 3GLKA 4P4GA 3DAGA 1AO0A 2GZSA 4ZV9A 4IM7A 4OGKA 2BM8A 3NO4A 1DEXA 4RHXA 2IBTA 5IW8A 5JD4A 4TKUB 1W47A 3NHPA 4GZLA 4D56A 3HLTA 1X70A 1TM1E 2GZ1A 1O4VA 3N86A 3VYWA 2J6HA 4AYWA 1VIAA 3NRBA 4BNVA 1XNJA 2FW7A 4URZR 8AT1A 1J1IA 1O7JA 1J0AA 1W6UA 3BJIC 2CHUA 3BTVA 3GAAA 3E7DA 4M38A 4F3NA 4XEUA 2R7AA 4MGHA 1OQAA 2QG6A 3CZAA 2PSFA 4OQYA 5CH3A 3AZPA 3KBOA 4WBNF 1UOOA 5IT5A 3L4BC 4P53A 1EGMB 1TFUA 1DIAA 3OY2A 3P2IA 3W6OA 3ROXA 1C80A 4BPBA 4BTVA 3VC1A 1N3LA 1IXRC 1R9GA 4YXFA 1USIA 2XQKA 3QI7A 4GAEA 2RGUA 3PF9A 4GYKA 5HPYB 4RULA 3BTUA 3F3MA 1U9JA 1WXQA 2QX7A 2XQIA 3KU1A 3TNJA 4QUBA 3AWDA 4RHCA 4FYIA 3WRYC 3ZD9A 2HMWA 1N2XA 1LK5A 1MR3F 2UVQA 3SMVA 4RXUA 3UGTA 5GZ6A 1JLHA 1HZZA 3KJFA 4CL3A 2WTUA 5JAQA 1FDIA 5BWCA 2MTBA 5K3OA 3DM9B 2GN0A 4DUGD 4ZOBA 5FIUA 3SQOA 3QFHA 1WKVA 1XXHA 1N2BA 4DG8A 4H7PA 3K92A 3KFXA 1THTA 1KDVA 3PD1A 3KXPA 3NEJA 4QECA 5EP1A 3B48A 2PBRA 3ZWWA 5KNDD 1J9ZA 2YJ6A 2ZJ3A 2MCFA 1REQA 1X42A 3RWMB 1HLGA 1I0ZA 1NOKA 1TZMA 1V47A 2NVOA 3AYXB 3H6GA 4FDTA 2XBMA 1O03A 3A0UA 3SXUB 1EJ6A 1FMLA 3I3OA 4G07A 4C0HA 4E7PA 5JDIA 5MFPA 1WBBA 1NQTA 1OD6A 1E8DA 1KXZA 3IOCA 1H2AS 1IBCA 2Y6VA 1J7KA 4GZ5A 5A9RA 2ADMA 3D8BA 3IKMB 1DB3A 3ZX5A 4J91A 5EA2A 4EABA 5A3JA 3TQOA 5I01A 1ZJJA 1RXCA 2X4DA 5KQGA 3WMRA 3ZDRA 3OKPA 3P9RA 4K26A 1XJ5A 2C4KA 3BRQA 4KAAA 2OLEA 1YFKA 2W8ZA 4XFKA 1L5NA 1W36C 1E59A 2WG2A 4LHSA 1MEEA 2BR4A 3P94A 1TQ4A 4AP9A 4TOIA 3A1FA 3ESBA 1PL0A 1Z9BA 2DXIA 3C7AA 3NGMA 3F6CA 3IKLA 4L28A 4YJ2F 5KCMA 4G0XA 2IS2A 5G2OA 1CV2A 5BQ5A 3S7ZA 4NAHA 3UAWA 3BAFA 1PJSA 2Z1DA 2YNMA 3L0YA 5A5DA 2YV1A 1BZYA 1VIYA 3JZAA 1HQCA 1NXVA 3Q6MA 3F96A 3RYHB 4ZV7A 1YZKA 4JQSA 1XLTC 1WWKA 2A7XA 3TL2A 4GPBA 1QHXA 1QVRA 4IDEA 4F5ZA 2VHUA 3MPUA 2B1GA 2MIIA 4FKMA 2LR0A 2VJAA 2IL1A 4GU5A 4RBNA 4YFYA 4H18A 1VZ2A 2HFKA 1EKXA 5FBLB 1EGAA 5CVDA 3JWPA 5IJAA 5IEJA 3VXKA 3MM4A 3TWOA 2EFJA 1FJHA 4A8JC 3AZOA 4XUGB 5AXAA 2Z8ZA 4KR2A 3BRSA 3BXXA 5HW0A 4G0ZA 2BKLA 5FL7D 2Q7XA 3WFIA 1MIHA 1YS1X 1IZ8A 2ZZNA 4PY2A 4WINA 4A9AA 1Q92A 2BGTA 2QXYA 4XQEA 1FB5A 1ETHA 1EU1A 1QHIA 4EX7A 5F5XA 2CYAA 3VGJA 3GUHA 4I5GA 1OU4A 2IHYA 2A33A 2O4CA 3MAGA 1ZD1A 2J3JA 3CVJA 3H9GA 3LQRA 4R40A 5EIBD 3DXXA 1U0GA 2FEXA 7ABPA 5HTOA 3P27A 3GLGA 4BGVA 5HOEA 3IALA 3KJNA 4AKEA 4JEHA 3ZQUA 5BXYA 5HS4A 3GFVA 3AVTA 5T8KA 5M34A 1ZMOA 1FFAA 1FNSA 4ZD6A 2WHPA 4KFUA 