3HJJA

Crystal structure of maltose o-acetyltransferase from bacillus anthracis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
NAMKTEKDKMLAGEMYIADDEELVADRVEAKRLTRLYNEAVETGDERRFTLLNQLLGSSADGKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDHCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose O-acetyltransferase
publication title Crystal Structure of Maltose O-acetyltransferase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 63
structure length 189
sequence length 189
chains with identical sequence B, C
ec nomenclature ec 2.3.1.79: Maltose O-acetyltransferase.
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12464 Mac Maltose acetyltransferase
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3hjjA00
5E3QA 1KRRA 1TDTA 2V0HA 3R5BA 4J09A 1YP3A 4M98A 4IHGA 4M2AA 3I3AA 3KWEA 3F1XA 2ICXA 3IGJA 5DEMA 3D98A 1XATA 4E75A 1SSTA 1Z90A 2V0KA 3GOSA 3HSQA 3FSCA 3V4EA 4J18A 1KK6A 4M9CA 4G3PA 2ICYA 2WLGA 2OI7A 3EH0A 2WLEA 4H7OA 4M2BA 3VBNA 4E79A 4G87A 3R5DA 1KK5A 4EA7A 4E6UA 2VD4A 4R7PA 4G3QA 1J2ZA 2GGOA 2XATA 2JF3A 3OU9A 2WLFA 4HZCA 1KRUA 1LXAA 1MR7A 3C8VA 3D8VA 3BRKX 5E3RA 1SSMA 3TV0A 1V3WA 4EAAA 3R3RA 3R5AA 2IU9A 4EA8A 2W0WA 3CJ8A 3TWDA 1QQ0A 3KWDA 4E6TA 1MR9A 2Q4JA 1HM8A 3VBIA 3OUPA 2FKOA 1KK4A 1G97A 3ECTA 4HUSA 2QIAA 4MYOA 1HM0A 3FOQA 4HURA 3FSYA 3MQGA 1FXJA 4KQLA 3FSBA 2V0IA 5ADXV 3DK5A 1MRLA 2V0JA 3HJJA 5L6VA 3NZ2A 2OEGA 2W0VA 3R0SA 4KPZA 5L6SA 3VBLA 1OCXA 3BFPA 2WLDA 2OEFA 3R5CA 4EA9A 4N27A 3R3IA 5ADXU 5F42A 4KPXA 3OW5A 1G95A 1T3DA 3T57A 1FWYA 1KHRA 3BSWA 4R36A 1KQAA 4MZUA 1S80A 3Q1XA 3PMOA 3R1WA 4IHHA 1KGTA 3EG4A 3P47A 4N6BA 4N6AA 4AA7A 3MC4A 3OTMA 1YP2A 1QRMA 3BXYA 3SRTA 3KWCA 1KRVA 2RIJA 2AQ9A 2IUAA 1QRFA 1QRGA 3GVDA 3TK8A 4M28A 1KGQA 3FTTA 4G3SA 4MFGA 2OI5A 3BSSA 3SPTA 2QKXA 2WLCA 3MQHA 3GUEA 4EGGA 3FWWA 4IHFA 3VBKA 1XHDA 3TDTA 4K6RA 2V0LA 4AC3A 4R37A 1SSQA 3JQYA 4EQYA 3FS8A 3DJ4A 3P1BA 3R2WA 3EEVA 4M99A 1HV9A 3TISA 2GGQA 2OI6A 2P2OA 1HM9A 1YP4A 3BSYA 3FSXA 3I3XA 2QIVX 4AAWA 3TIOA 4KNXA 1THJA 2I5KA 3VBPA 2JF2A 2VHEA 5AFUV 4E1KA 3VBJA 4DCLA 4HCQA 5DG3A 1V67A 5E3PA 3VNPA 1QREA 4ISXA 3DHOA 5DEPA 2IU8A 5U2KA 2TDTA 1QRLA 3ST8A 4EABA 2IC7A 3OTZA 3VBMA 3IXCA 4KNRA 4FCEA 3R8YA 4HZDA 2NPOA 5AFUU 4N69A