3KXDA 1TEVA 3UUEA 5CCEA 3GVIA 3JPWA 2B5OA 4C21A 4QUIA 3TTWA 5DTQA 1RXYA 4D8XA 5IM4F 5E4TA 4AJ4A 5D3MB 1E2DA 1L1EA 2WIJA 1D4ZA 1T2DA 2B78A 4OBBA 4HDOB 1T6YA 2GCNA 3NORA 4E1AA 1Y63A 3HJRA 5CPBA 4YI5A 1OA0A 1EG7A 2DHCA 5B1EA 3AEQA 2VZ9A 3DFIA 3IUPA 1A04A 3G5LA 3KWFA 3P26A 5TSDA 1XHFA 1WHTB 3IDOA 4AZWA 3A1TA 2W8BA 1IPHA 1DOAA 1OTYA 4PLVA 4EB6B 3H5LA 3T0IA 3T0GA 3TNYA 4Q1EA 3AR5A 5KYWB 3KWJA 4D74A 1SZCA 1WV1A 1PWHA 3VPBA 2O8FA 4KDCA 4F9EA 1MUUA 3V4OA 1MFPA 2IEZA 3IFSA 3ERCA 3AIOA 1M76A 3MWLA 3AHCA 1C1DA 1A9YA 2CLIB 4YBZA 4FGSA 4RKEA 4EWLA 1AXEA 1X86B 3M1LA 1YDEA 4MV7A 5EJ4A 4J0FA 1SG9A 1P74A 1PIWA 1KQOA 1X38A 1XMVA 2PBFA 1QK3A 3JQGA 4JN6B 4LYAA 3PTAA 4HEQA 2O5CA 2WPDD 1L5MA 1BHSA 1BS1A 4B8WA 3F3YA 2CLKB 3D8TA 2PUJA 2PWAA 1T8WA 4HO1X 4MS3A 5DM4A 2IV3A 3VJKA 2AWNA 4ZKEA 4Q15A 3P9ZA 4D79A 1DLIA 1RLTA 3A27A 3LCCA 1RYBA 2W11A 4K6MA 5JSZA 5KDOA 5KHOC 3GLIB 2HNBA 4PPGA 1IXYA 2C5AA 4P35A 1KORA 3UPTA 2AUTA 4KXWA 4H15A 4RSMA 3CC8A 1A2OA 3TUZC 1YASA 4FCWA 4LXYA 5ISMA 2UZAA 5HIJA 4WK2B 1CNEA 1NN3A 2PZGA 1U2DC 1G66A 2V74B 3U7RA 2Z09A 4MA4A 5CVVA 1Z6GA 2FWBA 3ZWXA 2H9YA 3B1YA 4NJMA 4E2XA 4OHWA 1TF7A 2JB9A 2P67A 1GN9A 3EOBI 3OTIA 5HRAA 5DSXA 3HEAA 2ZJOA 4M2LA 3PNLA 3C1AA 4ER3A 4X00A 3HYLA 1YB2A 3L7YA 4EFNA 3W6ZA 2NYVA 5EJIA 2XKJE 3TBHA 4QFCA 2RHRA 1CEEA 4FPXA 3IJRA 3VSDA 5ALLA 2G5PA 2FY8A 2YN2A 4NFYA 2GNOA 4AJJA 2QXTA 3RO7A 3JWGA 5IMSA 5K01A 3RVMA 1TCAA 2H1FA 4P08A 3GEIA 5ALYA 5C0OE 3KKEA 3ZY5A 4KBYA 1ZZEA 3AY0A 4J03A 5JISA 2XUZA 3DHNA 3TTTA 4C29A 5EINA 1VKJA 4E5MA 2BGUA 1VCIA 3NAZA 5AVWA 2P0YA 5IAKA 1GNLA 3FBWA 3NTOA 4QU5A 4UNQA 1HLDA 1IPEA 5AHRA 4YMTA 5BYKA 1LRLA 1BOOA 3W8EA 2R6GA 1NNLA 4KBGA 1NI5A 3A26A 1Z33A 4K3UA 4E30A 1JMKC 5KNBA 1W29A 2ODTX 2J32A 3BSFA 3HKCB 4EFDA 4HNVA 4ZTUB 2QQEA 4M36A 4NRDA 2EX0A 2VP3A 1OV6A 5FORA 4AMZA 3U6BA 3AVUA 3T0FA 2BPOA 3QKIA 5IG2A 4WECA 2GKGA 1WZIA 4W63A 5I9BA 5JDIC 1E1RA 3D5QA 3DTVB 2EF0A 4MI9A 3ZGNA 3VZBA 1H1LA 3U4IA 1FL9A 1IB6A 1IZ7A 1NW6A 2JA2A 5EIAA 3L93A 4QVIA 1NIPA 2B92A 3O2NA 3KB8A 1XELA 1ZO8A 1R10A 3VOSA 3ZHXA 4D3FA 1W25A 2QUZA 1ADGA 5T4HA 3TB6A 3RUHA 4KREA 2GCEA 5GPBA 5DBEX 5AJTA 5EJ9A 2ZRGA 1JDSA 4GGMX 2H4FA 1L5RA 1AJEA 1KEWA 1ICEA 5GM1A 3WO1A 1OH6A 4CN8A 1IHOA 3L1IA 1S7CA 2H1OA 1RWPA 2YBDA 3GB9A 5AKZA 2LCFA 1L1FA 3ROZA 3PL1A 1ZIDA 3VVBA 1SA0B 4FB5A 4YDQA 