chains in the Genus database with same CATH superfamily
3GQAA 5E3QA 1KRRA 1TDTA 2V0HA 3OH1A 3R5BA 4J09A 1YP3A 4M98A 4IHGA 4M2AA 3I3AA 3KWEA 3F1XA 2ICXA 3IGJA 5DEMA 3D98A 1XATA 4E75A 1SSTA 1Z90A 2V0KA 3GOSA 3HSQA 3FSCA 3V4EA 4J18A 1KK6A 4M9CA 4G3PA 2ICYA 2WLGA 2OI7A 3EH0A 2WLEA 4H7OA 4M2BA 3VBNA 4E79A 4G87A 3R5DA 1KK5A 4EA7A 4E6UA 2VD4A 4R7PA 4G3QA 1J2ZA 2GGOA 2XATA 2JF3A 3OU9A 2WLFA 4HZCA 1KRUA 1LXAA 1MR7A 3C8VA 3D8VA 3BRKX 5E3RA 1SSMA 3TV0A 1V3WA 4EAAA 3R3RA 3R5AA 2IU9A 4EA8A 2W0WA 3CJ8A 3TWDA 1QQ0A 3KWDA 4E6TA 1MR9A 3OH4A 2Q4JA 3OGZA 1HM8A 3OH3A 3VBIA 3OUPA 2FKOA 1KK4A 1G97A 3ECTA 4HUSA 2QIAA 4MYOA 3SUCA 1HM0A 3FOQA 4HURA 3FSYA 3MQGA 1FXJA 4KQLA 1M8NA 3FSBA 2V0IA 5ADXV 3DK5A 1MRLA 2V0JA 3HJJA 5L6VA 3NZ2A 3GQ9A 2OEGA 1EWWA 2W0VA 3R0SA 4KPZA 5L6SA 3VBLA 1OCXA 3BFPA 2WLDA 2OEFA 3R5CA 4EA9A 4N27A 3R3IA 5ADXU 5F42A 4KPXA 3OW5A 1G95A 1T3DA 3T57A 1FWYA 1KHRA 1N4IA 3BSWA 4R36A 3GQ8A 1Z2FA 1KQAA 4MZUA 1S80A 3Q1XA 3PMOA 3R1WA 4IHHA 1KGTA 3EG4A 3P47A 4N6BA 4N6AA 4AA7A 3MC4A 3OTMA 1YP2A 1QRMA 3BXYA 3SRTA 3KWCA 1KRVA 2RIJA 2AQ9A 2IUAA 1QRFA 1QRGA 3GVDA 3TK8A 4M28A 1KGQA 3FTTA 4G3SA 4MFGA 2OI5A 3BSSA 3SPTA 2QKXA 2WLCA 3MQHA 3GUEA 4EGGA 3OH2A 3FWWA 4IHFA 3VBKA 1XHDA 3TDTA 4K6RA 2V0LA 4AC3A 4R37A 1SSQA 3JQYA 4EQYA 3FS8A 3DJ4A 3P1BA 3R2WA 3EEVA 4M99A 1HV9A 3TISA 2GGQA 2OI6A 2P2OA 1HM9A 1YP4A 3BSYA 3FSXA 3GQ7A 2QIVX 3I3XA 3TIOA 4AAWA 4KNXA 1THJA 2I5KA 3VBPA 2JF2A 2VHEA 5AFUV 4E1KA 3VBJA 4DCLA 4HCQA 5DG3A 1V67A 5E3PA 3VNPA 1QREA 3OH0A 4ISXA 3DHOA 5DEPA 2IU8A 5U2KA 2TDTA 1QRLA 3ST8A 4EABA 2IC7A 3OTZA 3VBMA 3IXCA 4KNRA 4FCEA 3R8YA 4HZDA 1L0SA 2NPOA 5AFUU 4N69A
chains in the Genus database with same CATH topology