3TLYA 1YXMA 2BEKA 2ID7A 2BN4A 4M9ZA 3PNOA 1NMQA 1L8AA 2I2BA 2P35A 1ZVVA 5K3CA 1FZQA 3A3YA 2CYCA 2JVJA 1E3WA 1TAGA 1LS6A 3J7TA 3SJUA 4OXKA 4TZKA 2QN8A 2VK2A 4R9NA 1AX9A 2UZ1B 2SKEA 1K3TA 1U4SA 1C30A 1YA4A 3RPEA 3S5UA 5C5IA 3U17A 2JGDA 1A2KC 1BX1A 1XRQA 2ECFA 1X8JA 5TC4A 5I51A 4EA7A 3UJCA 4ZZ1A 5BY2A 5JHGB 3RAEC 5H3CA 2VXCA 4M7WA 4HPXB 5F1OA 1FTSA 5C53B 3LUFA 5EKSA 4IIUA 3REQB 3L18A 1EXVA 4U7WA 1AKQA 2SKCA 4TV8A 3TE6A 3OTOB 1UPXA 2I2FA 1RWNA 4PTZA 1DAPA 3G59A 5EC8A 3S1AB 2BFWA 3R44A 4TT3A 3M6IA 4MUHA 1ESZA 1OT3A 3H19A 5K3DA 3NVAA 2AZMA 4ZEOA 4FHEA 3FCSB 3NBQA 4ABTA 4FX5A 3HCRA 4G1CA 1FUEA 1JHZA 3LCVB 5DM0A 1Z4LA 1ECJA 1Q1BA 4X0EA 4O2BB 3VC7A 2IYSA 2OEPA 4BVLA 1ZU5A 5LLSA 4C0LA 2QYSA 3PGMA 5C2JB 2QSUA 5T8KC 4A6EA 4EH1A 3HKEA 2W0MA 3D5EA 5ICSA 3Q7IA 2DHDA 3OCCA 3GD5A 2WY2D 3JD3A 4CBVA 4XWGA 1ZD3A 3ZU4A 5JLJA 1FXUA 5KTNA 3GEHA 4D3SA 3CVYA 3FOFC 2Q28A 3EK2A 1Z3IX 2FEKA 3SJZA 3WICA 1QWOA 4E46A 1KNXA 1V48A 4JV5B 1J9EA 1VI6A 1SHLA 3T7DA 3DZKA 1R0LA 4CN9A 1Z5NA 1XX6A 3D5TA 1DBRA 4J0EA 1YC5A 1MT3A 4BDTA 2VTBB 1EHCA 5BOSA 5DV9A 5F3DA 3O75A 1KZ7B 1W0KA 1U2TA 1G3RA 3E3AA 2OTCA 1VJDA 5BURA 1OH7A 5EEHA 2PR7A 3CH7A 3AZQA 4GVXA 3AFIA 1SXJA 4C78A 1V96A 2NP6A 5KS2A 3ABOB 2AKYA 3MIZA 5C8VA 1QGUB 3TR5A 1QIGA 5AW5A 1RC1A 4WCVA 5A7FA 2VJPA 3LVFO 3EY9A 1T9KA 4JXZA 5DX0A 2TMYA 1Z75A 3RJ5A 3R6GA 4QUHA 5B7QA 3I0MA 3NYWA 2E6KA 2EBHX 2XECA 2UZ4A 3K4PA 4N82A 5F76A 3WL4A 2CDRA 1XQYA 1GQRA 3IEIA 3JZDA 4JUIA 1G1AA 2OXTA 2EZ9A 4KV9A 2ZUFA 4MUMA 1JJFA 3CBGA 1MOPA 2M1ZA 3E9CA 3HI4A 5BYBA 3ESCA 3C87A 3RIGA 1Q7TA 1IY2A 1JZTA 1Z36A 2XPCA 2V9ZA 1XYVA 2R5WA 2B2NA 2PBLA 3UGKA 5E1BA 3GLFE 4DIDA 3H2KA 1K6IA 3D6VA 3P32A 4GFDA 3GVXA 1VCNA 3SS7X 5EJ7A 3EX7C 1NX9A 4UNIA 2B8NA 4RSHA 5EHQA 5AK4A 2JBWA 3ASYA 3CS3A 5A4DA 1LVGA 1U9ZA 5CVCA 3VR0A 3X2EA 5ELXA 1AUOA 2OZPA 1XZDA 2V97A 3A70A 4G5HA 4NX2A 4D0NA 4D8YA 2ZRQA 2YHIB 2VYND 3SQMA 3BE6A 3IA7A 2DULA 4GWKA 3WWEA 3K9BA 4F3CA 3OEHA 4BC1A 4CDRA 1W96A 1EVJA 2R84A 1E1QA 4HRVA 4IL5A 2CXNA 1J33A 2MYPA 3AYZB 3K6JA 2QL7A 6ADHA 1HFWA 3G0BA 1ESDA 3WP0A 1V9CA 4W9MC 2WKSA 1A2QA 4F86A 4WY8A 5CIYA 3NX4A 4IIXA 4JA0A 1EINA 4QPDA 5BN5B 5SYMA 5A1JA 3X43A 4PZZA 2ZRMA 1QIHA 3F0TA 5I9LA 3SQWA 1T34A 2HA0A 3WLSA 1B42A 3N0XA 3ORYA 4MXDA 1L7AA 3OCXA 2XUDA 5LBIA 2GO7A 1Z4OA 3RR2A 1Y6JA 2ZOSA 3PSHA 1BCSA 3PLRA 3GRPA 1DE0A 1XTKA 2EKLA 4N65A 3C16C 3SR0A 2G5CA 4QXOA 2X0JA 2V8OA 3U19A 1J8MF 2A9KA 3RKSA 4NFSA 2WJZB 1JQJC 2WJ4A 5BV2P 4KAJA 1IQRA 5F1YA 4NOLA 3VMMA 4Q1DA 1SK9A 4RPGA 4WKGA 2O8CB 3IVCA 4NPAA 2B20A 2NYAA 3O38A 1PEDA 3O8NA 3HL0A 1DFGA 3QQPA 3B7PA 3ZLTA 1NNEA 1EGQA 4K86A 5HJ2A 3U3MA 1LQUA 3FCAA 3GH1A 4TKLA 5E95A 3F5DA 4PVCA 4U4AA 1OVGA 5A06A 4LOIA 1ZJ4A 3C15C 3HGMA 4DS3A 3EVNA 4RKRA 1UDWA 3NUQA 1N6KA 4M7RA 3CVXA 1AG9A 1OLUA 3LXMA 5B6JA 2VYVD 3LQKA 5BR8B 4NCAA 2DWPA 5LVAA 3GPBA 3N59A 1DBPA 1WXIA 3QA3E 1XDBA 1PZMA 3REQA 3FCXA 3KQTA 1TMKA 3DZCA 4J7UA 4EY6A 4UW9A 2Z04A 2PXCA 4HR7A 4MYRA 2P9YA 5I7AA 5I7VA 5JNRA 1Z38A 3DFMA 5JMTA 1A9ZA 2Z1MA 4M9UA 5C32A 2QR5A 2GHQA 3DZBA 3FKSA 1C8LA 3SVLA 4MVJP 3O84A 1XAGA 3CIFA 3CVOA 4CG1A 2QRVB 3CBQA 3PCXA 2WSSA 4L4SA 4C4ZA 5C7LO 5K0CA 4KXQA 4GX2A 4ZYUA 3E7PA 4C7MA 3MZ0A 2O2IA 4B6EA 5CYPA 4UMFA 1UL1X 3PXEA 1A8IA 4J0KA 2E82A 2GZAA 1V16A 3GT0A 4H7KA 4QUGA 2X4GA 1YTLA 3IPAA 3QVXA 5FFMA 1VL0A 2ZVDA 3CKKA 3QENA 3GEPA 2I6UA 4MOWA 5JDCC 3QJ5A 4BFSA 2ZUEA 3HDQA 1IJKA 4P1ZA 1W44A 5T3UA 3QF4B 1DEHA 3U61B 2ORED 4XGKA 5GY7A 1MJFA 4RH0A 3WLAA 2FHPA 3LKVA 3HWWA 3SSNA 3OT1A 1J8YF 3WYGA 1I01A 1YNOA 4J43A 2HK7A 4IDQA 2AFHB 2IUYA 4GMHA 2X19A 2R87A 1E77A 2PL1A 3COVA 3I2JA 2R8RA 2I1VB 5IJ0A 1QH1B 2W6ZA 4PCAA 4UREA 4MZDA 3B9QA 5KVAA 1P7YA 3U60B 1YR6A 2QDKA 1PS9A 1VIMA 1CUZA 1S1MA 1U5CA 1KEUA 1Z0FA 2EERA 4KQFA 7GPBA 2VPTA 4MQEA 3LW7A 2X13A 2AE1A 1W2HA 5TMEA 4ZJUA 3JYPA 1PEYA 1JEAA 1E0DA 2Y4NA 3OT5A 4QUDA 1DUSA 3RVKA 4A8JB 1GGMA 4HSGA 5AI4A 4DLTA 1O96A 4MKZA 2P5YA 2IGTA 4MVJF 3DOHA 3OF3A 3MERA 2G72A 4HQ0A 4TVBA 4OQXA 4YRIA 5JR3A 1DAFA 1YDHA 4CMEA 3PK0A 2IRWA 5DGIA 3MS7A 1BXGB 5LP6F 3ZWAA 1R2QA 2J09A 2QP9X 2OXRA 1CLEA 1BW9B 3MJSA 3OWHA 1KVQA 2WMNB 4MV6A 4JBGA 3D6FA 2OSBA 5D84A 3FN4A 3LMKA 2QQFA 3AHIA 3K0FA 3OZUA 1HGXA 1L5SA 1K92A 3NBUA 2H1HA 1V3QE 3GMDA 4F3YA 1YRLA 3DE2X 5CP8A 4RK0A 4YRBA 4D0SA 3GA5A 3ONDA 1X1BA 2BI4A 1T3LA 5ER9A 3ZYCA 4OAQA 1OFUA 2WFMA 3PFCA 1B3BA 2YZGA 3IP3A 4CG3A 1TOAA 1XCPA 2GUWA 4KXNA 3UICA 4AJ1A 4ECAA 4ZICA 3QU2A 3VDNB 4QOIA 1U8EA 4R69A 3VOBA 5CTAA 5EMNA 4G0MA 3L8MA 2C9BA 5K4HA 3HU5A 1DL5A 3B6IA 4DEXA 1E1KA 4PHGA 5LMUB 3GLQA 3PE6A 4J1TA 1FZTA 2HRBA 3NOQA 2POQX 3HCBA 1KMIY 1KSJA 2M1XA 2PIDA 4L8FA 4AL4A 1PVDA 2DBZA 4JJEA 2XW6A 3DE6X 2B69A 1IN8A 2PX5A 