5E3QA 1KRRA 1TDTA 2V0HA 3R5BA 4J09A 1YP3A 4M98A 4IHGA 4M2AA 3I3AA 3KWEA 3F1XA 2ICXA 3IGJA 5DEMA 3D98A 1XATA 4E75A 1SSTA 1Z90A 2V0KA 3GOSA 3HSQA 3FSCA 3V4EA 4J18A 1KK6A 4M9CA 4G3PA 2ICYA 2WLGA 2OI7A 3EH0A 2WLEA 4H7OA 4M2BA 3VBNA 4E79A 4G87A 3R5DA 1KK5A 4EA7A 4E6UA 2VD4A 4R7PA 4G3QA 1J2ZA 2GGOA 2XATA 2JF3A 3OU9A 2WLFA 4HZCA 1KRUA 1LXAA 1MR7A 3C8VA 3D8VA 3BRKX 5E3RA 1SSMA 3TV0A 1V3WA 4EAAA 3R3RA 3R5AA 2IU9A 4EA8A 2W0WA 3CJ8A 3TWDA 1QQ0A 3KWDA 4E6TA 1MR9A 2Q4JA 1HM8A 3VBIA 3OUPA 2FKOA 1KK4A 1G97A 3ECTA 4HUSA 2QIAA 4MYOA 1HM0A 3FOQA 4HURA 3FSYA 3MQGA 1FXJA 4KQLA 3FSBA 2V0IA 5ADXV 3DK5A 1MRLA 2V0JA 3HJJA 5L6VA 3NZ2A 2OEGA 2W0VA 3R0SA 4KPZA 5L6SA 3VBLA 1OCXA 3BFPA 2WLDA 2OEFA 3R5CA 4EA9A 4N27A 3R3IA 5ADXU 5F42A 4KPXA 3OW5A 1G95A 1T3DA 3T57A 1FWYA 1KHRA 3BSWA 4R36A 1KQAA 4MZUA 1S80A 3Q1XA 3PMOA 3R1WA 4IHHA 1KGTA 3EG4A 3P47A 4N6BA 4N6AA 4AA7A 3MC4A 3OTMA 1YP2A 1QRMA 3BXYA 3SRTA 3KWCA 1KRVA 2RIJA 2AQ9A 2IUAA 1QRFA 1QRGA 3GVDA 3TK8A 4M28A 1KGQA 3FTTA 4G3SA 4MFGA 2OI5A 3BSSA 3SPTA 2QKXA 2WLCA 3MQHA 3GUEA 4EGGA 3FWWA 4IHFA 3VBKA 1XHDA 3TDTA 4K6RA 2V0LA 4AC3A 4R37A 1SSQA 3JQYA 4EQYA 3FS8A 3DJ4A 3P1BA 3R2WA 3EEVA 4M99A 1HV9A 3TISA 2GGQA 2OI6A 2P2OA 1HM9A 1YP4A 3BSYA 3FSXA 3I3XA 2QIVX 4AAWA 3TIOA 4KNXA 1THJA 2I5KA 3VBPA 2JF2A 2VHEA 5AFUV 4E1KA 3VBJA 4DCLA 4HCQA 5DG3A 1V67A 5E3PA 3VNPA 1QREA 4ISXA 3DHOA 5DEPA 2IU8A 5U2KA 2TDTA 1QRLA 3ST8A 4EABA 2IC7A 3OTZA 3VBMA 3IXCA 4KNRA 4FCEA 3R8YA 4HZDA 2NPOA 5AFUU 4N69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3Q A;  1KRR A;  1TDT A;  2V0H A;  3R5B A;  4J09 A;  1YP3 A;  4M98 A;  4IHG A;  4M2A A;  3I3A A;  3KWE A;  3F1X A;  2ICX A;  3IGJ A;  5DEM A;  3D98 A;  1XAT A;  4E75 A;  1SST A;  1Z90 A;  2V0K A;  3GOS A;  3HSQ A;  3FSC A;  3V4E A;  4J18 A;  1KK6 A;  4M9C A;  4G3P A;  2ICY A;  2WLG A;  2OI7 A;  3EH0 A;  2WLE A;  4H7O A;  4M2B A;  3VBN A;  4E79 A;  4G87 A;  3R5D A;  1KK5 A;  4EA7 A;  4E6U A;  2VD4 A;  4R7P A;  4G3Q A;  1J2Z A;  2GGO A;  2XAT A;  2JF3 A;  3OU9 A;  2WLF A;  4HZC A;  1KRU A;  1LXA A;  1MR7 A;  3C8V A;  3D8V A;  3BRK X;  5E3R A;  1SSM A;  3TV0 A;  1V3W A;  4EAA A;  3R3R A;  3R5A A;  2IU9 A;  4EA8 A;  2W0W A;  3CJ8 A;  3TWD A;  1QQ0 A;  3KWD A;  4E6T A;  1MR9 A;  2Q4J A;  1HM8 A;  3VBI A;  3OUP A;  