1O94A 2FN4A 2Z2IA 4LC9A 4QJIA 4DHWA 2OGWA 3ST7A 3M6LA 5FO1A 2PXXA 3PHIA 1PHPA 2WWGA 1E63A 1F0PA 3QXJA 1PEKE 2P2SA 5ITWA 4YT8A 2AV6A 2BTQA 2PH3A 3GAFA 3C5VA 2W5UA 4HEJA 2PNJA 1BROA 4F3KA 1F9AA 1ZPDA 3AKYA 2WZBA 3JYNA 2FEMA 1NVFA 2COEA 3H84A 1GY8A 4NMMA 1T9AA 4Z99A 1I9GA 2J46A 1DIBA 2Q5IA 2QK4A 3L4BA 4ARZB 1JB1A 3H4IA 3OMXA 4GPTA 2DRIA 2ZR0A 4Y2RA 2QT0A 1HC7A 1U8UA 4JDPA 3IDQA 5FV7A 4QQNA 4ZVRA 3F78A 1RSZA 2N42A 1YRAA 4BX2A 3HN2A 4HXEB 1NUQA 4HZIA 5D5QA 5TPZD 1Z7EA 2VCEA 3DFZA 3CX4A 4AU1A 4G86A 2B34A 1A77A 3NUZA 2VHXA 4CCAA 3QF4A 3UH1A 1HE8B 2PZEA 4MHTA 3UMCA 5GV7A 2F8MA 3PTLA 4N9WA 5I7SA 1XQWA 2FA9A 3FYUB 3VQTA 1HZZC 3WGVA 2NO6A 2ZLBA 3G2LA 4L7VA 1NF2A 3E3NA 2I4LA 3NOVA 2Q4RA 1NMSA 2IY8A 2QWXA 1U9CA 2P3QA 3BOSA 2MINB 4O8ZA 3VC3A 2HMSA 2JI9A 4AICA 1NU6A 4W8OA 5KYWA 3DKIA 3IJEB 1OUMA 2A9QA 1JIUA 4KMMA 4A27A 5ALDA 1MV8A 2I7XA 4UHKA 4CDNA 3KTFA 2D0OB 2NU6B 4IDBA 1P6XA 4D96A 2BVNA 2WUVA 2FP4A 4JMPA 2I9PA 4DLYA 5CBPA 1Q57A 1QU3A 1P44A 3I2HA 3QPWA 3LT5A 4F4IA 1SO8A 3SI7A 1FBTA 3EEOA 1P2FA 2QDXA 2IWHA 1N7HA 1JKFA 3OZXA 4BVHA 3BD7A 1W85A 1L4MA 1E1NA 4OU4A 4D81A 4QXAA 5COQA 1GZHB 4YQFA 3BWVA 2B30A 3OHMA 4NCNA 5EMKA 2ZUVA 3VR5D 3KQUA 5AVUA 2CLCX 3CLSC 1Q91A 4UVIA 3W5DA 2G70A 1QCYA 1R5BA 2Y92A 3T41A 3O8LA 4JXKA 3TKLA 3FVRA 4MVJM 4Q3BA 1DMSA 1YR3A 2WT9A 3LO5A 4DV3B 4US2R 3B53X 4MYHA 1QYWA 2ZZKA 7AT1A 2ZXFA 2F62A 2OK7A 1AIPA 1JI0A 4Q7EA 3VKHA 1Z35A 1QOPB 1NI4B 3HC7A 1J42A 5C5EA 1REQB 1P73A 1A9SA 4V2IA 4MQ5A 3N2GA 5KINB 5HFNA 1H2EA 3QOXA 4IGEA 1WXHA 3HI6A 3LUDA 4MKRA 5D86A 5BW8A 1YBHA 2OM6A 3NFRA 4HH3C 3IRVA 2G1AA 2YV3A 1QAOA 1FMFA 4RTSA 1OIWA 1NW8A 5IYZF 4HVTA 3M3HA 3AESB 3MWEB 3ZV4A 5E0OA 4FUTA 1HE2A 1GPMA 3BTSA 3RFCA 3S81A 4INOA 3D7SA 5KDLA 1XZMA 3FR7A 1CWUA 4R81A 4YJGB 2K7ZA 1M0SA 2ZBFA 3FJYA 4WERA 1BWRA 1C3OB 4MA5A 4D4GA 4BUJA 3N28A 3FBGA 1GYQA 1H94A 1LD3A 2G4VA 1TAQA 1J22A 3GVPA 3IUMA 3MWJA 4PN7A 2PSSA 1OX5A 3EIOA 3MOIA 2GJ4A 4GBED 3NDIA 4JB8A 2P6UA 4KO2S 4W8HA 4WD3A 4MIOA 4X8LA 5H16A 5M7EA 3ZK7A 4AJLA 1LGYA 4D0GA 2IQIA 2J5KA 1OFGA 1SU8A 2C94A 1MAVA 3ZWVA 1JTFA 3R3ZA 2TECE 1HOXA 2Q5FA 4IJUA 4Q3DA 2ZSAA 5KVSA 3JZFA 5JO9A 1NQAO 3ZWCA 3ANMA 5SY4A 3RUEA 2H5LA 3OQPA 5KYYA 4MI1A 4EYEA 5T6MA 3RHSA 821PA 4AJ2A 4GX5A 1NRWA 2XV1A 3HB9A 2AN4A 4M0UA 3N9IA 4RVSA 1QB8A 2BFDB 3ANYB 4U2GA 3I6YA 3G2PA 4GLOA 