2FKO A;  1KK4 A;  1G97 A;  3ECT A;  4HUS A;  2QIA A;  4MYO A;  1HM0 A;  3FOQ A;  4HUR A;  3FSY A;  3MQG A;  1FXJ A;  4KQL A;  3FSB A;  2V0I A;  5ADX V;  3DK5 A;  1MRL A;  2V0J A;  3HJJ A;  5L6V A;  3NZ2 A;  2OEG A;  2W0V A;  3R0S A;  4KPZ A;  5L6S A;  3VBL A;  1OCX A;  3BFP A;  2WLD A;  2OEF A;  3R5C A;  4EA9 A;  4N27 A;  3R3I A;  5ADX U;  5F42 A;  4KPX A;  3OW5 A;  1G95 A;  1T3D A;  3T57 A;  1FWY A;  1KHR A;  3BSW A;  4R36 A;  1KQA A;  4MZU A;  1S80 A;  3Q1X A;  3PMO A;  3R1W A;  4IHH A;  1KGT A;  3EG4 A;  3P47 A;  4N6B A;  4N6A A;  4AA7 A;  3MC4 A;  3OTM A;  1YP2 A;  1QRM A;  3BXY A;  3SRT A;  3KWC A;  1KRV A;  2RIJ A;  2AQ9 A;  2IUA A;  1QRF A;  1QRG A;  3GVD A;  3TK8 A;  4M28 A;  1KGQ A;  3FTT A;  4G3S A;  4MFG A;  2OI5 A;  3BSS A;  3SPT A;  2QKX A;  2WLC A;  3MQH A;  3GUE A;  4EGG A;  3FWW A;  4IHF A;  3VBK A;  1XHD A;  3TDT A;  4K6R A;  2V0L A;  4AC3 A;  4R37 A;  1SSQ A;  3JQY A;  4EQY A;  3FS8 A;  3DJ4 A;  3P1B A;  3R2W A;  3EEV A;  4M99 A;  1HV9 A;  3TIS A;  2GGQ A;  2OI6 A;  2P2O A;  1HM9 A;  1YP4 A;  3BSY A;  3FSX A;  3I3X A;  2QIV X;  4AAW A;  3TIO A;  4KNX A;  1THJ A;  2I5K A;  3VBP A;  2JF2 A;  2VHE A;  5AFU V;  4E1K A;  3VBJ A;  4DCL A;  4HCQ A;  5DG3 A;  1V67 A;  5E3P A;  3VNP A;  1QRE A;  4ISX A;  3DHO A;  5DEP A;  2IU8 A;  5U2K A;  2TDT A;  1QRL A;  3ST8 A;  4EAB A;  2IC7 A;  3OTZ A;  3VBM A;  3IXC A;  4KNR A;  4FCE A;  3R8Y A;  4HZD A;  2NPO A;  5AFU U;  4N69 A; 
#chains in the Genus database with same CATH topology
 3GQA A;  5E3Q A;  1KRR A;  1TDT A;  2V0H A;  3OH1 A;  3R5B A;  4J09 A;  1YP3 A;  4M98 A;  4IHG A;  4M2A A;  3I3A A;  3KWE A;  3F1X A;  2ICX A;  3IGJ A;  5DEM A;  3D98 A;  1XAT A;  4E75 A;  1SST A;  1Z90 A;  2V0K A;  3GOS A;  3HSQ A;  3FSC A;  3V4E A;  4J18 A;  1KK6 A;  4M9C A;  4G3P A;  2ICY A;  2WLG A;  2OI7 A;  3EH0 A;  2WLE A;  4H7O A;  4M2B A;  3VBN A;  4E79 A;  4G87 A;  3R5D A;  1KK5 A;  4EA7 A;  4E6U A;  2VD4 A;  4R7P A;  4G3Q A;  1J2Z A;  2GGO A;  2XAT A;  2JF3 A;  3OU9 A;  2WLF A;  4HZC A;  1KRU A;  1LXA A;  1MR7 