3P9IA 4PN3A 4OH1A 1WJGA 9MHTA 2VP4A 1WUTA 4OCZA 4RHYA 5C1DA 3M4XA 2BHNA 1O58A 2XGMA 1J0EA 5FUVA 1YUMA 4AWBA 5ED0A 4DZRA 4ZCRA 2XHZA 2BBTA 1JJVA 1KK3A 2OQIA 4YRDA 2QZJA 1SN7A 1ACMA 3E5RA 1QF7A 1XWFA 4J0GA 5FBKA 2AKEA 1FNBA 2BDTA 3S99A 1DI0A 3L8ZA 3AFHA 5BN3A 3RVOA 2B4KA 3IIKA 2UAGA 2WYWA 3B2QA 3EUAA 2ZIVB 1HDGO 2JASA 2CHFA 4ISCA 1U9YA 3T12A 3UG7A 4C2AA 3LZCA 4FMCB 1A2BA 3TE7A 1P8AA 3KCNA 2BM9A 4RXMA 3U7IA 3T7TA 1JFVA 3ZE2B 1QFXA 5ALMA 1M6YA 3BG5A 3V3TA 1X1RA 1H22A 4P5EA 3GLSA 2ZCJA 1B8VA 3VMFA 3QLVA 3F4LA 3K1YA 3QWAA 1UBOS 3JVEA 4GE3A 2JK0A 2VC2B 3KSMA 4HOYA 4ARBA 1EAMA 2PGJA 2NQTA 1T91A 4JUDX 4R9RA 2P9QA 5CPFA 3T9AA 1V7PC 3HFSA 3CEAA 2LD4A 3M6VA 4JI7B 3M6AA 2Q7OE 4KIGA 4DRYA 3CKMA 3KZMA 2W83A 1GXSB 3VYTB 2QZ9A 3BAZA 1GR0A 1I4LD 2RHDA 2PUFA 1VKHA 3R6TA 4D3DA 1NYLA 4YJ3A 5F51A 4PAQA 3THSA 1OWMA 4KR9A 3SU8A 2O0MA 4DC1A 2X7XA 1PDVA 1N5JA 3KQKA 2WIFA 3A4IA 5LOVB 4RVOA 5IT9A 4P8RA 2E4WA 1NJGA 4MZXA 2HHLA 1EVIA 2X23A 1SQGA 5TT1A 4TYYA 1W0CA 3H2SA 4W1QA 4IXDA 3WC4A 4MQ6A 2M6KA 5BUCA 3L1JA 3TXAA 5AW3A 1M66A 1V1RB 3EQ2A 3JYLA 1KMHB 1ODSA 1QG0A 1XUOA 2XAAA 3EVDA 3K9HA 4XD2A 2PMEA 3X3HA 5BT8A 4UUNA 3HVRA 1JA1A 4B8ZA 3I72A 2YZ2A 4S0XA 3NDRA 4J3FA 2ASVA 2WFAA 2X86A 3N5KA 4AT1A 1XTJA 3GFQA 4P38A 3N2KB 1XXHE 1TM2A 2WYIA 3R40A 4YI3A 5TB5A 4CMJA 1WMDA 1JIXA 1Y5MA 3FPBA 2F6RA 4WCFB 4KLZA 5P8WA 4IUYA 4PRLA 2AD5A 4WKBA 1FLVA 1CZHA 1NKSA 3R7WB 4MYDA 1DJNA 2DUWA 4ZAZA 1XDWA 2XITA 3CUTA 4W7SA 3ZDQA 4DAEA 2BZGA 4V3CA 4JLSA 3VH3A 4O4LA 1N32B 1G2PA 2G07A 3MJFA 1QHYA 4Q00A 3C85A 3LK6A 3UWMA 2YIMA 3BULA 4Z3DA 1K3FA 4H16A 1DDOA 4JL8A 1ZMXA 1U8XX 2I76A 2Y93A 2P9GA 3KJIA 3PQEA 4ND8A 5CGQB 3BILA 4OKIA 3HHEA 4P9NA 4CF7A 5L6MB 4KK4A 3FSEA 4JC5A 2PL5A 1IQPA 2CHEA 1DRVA 2FPKA 3EDYA 2VYCA 2ZQ5A 3BJEA 1LDEA 1PFQA 1S01A 3I6ZA 3MMZA 4TLBA 3SR3A 5K7SA 2OAGA 2C4HA 4RD3A 1A98A 2AOTA 3Q98A 3SNHA 1WW8A 1Q0LA 2FZWA 3DHEA 3V2GA 1OXVA 2CHQA 2H1LA 3ZJYA 3UJBA 1JQ3A 4HQRA 4D9NA 3RC9A 1KDPA 3R6DA 1BE8A 3DBIA 3U26A 1DXOA 2EJTA 3ICVA 3TVDA 4L08A 2AXNA 4U1RA 1W4BA 3W9YA 4J1TC 4DXAA 1UPCA 4B45A 1QNFA 3W5CA 4UU8A 2PKXA 3O3CA 3DF9A 1U6JA 2O57A 2WIAA 2ZG6A 4V38A 3GO4A 2ZTVA 4QFMA 3I4LA 2XYRA 2Q2NA 4FFLA 1WSAA 1G20E 2F4NA 1SUCA 4H77A 4IOMA 3NEYA 2IA5A 3ZU5A 2GKOA 5HVNA 2C92A 4GOXA 1G8MA 3FBTA 4O4HF 5JG7A 2DT5A 2HR1A 3WLFA 1C0PA 2XE8A 2PJZA 1CUAA 1LBTA 4RF3A 2QRGA 3NHSA 2GFHA 4UDYX 5EQFA 3K09A 3WRXA 3T1TA 2R7KA 3LV8A 1SG6A 1ADBA 3ONEA 3HMKA 3DMRA 3PEFA 2Z2JA 1M75A 3FPFA 4GRAA 3WLKX 4MV5A 4NXMB 1SURA 2PUVA 3EQ6A 5F98A 4OQ4A 4BP3A 2C1XA 5JV5A 2G77B 2JI4A 2X0IA 2WABA 4YDHB 5J4LA 2YKGA 3R5HA 1WF6A 3CPEA 4R8SA 4J4HA 3SBXA 4HDNB 1J23A 2AUNA 3U7QB 3H9BA 1SG0A 1T2NA 4R1TA 4N3NA 2BUBA 2GBIA 2O7RA 3UJNA 1CS0A 4N7JA 2HQOA 3JXEA 3OEWA 1DG3A 3UYKA 3VU3A 3WGMA 1V5FA 2HC9A 1NBAA 1EJ2A 1DC3A 4Q37A 2XE7A 5BWOA 1L8QA 2JIZD 1CHNA 1PK9A 4QTXA 4CZ2A 2QRMA 4Y2QA 4TQ9A 1VL5A 1EP2B 3LBFA 5FWDA 3MJEA 2R5FA 3UM9A 3BH0A 3Q7EA 1NG9A 3C98A 3LVBA 3ZS8A 4WOKA 1K97A 1XU7A 3JTMA 4L5IA 4IZOA 4BBPA 2Q5QA 3W8DA 2RK4A 3BT7A 1NTRA 1G60A 4JB3A 3T9FA 4I9FA 2R4TA 3DEJA 4BEVA 1QP0A 5EIXA 1Z0DA 1K6XA 2QIPA 4AI6A 3FPLA 4MJ3A 2EDAA 4F8JA 2NZ2A 1D2RA 2P41A 1G7RA 5GOTA 4YIHA 4U7GA 1LC3A 2ZSKA 1NE7A 1UBNA 4MVJH 5EXPA 2A9VA 4IAOA 3VTAA 4KQ1A 3TD6A 1XKQA 3W2TA 3S2ZA 1T0IA 421PA 4YMVA 3IHKA 4M1ZA 5IABA 2HIMA 4HTAA 4ARCA 4MQ4A 5E6RA 4G6ZA 1G3QA 1P1IA 1J70A 1Y9AA 2PM8A 1PZHA 3ZQ6A 2B1JA 5LJIA 4Q1BA 4R71A 1RQPA 1IPFA 3VU0A 1Y1TA 4V03A 5FFFA 4OVKA 3KYCA 3SC3A 2P8SA 2IV7A 4XTCS 3RBZA 4AJHA 5BWNA 3PE4A 4N8EA 4H4EA 3DEZA 2LP4Y 4EENA 4D2IA 5JCXA 3S55A 4YUVA 4WZAE 2SCUA 1I8TA 1OFVA 1PWYE 3BB4A 3CF2A 3MK31 5TS2A 1JIQA 5E9QA 1O94D 3MWYW 1VYUA 2GS9A 2W6NA 1SBHA 1I7PA 4EPWA 4F7DA 2C78A 2G08A 2DPXA 4JYBA 3FNRA 3OUTA 2QLBA 2HXGA 2PGIA 3ZDBA 1G18A 3B1XA 3C3CA 4XLZA 1JZSA 1ZD8A 3M9WA 2G0AA 3T7CA 2G9ZA 1XK7A 2OESA 4HDKB 2HF7A 4RKFA 3V3KA 3WBJA 1P0MA 1DU4A 5EQTA 4D45A 5AIBA 2F8TA 5AVKA 1KO8A 5FOTA 2AQKA 4EUFA 2ZJ4A 4B3JA 3IDAA 5AKKA 4UNRA 2GD1O 3PPVA 4D6YA 1CQXA 1K86A 1R8JA 1G9XA 2QM3A 1Y8CA 3FCCA 1XBTA 1DARA 1SUDA 3DDOA 1Z15A 4AN4A 2Y0EA 4D3ZA 1FP2A 1F8XA 2ECQA 1XO1A 3ISJA 2EL9A 3IQHX 4L9SA 2Z2XA 4F2PA 2DM6A 4D8VA 1SC4A 3G02A 1ADYA 1W9HA 4ZCMA 1Z45A 3CF6R 1VCOA 4P0TA 1HE3A 2JC3A 4RFVA 1CJBA 4LAFA 3L0DA 3LC2O 1DKQA 3JQCA 3DWFA 4L6AA 4UUOA 3RFFA 4CL8A 5B3LA 3NW9A 1U3DA 4XGRA 5FRDA 3WSTA 4FWIB 3CVUA 1WW2A 2B82A 4X7BA 5DN6A 2E7ZA 3MXOA 2Q6OA 5KNDA 3GJ5A 5E6UB 4B2YA 2LVBA 2GA9A 5FTKA 4B84A 4LF6B 1XPUA 1QRRA 1UIMA 1RHUA 5CB4A 4MS4A 2ZSJA 4QYMA 1AUQA 3R7SA 1TLLA 1ZOIA 3GHYA 3IYLW 1E32A 4OJYA 3TLAA 4S35A 3C5CA 4ZYYA 3JAKA 3OZDA 1EUDB 1OX4B 2NYUA 1E2UA 3DUFB 4OSPA 4KZPA 4Z7OB 4TXMA 4BAGA 4QICA 