A;  3C8V A;  3D8V A;  3BRK X;  5E3R A;  1SSM A;  3TV0 A;  1V3W A;  4EAA A;  3R3R A;  3R5A A;  2IU9 A;  4EA8 A;  2W0W A;  3CJ8 A;  3TWD A;  1QQ0 A;  3KWD A;  4E6T A;  1MR9 A;  3OH4 A;  2Q4J A;  3OGZ A;  1HM8 A;  3OH3 A;  3VBI A;  3OUP A;  2FKO A;  1KK4 A;  1G97 A;  3ECT A;  4HUS A;  2QIA A;  4MYO A;  3SUC A;  1HM0 A;  3FOQ A;  4HUR A;  3FSY A;  3MQG A;  1FXJ A;  4KQL A;  1M8N A;  3FSB A;  2V0I A;  5ADX V;  3DK5 A;  1MRL A;  2V0J A;  3HJJ A;  5L6V A;  3NZ2 A;  3GQ9 A;  2OEG A;  1EWW A;  2W0V A;  3R0S A;  4KPZ A;  5L6S A;  3VBL A;  1OCX A;  3BFP A;  2WLD A;  2OEF A;  3R5C A;  4EA9 A;  4N27 A;  3R3I A;  5ADX U;  5F42 A;  4KPX A;  3OW5 A;  1G95 A;  1T3D A;  3T57 A;  1FWY A;  1KHR A;  1N4I A;  3BSW A;  4R36 A;  3GQ8 A;  1Z2F A;  1KQA A;  4MZU A;  1S80 A;  3Q1X A;  3PMO A;  3R1W A;  4IHH A;  1KGT A;  3EG4 A;  3P47 A;  4N6B A;  4N6A A;  4AA7 A;  3MC4 A;  3OTM A;  1YP2 A;  1QRM A;  3BXY A;  3SRT A;  3KWC A;  1KRV A;  2RIJ A;  2AQ9 A;  2IUA A;  1QRF A;  1QRG A;  3GVD A;  3TK8 A;  4M28 A;  1KGQ A;  3FTT A;  4G3S A;  4MFG A;  2OI5 A;  3BSS A;  3SPT A;  2QKX A;  2WLC A;  3MQH A;  3GUE A;  4EGG A;  3OH2 A;  3FWW A;  4IHF A;  3VBK A;  1XHD A;  3TDT A;  4K6R A;  2V0L A;  4AC3 A;  4R37 A;  1SSQ A;  3JQY A;  4EQY A;  3FS8 A;  3DJ4 A;  3P1B A;  3R2W A;  3EEV A;  4M99 A;  1HV9 A;  3TIS A;  2GGQ A;  2OI6 A;  2P2O A;  1HM9 A;  1YP4 A;  3BSY A;  3FSX A;  3GQ7 A;  2QIV X;  3I3X A;  3TIO A;  4AAW A;  4KNX A;  1THJ A;  2I5K A;  3VBP A;  2JF2 A;  2VHE A;  5AFU V;  4E1K A;  3VBJ A;  4DCL A;  4HCQ A;  5DG3 A;  1V67 A;  5E3P A;  3VNP A;  1QRE A;  3OH0 A;  4ISX A;  3DHO A;  5DEP A;  2IU8 A;  5U2K A;  2TDT A;  1QRL A;  3ST8 A;  4EAB A;  2IC7 A;  3OTZ A;  3VBM A;  3IXC A;  4KNR A;  4FCE A;  3R8Y A;  4HZD A;  1L0S A;  2NPO A;  5AFU U;  4N69 A; 
#chains in the Genus database with same CATH homology
 5E3Q A;  1KRR A;  1TDT A;  2V0H A;  3R5B A;  4J09 A;  1YP3 A;  4M98 A;  4IHG A;  4M2A A;  3I3A A;  3KWE A;  3F1X A;  2ICX A;  3IGJ A;  5DEM A;  3D98 A;  1XAT A;  4E75 A;  1SST A;  1Z90 A;  2V0K A;  3GOS A;  3HSQ A;  3FSC A;  3V4E A;  4J18 A;  1KK6 A;  4M9C A;  4G3P A;  2ICY A;  2WLG A;  2OI7 A;  3EH0 A;  2WLE A;  4H7O A;  4M2B A;  3VBN A;  4E79 A;  4G87 A;  3R5D A;  1KK5 A;  4EA7 A;  4E6U A;  2VD4 A;  4R7P A;  4G3Q A;  1J2Z A;  2GGO A;  2XAT A;  2JF3 A;  3OU9 A;  2WLF A;  4HZC A;  1KRU A;  1LXA A;  1MR7 A;  3C8V A;  3D8V A;  3BRK X;  5E3R A;  1SSM A;  3TV0 A;  1V3W A;  4EAA A;  3R3R A;  3R5A A;  2IU9 A;  4EA8 A;  2W0W A;  3CJ8 A;  3TWD A;  1QQ0 A;  3KWD A;  4E6T A;  1MR9 A;  2Q4J A;  1HM8 A;  3VBI A;  3OUP A;  2FKO A;  1KK4 A;  1G97 A;  3ECT A;  4HUS A;  2QIA A;  4MYO A;  1HM0 A;  3FOQ A;  4HUR A;  3FSY A;  3MQG A;  1FXJ A;  4KQL A;  3FSB A;  2V0I A;  5ADX V;  3DK5 A;  1MRL A;  2V0J A;  3HJJ A;  5L6V A;  3NZ2 A;  2OEG A;  2W0V A;  3R0S A;  4KPZ A;  5L6S A;  3VBL A;  1OCX A;  3BFP A;  2WLD A;  2OEF A;  3R5C A;  4EA9 A;  4N27 A;  3R3I A;  5ADX U;  5F42 A;  4KPX A;  3OW5 A;  1G95 A;  1T3D A;  3T57 A;  1FWY A;  1KHR A;  3BSW A;  4R36 A;  1KQA A;  4MZU A;  1S80 A;  3Q1X A;  3PMO A;  3R1W A;  4IHH A;  1KGT A;  3EG4 A;  3P47 A;  4N6B A;  4N6A A;  4AA7 A;  3MC4 A;  3OTM A;  1YP2 A;  1QRM A;  3BXY A;  3SRT A;  3KWC A;  1KRV A;  2RIJ A;  2AQ9 A;  2IUA A;  1QRF A;  1QRG A;  3GVD A;  3TK8 A;  4M28 A;  1KGQ A;  3FTT A;  4G3S A;  4MFG A;  2OI5 A;  3BSS A;  3SPT A;  2QKX A;  2WLC A;  3MQH A;  3GUE A;  4EGG A;  3FWW A;  4IHF A;  3VBK A;  1XHD A;  3TDT A;  4K6R A;  2V0L A;  4AC3 A;  4R37 A;  1SSQ A;  3JQY A;  4EQY A;  3FS8 A;  3DJ4 A;  3P1B A;  3R2W A;  3EEV A;  4M99 A;  1HV9 A;  3TIS A;  2GGQ A;  2OI6 A;  2P2O A;  1HM9 A;  1YP4 A;  3BSY A;  3FSX A;  3I3X A;  2QIV X;  4AAW A;  3TIO A;  4KNX A;  1THJ A;  2I5K A;  3VBP A;  2JF2 A;  2VHE A;  5AFU V;  4E1K A;  3VBJ A;  4DCL A;  4HCQ A;  5DG3 A;  1V67 A;  5E3P A;  3VNP A;  1QRE A;  4ISX A;  3DHO A;  5DEP A;  2IU8 A;  5U2K A;  2TDT A;  1QRL A;  3ST8 A;  4EAB A;  2IC7 A;  3OTZ A;  3VBM A;  3IXC A;  4KNR A;  4FCE A;  3R8Y A;  4HZD A;  2NPO A;  5AFU U;  4N69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...