4D0LB 1R18A 2OBMA 5C5DA 3LGAA 3A37A 4WHMA 4GVPA 2YFKA 1NQ5A 1GGFA 2J6BA 4YP0A 3BDAA 4XVCA 1BN7A 1XA3A 3DFFA 2CBGA 2OO3A 4FI3C 5KOJA 3L7KA 1FUYB 4FS3A 3RK0A 3BRWD 3R1IA 1T4BA 4P5PA 2VP5A 3CVVA 1IN5A 3QKSB 5AKYA 4YAUA 4I6GA 4LQLA 3C4JA 4X3CA 1EIWA 2R6JA 3TW0A 3PGKA 1I1QB 4I9GA 5HOQA 2AG5A 1XQ9A 3KS9A 1U0OC 2ZYUX 4NK5A 1GUZA 4KLAA 4MR7A 4TKVB 2AZXA 3G9XA 1LZKA 1DJMA 4E4RA 3HXLA 4Z9XA 1E2MA 3K0KA 4K2HA 2B21A 2YYYA 4E2ZA 3SEAA 4A91A 5KX5A 1EXNA 1PP4A 4EAQA 1KAGA 1U9IA 4JLMA 4PXAA 2RH4A 2JAUA 2OCDA 3ORRA 4RHTA 2IOFA 5LP6C 2A84A 4ML3A 2EWMA 5D5HA 2CFCA 4UCXA 4HRYA 2GYWA 2ILVA 5GJCA 4EHBA 2FK8A 2X5XA 3CTMA 3I9NA 5K3FA 3ZGZA 4DC0A 4EQ6B 1X9IA 4HLCA 4UJ3A 1ZRSA 2FQXA 1TLTA 3F9CA 4OAOA 4OQDA 1PFWA 5K8TA 4UHEA 2ZKLA 5JVDF 2CD7A 2QLTA 5G4KB 1QV9A 2GEDA 2NZ8A 4PYIA 1MB0A 2W48A 4FYPA 1RE1A 3PNQA 4PXSA 3C14C 3M4JA 1JHMA 4D9HA 1PL7A 3OLVA 1GNRA 4I1UA 4FBMA 1IM5A 4KOEC 5JDCA 3ABZA 1V9LA 4KQEA 3W79A 5HCNA 1N3YA 1XZEA 1N7JA 4H6XA 3H5IA 4XAQA 4PZ0A 3SYMA 2WP8J 4F4UA 2QN6A 4DV1B 4BNKA 2FUNB 3TNLA 4MAAA 1O0SA 2ZB2A 1KOJA 1C1DB 2AMYA 2HY7A 2PH7A 1P7WA 5C18A 2V9CA 4RD4A 3HS3A 1S2GA 3D0KA 4O29A 4X9XA 3ZV6A 4AY3A 2WJYA 2GRUA 3V8EA 3PBKA 5DN9A 1DS6A 4AMUA 1UMCA 4MV0A 4C01A 5F2NA 3RIYA 3NVKI 1NIJA 3L40A 5B1DA 4QDZA 2GBLA 1FU8A 3H65A 4E14A 5IS2A 2DHRA 1CRWG 1PFUA 4G3XA 3WB0A 4BV3A 1CZOA 4NZOA 5IC5A 4DRXA 1Z0UA 4GBJA 4ANFA 3E48A 2QVCA 2DWQA 4H35A 5JEEA 1UBHS 5IUKC 5BMOA 1XZFA 1VLQA 3FOAA 1SUWA 4MUFA 5L3QB 4HP8A 2B1IA 3DEAA 4M9SA 3RG2A 2GBLC 2VHTA 1WMSA 3GGCA 3OZFA 4TV9B 1O6BA 2X4LA 3NHKA 4CF5A 3ACCA 3DBVO 3R6LA 3K72B 4XIIA 4IYJA 2VAMA 4MAMA 2DUMA 3AR6A 1Q11A 2Q5CA 4HWOA 1A4IA 4Y6GB 2HL6A 3HPQA 4O4LB 4C2TA 5TY0A 3SQXA 1FK8A 2PKRA 3VNVA 3OQ1A 4LDNA 3SYNA 3A9TA 4KQCA 1IAQA 1GPJA 1SOVA 3MNFA 1JQ5A 3A3NA 3Q5GA 4JLKA 1FX0A 2VNAA 2A1IA 3R0IA 5IAOA 3W3AA 2YRXA 1WQ4A 3G8BA 3INGA 1F4VA 4X45A 4AJOA 4RTLA 1H6AA 2YXPX 4ESVA 3LHDA 1O2DA 2ZE6A 3Q40A 3J81A 1Y1QA 2WZQA 2GTPA 2PEYA 3D9QX 4IHJA 4M0DA 1O94C 4TSFA 4XSVA 4YRRA 3TM4A 3E22B 4DDMA 1EK1A 1RMTA 3GYGA 5C37A 4YJ3F 5LZ2A 2VJQA 1LI4A 3BK2A 1T36B 2ZRFA 1YR7A 3RE1A 1W0JA 3EPPA 3UMSA 3C3DA 1OPXA 2C2YA 3UN1A 4BLRA 1D4AA 2XHEA 3STVA 3KPUA 5KJ6A 3CLUD 3K1AA 2H08A 4EPRA 1MBZA 3QLUA 3SX0A 1EYZA 3RT9A 4YMLA 5J4VA 3KKZA 2PZBA 2YWRA 2ARKA 1HORA 3BSSA 2QV7A 4XSGA 4Q48A 2WFLB 4QREA 3S68A